1X12A

Structure of mutant pyrrolidone carboxyl peptidase (e192d) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
b'MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMDLEAVKVAIEVALEELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1x12A00
1IU8A 3GIUA 3RO0A 1Z8TA 3RNZA 1IOFA 1X10A 1Z8XA 2EBJA 1X12A 4GXHA 2EO8A 1A2ZA 2DF5A 1AUGA 1IOIA 3LACA 4HPSA 1Z8WA
chains in the Genus database with same CATH superfamily
4MMOA 2PJ8A 4P4IA 4CYOA 2J8RA 4FWUA 4UWJA 3GUXA 2JEWA 4AVBA 1SQHA 2CIJA 2V8GA 2VXKA 2ZENA 4OP4A 1YW4A 3D2PA 1KUXA 4UIAA 4KVME 4ZBGA 1Z8TA 3CDXA 5HXDA 4ONWA 1Q2CA 3QAHA 3F0AA 3NH4A 4HNXB 2XEGA 2I79A 2ZEFA 2BL1A 4OIWA 1ELLP 2PJ7A 1YQEA 3PB4X 3PBBA 4NF1A 4AXVA 2PJ3A 4L89A 2NMTA 2Z3MA 3PB7X 1RO5A 1XBUA 1Z2LA 2Z3PA 1LAMA 1CPXA 4MCRA 4PQAA 4HKFA 1N71A 2ZOGA 5JQ4A 2KCWA 4O23A 2F7VA 2VEZA 3KI9A 2OB0A 1S7FA 4OLLA 2PVWA 4CRYB 4KOXA 4K30A 4KOUA 2X7BA 2Q04A 2WUUA 3MGDA 5LYDA 1Y9KA 4OKOA 3PB8X 2CNTA 3LMSA 2GANA 2WSAA 4FD4A 3WABA 4JZ0A 1CG2A 1U6MA 1LFWA 1CP6A 5K8OA 2IQ6A 3I3GA 4MY3A 1ZLHA 2DXQA 2ZEOA 3S6KA 4YRHA 4BBHA 2CY2A 2EO8A 3V38A 4UFVA 4KLWA 4OAEA 3B3WA 3PB6X 1NSAA 4YWYA 3LACA 4A94A 1F2PA 1VHOA 3CXSA 4GS4A 1TKFA 2P6EA 4A95A 2FT0A 3BJ7A 4KOTA 1Z8WA 1FY7A 3FX6A 1IU8A 2AFWA 1Z8LA 1TIQA 3GIUA 4ZGYB 4ONUA 4ZY1A 4KOSA 2ZW4A 3FEDA 1V0CA 4F0XA 4Q7AA 4UEFA 4II9A 3IWWA 1KZFA 4MY0A 3RAMA 5J8FA 1Z4EA 3NH8A 3F8KA 4LUAA 1XRYA 4TNUA 1TF8A 2YNEA 4MHDA 2ZW5A 4OIDA 4CGPA 2AFMA 4NGPA 2D4PA 4P4JA 5C88A 4PXBA 1WWZA 3FH4A 1LOKA 5G21A 5EC4A 2Z3LA 3B8GA 4B10A 1S7LA 1Q2DA 4NGNA 3T90A 1S60A 1B6BA 1P0HA 3FNCA 2F8HA 4H6ZA 5CPAA 1Y0RA 4OADA 5AG5A 3WR7A 4UWIA 1BPNA 2ATRA 4KVXA 7CPAA 3G3SA 1XFOA 5LYLA 1ON0A 5LYFA 3R96A 5DS0A 5ELYA 1M1DA 3B2YA 1X10A 2B4BA 4UEZA 4ZX9A 2PJBA 1ZO0A 2EBJA 2PR8A 3ISXA 3TO6A 2ZW7A 4C2ZA 3KR5A 5AGEA 2G3TA 4UCPA 4MCPA 3IGRA 4HNWB 4MRIA 2B5GB 3NH5A 3BI1A 2HB6A 1Y7RA 2XEFA 2YNCA 3TTHA 4P45A 5I4MA 5KTAA 4UEEA 3S9MA 2PIYA 4CPAA 4B11A 1M4LA 2A4NA 3GY9A 4CGMA 3B3TA 4OMEA 3EFAA 4IF5A 5DWMA 2OZUA 4UCNA 1Z4RA 5AG4A 2NSMA 4NJRA 1UFHA 1M4GA 2REEA 3F5BA 3B3SA 2HV2A 2FIWA 3HUVA 4NFRA 3ZZIA 4ORFA 2QMLA 3EXNA 2JEVA 5G20A 