1X12A

Structure of mutant pyrrolidone carboxyl peptidase (e192d) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMDLEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1x12A00
1Z8XA 2EO8A 1AUGA 1X10A 1IOIA 1IU8A 1Z8TA 1X12A 1IOFA 4GXHA 1A2ZA 2EBJA 2DF5A 3RO0A 3LACA 3GIUA 1Z8WA 4HPSA 3RNZA
chains in the Genus database with same CATH superfamily
3GLJA 4JD6A 4HNWB 2PIYA 4KOSA 4OC1A 4OKOA 3S9LA 4L89A 2YNCC 1VKCA 3OWCA 4NGPA 4UIBA 4KVME 1RO5A 4KVXA 2IJZA 1I12A 3P2HA 5ISVA 4LUAA 2K5TA 4QB9A 1XOVA 2B3VA 1XMTA 1P4NA 1CM0A 3FYNA 2R1IA 1TXRA 3TFYA 2PR8A 4U5YA 3N7ZA 2DPTA 2J9AA 2DF5A 2XEJA 2WZNA 1YW4A 3DR6A 2VXKA 3P2FA 3DSBA 1TIQA 1AYEA 1Z4RA 2BUEA 3TO9A 4F6AA 5HVHA 2PR1A 3GY9A 2O28A 3KL9A 3SXNA 4KOTA 3T8WA 3D66A 2OU2A 4U9ZA 4CYQA 4CAFA 2EK8A 4F8ZA 1EE3P 2R98A 4TWEA 4PK2A 3IC1A 1M4IA 5HMNA 2Q4ZA 2F5IA 1VHSA 5CPAA 1ARMA 1ZO0A 4A30A 2ZW4A 1YMEA 2PJ3A 4Q7AA 3TT2A 4UWIA 2OR4A 2VI7A 2EUIA 3EC4A 5LYDA 4ORFA 4DNCA 3NH5A 1SQHA 3R95A 2VL1A 3W91A 4CAWA 3B35A 3KQZA 4B5PB 4PV6A 1Y7RA 5IX3A 1S60A 3K9UA 1ON0A 5K8MA 4F0YA 4PXBA 4PK3A 3B3TA 3GB0A 1AMPA 2GLJA 1XRYA 2PJ8A 2Q7SA 3D7FA 1F57A 2VZZA 3IWWA 1S3ZA 4IF5A 4P4FA 5AG6A 4C68A 3JTKA 4NGQA 3UY5A 4MCSA 3S6GA 2YNCA 2CXAA 2ZOFA 4A31A 5F48A 1MK4A 3FVLA 4PPZA 1YX0A 4MCRA 4KOXA 3DR8A 2AFOA 3EO4A 3JRUA 2R8VA 1IYKA 4QBJA 2ZEHA 4UEFA 1GHEA 3QNVA 4NGTA 3F8KA 3I1UA 1ZLHA 2PJ6A 1R57A 1VIXA 4IUSA 4MRIA 4XNHC 5IB0A 4JZ0A 2V8GA 4A37A 2ZW5A 3FX6A 3H8GA 1CG2A 1VHOA 3K9TA 4MMOA 2WYRA 4FBEA 2JEVA 2PJCA 1IYLA 3MGDA 2RC4A 2Q7BA 1J4JA 3R9GA 4MBUA 3F5BA 1BO4A 2ZEPA 3DGVA 5KTCA 3BI0A 3PB7X 1BPMA 4KOVA 4X5KA 4Y49B 4MFPA 1KUVA 1YVOA 1HDUA 2Q4VA 5LRGA 3S9MA 3MN8A 2ZEEA 4YGOA 2B4DB 1NE9A 4ZX8A 1ZG8A 2ZEGA 2B3UA 3T90A 5K8NA 1BOBA 4JLYA 3PB4X 4KOWA 1MJ9A 4NSQA 4MXUA 3NH8A 3S6FA 4AVBA 2HUZA 2BOAA 3SHPA 5K8PA 2GU2A 3W6SA 4B10A 2FSRA 3TCVA 4ZY1A 1LOKA 1M1DA 2G3TA 4YFJA 2FVGA 1U6MA 2J8MA 2V8HA 3BJ7A 4JWPA 4MHYA 5KTDA 3LMSA 4L8AA 3DDDA 1F2OA 4HKFA 5LRKA 3IEHA 3RAMA 5HVGA 3K2KA 4NJQA 4OIDA 4OMEA 1HEEA 4CRZB 4UF4A 1Z8XA 2REEA 1CPXA 3ISXA 4RN7A 4E2AA 2Z3LA 2PJ5A 3FXTA 3QAHA 1WK4A 4WJBA 3D7HA 4NEXA 4NF1A 