1X12A

Structure of mutant pyrrolidone carboxyl peptidase (e192d) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
b'MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMDLEAVKVAIEVALEELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
molecule keywords Pyrrolidone-carboxylate peptidase
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1x12A00
4GXHA 1AUGA 1A2ZA 2DF5A 3RO0A 1Z8XA 3GIUA 1Z8TA 1X12A 3LACA 4HPSA 1X10A 1IOIA 2EBJA 2EO8A 1IU8A 1Z8WA 3RNZA 1IOFA
chains in the Genus database with same CATH superfamily
2C6GA 2OH1A 2XEFA 2JDCA 3B3CA 4CAEA 4ZYQA 1S3ZA 1QSNA 3IFEA 3T8WA 1MJ9A 3KR4A 2POKA 2I00A 3WR7A 2DF5A 1S7FA 3JTKA 2I3CA 5H84A 1GHEA 5HMNA 3H8EA 4FD6A 4MHZA 1GYTA 3KL9A 4KSFA 1YREA 3R95A 3CXSA 2DPSA 2BCOA 4KVOE 4NJRA 3DR6A 1YVOA 2Z0ZA 2HC9A 4NXYA 1IIDA 4TNUA 1VIXA 2B3VA 5J8CA 2PC1A 3PB7X 4MFPA 1UFHA 2VZYA 4MFLA 3RNZA 4R7MA 2C27A 4AVCA 3B35A 1U6MA 2B4DB 3S6FA 1Z8LA 1CP6A 1IYKA 4MRIA 4UWJA 4KUBA 2Q0YA 2AFWA 3NE7A 4CGPA 3NFZA 1XBUA 4R3KA 2DEAA 3JRUA 1YMEA 5D29A 3PFOA 1FNOA 1SQHA 2OR4A 4RS2A 1IYLA 2OZUA 3K9TA 5G21A 1RTQA 3IGRA 4O23A 1B6BA 3QNVA 3D2MA 4BD9A 4F9VA 1IGBA 3BXMA 3I9SA 5F46A 4UA3A 4NJQA 2Y0MA 2GLFA 3SJEA 2CF4A 4MFKA 3TX8A 2ZW5A 2Q7BA 3K2KA 3KHXA 1Y0YA 2PRQA 4OC1A 4OC5A 5HH1A 2CNSA 3PP9A 3TFYA 4X8IA 5G1ZA 1XEBA 3L2NA 3R96A 4MXUA 2CNMA 2AE6A 2Q04A 2QJ8A 4BINA 4EMEA 3TO7A 4CAXA 1EE3P 1ZLHA 2Z3KA 4G1PA 5KTDA 1Z8TA 3VH9A 2G3TA 3N7ZA 3QAYA 4L8AA 5KTCA 1PUAA 2VBQA 4OIWA 5IV0A 4A33A 2OU2A 5JGFA 4MY3A 3KI9A 5G20A 5BWAB 1YQEA 3CXQA 4M6IA 4PXBA 1CP7A 1X10A 2ZW7A 3KHZA 3TO6A 2WPXA 2X7BA 2AFOA 1IY7A 4F8ZA 4EFDA 1L0CA 4A95A 4H6UA 2FL4A 1AUGA 4XPDB 4OLLA 4Q7AA 1F2OA 3FXTA 4J3GA 1PU9A 3VWEA 2C6PA 3F8KA 4PXEA 4UEFA 3W6XA 3BJ8A 4UIAA 8CPAA 2R8VA 4KLWA 2CTCA 5J1QA 2O28A 2Z3OA 3H4QA 3N5FA 4OC4A 2J9AA 2HQYA 3S9NA 3SJXA 1KWMA 4A31A 2IL4A 1TIQA 1UWYA 3BLNA 4ONWA 4NGPA 4PQAA 3TT2A 3TE4A 2O53A 2V8VA 4UEZA 5DWNA 3B7IA 1IU8A 2P6EA 2KCWA 3EXNA 4KSAA 1XMBA 3H8FA 1IOFA 4MCPA 1VHSA 3V8IA 1S7NA 4M85A 3QAHA 3R1KA 3TC8A 4KSIA 2J8RA 4P45A 2F8HA 3RZAA 3IU1A 2QMLA 1Y0RA 1A2ZA 1XRYA 3EC4A 3R9EA 2HB6A 1LFWA 3G8WA 3TCVA 4CS0B 5KTAA 