4A37A 4F8ZA 4R3KA 4P10A 5CBMA 1IY7A 1MJBA 4OC5A 1BOBA 1CPSA 1F57A 2CXAA 1QSRA 3R9EA 5J8CA 5LRKA 4UIBA 1MJ9A 2C6CA 4M6GA 4F9VA 5J1QA 3NFZA 1PYTB 5AG6A 3CPAA 4A2ZA 4GM5A 3VWDA 1CX8A 3KR4A 1YSJA 4A31A 4A38A 4FD7A 1IOIA 1PCAA 4M6IA 2Z11A 3KASA 4PPZA 5FVJA 2J9AA 2PDOA 2PE3A 3MRUA 4OC1A 4P4BA 4EFDA 2BEIA 1IICA 4MHZA 4UA3A 5A28A 2YGWA 4RN7A 4BINA 4XPLA 4CRZB 5JH9A 3SHPA 3KGQA 3I9SA 1S7NA 5KTCA 3EO4A 4PXEA 4KOWA 4UFWA 4F9UA 1RXTA 2ABZA 3D4UA 2F5IA 4OC3A 4ZYQA 2QIRA 5JM6A 1Z8XA 4KSIA 3DSBA 3EY5A 2ZW6A 2FVGA 1TXRA 5EMIA 2PJCA 2HC9A 3IJ3A 3WC6A 3D7FA 2PJ1A 2GFQA 4JWPA 2REFA 1XE4A 3JVNA 4XPDC 3KQZA 2PJ4A 5HVGA 2BSWA 4YGOA 4C7IA 3VH9A 2D4OA 3SJFA 4HPSA 4IAVA 1QSTA 2FXFA 4WJBA 3FXTA 1Q7LA 4UF4A 1OBRA 4A39A 4MFZA 2ZEEA 3D2MA 4EMEA 4DUKA 4CAFA 1LANA 1IB1E 2CNSA 3N5FA 4P44A 1BO4A 4ZI6A 2PCUA 3CZXA 1P4NA 1IYLA 3RNZA 3H8FA 1CBXA 1I12A 1JWQA 2DEAA 2EK8A 3KHXA 2B3VA 2Z3OA 4XPDB 4M85A 1XIXA 4NGMA 4CAWA 2AFZA 1TKHA 1YX0A 3GB0A 4H2KA 4R57A 5F49A 3P2FA 3SJEA 1J4JA 2OU2A 3H8GA 3TO7A 4E0AA 3BI0A 1VIXA 2QYVA 3D8PA 2RC4A 3GYAA 1XMBA 2Q4VA 5IV0A 4FBEA 1XOVA 1DE4C 2BCOA 5F09A 2ARHA 2V8DA 3SXNA 4A30A 5GCNA 4MHNA 4KUBA 1NMTA 1RTQA 3S9NA 1S5KA 1EE3P 4MFQA 3G8WA 4IK2A 2R8VA 2DPSA 2I00A 2JBKA 4MXUA 2C6PA 3KHZA 1IIDA 4P4FA 4OC2A 4KZTA 5F48A 2Q4YA 1ZLIA 4FAIA 4X3RA 1BAVA 2JDDA 4MFLA 4A33A 2ZOFA 3IC1A 4LX9A 1KWMA 2BOAA 2VI7A 4Z65A 2Z3NA 3TC8A 2PVVA 3FIXA 3S6GA 4U9ZA 5CNPA 4DJLA 2ZEGA 3MN8A 4B14A 2ZEMA 3IIBA 3FF3A 4M6HA 3FBUA 1HDUA 5LRJA 3R9FA 4C2XA 4CAXA 4R8FA 3RO0A 4B5OA 3D67A 2PJAA 1M4IA 1XJOA 3B3VA 2Q4ZA 4I49A 1HDQA 4BD9A 4QBJA 3VWEA 1M44A 2I3CA 4NGSA 3SI2A 1YVKA 3C26A 4PV6A 4CYQA 3NE7A 2ZXVA 4NCZA 3TE4A 1QQ9A 2AE6A 4GXHA 1PUAA 3KQXA 1ARLA 4G1PA 4WWVA 4UBRA 1A2ZA 1KUVA 1NSLA 3LWUA 3B3CA 4W9YA 4A32A 4F6AA 3QAYA 4C68A 1YW6A 3CXQA 4AVAA 3RZAA 2JLMA 4B12A 3D66A 2IMOA 4EWTA 2PIZA 1K4JA 4MFJA 5ISVA 5G22A 3R9GA 4H89A 1GHEA 4KORA 2GE3A 4OC4A 4R3LA 4B5PA 3DGVA 4KSAA 2JBJA 2PJ0A 4U5YA 1BLLE 2B4DA 3FECA 4F0YA 2Q7SA 3D7HA 2GLFA 3GLJA 5EBVA 3BXMA 1ZG8A 2RFHA 4KLVA 4MHPA 2K5TA 2Q7BA 4C7HA 2EVNA 1YK3A 3JRUA 4JXQA 4EVYA 4MI4A 2G0BA 3P2HA 3DDDA 3PEIA 1QSOA 