2PJ0A 1X10A 4A39A 4FAIA 2FIAA 3D2MA 4PSWA 1BPNA 3RZAA 4W9YA 1ZG7A 1Z9UA 3C26A 1CX8A 2QJ8A 4KSFA 5HH1A 4F9VA 1XJOA 4P4DA 2IL4A 3I9SA 3B3SA 4AVCA 4BINA 5JM6A 4MY3A 3IU2A 2B5GB 2ZEFA 4FD5A 5J1QA 2OZUA 2RB7A 1Z5RA 2WSAA 4C2XA 3EXNA 1M4LA 2AFWA 2FL4A 3LACA 4R3KA 1LRZA 2HV2A 2GFQA 3ISZA 4R57A 1R43A 2FIWA 4ONWA 2ZEOA 3KKWA 1L0CA 2PJBA 1PUAA 1KZFA 4P4BA 3SI2A 5IB9A 2OB0A 2JBKA 1XE4A 3GUXA 4CGPA 2ANPA 1MJAA 3H8FA 2R7HA 5THWA 4M6IA 1Y0YA 4PSXA 3CXPA 4RI1A 3S9NA 3DNSA 5A28A 3KHXA 4A94A 3BJ8A 3KGQA 3SJEA 2ATRA 2I3CA 2ZOGA 3WC7A 2JDDA 3DLJA 1KWMA 2KCWA 4X3RA 3A9LA 1FY7A 4Y49C 4F9UA 2F7VA 5ELYA 4XPDC 2OOTA 4AB7A 2Z3NA 2GE3A 4OC3A 3VH9A 2DXQA 4EVYA 2PJ9A 4UFVA 4EFDA 2Q44A 4A33A 3PFEA 1JWQA 4IK2A 4MFQA 1Z8WA 5JGFA 2FCKA 2PC1A 4NFRA 5G20A 4J3GA 4B5PA 4JXRA 1Z8LA 3WC5A 2D4PA 1S7LA 3NH4A 3B2YA 3D2PA 2QECA 2JEWA 3D7DA 1PU9A 4OAEA 4P45A 2JLMA 3FJUA 4KLVA 2GLFA 4NGSA 1F2PA 3SJGA 2HC9A 1KUYA 4PXDA 3V7ZA 2BEIA 5A27A 4R8FA 5KTAA 3IIBA 4MCQA 4OLLA 2I79A 4TNUA 4OC0A 5LYFA 4PXEA 5K8OA 2IMOA 4UEZA 1LAPA 2C6CA 1RXTA 2AFUA 2PDOA 3PB6X 1Y9KA 4KUBA 5F47A 1DE4C 4UA3A 1YREA 3IGRA 2F8HA 2ZXVA 4BD9A 4ZY0A 3IJ3A 4OP4A 2YNEA 4IAVA 4MI4A 4KZTA 4FD4A 2CF4A 3D67A 4P6YA 5AGEA 3LD2A 4A2ZA 3LODA 4FWUA 4H89A 1B6BA 4KVOE 4AG9A 1YK3A 2PRQA 2ZPAA 4UFXA 2XEIA 4NCZA 1WWZA 2ZEDA 3KI9A 3N5FA 1YLOA 2Q51A 1DTDA 1JQGA 3PRTA 5E96A 3GKRA 4X8IA 5D8NA 7CPAA 4UEEA 4M85A 2YNDA 5DWMA 1NMTA 2EWBA 2P0WA 2FE7A 1I1DA 3R96A 4CYPA 4XPLA 2ABZA 4C2YA 2QIRA 4CGMA 1TKHA 4AXVA 2VQYA 1M44A 2B4DA 4HNXB 4P4EA 2PSWA 2G9DA 5BWAB 2O53A 4BBHA 1QQ9A 1YW6A 4YWYA 3D68A 4CGOA 4JYWA 3VWDA 1ZLIA 4ONUA 1B87A 4Q38A 3PBBA 4B11A 2PIZA 2I00A 4HNYB 4MHDA 3S6HA 4Z65A 3FRMA 2Z3PA 1CPSA 4Q36A 3WT4A 3L2NA 1Q2YA 3KR4A 5F46A 4QVTA 1P0HA 4K30A 4IHMA 3W6XA 3SXOA 3PB9X 4R3LA 3KR5A 4OC4A 4CAXA 2EBJA 2GANA 2P6GA 1XFOA 4O23A 4CS0B 3EY5A 4OIWA 4GS4A 4BMHA 4UBRA 3V38A 1QSMA 4CGNA 2JBJA 2EVNA 4NGRA 2J8NA 3FNCA 4R9MA 5H84A 4XPKA 3KASA 3PFOA 1IGBA 2P6EA 1N71A 2ZW7A 3FF3A 2CNTA 4UWJA 4HPSA 3WABA 4II9A 2PJAA 2B5GA 1Z2LA 2C6GA 1CBXA 2EO8A 4MCPA 3T9YA 3IWGA 3KHZA 8CPAA 3ZZIA 1YSJA 4OC5A 5G21A 4M6HA 1IOIA 2C27A 