1X1EA

Crystal structure of tt0495 protein from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
b'MERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title Crystal Structure of TT0495 protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 85
structure length 239
sequence length 239
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x1eA00
1LSOA 3H9UA 4J1SA 3HDHA 1I01A 3Q3CA 5KTKA 3D4PA 3KEQA 2OL4A 3QSGA 3E5RA 2G5CA 3D7LA 1SO8A 3RBVA 3RASA 3ZWXA 4HBGA 3VC7A 2OXIA 5L51A 4FDAA 1Y8QA 4YBZA 3O38A 2VOJA 4YRAA 4GBJA 3NUGA 3NTRA 2HAEA 1ADGA 2GLXA 2JCVA 1YDWA 3E82A 4KQXA 3WDSA 2X5JO 4L9RA 4TQGA 4JP2A 4AJ4A 2AW5A 1RM3A 3GDFA 2HK8A 3MJTA 2ZB3A 4J90A 3PPIA 1LDGA 2BH9A 4BV8A 1H6DA 2B5WA 3DBHB 3G49A 3RKUA 3KB6A 2DFVA 3NX4A 3W1VA 1B7GO 1DIAA 1DRVA 1P1JA 1CJCA 1Y8RB 3U4IA 3UOGA 5BSGA 4N7RA 4QXMA 1CWUA 3ICPA 4IQ0A 2I67A 1GUYA 3UF0A 2ZTLA 3W4JA 4N54A 3NAQA 3K5PA 1FMCA 2C2XA 4YWJA 4DVJA 3PQFA 1I3MA 1PWZA 2BF7A 3QA9A 4OSOA 2IYOA 3ZWVA 4CV1A 4DQUA 4B4VA 4IJUA 3WWYA 2ZQYA 2NU8A 1LDBA 4YAEA 2Q3EA 3DZBA 3KYCA 2LDBA 4BNVA 2W4QA 3ASUA 4ZU3A 3OJFA 5C3MA 5IXSA 1ML3A 3JQCA 5B37A 3BIOA 4HFMA 1PS8A 2O2YA 2V6GA 4AJOA 1FK8A 2YV2A 1SOWA 3C85A 3SEFA 2B35A 3KV3O 3AM4A 3NT5A 3TZKA 3HFSA 1EFLA 2VN8A 3BTVA 4OMUA 3AUAA 2HK9A 1FDVA 4LGVA 3U3XA 1UJMA 4CM4A 2NNLD 2HMSA 3VKUA 3FNHA 3WWZA 2V65A 4UREA 3OJEA 4HWKA 2GDZA 1LDMA 2P68A 4GGPA 2QRJA 1P77A 2DTXA 4ITUA 2JD0A 1UP6A 2VWPA 3SBOA 5CDYA 2RH8A 3W6ZA 3ETEA 4EEXA 1PJ3A 1ISIA 2X86A 3LYLA 4E12A 1XQ6A 3T7CA 1DAOA 3EHEA 1ZH8A 1Y6JA 3MTGA 2UUOA 1IYZA 3DHNA 4TROA 1ISGA 1K3TA 1VPDA 3WBBA 3U62A 1XEAA 4RF3A 2GCGA 1VL8A 1AE1A 2X6TA 3QY9A 1NVGA 4JP3A 3QWHA 3HB5X 1I30A 2NVBA 2XOXA 1ISMA 3E9MA 5IFLA 5DNAA 5CEEA 3JQGA 3CMMA 1J49A 1Y9AA 1LUAA 4JBHA 4WJZA 3HZZA 1P0FA 1ZMOA 4MP8A 