1X12A

Structure of mutant pyrrolidone carboxyl peptidase (e192d) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMDLEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1x12A00
1IOFA 1Z8XA 1Z8TA 1IU8A 1X10A 3GIUA 4GXHA 1IOIA 3LACA 3RNZA 1Z8WA 3RO0A 1A2ZA 1X12A 2EBJA 2EO8A 1AUGA 4HPSA 2DF5A
chains in the Genus database with same CATH superfamily
4NGQA 2Z3MA 4K30A 2G0BA 3PFOA 4KVXA 3LODA 4B10A 3KR5A 4UWIA 2FCKA 4DNCA 2PRBA 4P4FA 3IJ3A 3S6GA 4QBJA 4RUHA 2Z11A 1VHOA 5K8MA 3TT2A 1CP6A 1Q7LA 3SXNA 1GYTA 1F2OA 3B2YA 4P4IA 5G1ZA 3TC8A 2VXKA 3BJ8A 1FY7A 2Q0YA 5JPHA 2V8HA 3D66A 1YGHA 4UBRA 4PSWA 1YVOA 3P2HA 4WJBA 4MI4A 5H84A 2HC9A 5EC4A 1XMBA 2RC4A 2XEJA 2QJ8A 3S9LA 5AG4A 5F48A 4L89A 1YQEA 2O28A 3RAMA 4UWJA 3IIBA 4A30A 2PJ6A 3GLJA 2H5MA 2V8VA 8CPAA 1BOBA 2IQ6A 2EO8A 2VL1A 5AG7A 4CRYB 3D8PA 4X8IA 3NH4A 3TTHA 3VWDA 4B5PA 4F6AA 3WC6A 2Z3PA 3KGQA 3GB0A 3G3SA 3P2FA 1BPNA 4X2TA 2CNMA 4A32A 1Z9UA 2BL1A 3D7GA 3D7DA 4K3NA 1XF8A 2VZZA 4OIDA 1QSTA 1CG2A 2AE6A 2PVWA 4H6UA 4OIWA 2FSRA 4XPDB 2AFSA 4CAFA 2PJ0A 1XEBA 4W9YA 3H4QA 5GCNA 4C7HA 2JBJA 2YNCC 1Z4EA 3F8KA 3LMSA 4FD6A 4KOYA 3S9NA 4NGMA 3IC1A 2HB6A 2CTCA 3NH5A 4OC2A 2WPWA 3R9FA 4ZI6A 3BI0A 4NXYA 4QB9A 1ZLIA 1MJBA 2XEGA 4KSFA 4KVME 2QMLA 3KL9A 2R7HA 2Q4VA 1LOKA 2P6EA 4B13A 2IMOA 2OR4A 4HNWB 1IB1E 2PJ9A 1IU8A 4R8FA 2ZPAA 5C88A 3GIUA 3BI1A 4CGLA 4R3LA 1YVKA 2YNEA 2JDCA 3FX6A 3DLJA 3MGDA 1JQGA 1F2PA 4UIAA 1YREA 3JRUA 4EFDA 2Q4ZA 2GE3A 4ZY0A 3RO0A 1Z4RA 4A37A 3W91A 3FMCA 4JXRA 3T9YA 3PB7X 5CBMA 2ABZA 1RXTA 2Z3OA 2ZEOA 2XEIA 3B7IA 1BO4A 1X12A 4EWTA 1IY7A 4OC3A 4XPDC 2ZW4A 2IL4A 2R8VA 4HPSA 5DWMA 2PJ2A 1YLEA 1ELMP 2FIAA 3K9TA 4CPAA 1XRYA 4KOWA 2OZGA 4AVBA 4BMHA 2Z10A 4CGNA 3CPXA 1M4LA 2K5TA 3PB9X 2PQ8A 2Y0MA 1J4JA 1VKCA 3K9UA 4H2KA 1Y7EA 2ANPA 1Y0YA 5EMIA 2CY2A 3OWCA 2Q4YA 3SXOA 2ATRA 4R57A 3KI9A 5FVJA 1Y9KA 3RBUA 1HEEA 3C26A 4M6HA 4MHPA 1I1DA 2PJ1A 4NF1A 2GLFA 2AFXA 5ISVA 2EUIA 5KTCA 4L8AA 3B3VA 1DTDA 3D2MA 4R7MA 3FVLA 4XNHC 4II9A 1TF9A 1AUGA 2C6GA 4NGPA 2ZEMA 1QSRA 2ODFA 1CP7A 3IO1A 5DWNA 3FH4A 2B58A 4AG9A 4MCRA 4BD9A 2CNTA 2EK8A 3GUXA 4P4BA 4R87A 4WWVA 5JM6A 3DSBA 