4K3NA 1Y0YA 2J8NA 1R57A 4KS9A 3KKWA 4NGTA 5E96A 3IO1A 5LYIA 4AG7A 2R7HA 5K8PA 2XEJA 4X2TA 3H4QA 2V8VA 4X8IA 4CAEA 2PSWA 2DPTA 1YMEA 1ZG9A 3W6SA 4DNCA 4KOYA 4NGQA 5H86A 3TOBA 2ZPAA 2POKA 3N7ZA 2ZEHA 4XNHC 2BUEA 3KL9A 3S6HA 3W6XA 2V8HA 4B6ZA 3GKRA 1VHSA 2Q44A 2AFOA 2O4HA 2QVPA 2VQYA 2O28A 1ZG7A 4PK2A 4L8AA 2G3AA 1KUYA 1AMPA 1LCPA 2RB7A 4M3SA 4YU9A 3SJXA 4Y49C 1VHEA 2B3UA 2FSRA 4MCSA 3FMCA 2OH1A 2OOTA 5K8NA 5I0CA 2IL4A 4FD6A 4ZY0A 3IEHA 1L0CA 4JJXA 5D8NA 3PBEA 3TO9A 2CNMA 3PZJA 5HVFA 1Y7EA 2JDCA 3VATA 1Z5RA 4XNHB 3RBUA 2OR4A 3FRMA 4PSWA 1VGYA 1XMTA 3K9TA 4TWEA 1M4DA 2R98A 2PJ6A 4PXCA 3CT9A 2CTBA 3PGPA 2HUZA 2VBQA 1AYEA 1Z9UA 4RI1A 4AG9A 3E0KA 4X5KA 1VKCA 3IU2A 4Y49B 4J3GA 5D29A 4RS2A 2PRQA 4JD6A 4OC0A 1QSNA 3D68A 4U9YA 1CJWA 4NEXA 3VARA 4CYPA 1TKJA 4MFPA 4CYNA 2C6GA 4RUHA 2EWBA 3T9YA 4B13A 5G1ZA 1NE9A 2FL4A 4R76A 3ZJ0A 4YFJA 1FT7A 5BWAB 4DYOA 3CPXA 2O53A 2QJ8A 3CXPA 4KOVA 4P4EA 4R87A 4ZX8A 1LRZA 5HVHA 3LODA 2PC1A 4IHMA 4UCMA 5JPHA 3FB3A 3IU1A 2WPXA 4JYWA 4R9MA 3T8WA 2OZGA 1FNOA 4KSFA 4QB9A 4E8OA 1I21A 4CS0B 4FD5A 1S7KA 3I1UA 2GREA 2NYQA 3H8EA 2C27A 3SI1A 2VL1A 3JUWA 3FVLA 3SXOA 3B7IA 2Q43A 4P6YA 3WC5A 4LQ6A 2V77A 2J8MA 1XEBA 1OZPA 1PU9A 1S3ZA 3BLNA 2Q0YA 3UY5A 4CGOA 2Z3KA 3TCVA 1MJAA 3TT2A 3D7DA 2ZEPA 5F46A 2XEIA 2YNDA 2EK9A 4QVTA 5F47A 1QSMA 3KZWA 3LD2A 2IJZA 2G9DA 1CM0A 5IX3A 3FYNA 2Q51A 2H5MA 1IGBA 1JQGA 2CTCA 3WC7A 3WT4A 2B5GA 4NXYA 4AVCA 4ZY2A 2WPWA 4MCQA 1R3NA 1ARMA 5DWNA 3V7ZA 3PRTA 3FJUA 4P4DA 2C1CA 3L2NA 3NA6A 5A27A 2PJ2A 2PQ8A 2VZYA 1B87A 3BHXA 4AB7A 2HQYA 3S9LA 1HEEA 1X12A 1LAPA 1F2OA 5AG7A 2GIVA 4PXDA 4UFXA 2FCKA 1R43A 1H8LA 4JXRA 2DF5A 1AUGA 5JGFA 2PRBA 4C2YA 1YLEA 3RYOA 3IFEA 1TF9A 3NE8A 4BMHA 3EC4A 4Q38A 3DR8A 3PP9A 4H6UA 2WYRA 2WZNA 3DNSA 4QUSA 2FIAA 1Q2YA 4QC6A 3A9LA 3FEEA 3HLPA 4R7MA 1ELMP 3D7GA 4CAVA 1I1DA 3TFYA 4KUAA 5HH1A 3R95A 5C82A 2P0WA 2Z10A 3TX8A 1MK4A 2QECA 2Z0ZA 4HNYB 5HMNA 3OWCA 2B58A 2GU2A 2FS5A 2YNCC 3K9UA 4XPKA 3IWEA 1CP7A 3JTKA 1IYKA 4PSXA 4IUSA 2ZELA 4MFKA 3D3SA 2AFSA 4R6TA 4CGLA 1YGHA 2PJ9A 3QB8A 3DR6A 5KTDA 4MJ8A 3QNVA 4LQGA 4Q36A 1GYTA 3W91A 3ISZA 4MBUA 4CGNA 1UWYA 2OZHA 