1KC1A 4JN6B 2DM6A 4XDZA 2WYUA 1GAEO 3GVIA 5HA5A 2RHRA 4N5NA 4L4RA 4CM1A 3GEDA 5MDHA 3PLNA 4W82A 5IG2A 5IJZA 4DMLA 3BHJA 4ZVVA 4QQRA 4BGIA 3WX0A 2OP0A 3RBXA 3VZSA 3PGXA 4Z9YA 4AJ2A 1MFZA 1EFKA 1YH3A 4L73A 4XQEA 4YJHA 5ICSA 4JLWA 2VUTA 1C0IA 3WBFA 2O3JA 4MIEA 2DQ4A 1V3VA 5EN4A 3NT4A 2I9PA 1GZ4A 4O63O 5DBIA 1EQ2A 4D41A 1PZGA 2PV7A 3LSYA 2Z5LA 2FY8A 1BXZA 5EL0A 1VJTA 1HLPA 1GTMA 1TA4A 2YY7A 3ZU5A 4CQMA 3IJPA 1KOLA 1U7HA 4ZN6A 2ZTVA 4BGEA 2C20A 1U2GA 4Q3CA 3OA0A 4Q3EA 2CDCA 3VDRA 3O4RA 4BV9A 2I3AA 2PGDA 1C1XA 4EW6A 3P2OA 1NASA 2WWRA 3MJVA 4FR5A 1PGNA 2NM0A 1ZEMA 3DBLA 3FNFA 3FRJA 3PFFA 2YHIA 1OMOA 5B12A 1DXYA 1P44A 1XU9A 3PYMA 1QYXA 2C7VA 3JQ7B 4IZIA 4NMHA 4NZ9A 1QR6A 1SNYA 3DZIA 1R6DA 1EUDA 4U5QA 5KCZA 5A03A 1XELA 4XDYA 4R68A 3TL2A 4BS9A 4BL5A 3NDJA 5KKAA 1GEGA 4BNTA 4DXHA 3VVCA 3PIIA 3ZHBA 2JL1A 3IDSA 1IL0A 4YT5A 4J0FA 1U3WA 2IDZA 3MWEB 1TXGA 1B8VA 3F1LA 4NFSA 4XGIA 3NJ4A 6LDHA 2I99A 3CKYA 2PZLA 3WJ7A 5A1TA 3ONEA 2HU2A 4BMVA 2DVMA 3G3EA 2LDXA 4E31A 3DAPA 1E1LA 1D7OA 1EBFA 3JQAB 4BNNA 1PTJA 4WNCA 3P19A 3ENNA 4IY1A 4OJNA 3BTSA 2WD8A 1N92A 4R01A 1EMDA 3ONDA 4CV2A 3U4CA 1WLYA 1UP4A 4HY3A 3PJGA 3WFIA 4E5YA 4UULA 4EJ6A 1VKNA 2XPCA 2VHYA 3GT0A 2ZKLA 4ILKA 4YAJA 3RIHA 3CE6A 4DGSA 1HDZA 2BI8A 3I23A 1FDTA 5KWEA 5A04A 2EV9A 4CMEC 4QUKA 1QG6A 4XWYA 2B4RO 5MGBA 4CMKA 2O4CA 1GY8A 3IIEA 3BMNA 3JD4A 4WECA 4G65A 3WNQA 2PZKA 5FF9A 1F0YA 3ABIA 4RVHA 3K73O 4YT4A 2FSSA 1LU9A 3ZCXA 4XEHA 2PY6A 2PD4A 2D59A 3H5AA 2C54A 2Q1UA 1OI7A 3C8MA 4YJFA 4BNIA 1GU7A 4CM8B 3NYWA 4BNUA 2ILTA 1YL5A 2WE7A 1WZEA 2C59A 3VTZA 1HKUA 4WKGA 4QFDA 3DZKA 1H94A 4L75A 1YO6A 1T2EA 4ZJUA 5J23A 3ZDFA 1E5QA 2ZB8A 3GN1A 3GPIA 1E7YA 4RPGA 3PFWO 4NBRA 1NWHA 5JLAA 2YQ5A 5DULA 4BKUA 2Z1NA 4PGFA 4L74A 4BMNA 1M6HA 3WG9A 3IOYA 1ONOA 2UUPA 4XQ9A 4E2XA 