3PP9A 3A9LA 2OH1A 3NE8A 3R9EA 4MCPA 1PCAA 4MFPA 1Z5RA 2Q44A 3FIXA 4RS2A 1Z8WA 2Q7SA 1LAMA 1UWYA 2OZUA 4ZX8A 3VATA 2GU2A 4OADA 2ZOGA 2PJBA 4F0XA 4E8OA 1YW6A 3V8IA 2I79A 1XMTA 2PSWA 3KR4A 1OZPA 2V77A 1YX0A 1QMUA 3B3CA 1Z2LA 3DDDA 1QSMA 5JH9A 4A2ZA 1I12A 2IJZA 4KOVA 5CNPA 3B3WA 3QAHA 3R95A 2ZOFA 1Y9WA 1F57A 5LYFA 5K8OA 2EWBA 1WWZA 3PEIA 2HUZA 4KSAA 2DPTA 3PBBA 3RNZA 3IWGA 3KQXA 4NJQA 4X3RA 1VHSA 4LX9A 4MHYA 3I9SA 3FNCA 5AGEA 4CYOA 5C82A 1KZFA 4YGOA 2G9DA 3MN8A 3KQZA 4MFQA 3KKWA 3KASA 4M3SA 3CZXA 4KLVA 1IYLA 3IU1A 3S6FA 2D4PA 1DE4C 1LAPA 4JD6A 5E96A 5AG5A 1HDUA 4M85A 4P4EA 2C1CA 2OZHA 3D4UA 5D8NA 4KOSA 1Y0RA 2DXQA 3D2PA 4JWPA 1YK3A 4ONWA 4PV6A 3CXPA 4C2YA 3CDXA 2YNCA 3LACA 4KORA 4UIBA 5A28A 5HH1A 4A39A 1ARMA 3WR7A 2J9AA 1MK4A 4U5YA 4TWEA 4Z65A 2ARHA 1ZG9A 2GFQA 2PR8A 2VI7A 1B87A 4IAVA 4OMEA 2ZENA 1QQ9A 2EK9A 2Z3KA 4NGNA 2XEFA 5IX3A 3PBEA 5K8NA 4A38A 2PIZA 4R9MA 4F0YA 2AFOA 1AMPA 4IF5A 4IK2A 4YU9A 2CTBA 3QB8A 4MCSA 1XIXA 3IU2A 2DF5A 2B5GB 4LUAA 4NEXA 2BO9A 3KZWA 2X7BA 3E0KA 4JJXA 4X5KA 1Q2DA 1IOFA 4C7IA 3TX8A 2C6PA 2BSWA 2PJ4A 5K8PA 2JDDA 2WZNA 4AB7A 5F09A 3D67A 2RB7A 3SI1A 3CPAA 4U9YA 4TNUA 1SQHA 4MHZA 4PK3A 1TXRA 2GANA 2YNDA 2A4NA 4QC6A 4UFVA 5THWA 1AYEA 2P0WA 4XNHB 3QNVA 4NGSA 3H8FA 3TO7A 4A95A 4JXQA 2FVGA 4KZTA 1S5KA 3BLNA 4NGRA 3N7ZA 4UCMA 4UCNA 3T8WA 3EO4A 3D68A 1UFHA 2I00A 3CXSA 4CGOA 2OB0A 4HNXB 1S7LA 5J1QA 1NMTA 1KUXA 5HVGA 1EE3P 4A33A 2ZEGA 4PSXA 2G3TA 3DNSA 4MY0A 5DS0A 2PJ7A 4UFXA 4BINA 2JEWA 3RZAA 3JUWA 1CPSA 2AFZA 3FBUA 4P45A 2Q51A 3FXTA 3TO9A 3BXMA 4PQAA 5HXDA 3CT9A 2FE7A 4P44A 2QECA 3IWEA 1S7FA 1S3ZA 3R1KA 2ZEEA 1TF8A 1VHEA 1LRZA 4MBUA 4GS4A 3WC7A 5BWAB 2YGWA 4QUSA 4MY3A 2OU2A 1ON0A 1R3NA 2VEZA 2ZW7A 3FF3A 5CPAA 5LRGA 3WC5A 4ZGYB 5HMNA 1S60A 1H8LA 1ARLA 2BOAA 2O4HA 4E2AA 4HKFA 4B11A 4B6ZA 2B3VA 3FECA 1V0CA 1ELLP 4G1PA 1XFOA 1CJWA 5ELYA 4CS0B 3F0AA 2AFMA 3PZJA 5LYLA 2F7VA 1XJOA 2PJ8A 1X10A 2PCUA 3WT4A 3IEHA 4UEFA 3R9GA 1S7NA 4PXDA 3W6SA 1ZG7A 2PR1A 2DEAA 2GIVA 1CPXA 3TOAA 2CXAA 2PJCA 5LRKA 4PPZA 1M44A 2C27A 2KCWA 4MHDA 3B35A 4KS9A 5J8FA 4MFZA 3SI2A 3H8GA 5KTAA 1B6BA 2POKA 4UCPA 4CAWA 2AJ6A 