4NSQA 2AJ6A 4NGRA 1YVOA 2AFUA 5LRGA 2AFXA 4FUUA 3R1KA 2CF4A 1XF8A 2ANPA 2FE7A 2ZEDA 3SI0A 3TOAA 1IOFA 3B35A 1YREA 3DLJA 2GLJA 5IB0A 3K2KA 8CPAA 3S6FA 2PJ5A 4E2AA 2ODFA 3PFEA 3H5ZA 1WK4A 2PR1A 1YR0A 4KVOE 1Y9WA 1DTDA 2BO9A 3BJ8A 2P6FA 5IB9A 3V8IA 6CPAA 1YLOA 3PFOA 3SJGA 4MHYA 3IWGA 1BPMA 2R1IA 4JLYA 2VZZA 2EUIA 4B5PB 2Y0MA 2P6GA 5K8MA 3PB9X 4NJQA 4PK3A 2B4DB 5THWA 5H84A 1QMUA
chains in the Genus database with same CATH topology
1IU8A 3GIUA 3RO0A 1Z8TA 3RNZA 1IOFA 1X10A 1Z8XA 2EBJA 1X12A 4GXHA 2EO8A 1A2ZA 2DF5A 1AUGA 1IOIA 3LACA 4HPSA 1Z8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IU8 A;  3GIU A;  3RO0 A;  1Z8T A;  3RNZ A;  1IOF A;  1X10 A;  1Z8X A;  2EBJ A;  1X12 A;  4GXH A;  2EO8 A;  1A2Z A;  2DF5 A;  1AUG A;  1IOI A;  3LAC A;  4HPS A;  1Z8W A; 
#chains in the Genus database with same CATH topology
 4MMO A;  2PJ8 A;  4P4I A;  4CYO A;  2J8R A;  4FWU A;  4UWJ A;  3GUX A;  2JEW A;  4AVB A;  1SQH A;  2CIJ A;  2V8G A;  2VXK A;  2ZEN A;  4OP4 A;  1YW4 A;  3D2P A;  1KUX A;  4UIA A;  4KVM E;  4ZBG A;  1Z8T A;  3CDX A;  5HXD A;  4ONW A;  1Q2C A;  3QAH A;  3F0A A;  3NH4 A;  4HNX B;  2XEG A;  2I79 A;  2ZEF A;  2BL1 A;  4OIW A;  1ELL P;  2PJ7 A;  1YQE A;  3PB4 X;  3PBB A;  4NF1 A;  4AXV A;  2PJ3 A;  4L89 A;  2NMT A;  2Z3M A;  3PB7 X;  1RO5 A;  1XBU A;  1Z2L A;  2Z3P A;  1LAM A;  1CPX A;  4MCR A;  4PQA A;  4HKF A;  1N71 A;  2ZOG A;  5JQ4 A;  2KCW A;  4O23 A;  2F7V A;  2VEZ A;  3KI9 A;  2OB0 A;  1S7F A;  4OLL A;  2PVW A;  4CRY B;  4KOX A;  4K30 A;  4KOU A;  2X7B A;  2Q04 A;  2WUU A;  3MGD A;  5LYD A;  1Y9K A;  4OKO A;  3PB8 X;  2CNT A;  3LMS A;  2GAN A;  2WSA A;  4FD4 A;  3WAB A;  4JZ0 A;  1CG2 A;  1U6M A;  1LFW A;  1CP6 A;  5K8O A;  2IQ6 A;  3I3G A;  4MY3 A;  1ZLH A;  2DXQ A;  2ZEO A;  3S6K A;  4YRH A;  4BBH A;  2CY2 A;  2EO8 A;  3V38 A;  4UFV A;  4KLW A;  4OAE A;  3B3W A;  3PB6 X;  1NSA A;  4YWY A;  3LAC A;  4A94 A;  1F2P A;  1VHO A;  3CXS A;  4GS4 A;  1TKF A;  2P6E A;  4A95 A;  2FT0 A;  3BJ7 A;  4KOT A;  1Z8W A;  1FY7 A;  3FX6 A;  1IU8 A;  2AFW A;  1Z8L A;  1TIQ A;  3GIU A;  4ZGY B;  4ONU A;  4ZY1 A;  4KOS A;  