2JFHA 1GPDG 1UH5A 5B4UA 1ENZA 1AXEA 5U4QA 3DO5A 3Q9UA 5ENVA 2CMDA 1NPTO 3A4VA 4NHEA 3TDKA 2OORA 3B1FA 3R3JA 3RC7A 3IC5A 4NK4A 1PJ2A 3KYDA 1DOHA 3ANLA 2GN8A 1XU7A 4DRYA 5JCXA 1N2SA 3PQEA 4GX2A 2C5EA 1EDZA 3WNVA 3MJCA 5IN5A 2X9NA 3GPDG 1A4UA 1RKXA 3CIFA 4RQUA 4J9UE 4PVDA 4OHUA 2Y1GA 4EYEA 2Q50A 3Q2KA 1YQXA 2Q45A 3JD2A 4EZBA 4CL3A 3EVTA 3DBHA 2FPPA 2CD9A 2PKQO 4WCDA 3BAZA 3JQAD 4ALLA 3AU9A 4R51A 3TL3A 1Y8RA 1KYQA 4JK3A 1IHYA 5I8ZA 1ZBQA 5IZ4A 1NWCA 1JKIA 2QRLA 1SZJG 1B3BA 3MJ4A 5JY1A 3NGLA 2HUNA 2B37A 5EQDA 1NM5A 2AG8A 1Z73A 2GASA 2O3TA 4MPDA 3ITDA 2AA3A 2OBNA 1PJLA 4LISA 5G0WA 3H7AA 3DEYX 4FFPA 1V9LA 4F6CA 1PR3A 5T8KC 5KNLA 2NSDA 2Y93A 3T4EA 4KWIA 3ETGA 1NR7A 3QWIA 4MKZA 4CLXA 2BGMA 4N5LA 3PYXA 4MOWA 2GZ2A 4M8SA 3KM0A 3RC1A 1GDHA 2WE8A 4EUFA 3GGPA 4DLLA 3RC2A 3ROKA 3QWBA 4PLCA 1PX0A 3L9XA 1GCOA 2EGGA 5C7IO 1LEHA 1PZEA 2C0CA 4CM6A 3ZI0A 5CEFA 1S6YA 4DTIA 5JO0A 1X1EA 1GYQA 4GX5A 5A5EA 2BFPA 4LSWA 1E6WA 2NADA 3A1NA 4BO3A 3SXPA 4J9VA 4D46A 2UVDA 1T26A 3ORFA 4LSMA 4XCVA 2J5KA 3RJ5A 9LDTA 3E9NA 2OFPA 3DWFA 4R54A 4RORA 3RUAA 1HE3A 1YL7A 3VZPA 4EUEA 4PLPA 3FTPA 4HADA 4JX8A 5H81A 2AEMA 1HZZA 1R16A 4Z9XA 2BFAA 3C7DB 3RCBA 4PZDA 4HV4A 4E32A 4WEOA 1VL6A 1XG5A 1ZO8A 3KRTA 1B2LA 3E18A 1X14A 4E21A 5I9NA 5F1OA 4TWRA 5BNTA 4NJMB 3UKOA 3INRA 1JAYA 2D0IA 3L07A 4G2NA 4GWGA 3G79A 3I83A 4FOOA 3AUUA 4IDFA 4MVJM 1YOVB 3GGGA 3U0BA 2JAPA 1WZIA 2IXAA 4YDRA 5C7OO 4ROSA 2EG9A 4FCCA 2IEBA 3RROA 1EEHA 3WGIA 1OAAA 2AQIA 2SCUA 4PG4A 3U4HA 1ZK2A 5IDXA 1DB3A 4XJTA 1UXIA 1DRUA 3ON5A 1LRLA 5JYEA 2J5RA 4CMIB 5G4LA 3V8BA 3WS7A 4J6FA 3BYZA 3QHAA 5CG1A 4U0JA 1MXHA 2DFDA 3TZHA 3JYLA 1JVSA 3FD8A 3IP1A 3GN2A 1QORA 1G0OA 1VRWA 4NNJA 3SC4A 4U6SA 5JMWA 2DUUA 4WNIA 3WSVA 2GRAA 3QWFA 1UZNA 1K6XA 3PWSA 4Q9NA 1T4BA 4K1LA 4W4TA 1CQJA 1W4ZA 