2QIRA 1TKJA 4ZX9A 2ZW5A 4OC4A 2WSAA 2FL4A 4Q38A 4OKOA 3SHPA 1L0CA 1KUVA 4AXVA 3B8GA 1XBUA 3I3GA 1MJAA 2ZEFA 1LCPA 2R98A 2VBQA 3BHXA 3CXQA 1HDQA 4J3GA 2Q43A 3NFZA 4XPLA 2PJAA 2NYQA 4P4JA 2GREA 2C6CA 4FD7A 5I0CA 4OAEA 4FD4A 4CRZB 2F5IA 4PK2A 4E0AA 4FD5A 2QVPA 1M4GA 4IHMA 4JZ0A 1NSAA 2WYRA 4KOTA 2FT0A 2Z3NA 4DUKA 4R76A 1ZG8A 4B14A 1YLOA 4BBHA 1PUAA 3GYAA 2R1IA 3GKRA 5LRJA 2CIJA 3PB8X 1IIDA 4NSQA 1BLLE 2REEA 3D3SA 1K4JA 2V8GA 3FEDA 3LD2A 4YRHA 2PIYA 3L2NA 4HNYB 1YW4A 4CGMA 4FBEA 4B5PB 2B4BA 2PJ3A 2AFUA 4C2ZA 5IB0A 3SI0A 4FWUA 4Y49B 2FS5A 4UEEA 3D7FA 3MRUA 2Z0ZA 1PU9A 3ISZA 4NGTA 4Q36A 3EXNA 1YR0A 5I4MA 3DR6A 3TO6A 4GM5A 3TCVA 4R6TA 3S6HA 4CYPA 4I49A 2PC1A 1M4IA 1XE4A 2J8MA 3SJFA 4KUBA 1P4NA 3TOBA 7CPAA 1JWQA 3ZZIA 5JGFA 2AFWA 2D4OA 3EC4A 1S7KA 2CNSA 3F5BA 3PFEA 4ONUA 2BCOA 4B5OA 3T90A 2J8NA 2ZEDA 5F47A 1OBRA 1GHEA 4JLYA 1P0HA 1XOVA 1R43A 2PE3A 1LANA 4CYQA 3B3SA 4OLLA 1PYTB 4UEZA 2WPXA 2PVVA 2VQYA 4AVCA 1FNOA 1FT7A 3VH9A 5J8CA 3FJUA 3SJEA 3NH8A 1NE9A 1LFWA 4KVOE 1IOIA 4UA3A 4CYNA 1I21A 4EMEA 4Y49C 5LYIA 1CX8A 2O53A 3GY9A 2PDOA 2JLMA 2NMTA 5H86A 3K2KA 5KTDA 3FYNA 4M6IA 3SJXA 2Z3LA 3PB6X 5D29A 1Y7RA 4M6GA 2JBKA 4OP4A 1CBXA 4U9ZA 3UY5A 1BPMA 4OC1A 4F9UA 2PJ5A 1IGBA 3G8WA 3H5ZA 4H89A 4NJRA 3H8EA 4A94A 2BUEA 4QVTA 2B5GA 4DJLA 4O23A 1ZO0A 4UF4A 1WK4A 2NSMA 3BJ7A 3NE7A 3S9MA 6CPAA 3ZJ0A 2F8HA 2FIWA 4ZY2A 3KHZA 4A31A 3N5FA 4MCQA 4PXBA 4FUUA 3PGPA 3HUVA 4R3KA 4KOXA 5EBVA 3WABA 3NA6A 4KSIA 1IYKA 3ISXA 5F46A 2BEIA 3FRMA 3JTKA 2PRQA 4PXEA 2G3AA 2P6FA 1M1DA 4LQGA 4C2XA 4OC5A 4OC0A 4CAXA 1RTQA 2JEVA 2EBJA 5G20A 4ORFA 3D7HA 3TE4A 3IGRA 3QAYA 2Q04A 1KUYA 4AG7A 4C68A 4FAIA 4EVYA 3EFAA 4NFRA 1KWMA 4MMOA 3V38A 3RYOA 4ZY1A 2QYVA 1U6MA 2ZELA 1YMEA 1Z8XA 2ZW6A 3PB4X 3FEEA 3IWWA 4P6YA 4PXCA 1QSNA 3V7ZA 4YWYA 4GXHA 2DPSA 5AG6A 4YFJA 1BAVA 1NSLA 5HVHA 2B3UA 2P6GA 2ZEHA 4CAEA 4ZYQA 1VGYA 1ZLHA 2Q7BA 4MFJA 4F8ZA 4MRIA 2I3CA 4KUAA 3FB3A 4JYWA 1QSOA 2B4DB 4KOUA 1R57A 1TIQA 1YSJA 3TFYA 1TKHA 5LYDA 3W6XA 4AVAA 4DYOA 4NCZA 1IICA 4MJ8A 4P10A 1N71A 3S6KA 2GLJA 1Z8LA 2HQYA 1RO5A 4MFLA 4MXUA 2WUUA 3B3TA 1TKFA 2HV2A 1Z8TA 3EY5A 4H6ZA 4MFKA 