1KUYA 1R43A 1Z8XA 4OC0A 2CIJA 5AG4A 4F0YA 2GREA 2JDDA 3S6GA 4CRZB 1CBXA 3S9MA 2P0WA 1M4LA 2NYQA 1YLOA 4ZY2A 3MGDA 1VHEA 4K30A 4MFZA 5HVGA 3HUVA 2FXFA 2PE3A 4MBUA 4LQ6A 1YR0A 4KS9A 4PV6A 4NGRA 5IB0A 5AG7A 2REFA 5JQ4A 2ZW4A 4P44A 3TOAA 5A27A 2DXQA 4BMHA 1P0HA 4ZGYB 5I4MA 3QB8A 4XNHC 2Q4VA 2WPWA 2PJ3A 2ZOFA 1ELLP 2AJ6A 2F5IA 2Z3NA 3FECA 3SXOA 4B5PB 3DR8A 2A4NA 5H86A 4C2YA 4C68A 4JLYA 4KUAA 5ISVA 3P2HA 2PIYA 3DLJA 3LODA 3FRMA 4NGMA 4OC3A 3WC7A 4ZI6A 3SXNA 2PJ1A 2ZEDA 4HPSA 4GS4A 1QSOA 2H5MA 4B13A 2VZZA 5EC4A 2PJ4A 2PCUA 2Q4ZA 4CGOA 2XEIA 1BPNA 5AGEA 4A39A 3D7DA 1K4JA 5DS0A 4YRHA 3S6KA 4QBJA 4UWIA 1XMTA 2IQ6A 3FB3A 5LYLA 3ZJ0A 3PEIA 3GLJA 4R8FA 1AYEA 2B5GB 2GFQA 1KUVA 2V8HA 5K8NA 2B4BA 2G3AA 4PXCA 2PVWA 2IMOA 4ZX8A 1KZFA 1NE9A 3PRTA 1M4IA 2C6CA 4P4IA 4CGNA 1FY7A 1HEEA 2P6GA 1M4GA 2PDOA 4DJLA 4MJ8A 5IX3A 4KOTA 4M3SA 5JM6A 3PB4X 5CBMA 3LACA 1QSMA 2CNTA 4R9MA 2JLMA 4H2KA 4QC6A 5DWMA 4Q38A 2BOAA 5K8PA 2ANPA 1Y7EA 4NFRA 5HVHA 2JBJA 2Z3PA 5FVJA 1MJBA 5GCNA 2EBJA 1WWZA 3MRUA 4FD5A 4RI1A 3S9LA 3FBUA 4IAVA 4NGSA 3CT9A 4MHPA 4HKFA 4B11A 1I1DA 5AG6A 2EWBA 1KUXA 2IJZA 2D4PA 2GANA 2PJAA 5J8FA 1ZG9A 2FVGA 2QVPA 4X2TA 1LAPA 3JVNA 4UF4A 1TXRA 2PVVA 1BLLE 3IIBA 2YNEA 3FH4A 4LQGA 3F5BA 1M1DA 2PJBA 1TKHA 5F48A 3T9YA 5K8OA 2Q4YA 4P4JA 2F7VA 4B12A 2FS5A 3UY5A 2RB7A 3NA6A 1I21A 1DE4C 4UBRA 4JD6A 3W6SA 4FUUA 1ZG7A 1TKJA 5C88A 4OADA 1PCAA 2ZEHA 4AVBA 4Z65A 4TWEA 5CPAA 1Z4RA 4X3RA 3RYOA 1LAMA 2YGWA 3CDXA 4E0AA 2V8GA 3FEEA 4E8OA 1TF9A 2JEVA 4JJXA 5THWA 3RO0A 4LUAA 4U5YA 2GU2A 3A9LA 4KOVA 1Z5RA 3CPAA 1JQGA 2ZEFA 4NCZA 3D7GA 4MFQA 1IICA 1R57A 4Y49C 1NSLA 3CZXA 2REEA 3FNCA 2EK8A 4P4DA 5AG5A 2PJCA 1XIXA 1ARLA 3FYNA 3PGPA 5LRJA 1Q2CA 5ELYA 3PB8X 2OOTA 3T90A 4YU9A 4CYPA 1CPXA 4B5OA 3PBBA 4P10A 2AFSA 5CNPA 1NSAA 5EBVA 3WT4A 2GE3A 4DYOA 2G9DA 4B10A 4CGMA 2ZEEA 5F47A 3EY5A 2AFZA 1ARMA 5LYDA 3KR5A 3TTHA 4MHDA 2ZXVA 2Q51A 4ZY0A 4P4EA 5F49A 4CRYB 4MCQA 4XNHB 1CJWA 2DPTA 2R98A 4AVAA 3IWGA 3FIXA 1X12A 3EFAA 2WSAA 3KQXA 1S7LA 3PB9X 4KOSA 4OC2A 4A32A 4OIDA 1YW4A 4IK2A 4YFJA 1HDQA 1VHOA 3DSBA 3FMCA 2NSMA 4K3NA 1J4JA 1IB1E 3CPXA 1MK4A 1JWQA 4NSQA 4M6GA 4C2ZA 3VARA 4YWYA 