3AUTA 5DBFA 5A3VA 1F12A 1M66A 1N8KA 1NVMB 1WDLA 3GDOA 4J1QA 1YBAA 3SLGA 1WMAA 4PIVA 1TLTA 1WVGA 2J3HA 1U3TA 1R0LA 4BHTA 1HE2A 4HFRA 4RVUA 4B4WA 4XR9A 2D1YA 1YVEI 3KEOA 2VWQA 1YRLA 3SC6A 1H6BA 1U3UA 1B8PA 2ZYGA 2F00A 3EC7A 1YDEA 5JNLA 3WGYA 1ZKMA 3RQSA 4JQCA 3OQ6A 1PL7A 4CLRB 5L9AA 3TWOA 3JQ7A 1DBVO 4XIYA 1I0ZA 3I4CA 3G17A 3PGJA 4I9HA 2QZZA 3ST7A 5JDCA 4R1TA 4XD2A 3V5NA 4A0SA 1P33A 3F47A 4B8ZA 5ER6A 1JKJA 3C7CB 4BO6A 4PRKA 4IXTA 4YEDA 5GZ6A 5TGDA 5ITVA 2BGKA 1ZJYA 4J0EA 1PR9A 4R69A 3RFTA 1N1GA 4MINA 3WMXA 3RI3A 4ZRMA 1WWKA 4UUOA 3I6IA 3JV7A 1GV1A 2GN6A 3JQEA 1HDRA 4FOSA 1EUZA 3QJ5A 4B7XA 4BB5A 3JQAA 2OZPA 3D0OA 3RSHA 5AYVA 4D79A 2Y05A 5BT9A 2J8ZA 1XGKA 2YV3A 4YT8A 2O23A 4YTEA 4R1UA 4PG5A 3E9QA 1U5CA 2X23A 3OETA 5A9SB 4CODB 3EY4A 3ZNPA 2C29D 4B3HA 2AG5A 5JS6A 4NBUA 5CDTA 3NTOA 2YYYA 5F3RA 2B69A 1H2HA 2V6BA 2DT5A 1W73A 2O48X 4U6QA 1HXHA 3DC2A 4GI2A 2BMAA 4R41A 4XYLA 4URFA 1LNQA 3ZWYA 4U0KA 5IXYA 1IE3A 5FI5A 3RWBA 5A9RA 2QRKA 4GAEA 4ZQHA 3JYNA 4K9DA 2YHUA 1JWBB 1NP3A 3GMSA 1ZSVA 4YAGA 4XA8A 3KLMX 4NQZA 3LLSA 3VH3A 1LDEA 1JLLA 3DMTA 4BKRA 2OO5A 3GK3A 3I3OA 4A27A 2X0JA 4JROA 4O1MA 3ROMA 4CM8A 3MCVA 1P1RA 4WASA 4UUPA 2WD7B 1A9ZA 2QZ9A 3RVDA 3VH1A 4IM7A 4ZD6A 2WSBA 2QQ5A 3C1OA 1HEUA 4FGSA 3C7AA 4LMPA 4LVCA 3RUHA 3GQVA 4TRJA 1PZFA 4UAGA 1U5AA 1SPXA 3WIEA 5U9CA 3MOIA 2R6JA 2E49A 2AXQA 3DR3A 4RLSA 1K6IA 2AHRA 4S1VA 4E2ZA 3QVWA 1EDOA 3ZW8A 4BMSA 2BKAA 5DCWA 2ZTMA 4GWKA 5I8WA 3AFMA 3ZZNA 3BHIA 4CR8A 1ZZEA 1HE4A 1XSEA 5L7WA 2PLAA 4YQZA 4EEZA 4XJSA 3UICA 4JJIA 2HKIA 1Z7BA 1A7KA 3NRCA 4PLTA 3ZWMA 4QSMA 3LC1O 3DHYA 4HX5A 1PSDA 3WGTA 4M55A 2YQ4A 2NQ8A 4BNXA 1U1IA 3ETDA 5DOZA 5HS6A 1DLJA 4EI2A 1YL6A 1UAYA 3KYDB 5T67A 1Q7GA 5IAAA 4FD3A 3BMOB 3MZ0A 4CMEA 4CL8A 5G0UA 3HE3A 3DZJA 3I9KA 5THKA 5I7VA 2VTDA 