3KHXA 2VZYA 4F9VA 1CM0A 3PRTA 4KLWA 4XPKA 4Q7AA 1M4DA 2ZEPA 5G22A 2EVNA 3SJGA 4UFWA 5F49A 5JQ4A 5G21A 3VARA 5IB9A 5HVFA 2REFA 3JVNA 1Q2CA 3R96A 4CGPA 4MHNA 3LWUA 3I1UA 4CAVA 2ZXVA 5A27A 2CF4A 1A2ZA 1VIXA 5IV0A 4P4DA 3VWEA 2V8DA 1MJ9A 2B4DA 2FXFA 4LQ6A 4ZBGA 3DGVA 4RN7A 4B12A 1Q2YA 4RI1A 3IFEA 2OOTA 2RFHA 4IUSA 3HLPA 3DR8A 2J8RA
chains in the Genus database with same CATH topology
1IOFA 1Z8XA 1Z8TA 1IU8A 1X10A 3GIUA 4GXHA 1IOIA 3LACA 3RNZA 1Z8WA 3RO0A 1A2ZA 1X12A 2EBJA 2EO8A 1AUGA 4HPSA 2DF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IOF A;  1Z8X A;  1Z8T A;  1IU8 A;  1X10 A;  3GIU A;  4GXH A;  1IOI A;  3LAC A;  3RNZ A;  1Z8W A;  3RO0 A;  1A2Z A;  1X12 A;  2EBJ A;  2EO8 A;  1AUG A;  4HPS A;  2DF5 A; 
#chains in the Genus database with same CATH topology
 4NGQ A;  2Z3M A;  4K30 A;  2G0B A;  3PFO A;  4KVX A;  3LOD A;  4B10 A;  3KR5 A;  4UWI A;  2FCK A;  4DNC A;  2PRB A;  4P4F A;  3IJ3 A;  3S6G A;  4QBJ A;  4RUH A;  2Z11 A;  1VHO A;  5K8M A;  3TT2 A;  1CP6 A;  1Q7L A;  3SXN A;  1GYT A;  1F2O A;  3B2Y A;  4P4I A;  5G1Z A;  3TC8 A;  2VXK A;  3BJ8 A;  1FY7 A;  2Q0Y A;  5JPH A;  2V8H A;  3D66 A;  1YGH A;  4UBR A;  4PSW A;  1YVO A;  3P2H A;  4WJB A;  4MI4 A;  5H84 A;  2HC9 A;  5EC4 A;  1XMB A;  2RC4 A;  2XEJ A;  2QJ8 A;  3S9L A;  5AG4 A;  5F48 A;  4L89 A;  1YQE A;  2O28 A;  3RAM A;  4UWJ A;  3IIB A;  4A30 A;  2PJ6 A;  3GLJ A;  2H5M A;  2V8V A;  8CPA A;  1BOB A;  2IQ6 A;  2EO8 A;  2VL1 A;  5AG7 A;  4CRY B;  3D8P A;  4X8I A;  3NH4 A;  3TTH A;  3VWD A;  4B5P A;  4F6A A;  3WC6 A;  2Z3P A;  3KGQ A;  3GB0 A;  3G3S A;  3P2F A;  1BPN A;  4X2T A;  2CNM A;  4A32 A;  1Z9U A;  2BL1 A;  3D7G A;  3D7D A;  4K3N A;  1XF8 A;  2VZZ A;  4OID A;  1QST A;  1CG2 A;  2AE6 A;  2PVW A;  4H6U A;  4OIW A;  2FSR A;  4XPD B;  2AFS A;  4CAF A;  2PJ0 A;  1XEB A;  4W9Y A;  3H4Q A;  5GCN A;  4C7H A;  2JBJ A;  2YNC C;  1Z4E A;  3F8K A;  3LMS A;  4FD6 A;  4KOY A;  3S9N A;  4NGM A;  3IC1 A;  2HB6 A;  2CTC A;  3NH5 A;  4OC2 A;  2WPW A;  3R9F A;  4ZI6 A;  3BI0 A;  4NXY A;  4QB9 A;  1ZLI A;  1MJB A;  2XEG A;  4KSF A;  4KVM E;  2QML A;  