2YNCC 3B8GA 2PSWA 4X5KA 3SHPA 4F6AA 2WUUA 2PJ7A 4NEXA 1S5KA 4WJBA 3D67A 2PJ6A 4R87A 4PSXA 3VATA 3LMSA 3PZJA 4CAFA 4UFVA 2PIZA 1CM0A 1F2PA 1YVKA 4PK3A 5D8NA 3B2YA 2Z11A 3DGVA 3D7FA 1M44A 1ON0A 4JYWA 2PJ9A 2ABZA 2QECA 4H6ZA 2ZELA 4KOXA 5HVFA 4R57A 4W9YA 4YGOA 4XPKA 4DNCA 4UCPA 1IOIA 2BUEA 2PJ8A 3B3WA 2B4DA 4FD7A 4GM5A 5LRGA 2Q43A 4P4BA 4PSWA 4A38A 3BJ7A 2VXKA 3D2PA 2VQYA 5LYIA 1QMUA 3R9GA 4P6YA 4GXHA 2ARHA 4QVTA 4H89A 4CYQA 4CPAA 4U9YA 3DNSA 3D4UA 2ZOGA 2BO9A 2GLJA 3P2FA 4EVYA 4NF1A 3FEDA 2Z10A 4I49A 1OBRA 4UCMA 3PFEA 2J8MA 5JH9A 1BO4A 1LRZA 2XEJA 4KLVA 2EUIA 4HNXB 1CPSA 3SI1A 1Q2YA 1WK4A 5K8MA 4CYOA 4OMEA 5IB9A 4KORA 1QQ9A 4WWVA 3D68A 4AXVA 4MHYA 2CTBA 2B3UA 4IHMA 3SI2A 1M4DA 3ISZA 4AG7A 3IWEA 3IWWA 4NGNA 3B3SA 1HDUA 4KOYA 2OB0A 1Z9UA 3VWDA 1H8LA 3TOBA 3H5ZA 2RC4A 1TKFA 3KASA 2Q7SA 4CAVA 3BI1A 4C2XA 1VKCA 4MFJA 4QB9A 2PJ0A 2ZEGA 1RO5A 1FT7A 3KGQA 5LYFA 2R1IA 2OZHA 1XFOA 2VEZA 4OP4A 2AFXA 2PR8A 4JXQA 2AFUA 2PQ8A 3V7ZA 4AB7A 1B87A 2BL1A 3D66A 3W91A 4E2AA 3K9UA 3GB0A 5JPHA 4R3LA 4MMOA 4ORFA 1QSRA 2PR1A 2HUZA 3MN8A 4JXRA 1LCPA 4RUHA 4MI4A 3IJ3A 4KVME 3RAMA 3D7HA 1Q2DA 1CG2A 1YSJA 4M6HA 4Y49B 4FD4A 4C7IA 4MY0A 4R76A 3WABA 4A37A 2RFHA 4U9ZA 5I0CA 4MHNA 2C1CA 1YK3A 3NE8A 1XJOA 2PJ5A 3SI0A 1R3NA 2WZNA 2O4HA 2FIWA 3FF3A 4QUSA 3GUXA 3FVLA 2ZEPA 4MCRA 3D8PA 3EO4A 7CPAA 2G0BA 4PK2A 2CY2A 2FT0A 2YNCA 2AFMA 2V8DA 2P6FA 3E0KA 3HLPA 4L89A 1S60A 4FBEA 1Y9KA 4F9UA 3GKRA 4UFXA 3V38A 2ZPAA 5G22A 1ZLIA 4ZBGA 4KZTA 5E96A 4CGLA 1BAVA 3WC6A 5C82A 3H8GA 4JWPA 3SJFA 4RN7A 2EK9A 1MJAA 2ODFA 3OWCA 3B3TA 1LANA 2PRBA 1XE4A 1Y7RA 2CXAA 2EO8A 2I79A 1QSTA 1AMPA 1ZG8A 3FJUA 3IEHA 2GIVA 2B58A 4HNWB 1ELMP 4ZY1A 2XEGA 4II9A 2JBKA 4HNYB 2BEIA 4A2ZA 3ISXA 2QYVA 3WC5A 1ZO0A 4P4FA 1I12A 4MCSA 2Q44A 3NH5A 2FCKA 2OZGA 3LD2A 1CX8A 2FE7A 3D3SA 2ZENA 3NH8A 3PB6X 1Z2LA 3S6HA 3TO9A 4C7HA 1BOBA 4R6TA 2V77A 3FX6A 3SJGA 4ONUA 4F0XA 1Y9WA 5HXDA 2JEWA 4B14A 2VI7A 1NMTA 5LRKA 1RXTA 4UEEA 3ZZIA 4FAIA 4XPDC 2FSRA 2Z3LA 1YW6A 2VL1A 3F0AA 4KOWA 2ATRA 4LX9A 1Z4EA 3KZWA 3GY9A 5EMIA 4OKOA 4B6ZA 4DUKA 4JZ0A 1TF8A 4XPLA 5F09A 4ZX9A 1P4NA 3IC1A 4FWUA 4IF5A 1BPMA 3IO1A 1YGHA 4PPZA 