2FMUA 3L4BC 2P5UA 4RDHA 2EP7A 3F6YA 3TSCA 4BVAA 1BWSA 1EZ4A 1MG0A 5TLSA 2IYPA 1A4IA 1Z75A 3X2FA 5KVQA 3UHAA 1T2CA 2GO1A 5I9LA 1IZ9A 3ZWBA 3DBRB 3ZHYA 3WGGA 3WTBA 4PLGA 1ENYA 4GMFA 5FYDA 4I9UA 4IINA 4MVJE 4AFNA 3KUXA 3ZU2A 4DBZA 1MX3A 3BTOA 2BI7A 2J3JA 2YV1A 1DHTA 1UXJA 1QLHA 4CUZA 2Y0CA 1I32A 3D5TA 3UW3A 3A14A 1CEQA 4FFMA 5JAZA 2FWMX 4K6CA 2Y1DA 1E5LA 1P45A 2I66A 3C24A 3C1TA 3B70A 3D3WB 4AJ1A 1P1IA 2FHSA 3QRWA 1FF9A 2E82A 3AUSA 3ZN2A 3QW2A 1DAPA 4RPKA 2HQ1A 3Q2IA 3UH1A 4GL4A 3CH6A 1JDJA 1QYWA 3I6QA 4GVXA 1C0PA 3HDYA 3IS3A 4F46A 4LCJA 1PL6A 5F1KA 2DBZA 1R12A 4XB2A 1EE9A 4J1NA 2AE2A 5G0VA 2Q2QA 3ENKA 3VPHA 1K2WA 2O7QA 4H3VA 2X0NA 2J3KA 5HS4A 3OF2A 1HTBA 3IKVA 2VQ3A 4BNWA 4KTTE 3NT2A 3OFSA 3KZVA 2HO5A 2EJWA 4MO2A 4KMSA 3VPFA 1BDBA 3IP3A 3DZGA 1KVRA 4XGKA 4XGNA 1HDXA 2EKQA 1UXHA 4NJMA 3WFJA 3OJOA 1C3VA 1YE3A 2DBRA 2VRBA 4YVFA 3PVZA 5JPIA 1Q0LA 4P8RA 1E6UA 2FP4A 4ZICA 1EVIA 2E48A 3N7UA 4ZRNA 1YOVA 4ND5A 4AJLA 3VTFA 2GERA 5HWSA 1RYEA 4YQYA 5JDCC 4ND2A 1ULUA 2BHLA 2P9CA 4XYEA 1ZVMA 3AU8A 3IMFA 2JD2A 2VZ0A 4E33A 4RPLA 1HE5A 2P4QA 3INTA 4J1TA 1PJBA 5I9MA 1DO8A 1KEVA 4WOKA 1LQTA 4CMIA 1YB1A 5T8KA 4I1IA 3GG9A 3G1TA 1L1FA 4TZKA 3H2ZA 1JVBA 5TJHA 1LSJA 3IUPA 4OQYA 5EMHA 3K30A 1U7TA 4NBVA 1KEPA 2D5CA 3F4BA 2IODA 4IGFA 1IB6A 3LF2A 2OGUA 4UUNA 4BIIA 6ADHA 4C7JA 1GZ6A 5TT0A 4BNKA 4IDDA 1R0KA 1XWFA 5JBIA 4OKIA 1DEHA 1LJ8A 1BDMA 2BFMA 5F21A 3WOHA 1JAXA 5A3JA 3FHLA 7MDHA 1PGJA 4PG6A 4O59O 1WDMA 1ZUD1 4EUHA 1E3IA 3LT2A 2GF2A 5JC1A 3GRPA 2VUSA 2ZJ1A 4CPDA 1SB8A 4IQGA 5C7LO 1P74A 1HSZA 4WLNA 1DIHA 2VNAA 3ROPA 5DP1A 5CG2A 4J3FA 2W8ZA 1O5IA 3ZHXA 4CLRA 4ZQBA 1IHXA 4BO4A 4CV3A 5I7EA 3EMKA 2X7HA 1GQQA 1ISFA 3JSAA 4J2OA 3OSUA 4PLWA 1MP0A 4FS3A 3VZRA 4PLYA 1E7MA 3ZWNA 1E3LA 2W2LD 3V2HA 3KYBA 4J4BA 5AOVA 4BNZA 1CYDA 