3KL9 A;  2R7H A;  2Q4V A;  1LOK A;  2P6E A;  4B13 A;  2IMO A;  2OR4 A;  4HNW B;  1IB1 E;  2PJ9 A;  1IU8 A;  4R8F A;  2ZPA A;  5C88 A;  3GIU A;  3BI1 A;  4CGL A;  4R3L A;  1YVK A;  2YNE A;  2JDC A;  3FX6 A;  3DLJ A;  3MGD A;  1JQG A;  1F2P A;  4UIA A;  1YRE A;  3JRU A;  4EFD A;  2Q4Z A;  2GE3 A;  4ZY0 A;  3RO0 A;  1Z4R A;  4A37 A;  3W91 A;  3FMC A;  4JXR A;  3T9Y A;  3PB7 X;  5CBM A;  2ABZ A;  1RXT A;  2Z3O A;  2ZEO A;  2XEI A;  3B7I A;  1BO4 A;  1X12 A;  4EWT A;  1IY7 A;  4OC3 A;  4XPD C;  2ZW4 A;  2IL4 A;  2R8V A;  4HPS A;  5DWM A;  2PJ2 A;  1YLE A;  1ELM P;  2FIA A;  3K9T A;  4CPA A;  1XRY A;  4KOW A;  2OZG A;  4AVB A;  4BMH A;  2Z10 A;  4CGN A;  3CPX A;  1M4L A;  2K5T A;  3PB9 X;  2PQ8 A;  2Y0M A;  1J4J A;  1VKC A;  3K9U A;  4H2K A;  1Y7E A;  2ANP A;  1Y0Y A;  5EMI A;  2CY2 A;  3OWC A;  2Q4Y A;  3SXO A;  2ATR A;  4R57 A;  3KI9 A;  5FVJ A;  1Y9K A;  3RBU A;  1HEE A;  3C26 A;  4M6H A;  4MHP A;  1I1D A;  2PJ1 A;  4NF1 A;  2GLF A;  2AFX A;  5ISV A;  2EUI A;  5KTC A;  4L8A A;  3B3V A;  1DTD A;  3D2M A;  4R7M A;  3FVL A;  4XNH C;  4II9 A;  1TF9 A;  1AUG A;  2C6G A;  4NGP A;  2ZEM A;  1QSR A;  2ODF A;  1CP7 A;  3IO1 A;  5DWN A;  3FH4 A;  2B58 A;  4AG9 A;  4MCR A;  4BD9 A;  2CNT A;  2EK8 A;  3GUX A;  4P4B A;  4R87 A;  4WWV A;  5JM6 A;  3DSB A;  3PP9 A;  3A9L A;  2OH1 A;  3NE8 A;  3R9E A;  4MCP A;  1PCA A;  4MFP A;  1Z5R A;  2Q44 A;  3FIX A;  4RS2 A;  1Z8W A;  2Q7S A;  1LAM A;  1UWY A;  2OZU A;  4ZX8 A;  3VAT A;  2GU2 A;  4OAD A;  2ZOG A;  2PJB A;  4F0X A;  4E8O A;  1YW6 A;  3V8I A;  2I79 A;  1XMT A;  2PSW A;  3KR4 A;  1OZP A;  2V77 A;  1YX0 A;  1QMU A;  3B3C A;  1Z2L A;  3DDD A;  1QSM A;  5JH9 A;  4A2Z A;  1I12 A;  2IJZ A;  4KOV A;  5CNP A;  3B3W A;  3QAH A;  3R95 A;  2ZOF A;  1Y9W A;  1F57 A;  5LYF A;  5K8O A;  2EWB A;  1WWZ A;  3PEI A;  2HUZ A;  4KSA A;  2DPT A;  3PBB A;  3RNZ A;  3IWG A;  3KQX A;  4NJQ A;  4X3R A;  1VHS A;  4LX9 A;  4MHY A;  3I9S A;  3FNC A;  5AGE A;  4CYO A;  5C82 A;  1KZF A;  4YGO A;  2G9D A;  3MN8 A;  3KQZ A;  4MFQ A;  3KKW A;  3KAS A;  4M3S A;  3CZX A;  4KLV A;  1IYL A;  3IU1 A;  