4PXDA 4B5PA 6CPAA 2D4OA 4NGTA 4KOUA 2Z3MA 3RBUA 1LOKA 2PJ2A 1YLEA 1OZPA 1PYTB 2YNDA 1N71A 3GIUA 3I3GA 1V0CA 4EWTA 2NMTA 4UCNA 3BHXA 4CAWA 3KQZA 3CXPA 1XOVA 3C26A 2QIRA 4A30A 1XF8A 1VGYA 2K5TA 3B3VA 3I1UA 3IU2A 4BBHA 1DTDA 3NH4A 4IUSA 2ZEMA 2J8NA 2R7HA 1S7KA 2ZEOA 3JUWA 4A94A 3R9FA 1Q7LA 2WYRA 3DDDA 1YX0A 2FIAA 4KVXA 2ZW6A 4OAEA 4Q36A 3GYAA 3KKWA 2EVNA 1Z8WA 3LWUA 5A28A 4CYNA 2HV2A 3PBEA 4UFWA 1F57A 3G3SA 4NGQA 4UIBA 2BSWA 4AG9A 2B5GA 3BI0A
chains in the Genus database with same CATH topology
4GXHA 1AUGA 1A2ZA 2DF5A 3RO0A 1Z8XA 3GIUA 1Z8TA 1X12A 3LACA 4HPSA 1X10A 1IOIA 2EBJA 2EO8A 1IU8A 1Z8WA 3RNZA 1IOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GXH A;  1AUG A;  1A2Z A;  2DF5 A;  3RO0 A;  1Z8X A;  3GIU A;  1Z8T A;  1X12 A;  3LAC A;  4HPS A;  1X10 A;  1IOI A;  2EBJ A;  2EO8 A;  1IU8 A;  1Z8W A;  3RNZ A;  1IOF A; 
#chains in the Genus database with same CATH topology
 2C6G A;  2OH1 A;  2XEF A;  2JDC A;  3B3C A;  4CAE A;  4ZYQ A;  1S3Z A;  1QSN A;  3IFE A;  3T8W A;  1MJ9 A;  3KR4 A;  2POK A;  2I00 A;  3WR7 A;  2DF5 A;  1S7F A;  3JTK A;  2I3C A;  5H84 A;  1GHE A;  5HMN A;  3H8E A;  4FD6 A;  4MHZ A;  1GYT A;  3KL9 A;  4KSF A;  1YRE A;  3R95 A;  3CXS A;  2DPS A;  2BCO A;  4KVO E;  4NJR A;  3DR6 A;  1YVO A;  2Z0Z A;  2HC9 A;  4NXY A;  1IID A;  4TNU A;  1VIX A;  2B3V A;  5J8C A;  2PC1 A;  3PB7 X;  4MFP A;  1UFH A;  2VZY A;  4MFL A;  3RNZ A;  4R7M A;  2C27 A;  4AVC A;  3B35 A;  1U6M A;  2B4D B;  3S6F A;  1Z8L A;  1CP6 A;  1IYK A;  4MRI A;  4UWJ A;  4KUB A;  2Q0Y A;  2AFW A;  3NE7 A;  4CGP A;  3NFZ A;  1XBU A;  4R3K A;  2DEA A;  3JRU A;  1YME A;  5D29 A;  3PFO A;  1FNO A;  1SQH A;  2OR4 A;  4RS2 A;  1IYL A;  2OZU A;  3K9T A;  5G21 A;  1RTQ A;  3IGR A;  4O23 A;  1B6B A;  3QNV A;  3D2M A;  4BD9 A;  4F9V A;  1IGB A;  3BXM A;  3I9S A;  5F46 A;  4UA3 A;  4NJQ A;  2Y0M A;  2GLF A;  3SJE A;  2CF4 A;  4MFK A;  3TX8 A;  2ZW5 A;  2Q7B A;  3K2K A;  3KHX A;  1Y0Y A;  2PRQ A;  4OC1 A;  4OC5 A;  5HH1 A;  2CNS A;  3PP9 A;  3TFY A;  4X8I A;  5G1Z A;  1XEB A;  3L2N A;  3R96 A;  4MXU A;  2CNM A;  2AE6 A;  2Q04 A;  2QJ8 A;  4BIN A;  4EME A;  