1DIGA 4RGBA 5TF4A 2C82A 3H65A 3RBZA 4CR7A 3DMTC 4KUHA 2HDHA 3JQ9C 4E3ZA 2PGLA 3I9MA 5JCJA 4J4TA 1V3TA 1H5QA 4JGBA 3D4OA 3RAJA 5FWNA 2HMWA 1U8FO 2O2SA 4R1NA 1BXKA 2OOSA 3AJRA 1Q7CA 1I3NA 2UYYA 1LSUA 4QO7A 1QSGA 4RLHA 1Q2XA 1WDKA 3F1KA 1K0UA 2ZIZA 3BA1A 3HQ4O 4IMPA 4Z3KA 1I5RA 1TT7A 4A5OA 4GX0A 1F8FA 2DLDA 4K28A 1SMKA 4E5NA 4II3A 2RH4A 3PJEA 3JQBA 1DLIA 3AM3A 3JTMA 5CAEA 5A9SA 3EZLA 4BNGA 5JAQA 4BO2A 2P5YA 4TVOA 5JXWA 1W8DA 3FBGA 3K2BA 4FFRA 1O89A 4D3SA 2PD3A 4CLDA 1NPDA 5TT1A 4J91A 1GQ2A 4NBTA 2ZATA 1RPNA 4IDGA 4YYZA 3TFQA 3W4KA 1V35A 2IZZA 5DCYA 1JW9B 4M87A 2AEFA 4FFOA 4RPJA 4F6LA 1XLTA 1U28A 1H9AA 1VSVA 2VT2A 2X8LA 2O3UA 3ONFA 4GLLA 4I8XA 5K0ZA 2CSUA 5L7YA 2VOEA 2NVUB 1ZJZA 2Z1MA 1Y9EA 5TNXA 5L95A 2BD0A 1TB4A 3GLQA 4YRBA 3GF4A 4IIVA 4HP8A 1KVSA 2ZK7A 3D64A 4BQRA 1J4AA 1LQUA 2R2GA 2WD7A 3WLEA 4BNFA 1EK6A 2FR0A 2O50A 1FDSA 1MLDA 2PTGA 4NG5A 4AVYA 1RM0A 4YCAA 3TZQA 3VH4A 1I8TA 3QP9A 1MXFA 3DFUA 1R15A 3PHGA 2DPGA 1F17A 4NK5A 3WGOA 4IJVA 1Y7TA 4E0BA 1BHSA 3AWDA 3LC7O 2EJVA 1EVJA 4KZPA 3V1TC 2HMVA 4F45A 3B1JA 2WDZA 3WB9A 2QIOA 1LA2A 1V8BA 4YJDA 1SBYA 4IDCA 4HFNA 2GR9A 1QXSA 4E5MA 3NTQA 3TZCA 4Q3BA 1UR5A 4DC0A 4XYMA 1ZK0A 4ID9A 1SCUA 4ESOA 4FB5A 1HDGO 4A7PA 5CDUA 3CSDA 2O3QA 4BO9A 3CXRA 1ID1A 4K26A 5BSEA 3Q6IA 3ITKA 2X9VA 1VJ0A 2W2KB 1PIWA 1PGPA 3GG2A 2Q99A 3BMOA 3GVXA 4D45A 5JDIC 4B3IA 1TT5B 1PJTA 3LT1A 1Q1NA 2EW8A 1O0SA 3DMYA 4Y9DA 1HZJA 4UVDA 4I5DA 4MVJD 4RL6A 4D0RA 1N7HA 3MEQA 1MGOA 1FJHA 3DBRA 5G0SA 4OKNA 1NHWA 3DONA 3AI1A 1UZLA 3ZHZA 1I33A 5T64A 5GZ1A 4PRLA 2G82A 3PJDA 3FSRA 5FI3A 4OH1A 3TPCA 5ILOA 4KQWA 1C14A 4XQGA 2WEKA 3PI7A 4OOFA 4TKLA 2XF8A 2WTBA 3U4DA 3R1IA 4B7CA 5HM8A 3ZW9A 1LDNA 2DPHA 5CP8A 3B20A 3D3WA 2X22A 1KETA 2F1KA 3DTTA 3OIDA 2G0TA 3EAGA 1U4SA 5TIIA 1WMBA 2W2LA 3GH3A 4AJJA 