3TOAA 1CP6A 2IQ6A 4PQAA 1IB1E 3S6KA 1M4DA 1ELMP 4G1PA 3CXSA 2Z3OA 4AG7A 3B3VA 1PYTB 1HDQA 1A2ZA 2PVVA 1MJBA 1QSNA 3BLNA 3V8IA 5DWNA 4YU9A 4KORA 4MY0A 2B4BA 2Z3MA 3FEDA 4P4IA 4KLWA 5J8FA 3FIXA 4I49A 4FUUA 3HLPA 4AVAA 2V77A 5LYIA 1LAMA 4NXYA 3D4UA 1S5KA 4WWVA 2QMLA 2AFXA 1UWYA 4H6ZA 2AFMA 5FVJA 1S7NA 3B3WA 1TKJA 2OH1A 3ZJ0A 5JQ4A 2ODFA 4MFJA 2CIJA 1Q2CA 3H5ZA 4B5OA 1ELLP 3PB8X 2CTBA 2CNSA 2XEFA 2J8RA 2NSMA 2ZW6A 3CPXA 1Z8TA 2AJ6A 2CNMA 5HVFA 1KUXA 4CYOA 3PEIA 4NJRA 5AG7A 1IOFA 2P6FA 1FNOA 3JVNA 3KQXA 1BAVA 4P10A 3TOBA 1OBRA 3R1KA 4OC2A 3TC8A 1RTQA 1R3NA 5CNPA 1IY7A 1ZG9A 4B12A 3CPAA 1XMBA 3IWEA 2DPSA 2WPWA 3WC6A 2V8VA 1Q2DA 3RNZA 1CJWA 4F0XA 1FT7A 4MFZA 2YGWA 4XNHB 3CT9A 4C2ZA 2D4OA 1Y7EA 4CGLA 4U9YA 3H8EA 3LWUA 1K4JA 3IFEA 1TKFA 3NFZA 4JJXA 5H86A 3FECA 5D29A 1YQEA 2CTCA 2Z3KA 3QB8A 1X12A 2VEZA 4NGNA 2DEAA 2FXFA 2PE3A 4C7HA 5G1ZA 4M3SA 4H6UA 1QSOA 1QMUA 3GYAA 4K3NA 5GCNA 5HXDA 3TTHA 4H2KA 2BO9A 2PJ2A 4MFKA 5JPHA 2Q43A 4MHNA 4R76A 2GREA 4UCPA 4UCNA 3SJXA 3FMCA 2C1CA 3VATA 3IO1A 5LYLA 2B58A 1VHEA 5C88A 2ARHA 2Q4YA 4B6ZA 4E0AA 3RYOA 1IU8A 1S7KA 3PP9A 1YVKA 4ZI6A 4KOYA 4LQ6A 4A38A 5IV0A 3FH4A 5F49A 3SI1A 4B13A 5AG4A 2Q04A 2VZYA 3TO6A 3FBUA 2ZENA 1YLEA 2Z11A 4QC6A 4X2TA 1YR0A 2CY2A 4A95A 1YGHA 3JUWA 4DUKA 2NMTA 4ZYQA 4GM5A 1QSTA 4JXQA 4P4JA 2PJ4A 3PBEA 2Z10A 2AFZA 2ZELA 3SJFA 2BCOA 3NE8A 4RS2A 3BHXA 4CYNA 3G8WA 2GIVA 2HQYA 5I0CA 1I21A 2HB6A 4MFLA 3TE4A 2VBQA 2NYQA 3H4QA 2G3AA 4KSIA 3D7GA 1IIDA 1XBUA 4FD6A 2PVWA 4CAEA 2JDCA 3B7IA 3HUVA 2G0BA 2PJ7A 1Y0RA 5LRJA 2V8DA 4M6GA 3RBUA 2WUUA 4CRYB 5C82A 1H8LA 1M4GA 4ZBGA 4GXHA 1ARLA 2EK9A 4CAVA 2Q0YA 3CXQA 3WR7A 3EFAA 3VWEA 2O4HA 3PZJA 4E8OA 3NE7A 4LQGA 2POKA 4KUAA 3FB3A 5EC4A 4NGMA 1Z4EA 2OZHA 5CBMA 5JH9A 3R9FA 4XPDB 1LCPA 4RUHA 1BLLE 2XEGA 2Z0ZA 5J8CA 2PCUA 4ZY2A 3R9EA 4KOUA 1IICA 3CDXA 3FEEA 2Y0MA 1LFWA 4MHPA 4UFWA 1XIXA 4C7IA 1NSLA 2WPXA 5G22A 2BL1A 5EMIA 3CZXA 3B3CA 2AFSA 4YRHA 3G3SA 1TF9A 2PRBA 3MRUA 4B14A 3NA6A 6CPAA 1Y9WA 2H5MA 1V0CA 2PQ8A 2X7BA 3F0AA 2PJ1A 3BXMA 3I3GA 5AG5A 3RO0A 3GIUA 4LX9A 1PCAA 3PGPA 4ZGYB 1NSAA 4CPAA 5I4MA 1GYTA 1XF8A 4DJLA 4UIAA 1XEBA 