3TO7 A;  4CAX A;  1EE3 P;  1ZLH A;  2Z3K A;  4G1P A;  5KTD A;  1Z8T A;  3VH9 A;  2G3T A;  3N7Z A;  3QAY A;  4L8A A;  5KTC A;  1PUA A;  2VBQ A;  4OIW A;  5IV0 A;  4A33 A;  2OU2 A;  5JGF A;  4MY3 A;  3KI9 A;  5G20 A;  5BWA B;  1YQE A;  3CXQ A;  4M6I A;  4PXB A;  1CP7 A;  1X10 A;  2ZW7 A;  3KHZ A;  3TO6 A;  2WPX A;  2X7B A;  2AFO A;  1IY7 A;  4F8Z A;  4EFD A;  1L0C A;  4A95 A;  4H6U A;  2FL4 A;  1AUG A;  4XPD B;  4OLL A;  4Q7A A;  1F2O A;  3FXT A;  4J3G A;  1PU9 A;  3VWE A;  2C6P A;  3F8K A;  4PXE A;  4UEF A;  3W6X A;  3BJ8 A;  4UIA A;  8CPA A;  2R8V A;  4KLW A;  2CTC A;  5J1Q A;  2O28 A;  2Z3O A;  3H4Q A;  3N5F A;  4OC4 A;  2J9A A;  2HQY A;  3S9N A;  3SJX A;  1KWM A;  4A31 A;  2IL4 A;  1TIQ A;  1UWY A;  3BLN A;  4ONW A;  4NGP A;  4PQA A;  3TT2 A;  3TE4 A;  2O53 A;  2V8V A;  4UEZ A;  5DWN A;  3B7I A;  1IU8 A;  2P6E A;  2KCW A;  3EXN A;  4KSA A;  1XMB A;  3H8F A;  1IOF A;  4MCP A;  1VHS A;  3V8I A;  1S7N A;  4M85 A;  3QAH A;  3R1K A;  3TC8 A;  4KSI A;  2J8R A;  4P45 A;  2F8H A;  3RZA A;  3IU1 A;  2QML A;  1Y0R A;  1A2Z A;  1XRY A;  3EC4 A;  3R9E A;  2HB6 A;  1LFW A;  3G8W A;  3TCV A;  4CS0 B;  5KTA A;  1KUY A;  1R43 A;  1Z8X A;  4OC0 A;  2CIJ A;  5AG4 A;  4F0Y A;  2GRE A;  2JDD A;  3S6G A;  4CRZ B;  1CBX A;  3S9M A;  2P0W A;  1M4L A;  2NYQ A;  1YLO A;  4ZY2 A;  3MGD A;  1VHE A;  4K30 A;  4MFZ A;  5HVG A;  3HUV A;  2FXF A;  2PE3 A;  4MBU A;  4LQ6 A;  1YR0 A;  4KS9 A;  4PV6 A;  4NGR A;  5IB0 A;  5AG7 A;  2REF A;  5JQ4 A;  2ZW4 A;  4P44 A;  3TOA A;  5A27 A;  2DXQ A;  4BMH A;  1P0H A;  4ZGY B;  5I4M A;  3QB8 A;  4XNH C;  2Q4V A;  2WPW A;  2PJ3 A;  2ZOF A;  1ELL P;  2AJ6 A;  2F5I A;  2Z3N A;  3FEC A;  3SXO A;  4B5P B;  3DR8 A;  2A4N A;  5H86 A;  4C2Y A;  4C68 A;  4JLY A;  4KUA A;  5ISV A;  3P2H A;  2PIY A;  3DLJ A;  3LOD A;  3FRM A;  4NGM A;  4OC3 A;  3WC7 A;  4ZI6 A;  3SXN A;  2PJ1 A;  2ZED A;  4HPS A;  4GS4 A;  1QSO A;  2H5M A;  4B13 A;  2VZZ A;  5EC4 A;  2PJ4 A;  2PCU A;  2Q4Z A;  4CGO A;  2XEI A;  1BPN A;  5AGE A;  4A39 A;  3D7D A;  1K4J A;  5DS0 A;  4YRH A;  3S6K A;  4QBJ A;  4UWI A;  1XMT A;  2IQ6 A;  3FB3 A;  5LYL A;  3ZJ0 