1KY5A 4UEKA 2JHGA 1DFGA 3I9OA 1LBEA 2NQTA 2BLLA 1QYVA 4LN1A 4CJXA 4PLZA 4KUGA 4W99A 7ADHA 1ONPA 1X7HA 3Q11A 5T6BA 3NEPX 2IE0A 2AMFA 3QIVA 4WPGA 5TQVA 5A02A 5ER9A 3V1YA 5I7SA 1GZ3A 4INAA 3JQFC 4WOJA 3DTYA 3S2FA 4EITA 3TN7A 5BQFA 4E30A 1L7DA 2FPGA 1DFIA 3GVPA 4QEDA 2CVOA 2RBEA 1NQ5A 3V2UA 4KUEA 4WE3A 1KVUA 1WXDA 4GGOA 3R6DA 3ULKA 2CVQA 2Q1SA 4PLHA 4LRTB 5ES3A 2QG4A 2E4AA 2E37A 3UAGA 5CEJA 4YXFA 2PZJA 5G0TA 3L4BA 1U9JA 3KBOA 5KJ6A 3GAZA 5BNFA 4BO7A 1Z7EA 4RVFA 1R0SA 1QV6A 1GV0A 4M1QA 3HUDA 3UCEA 2Q2WA 3S1LA 5IDYA 2P9EA 3ZV5A 1P1FA 1XQ1A 2IZ1A 3GRKA 1KVQA 2VYND 5H82A 3WLFA 2NU9A 3WSWA 1T25A 2JFFA 3OBBA 4AJNA 4BNLA 1DPGA 2PZMA 2JHFA 1UAGA 1UDCA 4D7AA 3L0DA 2NUAA 2J6IA 1CIVA 1E77A 2J3IA 2B4QA 1PGOA 1A71A 2VWGA 1LLDA 1NX6A 2H5LA 1B8UA 1NFQA 5KJ1A 3KLPX 1JKFA 4KWHA 5C5IA 3R3SA 3DBVO 1GD1O 2DBQA 1N1EA 1N7GA 2ZYAA 2DTEA 4OYRA 3MJSA 1DC5A 4K6FA 3W6UA 2VNSA 4YPOA 1RM4A 1VLLA 2EP5A 3UCFA 5DT9A 4FIZA 1NXQA 1MUUA 4R16A 5T5QA 4KDEA 4WLEA 3ZGYA 1YBMA 2ZTUA 4BKQA 3JQBC 4YJGB 1YQGA 4H15A 5LC1A 3ZV4A 2X0RA 3EGOA 3TFOA 1HETA 3LVFO 4OXKA 1ENPA 4QFCA 5EINA 2CVZA 3U09A 3E48A 2X5KO 4JIGA 2AQKA 4BNYA 5L45A 2HMUA 1UDBA 4QTZA 1QLJA 2I76A 5JO9A 1QRRA 3H9JA 4RZHA 4I5GA 3PHHA 5COAA 3F46A 3WIDA 3WGQA 3GC6A 1AHHA 4ZGWA 4NI5A 1X7GA 1H93A 4NFHA 4JXKA 2G76A 1YWGO 3A06A 2VCYA 2UV8A 2G17A 1B14A 4LK3A 4N5MA 2W90A 1NPYA 1HSOA 4GH5A 4XZ3A 3ZNNA 1HYHA 5AVOA 3WICA 4M49A 1LTHR 4ZQFA 1LLUA 5I7FA 4D44A 3NDIA 2ZB4A 3GDGA 2C2YA 1DC4A 1HDYA 3RD5A 5K6AA 3WMWA 3PHJA 2GPTA 4WLOA 2ZJ0A 2Y1EA 5CHEA 4XRGA 2NLOA 2PH3A 3MWDB 1L7EA 1QKIA 1NBOA 2CY0A 3JQ8B 4DQXA 1GL3A 1W6UA 4AJKA 2IRWA 3CINA 4B8WA 4Y67A 4O5OA 2R00A 2ET6A 3VVBA 4OGWA 4J43A 1HT0A 1A27A 1VJ1A 5JAIA 3IQDB 1KVTA 5JE8A 4U8GA 1JWAB 3DZHA 1T2FA 4EJMA 3JCZA 1QP8A 2PD6A 4FPXA 4OO3A 