2FS5A 2QVPA 4QUSA 5EBVA 1AUGA 4ZX9A 1Q7LA 5DS0A 4EMEA 3VARA 4KS9A 4KSAA 5F09A 1VGYA 2REFA 4MJ8A 4R6TA 3TO7A 1UFHA 4R7MA 4UCMA 4PXCA 3E0KA 3IU1A 3D3SA 2C6PA 3SI0A 1OZPA 1TF8A 2A4NA 2AE6A 2BSWA 2FT0A 4FD7A 3TX8A 3BI1A 4EWTA 1S7FA 4R87A 1CP7A 2OZGA 2RFHA 4A32A 1LANA 2QYVA 4MHZA 2ZEMA 4P44A 3QAYA 3B8GA 1QSRA 3KZWA 4OADA 3D8PA 4DYOA
chains in the Genus database with same CATH topology
1Z8XA 2EO8A 1AUGA 1X10A 1IOIA 1IU8A 1Z8TA 1X12A 1IOFA 4GXHA 1A2ZA 2EBJA 2DF5A 3RO0A 3LACA 3GIUA 1Z8WA 4HPSA 3RNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z8X A;  2EO8 A;  1AUG A;  1X10 A;  1IOI A;  1IU8 A;  1Z8T A;  1X12 A;  1IOF A;  4GXH A;  1A2Z A;  2EBJ A;  2DF5 A;  3RO0 A;  3LAC A;  3GIU A;  1Z8W A;  4HPS A;  3RNZ A; 
#chains in the Genus database with same CATH topology
 3GLJ A;  4JD6 A;  4HNW B;  2PIY A;  4KOS A;  4OC1 A;  4OKO A;  3S9L A;  4L89 A;  2YNC C;  1VKC A;  3OWC A;  4NGP A;  4UIB A;  4KVM E;  1RO5 A;  4KVX A;  2IJZ A;  1I12 A;  3P2H A;  5ISV A;  4LUA A;  2K5T A;  4QB9 A;  1XOV A;  2B3V A;  1XMT A;  1P4N A;  1CM0 A;  3FYN A;  2R1I A;  1TXR A;  3TFY A;  2PR8 A;  4U5Y A;  3N7Z A;  2DPT A;  2J9A A;  2DF5 A;  2XEJ A;  2WZN A;  1YW4 A;  3DR6 A;  2VXK A;  3P2F A;  3DSB A;  1TIQ A;  1AYE A;  1Z4R A;  2BUE A;  3TO9 A;  4F6A A;  5HVH A;  2PR1 A;  3GY9 A;  2O28 A;  3KL9 A;  3SXN A;  4KOT A;  3T8W A;  3D66 A;  2OU2 A;  4U9Z A;  4CYQ A;  4CAF A;  2EK8 A;  4F8Z A;  1EE3 P;  2R98 A;  4TWE A;  4PK2 A;  3IC1 A;  1M4I A;  5HMN A;  2Q4Z A;  2F5I A;  1VHS A;  5CPA A;  1ARM A;  1ZO0 A;  4A30 A;  2ZW4 A;  1YME A;  2PJ3 A;  4Q7A A;  3TT2 A;  4UWI A;  2OR4 A;  2VI7 A;  2EUI A;  3EC4 A;  5LYD A;  4ORF A;  4DNC A;  3NH5 A;  1SQH A;  3R95 A;  2VL1 A;  3W91 A;  4CAW A;  3B35 A;  3KQZ A;  4B5P B;  4PV6 A;  1Y7R A;  5IX3 A;  1S60 A;  3K9U A;  1ON0 A;  5K8M A;  4F0Y A;  4PXB A;  4PK3 A;  3B3T A;  3GB0 A;  1AMP A;  2GLJ A;  1XRY A;  2PJ8 A;  2Q7S A;  3D7F A;  1F57 A;  2VZZ A;  3IWW A;  1S3Z A;  4IF5 A;  4P4F A;  5AG6 A;  4C68 A;  3JTK A;  4NGQ A;  3UY5 A;  4MCS A;  3S6G A;  2YNC A;  2CXA A;  2ZOF A;  4A31 A;  5F48 A;  1MK4 A;  