2ZW4 A;  3FED A;  1V0C A;  4F0X A;  4Q7A A;  4UEF A;  4II9 A;  3IWW A;  1KZF A;  4MY0 A;  3RAM A;  5J8F A;  1Z4E A;  3NH8 A;  3F8K A;  4LUA A;  1XRY A;  4TNU A;  1TF8 A;  2YNE A;  4MHD A;  2ZW5 A;  4OID A;  4CGP A;  2AFM A;  4NGP A;  2D4P A;  4P4J A;  5C88 A;  4PXB A;  1WWZ A;  3FH4 A;  1LOK A;  5G21 A;  5EC4 A;  2Z3L A;  3B8G A;  4B10 A;  1S7L A;  1Q2D A;  4NGN A;  3T90 A;  1S60 A;  1B6B A;  1P0H A;  3FNC A;  2F8H A;  4H6Z A;  5CPA A;  1Y0R A;  4OAD A;  5AG5 A;  3WR7 A;  4UWI A;  1BPN A;  2ATR A;  4KVX A;  7CPA A;  3G3S A;  1XFO A;  5LYL A;  1ON0 A;  5LYF A;  3R96 A;  5DS0 A;  5ELY A;  1M1D A;  3B2Y A;  1X10 A;  2B4B A;  4UEZ A;  4ZX9 A;  2PJB A;  1ZO0 A;  2EBJ A;  2PR8 A;  3ISX A;  3TO6 A;  2ZW7 A;  4C2Z A;  3KR5 A;  5AGE A;  2G3T A;  4UCP A;  4MCP A;  3IGR A;  4HNW B;  4MRI A;  2B5G B;  3NH5 A;  3BI1 A;  2HB6 A;  1Y7R A;  2XEF A;  2YNC A;  3TTH A;  4P45 A;  5I4M A;  5KTA A;  4UEE A;  3S9M A;  2PIY A;  4CPA A;  4B11 A;  1M4L A;  2A4N A;  3GY9 A;  4CGM A;  3B3T A;  4OME A;  3EFA A;  4IF5 A;  5DWM A;  2OZU A;  4UCN A;  1Z4R A;  5AG4 A;  2NSM A;  4NJR A;  1UFH A;  1M4G A;  2REE A;  3F5B A;  3B3S A;  2HV2 A;  2FIW A;  3HUV A;  4NFR A;  3ZZI A;  4ORF A;  2QML A;  3EXN A;  2JEV A;  5G20 A;  4A37 A;  4F8Z A;  4R3K A;  4P10 A;  5CBM A;  1IY7 A;  1MJB A;  4OC5 A;  1BOB A;  1CPS A;  1F57 A;  2CXA A;  1QSR A;  3R9E A;  5J8C A;  5LRK A;  4UIB A;  1MJ9 A;  2C6C A;  4M6G A;  4F9V A;  5J1Q A;  3NFZ A;  1PYT B;  5AG6 A;  3CPA A;  4A2Z A;  4GM5 A;  3VWD A;  1CX8 A;  3KR4 A;  1YSJ A;  4A31 A;  4A38 A;  4FD7 A;  1IOI A;  1PCA A;  4M6I A;  2Z11 A;  3KAS A;  4PPZ A;  5FVJ A;  2J9A A;  2PDO A;  2PE3 A;  3MRU A;  4OC1 A;  4P4B A;  4EFD A;  2BEI A;  1IIC A;  4MHZ A;  4UA3 A;  5A28 A;  2YGW A;  4RN7 A;  4BIN A;  4XPL A;  4CRZ B;  5JH9 A;  3SHP A;  3KGQ A;  3I9S A;  1S7N A;  5KTC A;  3EO4 A;  4PXE A;  4KOW A;  4UFW A;  4F9U A;  1RXT A;  2ABZ A;  3D4U A;  2F5I A;  4OC3 A;  4ZYQ A;  2QIR A;  5JM6 A;  1Z8X A;  4KSI A;  3DSB A;  3EY5 A;  2ZW6 A;  2FVG A;  1TXR A;  5EMI A;  2PJC A;  2HC9 A;  3IJ3 A;  3WC6 A;  3D7F A;  2PJ1 A;  2GFQ A;  