A;  3PEI A;  3GLJ A;  4R8F A;  1AYE A;  2B5G B;  2GFQ A;  1KUV A;  2V8H A;  5K8N A;  2B4B A;  2G3A A;  4PXC A;  2PVW A;  2IMO A;  4ZX8 A;  1KZF A;  1NE9 A;  3PRT A;  1M4I A;  2C6C A;  4P4I A;  4CGN A;  1FY7 A;  1HEE A;  2P6G A;  1M4G A;  2PDO A;  4DJL A;  4MJ8 A;  5IX3 A;  4KOT A;  4M3S A;  5JM6 A;  3PB4 X;  5CBM A;  3LAC A;  1QSM A;  2CNT A;  4R9M A;  2JLM A;  4H2K A;  4QC6 A;  5DWM A;  4Q38 A;  2BOA A;  5K8P A;  2ANP A;  1Y7E A;  4NFR A;  5HVH A;  2JBJ A;  2Z3P A;  5FVJ A;  1MJB A;  5GCN A;  2EBJ A;  1WWZ A;  3MRU A;  4FD5 A;  4RI1 A;  3S9L A;  3FBU A;  4IAV A;  4NGS A;  3CT9 A;  4MHP A;  4HKF A;  4B11 A;  1I1D A;  5AG6 A;  2EWB A;  1KUX A;  2IJZ A;  2D4P A;  2GAN A;  2PJA A;  5J8F A;  1ZG9 A;  2FVG A;  2QVP A;  4X2T A;  1LAP A;  3JVN A;  4UF4 A;  1TXR A;  2PVV A;  1BLL E;  3IIB A;  2YNE A;  3FH4 A;  4LQG A;  3F5B A;  1M1D A;  2PJB A;  1TKH A;  5F48 A;  3T9Y A;  5K8O A;  2Q4Y A;  4P4J A;  2F7V A;  4B12 A;  2FS5 A;  3UY5 A;  2RB7 A;  3NA6 A;  1I21 A;  1DE4 C;  4UBR A;  4JD6 A;  3W6S A;  4FUU A;  1ZG7 A;  1TKJ A;  5C88 A;  4OAD A;  1PCA A;  2ZEH A;  4AVB A;  4Z65 A;  4TWE A;  5CPA A;  1Z4R A;  4X3R A;  3RYO A;  1LAM A;  2YGW A;  3CDX A;  4E0A A;  2V8G A;  3FEE A;  4E8O A;  1TF9 A;  2JEV A;  4JJX A;  5THW A;  3RO0 A;  4LUA A;  4U5Y A;  2GU2 A;  3A9L A;  4KOV A;  1Z5R A;  3CPA A;  1JQG A;  2ZEF A;  4NCZ A;  3D7G A;  4MFQ A;  1IIC A;  1R57 A;  4Y49 C;  1NSL A;  3CZX A;  2REE A;  3FNC A;  2EK8 A;  4P4D A;  5AG5 A;  2PJC A;  1XIX A;  1ARL A;  3FYN A;  3PGP A;  5LRJ A;  1Q2C A;  5ELY A;  3PB8 X;  2OOT A;  3T90 A;  4YU9 A;  4CYP A;  1CPX A;  4B5O A;  3PBB A;  4P10 A;  2AFS A;  5CNP A;  1NSA A;  5EBV A;  3WT4 A;  2GE3 A;  4DYO A;  2G9D A;  4B10 A;  4CGM A;  2ZEE A;  5F47 A;  3EY5 A;  2AFZ A;  1ARM A;  5LYD A;  3KR5 A;  3TTH A;  4MHD A;  2ZXV A;  2Q51 A;  4ZY0 A;  4P4E A;  5F49 A;  4CRY B;  4MCQ A;  4XNH B;  1CJW A;  2DPT A;  2R98 A;  4AVA A;  3IWG A;  3FIX A;  1X12 A;  3EFA A;  2WSA A;  3KQX A;  1S7L A;  3PB9 X;  4KOS A;  4OC2 A;  4A32 A;  4OID A;  1YW4 A;  4IK2 A;  4YFJ A;  1HDQ A;  1VHO A;  3DSB A;  3FMC A;  2NSM A;  4K3N A;  