3FVL A;  4PPZ A;  1YX0 A;  4MCR A;  4KOX A;  3DR8 A;  2AFO A;  3EO4 A;  3JRU A;  2R8V A;  1IYK A;  4QBJ A;  2ZEH A;  4UEF A;  1GHE A;  3QNV A;  4NGT A;  3F8K A;  3I1U A;  1ZLH A;  2PJ6 A;  1R57 A;  1VIX A;  4IUS A;  4MRI A;  4XNH C;  5IB0 A;  4JZ0 A;  2V8G A;  4A37 A;  2ZW5 A;  3FX6 A;  3H8G A;  1CG2 A;  1VHO A;  3K9T A;  4MMO A;  2WYR A;  4FBE A;  2JEV A;  2PJC A;  1IYL A;  3MGD A;  2RC4 A;  2Q7B A;  1J4J A;  3R9G A;  4MBU A;  3F5B A;  1BO4 A;  2ZEP A;  3DGV A;  5KTC A;  3BI0 A;  3PB7 X;  1BPM A;  4KOV A;  4X5K A;  4Y49 B;  4MFP A;  1KUV A;  1YVO A;  1HDU A;  2Q4V A;  5LRG A;  3S9M A;  3MN8 A;  2ZEE A;  4YGO A;  2B4D B;  1NE9 A;  4ZX8 A;  1ZG8 A;  2ZEG A;  2B3U A;  3T90 A;  5K8N A;  1BOB A;  4JLY A;  3PB4 X;  4KOW A;  1MJ9 A;  4NSQ A;  4MXU A;  3NH8 A;  3S6F A;  4AVB A;  2HUZ A;  2BOA A;  3SHP A;  5K8P A;  2GU2 A;  3W6S A;  4B10 A;  2FSR A;  3TCV A;  4ZY1 A;  1LOK A;  1M1D A;  2G3T A;  4YFJ A;  2FVG A;  1U6M A;  2J8M A;  2V8H A;  3BJ7 A;  4JWP A;  4MHY A;  5KTD A;  3LMS A;  4L8A A;  3DDD A;  1F2O A;  4HKF A;  5LRK A;  3IEH A;  3RAM A;  5HVG A;  3K2K A;  4NJQ A;  4OID A;  4OME A;  1HEE A;  4CRZ B;  4UF4 A;  1Z8X A;  2REE A;  1CPX A;  3ISX A;  4RN7 A;  4E2A A;  2Z3L A;  2PJ5 A;  3FXT A;  3QAH A;  1WK4 A;  4WJB A;  3D7H A;  4NEX A;  4NF1 A;  2PJ0 A;  1X10 A;  4A39 A;  4FAI A;  2FIA A;  3D2M A;  4PSW A;  1BPN A;  3RZA A;  4W9Y A;  1ZG7 A;  1Z9U A;  3C26 A;  1CX8 A;  2QJ8 A;  4KSF A;  5HH1 A;  4F9V A;  1XJO A;  4P4D A;  2IL4 A;  3I9S A;  3B3S A;  4AVC A;  4BIN A;  5JM6 A;  4MY3 A;  3IU2 A;  2B5G B;  2ZEF A;  4FD5 A;  5J1Q A;  2OZU A;  2RB7 A;  1Z5R A;  2WSA A;  4C2X A;  3EXN A;  1M4L A;  2AFW A;  2FL4 A;  3LAC A;  4R3K A;  1LRZ A;  2HV2 A;  2GFQ A;  3ISZ A;  4R57 A;  1R43 A;  2FIW A;  4ONW A;  2ZEO A;  3KKW A;  1L0C A;  2PJB A;  1PUA A;  1KZF A;  4P4B A;  3SI2 A;  5IB9 A;  2OB0 A;  2JBK A;  1XE4 A;  3GUX A;  4CGP A;  2ANP A;  1MJA A;  3H8F A;  2R7H A;  5THW A;  4M6I A;  1Y0Y A;  4PSX A;  3CXP A;  4RI1 A;  3S9N A;  3DNS A;  5A28 A;  3KHX A;  4A94 A;  3BJ8 A;  3KGQ A;  3SJE A;  2ATR A;  2I3C A;  2ZOG A;  