3S6F A;  2D4P A;  1DE4 C;  1LAP A;  4JD6 A;  5E96 A;  5AG5 A;  1HDU A;  4M85 A;  4P4E A;  2C1C A;  2OZH A;  3D4U A;  5D8N A;  4KOS A;  1Y0R A;  2DXQ A;  3D2P A;  4JWP A;  1YK3 A;  4ONW A;  4PV6 A;  3CXP A;  4C2Y A;  3CDX A;  2YNC A;  3LAC A;  4KOR A;  4UIB A;  5A28 A;  5HH1 A;  4A39 A;  1ARM A;  3WR7 A;  2J9A A;  1MK4 A;  4U5Y A;  4TWE A;  4Z65 A;  2ARH A;  1ZG9 A;  2GFQ A;  2PR8 A;  2VI7 A;  1B87 A;  4IAV A;  4OME A;  2ZEN A;  1QQ9 A;  2EK9 A;  2Z3K A;  4NGN A;  2XEF A;  5IX3 A;  3PBE A;  5K8N A;  4A38 A;  2PIZ A;  4R9M A;  4F0Y A;  2AFO A;  1AMP A;  4IF5 A;  4IK2 A;  4YU9 A;  2CTB A;  3QB8 A;  4MCS A;  1XIX A;  3IU2 A;  2DF5 A;  2B5G B;  4LUA A;  4NEX A;  2BO9 A;  3KZW A;  2X7B A;  3E0K A;  4JJX A;  4X5K A;  1Q2D A;  1IOF A;  4C7I A;  3TX8 A;  2C6P A;  2BSW A;  2PJ4 A;  5K8P A;  2JDD A;  2WZN A;  4AB7 A;  5F09 A;  3D67 A;  2RB7 A;  3SI1 A;  3CPA A;  4U9Y A;  4TNU A;  1SQH A;  4MHZ A;  4PK3 A;  1TXR A;  2GAN A;  2YND A;  2A4N A;  4QC6 A;  4UFV A;  5THW A;  1AYE A;  2P0W A;  4XNH B;  3QNV A;  4NGS A;  3H8F A;  3TO7 A;  4A95 A;  4JXQ A;  2FVG A;  4KZT A;  1S5K A;  3BLN A;  4NGR A;  3N7Z A;  4UCM A;  4UCN A;  3T8W A;  3EO4 A;  3D68 A;  1UFH A;  2I00 A;  3CXS A;  4CGO A;  2OB0 A;  4HNX B;  1S7L A;  5J1Q A;  1NMT A;  1KUX A;  5HVG A;  1EE3 P;  4A33 A;  2ZEG A;  4PSX A;  2G3T A;  3DNS A;  4MY0 A;  5DS0 A;  2PJ7 A;  4UFX A;  4BIN A;  2JEW A;  3RZA A;  3JUW A;  1CPS A;  2AFZ A;  3FBU A;  4P45 A;  2Q51 A;  3FXT A;  3TO9 A;  3BXM A;  4PQA A;  5HXD A;  3CT9 A;  2FE7 A;  4P44 A;  2QEC A;  3IWE A;  1S7F A;  1S3Z A;  3R1K A;  2ZEE A;  1TF8 A;  1VHE A;  1LRZ A;  4MBU A;  4GS4 A;  3WC7 A;  5BWA B;  2YGW A;  4QUS A;  4MY3 A;  2OU2 A;  1ON0 A;  1R3N A;  2VEZ A;  2ZW7 A;  3FF3 A;  5CPA A;  5LRG A;  3WC5 A;  4ZGY B;  5HMN A;  1S60 A;  1H8L A;  1ARL A;  2BOA A;  2O4H A;  4E2A A;  4HKF A;  4B11 A;  4B6Z A;  2B3V A;  3FEC A;  1V0C A;  1ELL P;  4G1P A;  1XFO A;  1CJW A;  5ELY A;  4CS0 B;  3F0A A;  2AFM A;  3PZJ A;  5LYL A;  2F7V A;  1XJO A;  2PJ8 A;  1X10 A;  2PCU A;  3WT4 A;  3IEH A;  4UEF A;  3R9G A;  1S7N A;  4PXD A;  