1J4J A;  1IB1 E;  3CPX A;  1MK4 A;  1JWQ A;  4NSQ A;  4M6G A;  4C2Z A;  3VAR A;  4YWY A;  2YNC C;  3B8G A;  2PSW A;  4X5K A;  3SHP A;  4F6A A;  2WUU A;  2PJ7 A;  4NEX A;  1S5K A;  4WJB A;  3D67 A;  2PJ6 A;  4R87 A;  4PSX A;  3VAT A;  3LMS A;  3PZJ A;  4CAF A;  4UFV A;  2PIZ A;  1CM0 A;  1F2P A;  1YVK A;  4PK3 A;  5D8N A;  3B2Y A;  2Z11 A;  3DGV A;  3D7F A;  1M44 A;  1ON0 A;  4JYW A;  2PJ9 A;  2ABZ A;  2QEC A;  4H6Z A;  2ZEL A;  4KOX A;  5HVF A;  4R57 A;  4W9Y A;  4YGO A;  4XPK A;  4DNC A;  4UCP A;  1IOI A;  2BUE A;  2PJ8 A;  3B3W A;  2B4D A;  4FD7 A;  4GM5 A;  5LRG A;  2Q43 A;  4P4B A;  4PSW A;  4A38 A;  3BJ7 A;  2VXK A;  3D2P A;  2VQY A;  5LYI A;  1QMU A;  3R9G A;  4P6Y A;  4GXH A;  2ARH A;  4QVT A;  4H89 A;  4CYQ A;  4CPA A;  4U9Y A;  3DNS A;  3D4U A;  2ZOG A;  2BO9 A;  2GLJ A;  3P2F A;  4EVY A;  4NF1 A;  3FED A;  2Z10 A;  4I49 A;  1OBR A;  4UCM A;  3PFE A;  2J8M A;  5JH9 A;  1BO4 A;  1LRZ A;  2XEJ A;  4KLV A;  2EUI A;  4HNX B;  1CPS A;  3SI1 A;  1Q2Y A;  1WK4 A;  5K8M A;  4CYO A;  4OME A;  5IB9 A;  4KOR A;  1QQ9 A;  4WWV A;  3D68 A;  4AXV A;  4MHY A;  2CTB A;  2B3U A;  4IHM A;  3SI2 A;  1M4D A;  3ISZ A;  4AG7 A;  3IWE A;  3IWW A;  4NGN A;  3B3S A;  1HDU A;  4KOY A;  2OB0 A;  1Z9U A;  3VWD A;  1H8L A;  3TOB A;  3H5Z A;  2RC4 A;  1TKF A;  3KAS A;  2Q7S A;  4CAV A;  3BI1 A;  4C2X A;  1VKC A;  4MFJ A;  4QB9 A;  2PJ0 A;  2ZEG A;  1RO5 A;  1FT7 A;  3KGQ A;  5LYF A;  2R1I A;  2OZH A;  1XFO A;  2VEZ A;  4OP4 A;  2AFX A;  2PR8 A;  4JXQ A;  2AFU A;  2PQ8 A;  3V7Z A;  4AB7 A;  1B87 A;  2BL1 A;  3D66 A;  3W91 A;  4E2A A;  3K9U A;  3GB0 A;  5JPH A;  4R3L A;  4MMO A;  4ORF A;  1QSR A;  2PR1 A;  2HUZ A;  3MN8 A;  4JXR A;  1LCP A;  4RUH A;  4MI4 A;  3IJ3 A;  4KVM E;  3RAM A;  3D7H A;  1Q2D A;  1CG2 A;  1YSJ A;  4M6H A;  4Y49 B;  4FD4 A;  4C7I A;  4MY0 A;  4R76 A;  3WAB A;  4A37 A;  2RFH A;  4U9Z A;  5I0C A;  4MHN A;  2C1C A;  1YK3 A;  3NE8 A;  1XJO A;  2PJ5 A;  3SI0 A;  1R3N A;  2WZN A;  2O4H A;  2FIW A;  3FF3 A;  4QUS A;  3GUX A;  3FVL A;  2ZEP A;  4MCR A;  3D8P A;  3EO4 A;  7CPA A;  2G0B A;  4PK2 A;  2CY2 A;  2FT0 A;  2YNC A;  2AFM