3WC7 A;  2JDD A;  3DLJ A;  1KWM A;  2KCW A;  4X3R A;  3A9L A;  1FY7 A;  4Y49 C;  4F9U A;  2F7V A;  5ELY A;  4XPD C;  2OOT A;  4AB7 A;  2Z3N A;  2GE3 A;  4OC3 A;  3VH9 A;  2DXQ A;  4EVY A;  2PJ9 A;  4UFV A;  4EFD A;  2Q44 A;  4A33 A;  3PFE A;  1JWQ A;  4IK2 A;  4MFQ A;  1Z8W A;  5JGF A;  2FCK A;  2PC1 A;  4NFR A;  5G20 A;  4J3G A;  4B5P A;  4JXR A;  1Z8L A;  3WC5 A;  2D4P A;  1S7L A;  3NH4 A;  3B2Y A;  3D2P A;  2QEC A;  2JEW A;  3D7D A;  1PU9 A;  4OAE A;  4P45 A;  2JLM A;  3FJU A;  4KLV A;  2GLF A;  4NGS A;  1F2P A;  3SJG A;  2HC9 A;  1KUY A;  4PXD A;  3V7Z A;  2BEI A;  5A27 A;  4R8F A;  5KTA A;  3IIB A;  4MCQ A;  4OLL A;  2I79 A;  4TNU A;  4OC0 A;  5LYF A;  4PXE A;  5K8O A;  2IMO A;  4UEZ A;  1LAP A;  2C6C A;  1RXT A;  2AFU A;  2PDO A;  3PB6 X;  1Y9K A;  4KUB A;  5F47 A;  1DE4 C;  4UA3 A;  1YRE A;  3IGR A;  2F8H A;  2ZXV A;  4BD9 A;  4ZY0 A;  3IJ3 A;  4OP4 A;  2YNE A;  4IAV A;  4MI4 A;  4KZT A;  4FD4 A;  2CF4 A;  3D67 A;  4P6Y A;  5AGE A;  3LD2 A;  4A2Z A;  3LOD A;  4FWU A;  4H89 A;  1B6B A;  4KVO E;  4AG9 A;  1YK3 A;  2PRQ A;  2ZPA A;  4UFX A;  2XEI A;  4NCZ A;  1WWZ A;  2ZED A;  3KI9 A;  3N5F A;  1YLO A;  2Q51 A;  1DTD A;  1JQG A;  3PRT A;  5E96 A;  3GKR A;  4X8I A;  5D8N A;  7CPA A;  4UEE A;  4M85 A;  2YND A;  5DWM A;  1NMT A;  2EWB A;  2P0W A;  2FE7 A;  1I1D A;  3R96 A;  4CYP A;  4XPL A;  2ABZ A;  4C2Y A;  2QIR A;  4CGM A;  1TKH A;  4AXV A;  2VQY A;  1M44 A;  2B4D A;  4HNX B;  4P4E A;  2PSW A;  2G9D A;  5BWA B;  2O53 A;  4BBH A;  1QQ9 A;  1YW6 A;  4YWY A;  3D68 A;  4CGO A;  4JYW A;  3VWD A;  1ZLI A;  4ONU A;  1B87 A;  4Q38 A;  3PBB A;  4B11 A;  2PIZ A;  2I00 A;  4HNY B;  4MHD A;  3S6H A;  4Z65 A;  3FRM A;  2Z3P A;  1CPS A;  4Q36 A;  3WT4 A;  3L2N A;  1Q2Y A;  3KR4 A;  5F46 A;  4QVT A;  1P0H A;  4K30 A;  4IHM A;  3W6X A;  3SXO A;  3PB9 X;  4R3L A;  3KR5 A;  4OC4 A;  4CAX A;  2EBJ A;  2GAN A;  2P6G A;  1XFO A;  4O23 A;  4CS0 B;  3EY5 A;  4OIW A;  4GS4 A;  4BMH A;  4UBR A;  3V38 A;  1QSM A;  4CGN A;  2JBJ A;  2EVN A;  4NGR A;  2J8N A;  3FNC A;  4R9M A;  5H84 A;  4XPK A;  3KAS A;  3PFO A;  1IGB A;  