3W6S A;  1ZG7 A;  2PR1 A;  2DEA A;  2GIV A;  1CPX A;  3TOA A;  2CXA A;  2PJC A;  5LRK A;  4PPZ A;  1M44 A;  2C27 A;  2KCW A;  4MHD A;  3B35 A;  4KS9 A;  5J8F A;  4MFZ A;  3SI2 A;  3H8G A;  5KTA A;  1B6B A;  2POK A;  4UCP A;  4CAW A;  2AJ6 A;  2QIR A;  1TKJ A;  4ZX9 A;  2ZW5 A;  4OC4 A;  2WSA A;  2FL4 A;  4Q38 A;  4OKO A;  3SHP A;  1L0C A;  1KUV A;  4AXV A;  3B8G A;  1XBU A;  3I3G A;  1MJA A;  2ZEF A;  1LCP A;  2R98 A;  2VBQ A;  3BHX A;  3CXQ A;  1HDQ A;  4J3G A;  2Q43 A;  3NFZ A;  4XPL A;  2PJA A;  2NYQ A;  4P4J A;  2GRE A;  2C6C A;  4FD7 A;  5I0C A;  4OAE A;  4FD4 A;  4CRZ B;  2F5I A;  4PK2 A;  4E0A A;  4FD5 A;  2QVP A;  1M4G A;  4IHM A;  4JZ0 A;  1NSA A;  2WYR A;  4KOT A;  2FT0 A;  2Z3N A;  4DUK A;  4R76 A;  1ZG8 A;  4B14 A;  1YLO A;  4BBH A;  1PUA A;  3GYA A;  2R1I A;  3GKR A;  5LRJ A;  2CIJ A;  3PB8 X;  1IID A;  4NSQ A;  1BLL E;  2REE A;  3D3S A;  1K4J A;  2V8G A;  3FED A;  3LD2 A;  4YRH A;  2PIY A;  3L2N A;  4HNY B;  1YW4 A;  4CGM A;  4FBE A;  4B5P B;  2B4B A;  2PJ3 A;  2AFU A;  4C2Z A;  5IB0 A;  3SI0 A;  4FWU A;  4Y49 B;  2FS5 A;  4UEE A;  3D7F A;  3MRU A;  2Z0Z A;  1PU9 A;  3ISZ A;  4NGT A;  4Q36 A;  3EXN A;  1YR0 A;  5I4M A;  3DR6 A;  3TO6 A;  4GM5 A;  3TCV A;  4R6T A;  3S6H A;  4CYP A;  4I49 A;  2PC1 A;  1M4I A;  1XE4 A;  2J8M A;  3SJF A;  4KUB A;  1P4N A;  3TOB A;  7CPA A;  1JWQ A;  3ZZI A;  5JGF A;  2AFW A;  2D4O A;  3EC4 A;  1S7K A;  2CNS A;  3F5B A;  3PFE A;  4ONU A;  2BCO A;  4B5O A;  3T90 A;  2J8N A;  2ZED A;  5F47 A;  1OBR A;  1GHE A;  4JLY A;  1P0H A;  1XOV A;  1R43 A;  2PE3 A;  1LAN A;  4CYQ A;  3B3S A;  4OLL A;  1PYT B;  4UEZ A;  2WPX A;  2PVV A;  2VQY A;  4AVC A;  1FNO A;  1FT7 A;  3VH9 A;  5J8C A;  3FJU A;  3SJE A;  3NH8 A;  1NE9 A;  1LFW A;  4KVO E;  1IOI A;  4UA3 A;  4CYN A;  1I21 A;  4EME A;  4Y49 C;  5LYI A;  1CX8 A;  2O53 A;  3GY9 A;  2PDO A;  2JLM A;  2NMT A;  5H86 A;  3K2K A;  5KTD A;  3FYN A;  4M6I A;  3SJX A;  2Z3L A;  3PB6 X;  5D29 A;  1Y7R A;  4M6G A;  2JBK A;  4OP4 A;  1CBX A;  4U9Z A;  3UY5 A;  1BPM A;  4OC1 A;  4F9U A;  2PJ5 A;  1IGB A;  3G8W A;  3H5Z A;  4H89 