4JWP A;  2REF A;  1XE4 A;  3JVN A;  4XPD C;  3KQZ A;  2PJ4 A;  5HVG A;  2BSW A;  4YGO A;  4C7I A;  3VH9 A;  2D4O A;  3SJF A;  4HPS A;  4IAV A;  1QST A;  2FXF A;  4WJB A;  3FXT A;  1Q7L A;  4UF4 A;  1OBR A;  4A39 A;  4MFZ A;  2ZEE A;  3D2M A;  4EME A;  4DUK A;  4CAF A;  1LAN A;  1IB1 E;  2CNS A;  3N5F A;  4P44 A;  1BO4 A;  4ZI6 A;  2PCU A;  3CZX A;  1P4N A;  1IYL A;  3RNZ A;  3H8F A;  1CBX A;  1I12 A;  1JWQ A;  2DEA A;  2EK8 A;  3KHX A;  2B3V A;  2Z3O A;  4XPD B;  4M85 A;  1XIX A;  4NGM A;  4CAW A;  2AFZ A;  1TKH A;  1YX0 A;  3GB0 A;  4H2K A;  4R57 A;  5F49 A;  3P2F A;  3SJE A;  1J4J A;  2OU2 A;  3H8G A;  3TO7 A;  4E0A A;  3BI0 A;  1VIX A;  2QYV A;  3D8P A;  2RC4 A;  3GYA A;  1XMB A;  2Q4V A;  5IV0 A;  4FBE A;  1XOV A;  1DE4 C;  2BCO A;  5F09 A;  2ARH A;  2V8D A;  3SXN A;  4A30 A;  5GCN A;  4MHN A;  4KUB A;  1NMT A;  1RTQ A;  3S9N A;  1S5K A;  1EE3 P;  4MFQ A;  3G8W A;  4IK2 A;  2R8V A;  2DPS A;  2I00 A;  2JBK A;  4MXU A;  2C6P A;  3KHZ A;  1IID A;  4P4F A;  4OC2 A;  4KZT A;  5F48 A;  2Q4Y A;  1ZLI A;  4FAI A;  4X3R A;  1BAV A;  2JDD A;  4MFL A;  4A33 A;  2ZOF A;  3IC1 A;  4LX9 A;  1KWM A;  2BOA A;  2VI7 A;  4Z65 A;  2Z3N A;  3TC8 A;  2PVV A;  3FIX A;  3S6G A;  4U9Z A;  5CNP A;  4DJL A;  2ZEG A;  3MN8 A;  4B14 A;  2ZEM A;  3IIB A;  3FF3 A;  4M6H A;  3FBU A;  1HDU A;  5LRJ A;  3R9F A;  4C2X A;  4CAX A;  4R8F A;  3RO0 A;  4B5O A;  3D67 A;  2PJA A;  1M4I A;  1XJO A;  3B3V A;  2Q4Z A;  4I49 A;  1HDQ A;  4BD9 A;  4QBJ A;  3VWE A;  1M44 A;  2I3C A;  4NGS A;  3SI2 A;  1YVK A;  3C26 A;  4PV6 A;  4CYQ A;  3NE7 A;  2ZXV A;  4NCZ A;  3TE4 A;  1QQ9 A;  2AE6 A;  4GXH A;  1PUA A;  3KQX A;  1ARL A;  4G1P A;  4WWV A;  4UBR A;  1A2Z A;  1KUV A;  1NSL A;  3LWU A;  3B3C A;  4W9Y A;  4A32 A;  4F6A A;  3QAY A;  4C68 A;  1YW6 A;  3CXQ A;  4AVA A;  3RZA A;  2JLM A;  4B12 A;  3D66 A;  2IMO A;  4EWT A;  2PIZ A;  1K4J A;  4MFJ A;  5ISV A;  5G22 A;  3R9G A;  4H89 A;  1GHE A;  4KOR A;  2GE3 A;  4OC4 A;  4R3L A;  4B5P A;  3DGV A;  4KSA A;  2JBJ A;  2PJ0 A;  4U5Y A;  1BLL E;  2B4D A;  3FEC A;  4F0Y A;  2Q7S A;  3D7H A;  2GLF A;  3GLJ A;  