2P6E A;  1N71 A;  2ZW7 A;  3FF3 A;  2CNT A;  4UWJ A;  4HPS A;  3WAB A;  4II9 A;  2PJA A;  2B5G A;  1Z2L A;  2C6G A;  1CBX A;  2EO8 A;  4MCP A;  3T9Y A;  3IWG A;  3KHZ A;  8CPA A;  3ZZI A;  1YSJ A;  4OC5 A;  5G21 A;  4M6H A;  1IOI A;  2C27 A;  3TOA A;  1CP6 A;  2IQ6 A;  4PQA A;  1IB1 E;  3S6K A;  1M4D A;  1ELM P;  4G1P A;  3CXS A;  2Z3O A;  4AG7 A;  3B3V A;  1PYT B;  1HDQ A;  1A2Z A;  2PVV A;  1MJB A;  1QSN A;  3BLN A;  3V8I A;  5DWN A;  4YU9 A;  4KOR A;  4MY0 A;  2B4B A;  2Z3M A;  3FED A;  4P4I A;  4KLW A;  5J8F A;  3FIX A;  4I49 A;  4FUU A;  3HLP A;  4AVA A;  2V77 A;  5LYI A;  1LAM A;  4NXY A;  3D4U A;  1S5K A;  4WWV A;  2QML A;  2AFX A;  1UWY A;  4H6Z A;  2AFM A;  5FVJ A;  1S7N A;  3B3W A;  1TKJ A;  2OH1 A;  3ZJ0 A;  5JQ4 A;  2ODF A;  4MFJ A;  2CIJ A;  1Q2C A;  3H5Z A;  4B5O A;  1ELL P;  3PB8 X;  2CTB A;  2CNS A;  2XEF A;  2J8R A;  2NSM A;  2ZW6 A;  3CPX A;  1Z8T A;  2AJ6 A;  2CNM A;  5HVF A;  1KUX A;  4CYO A;  3PEI A;  4NJR A;  5AG7 A;  1IOF A;  2P6F A;  1FNO A;  3JVN A;  3KQX A;  1BAV A;  4P10 A;  3TOB A;  1OBR A;  3R1K A;  4OC2 A;  3TC8 A;  1RTQ A;  1R3N A;  5CNP A;  1IY7 A;  1ZG9 A;  4B12 A;  3CPA A;  1XMB A;  3IWE A;  2DPS A;  2WPW A;  3WC6 A;  2V8V A;  1Q2D A;  3RNZ A;  1CJW A;  4F0X A;  1FT7 A;  4MFZ A;  2YGW A;  4XNH B;  3CT9 A;  4C2Z A;  2D4O A;  1Y7E A;  4CGL A;  4U9Y A;  3H8E A;  3LWU A;  1K4J A;  3IFE A;  1TKF A;  3NFZ A;  4JJX A;  5H86 A;  3FEC A;  5D29 A;  1YQE A;  2CTC A;  2Z3K A;  3QB8 A;  1X12 A;  2VEZ A;  4NGN A;  2DEA A;  2FXF A;  2PE3 A;  4C7H A;  5G1Z A;  4M3S A;  4H6U A;  1QSO A;  1QMU A;  3GYA A;  4K3N A;  5GCN A;  5HXD A;  3TTH A;  4H2K A;  2BO9 A;  2PJ2 A;  4MFK A;  5JPH A;  2Q43 A;  4MHN A;  4R76 A;  2GRE A;  4UCP A;  4UCN A;  3SJX A;  3FMC A;  2C1C A;  3VAT A;  3IO1 A;  5LYL A;  2B58 A;  1VHE A;  5C88 A;  2ARH A;  2Q4Y A;  4B6Z A;  4E0A A;  3RYO A;  1IU8 A;  1S7K A;  3PP9 A;  1YVK A;  4ZI6 A;  4KOY A;  4LQ6 A;  4A38 A;  5IV0 A;  3FH4 A;  5F49 A;  3SI1 A;  4B13 A;  5AG4 A;  2Q04 A;  2VZY A;  3TO6 A;  3FBU A;  2ZEN A;  1YLE A;  2Z11 A;  4QC6 A;  4X2T A;  1YR0 A;  2CY2 