A;  4NJR A;  3H8E A;  4A94 A;  2BUE A;  4QVT A;  2B5G A;  4DJL A;  4O23 A;  1ZO0 A;  4UF4 A;  1WK4 A;  2NSM A;  3BJ7 A;  3NE7 A;  3S9M A;  6CPA A;  3ZJ0 A;  2F8H A;  2FIW A;  4ZY2 A;  3KHZ A;  4A31 A;  3N5F A;  4MCQ A;  4PXB A;  4FUU A;  3PGP A;  3HUV A;  4R3K A;  4KOX A;  5EBV A;  3WAB A;  3NA6 A;  4KSI A;  1IYK A;  3ISX A;  5F46 A;  2BEI A;  3FRM A;  3JTK A;  2PRQ A;  4PXE A;  2G3A A;  2P6F A;  1M1D A;  4LQG A;  4C2X A;  4OC5 A;  4OC0 A;  4CAX A;  1RTQ A;  2JEV A;  2EBJ A;  5G20 A;  4ORF A;  3D7H A;  3TE4 A;  3IGR A;  3QAY A;  2Q04 A;  1KUY A;  4AG7 A;  4C68 A;  4FAI A;  4EVY A;  3EFA A;  4NFR A;  1KWM A;  4MMO A;  3V38 A;  3RYO A;  4ZY1 A;  2QYV A;  1U6M A;  2ZEL A;  1YME A;  1Z8X A;  2ZW6 A;  3PB4 X;  3FEE A;  3IWW A;  4P6Y A;  4PXC A;  1QSN A;  3V7Z A;  4YWY A;  4GXH A;  2DPS A;  5AG6 A;  4YFJ A;  1BAV A;  1NSL A;  5HVH A;  2B3U A;  2P6G A;  2ZEH A;  4CAE A;  4ZYQ A;  1VGY A;  1ZLH A;  2Q7B A;  4MFJ A;  4F8Z A;  4MRI A;  2I3C A;  4KUA A;  3FB3 A;  4JYW A;  1QSO A;  2B4D B;  4KOU A;  1R57 A;  1TIQ A;  1YSJ A;  3TFY A;  1TKH A;  5LYD A;  3W6X A;  4AVA A;  4DYO A;  4NCZ A;  1IIC A;  4MJ8 A;  4P10 A;  1N71 A;  3S6K A;  2GLJ A;  1Z8L A;  2HQY A;  1RO5 A;  4MFL A;  4MXU A;  2WUU A;  3B3T A;  1TKF A;  2HV2 A;  1Z8T A;  3EY5 A;  4H6Z A;  4MFK A;  3KHX A;  2VZY A;  4F9V A;  1CM0 A;  3PRT A;  4KLW A;  4XPK A;  4Q7A A;  1M4D A;  2ZEP A;  5G22 A;  2EVN A;  3SJG A;  4UFW A;  5F49 A;  5JQ4 A;  5G21 A;  3VAR A;  5IB9 A;  5HVF A;  2REF A;  3JVN A;  1Q2C A;  3R96 A;  4CGP A;  4MHN A;  3LWU A;  3I1U A;  4CAV A;  2ZXV A;  5A27 A;  2CF4 A;  1A2Z A;  1VIX A;  5IV0 A;  4P4D A;  3VWE A;  2V8D A;  1MJ9 A;  2B4D A;  2FXF A;  4LQ6 A;  4ZBG A;  3DGV A;  4RN7 A;  4B12 A;  1Q2Y A;  4RI1 A;  3IFE A;  2OOT A;  2RFH A;  4IUS A;  3HLP A;  3DR8 A;  2J8R A; 
#chains in the Genus database with same CATH homology
 1IOF A;  1Z8X A;  1Z8T A;  1IU8 A;  1X10 A;  3GIU A;  4GXH A;  1IOI A;  3LAC A;  3RNZ A;  1Z8W A;  3RO0 A;  1A2Z A;  1X12 A;  2EBJ A;  2EO8 A;  1AUG A;  4HPS A;  2DF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...