5EBV A;  3BXM A;  1ZG8 A;  2RFH A;  4KLV A;  4MHP A;  2K5T A;  2Q7B A;  4C7H A;  2EVN A;  1YK3 A;  3JRU A;  4JXQ A;  4EVY A;  4MI4 A;  2G0B A;  3P2H A;  3DDD A;  3PEI A;  1QSO A;  4K3N A;  1Y0Y A;  2J8N A;  1R57 A;  4KS9 A;  3KKW A;  4NGT A;  5E96 A;  3IO1 A;  5LYI A;  4AG7 A;  2R7H A;  5K8P A;  2XEJ A;  4X2T A;  3H4Q A;  2V8V A;  4X8I A;  4CAE A;  2PSW A;  2DPT A;  1YME A;  1ZG9 A;  3W6S A;  4DNC A;  4KOY A;  4NGQ A;  5H86 A;  3TOB A;  2ZPA A;  2POK A;  3N7Z A;  2ZEH A;  4XNH C;  2BUE A;  3KL9 A;  3S6H A;  3W6X A;  2V8H A;  4B6Z A;  3GKR A;  1VHS A;  2Q44 A;  2AFO A;  2O4H A;  2QVP A;  2VQY A;  2O28 A;  1ZG7 A;  4PK2 A;  4L8A A;  2G3A A;  1KUY A;  1AMP A;  1LCP A;  2RB7 A;  4M3S A;  4YU9 A;  3SJX A;  4Y49 C;  1VHE A;  2B3U A;  2FSR A;  4MCS A;  3FMC A;  2OH1 A;  2OOT A;  5K8N A;  5I0C A;  2IL4 A;  4FD6 A;  4ZY0 A;  3IEH A;  1L0C A;  4JJX A;  5D8N A;  3PBE A;  3TO9 A;  2CNM A;  3PZJ A;  5HVF A;  1Y7E A;  2JDC A;  3VAT A;  1Z5R A;  4XNH B;  3RBU A;  2OR4 A;  3FRM A;  4PSW A;  1VGY A;  1XMT A;  3K9T A;  4TWE A;  1M4D A;  2R98 A;  2PJ6 A;  4PXC A;  3CT9 A;  2CTB A;  3PGP A;  2HUZ A;  2VBQ A;  1AYE A;  1Z9U A;  4RI1 A;  4AG9 A;  3E0K A;  4X5K A;  1VKC A;  3IU2 A;  4Y49 B;  4J3G A;  5D29 A;  4RS2 A;  2PRQ A;  4JD6 A;  4OC0 A;  1QSN A;  3D68 A;  4U9Y A;  1CJW A;  4NEX A;  3VAR A;  4CYP A;  1TKJ A;  4MFP A;  4CYN A;  2C6G A;  4RUH A;  2EWB A;  3T9Y A;  4B13 A;  5G1Z A;  1NE9 A;  2FL4 A;  4R76 A;  3ZJ0 A;  4YFJ A;  1FT7 A;  5BWA B;  4DYO A;  3CPX A;  2O53 A;  2QJ8 A;  3CXP A;  4KOV A;  4P4E A;  4R87 A;  4ZX8 A;  1LRZ A;  5HVH A;  3LOD A;  2PC1 A;  4IHM A;  4UCM A;  5JPH A;  3FB3 A;  3IU1 A;  2WPX A;  4JYW A;  4R9M A;  3T8W A;  2OZG A;  1FNO A;  4KSF A;  4QB9 A;  4E8O A;  1I21 A;  4CS0 B;  4FD5 A;  1S7K A;  3I1U A;  2GRE A;  2NYQ A;  3H8E A;  2C27 A;  3SI1 A;  2VL1 A;  3JUW A;  3FVL A;  3SXO A;  3B7I A;  2Q43 A;  4P6Y A;  3WC5 A;  4LQ6 A;  2V77 A;  2J8M A;  1XEB A;  1OZP A;  1PU9 A;  1S3Z A;  3BLN A;  2Q0Y A;  3UY5 A;  4CGO A;  2Z3K A;  3TCV A;  1MJA A;  3TT2 A;  3D7D A;  2ZEP A;  5F46 A;  2XEI A;  2YND A;  2EK9 