A;  2V8D A;  2P6F A;  3E0K A;  3HLP A;  4L89 A;  1S60 A;  4FBE A;  1Y9K A;  4F9U A;  3GKR A;  4UFX A;  3V38 A;  2ZPA A;  5G22 A;  1ZLI A;  4ZBG A;  4KZT A;  5E96 A;  4CGL A;  1BAV A;  3WC6 A;  5C82 A;  3H8G A;  4JWP A;  3SJF A;  4RN7 A;  2EK9 A;  1MJA A;  2ODF A;  3OWC A;  3B3T A;  1LAN A;  2PRB A;  1XE4 A;  1Y7R A;  2CXA A;  2EO8 A;  2I79 A;  1QST A;  1AMP A;  1ZG8 A;  3FJU A;  3IEH A;  2GIV A;  2B58 A;  4HNW B;  1ELM P;  4ZY1 A;  2XEG A;  4II9 A;  2JBK A;  4HNY B;  2BEI A;  4A2Z A;  3ISX A;  2QYV A;  3WC5 A;  1ZO0 A;  4P4F A;  1I12 A;  4MCS A;  2Q44 A;  3NH5 A;  2FCK A;  2OZG A;  3LD2 A;  1CX8 A;  2FE7 A;  3D3S A;  2ZEN A;  3NH8 A;  3PB6 X;  1Z2L A;  3S6H A;  3TO9 A;  4C7H A;  1BOB A;  4R6T A;  2V77 A;  3FX6 A;  3SJG A;  4ONU A;  4F0X A;  1Y9W A;  5HXD A;  2JEW A;  4B14 A;  2VI7 A;  1NMT A;  5LRK A;  1RXT A;  4UEE A;  3ZZI A;  4FAI A;  4XPD C;  2FSR A;  2Z3L A;  1YW6 A;  2VL1 A;  3F0A A;  4KOW A;  2ATR A;  4LX9 A;  1Z4E A;  3KZW A;  3GY9 A;  5EMI A;  4OKO A;  4B6Z A;  4DUK A;  4JZ0 A;  1TF8 A;  4XPL A;  5F09 A;  4ZX9 A;  1P4N A;  3IC1 A;  4FWU A;  4IF5 A;  1BPM A;  3IO1 A;  1YGH A;  4PPZ A;  4PXD A;  4B5P A;  6CPA A;  2D4O A;  4NGT A;  4KOU A;  2Z3M A;  3RBU A;  1LOK A;  2PJ2 A;  1YLE A;  1OZP A;  1PYT B;  2YND A;  1N71 A;  3GIU A;  3I3G A;  1V0C A;  4EWT A;  2NMT A;  4UCN A;  3BHX A;  4CAW A;  3KQZ A;  3CXP A;  1XOV A;  3C26 A;  2QIR A;  4A30 A;  1XF8 A;  1VGY A;  2K5T A;  3B3V A;  3I1U A;  3IU2 A;  4BBH A;  1DTD A;  3NH4 A;  4IUS A;  2ZEM A;  2J8N A;  2R7H A;  1S7K A;  2ZEO A;  3JUW A;  4A94 A;  3R9F A;  1Q7L A;  2WYR A;  3DDD A;  1YX0 A;  2FIA A;  4KVX A;  2ZW6 A;  4OAE A;  4Q36 A;  3GYA A;  3KKW A;  2EVN A;  1Z8W A;  3LWU A;  5A28 A;  4CYN A;  2HV2 A;  3PBE A;  4UFW A;  1F57 A;  3G3S A;  4NGQ A;  4UIB A;  2BSW A;  4AG9 A;  2B5G A;  3BI0 A; 
#chains in the Genus database with same CATH homology
 4GXH A;  1AUG A;  1A2Z A;  2DF5 A;  3RO0 A;  1Z8X A;  3GIU A;  1Z8T A;  1X12 A;  3LAC A;  4HPS A;  1X10 A;  1IOI A;  2EBJ A;  2EO8 A;  1IU8 A;  1Z8W A;  3RNZ A;  1IOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...