A;  4A95 A;  1YGH A;  3JUW A;  4DUK A;  2NMT A;  4ZYQ A;  4GM5 A;  1QST A;  4JXQ A;  4P4J A;  2PJ4 A;  3PBE A;  2Z10 A;  2AFZ A;  2ZEL A;  3SJF A;  2BCO A;  3NE8 A;  4RS2 A;  3BHX A;  4CYN A;  3G8W A;  2GIV A;  2HQY A;  5I0C A;  1I21 A;  2HB6 A;  4MFL A;  3TE4 A;  2VBQ A;  2NYQ A;  3H4Q A;  2G3A A;  4KSI A;  3D7G A;  1IID A;  1XBU A;  4FD6 A;  2PVW A;  4CAE A;  2JDC A;  3B7I A;  3HUV A;  2G0B A;  2PJ7 A;  1Y0R A;  5LRJ A;  2V8D A;  4M6G A;  3RBU A;  2WUU A;  4CRY B;  5C82 A;  1H8L A;  1M4G A;  4ZBG A;  4GXH A;  1ARL A;  2EK9 A;  4CAV A;  2Q0Y A;  3CXQ A;  3WR7 A;  3EFA A;  3VWE A;  2O4H A;  3PZJ A;  4E8O A;  3NE7 A;  4LQG A;  2POK A;  4KUA A;  3FB3 A;  5EC4 A;  4NGM A;  1Z4E A;  2OZH A;  5CBM A;  5JH9 A;  3R9F A;  4XPD B;  1LCP A;  4RUH A;  1BLL E;  2XEG A;  2Z0Z A;  5J8C A;  2PCU A;  4ZY2 A;  3R9E A;  4KOU A;  1IIC A;  3CDX A;  3FEE A;  2Y0M A;  1LFW A;  4MHP A;  4UFW A;  1XIX A;  4C7I A;  1NSL A;  2WPX A;  5G22 A;  2BL1 A;  5EMI A;  3CZX A;  3B3C A;  2AFS A;  4YRH A;  3G3S A;  1TF9 A;  2PRB A;  3MRU A;  4B14 A;  3NA6 A;  6CPA A;  1Y9W A;  2H5M A;  1V0C A;  2PQ8 A;  2X7B A;  3F0A A;  2PJ1 A;  3BXM A;  3I3G A;  5AG5 A;  3RO0 A;  3GIU A;  4LX9 A;  1PCA A;  3PGP A;  4ZGY B;  1NSA A;  4CPA A;  5I4M A;  1GYT A;  1XF8 A;  4DJL A;  4UIA A;  1XEB A;  2FS5 A;  2QVP A;  4QUS A;  5EBV A;  1AUG A;  4ZX9 A;  1Q7L A;  5DS0 A;  4EME A;  3VAR A;  4KS9 A;  4KSA A;  5F09 A;  1VGY A;  2REF A;  4MJ8 A;  4R6T A;  3TO7 A;  1UFH A;  4R7M A;  4UCM A;  4PXC A;  3E0K A;  3IU1 A;  3D3S A;  2C6P A;  3SI0 A;  1OZP A;  1TF8 A;  2A4N A;  2AE6 A;  2BSW A;  2FT0 A;  4FD7 A;  3TX8 A;  3BI1 A;  4EWT A;  1S7F A;  4R87 A;  1CP7 A;  2OZG A;  2RFH A;  4A32 A;  1LAN A;  2QYV A;  4MHZ A;  2ZEM A;  4P44 A;  3QAY A;  3B8G A;  1QSR A;  3KZW A;  4OAD A;  3D8P A;  4DYO A; 
#chains in the Genus database with same CATH homology
 1Z8X A;  2EO8 A;  1AUG A;  1X10 A;  1IOI A;  1IU8 A;  1Z8T A;  1X12 A;  1IOF A;  4GXH A;  1A2Z A;  2EBJ A;  2DF5 A;  3RO0 A;  3LAC A;  3GIU A;  1Z8W A;  4HPS A;  3RNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...