A;  4QVT A;  5F47 A;  1QSM A;  3KZW A;  3LD2 A;  2IJZ A;  2G9D A;  1CM0 A;  5IX3 A;  3FYN A;  2Q51 A;  2H5M A;  1IGB A;  1JQG A;  2CTC A;  3WC7 A;  3WT4 A;  2B5G A;  4NXY A;  4AVC A;  4ZY2 A;  2WPW A;  4MCQ A;  1R3N A;  1ARM A;  5DWN A;  3V7Z A;  3PRT A;  3FJU A;  4P4D A;  2C1C A;  3L2N A;  3NA6 A;  5A27 A;  2PJ2 A;  2PQ8 A;  2VZY A;  1B87 A;  3BHX A;  4AB7 A;  2HQY A;  3S9L A;  1HEE A;  1X12 A;  1LAP A;  1F2O A;  5AG7 A;  2GIV A;  4PXD A;  4UFX A;  2FCK A;  1R43 A;  1H8L A;  4JXR A;  2DF5 A;  1AUG A;  5JGF A;  2PRB A;  4C2Y A;  1YLE A;  3RYO A;  3IFE A;  1TF9 A;  3NE8 A;  4BMH A;  3EC4 A;  4Q38 A;  3DR8 A;  3PP9 A;  4H6U A;  2WYR A;  2WZN A;  3DNS A;  4QUS A;  2FIA A;  1Q2Y A;  4QC6 A;  3A9L A;  3FEE A;  3HLP A;  4R7M A;  1ELM P;  3D7G A;  4CAV A;  1I1D A;  3TFY A;  4KUA A;  5HH1 A;  3R95 A;  5C82 A;  2P0W A;  2Z10 A;  3TX8 A;  1MK4 A;  2QEC A;  2Z0Z A;  4HNY B;  5HMN A;  3OWC A;  2B58 A;  2GU2 A;  2FS5 A;  2YNC C;  3K9U A;  4XPK A;  3IWE A;  1CP7 A;  3JTK A;  1IYK A;  4PSX A;  4IUS A;  2ZEL A;  4MFK A;  3D3S A;  2AFS A;  4R6T A;  4CGL A;  1YGH A;  2PJ9 A;  3QB8 A;  3DR6 A;  5KTD A;  4MJ8 A;  3QNV A;  4LQG A;  4Q36 A;  1GYT A;  3W91 A;  3ISZ A;  4MBU A;  4CGN A;  1UWY A;  2OZH A;  4NSQ A;  2AJ6 A;  4NGR A;  1YVO A;  2AFU A;  5LRG A;  2AFX A;  4FUU A;  3R1K A;  2CF4 A;  1XF8 A;  2ANP A;  2FE7 A;  2ZED A;  3SI0 A;  3TOA A;  1IOF A;  3B35 A;  1YRE A;  3DLJ A;  2GLJ A;  5IB0 A;  3K2K A;  8CPA A;  3S6F A;  2PJ5 A;  4E2A A;  2ODF A;  3PFE A;  3H5Z A;  1WK4 A;  2PR1 A;  1YR0 A;  4KVO E;  1Y9W A;  1DTD A;  2BO9 A;  3BJ8 A;  2P6F A;  5IB9 A;  3V8I A;  6CPA A;  1YLO A;  3PFO A;  3SJG A;  4MHY A;  3IWG A;  1BPM A;  2R1I A;  4JLY A;  2VZZ A;  2EUI A;  4B5P B;  2Y0M A;  2P6G A;  5K8M A;  3PB9 X;  4NJQ A;  4PK3 A;  2B4D B;  5THW A;  5H84 A;  1QMU A; 
#chains in the Genus database with same CATH homology
 1IU8 A;  3GIU A;  3RO0 A;  1Z8T A;  3RNZ A;  1IOF A;  1X10 A;  1Z8X A;  2EBJ A;  1X12 A;  4GXH A;  2EO8 A;  1A2Z A;  2DF5 A;  1AUG A;  1IOI A;  3LAC A;  4HPS A;  1Z8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...