4I9NA 5L4SA 3TOZA 3ZWPA 1UZMA 4MJLA 3GVHA 5LDHA 1P9LA 1TEHA 3KSZO 2XXBA 3IUSA 1P31A 1WP4A 3COSA 4OAQA 4DMMA 3RUEA 3PHLA 5A5FA 5L3ZA 4Y6SA 3D3EA 2WM3A 2GGSA 2B83A 3EDMA 2NACA 4L0QA 4BO5A 5C37A 4P4NA 3IL2A 2ZB7A 1BRMA 1BTOA 3DAGA 2Y68A 3LT4A 4ND1A 4Y98A 3S2EA 3OH8A 3T7EA 2GZ3A 2J5QA 4PG8A 2H63A 4WUVA 1VI2A 3I52A 1DIRA 3HADA 9LDBA 4XQCA 3OICA 3O8QB 4TRMA 3RUCA 4JJFA 5GY7A 2NVUA 2EHDA 3VPXA 4IJWA 2FN7A 4XB1A 1UXGA 3Q1LA 4L4SA 4W6ZA 3N58A 2HLPA 1GFSA 5TJ9A 4FQ8A 4FC6A 4J7UA 3TQHA 1YONA 5AXCA 2YFHA 3QLJA 1E1NA 3ANNA 3H8VA 4M89A 1E3JA 1K5HA 1VC2A 3JQ9A 3D5QA 3OIGA 1LSSA 1N9GB 1ZSNA 2FSVA 1GR0A 4BKPA 2C07A 4IUYA 4DLAA 1PQPA 2EEZA 2O4UX 1LRJA 4IXWA 1K6JA 3RUIA 3E5MA 4DPLA 2ZQZA 3E6AA 3I9LA 2DKNA 5F5LA 4CQLB 2JCXA 2HJRA 3I9NA 2Q1WA 2V6MA 2PNFA 4OQZA 4KP7A 1DC3A 3PK0A 4RVDA 4CMGA 1NAIA 3DOJA 4NU6A 3ASVA 3JYQA 3PJFA 5CPFA 2IZ0A 1X7DA 5HBRA 1NR1A 1E3SA 1GYPA 3VOSA 4WEQA 3UN1A 2NU6A 3H2SA 4H16A 1QYDA 4J4HA 3C1AA 2VYNA 1O8CA 4DBVO 3CMCO 3HHPA 2VTEA 4MP6A 3ROQA 3IJRA 1XHLA 4GKVA 2W2KA 4XRRA 1FDUA 3ZNOA 3ZV6A 1MC5A 2RAFA 1B0AA 4KOAA 3WGZA 2VZ8A 5L7TA 1NHGA 3NKLA 5HTOA 1TT5A 4WCFB 5B4VA 1GYRA 4CM9D 4NJOA 2HJSA 1AGNA 1ADCA 1EQUA 1JTVA 2IXBA 2HMTA 1LLCA 5EQFA 2PWZA 4IDEA 3DOCA 3L9WA 4GX1A 1PZHA 1U3VA 5JAMA 3RFXA 4ALKA 4XYGA 1C1DB 4FW8A 4RV9A 1U2DA 1HF3A 4YA6A 4CLOB 5KOIA 3WQSB 4ALNA 4HFJA 1U8XX 1HDOA 4XYBA 2Y66A 4PVCA 1NFRA 2ZCUA 4RF4A 2NV6A 1FDWA 1CERA 1KS9A 3BMQB 3M1AA 4L4XA 1KBZA 1N5DA 3JYPA 1E0DA 2GZ1A 4QO8A 1D1SA 2ZYDA 4BOYA 4LW8A 4CMAA 3PZBA 3K96A 1ENOA 1ZK3A 2OP1A 1OC2A 1YXMA 2HRBA 1E3WB 2CZCA 3JQDA 5AQ1A 4HNHA 4IJKA 1B3RA 5U1PA 4MIYA 4IGEA 1GUZA 3W8DA 2CNBA 4NFYA 3ZWWA 1O95A 3DXFA 3GFBA 3DB2A 3ANMA 5IZCA 1HLDA 1KERA 1GQYA 3RKRA 3SVTA 5ADHA 2QX7A 4MVJP 3DAFA 3PP8A 4GSKA 5JSFA 1H6AA 3CUKA 4B4UA 3TZ6A 4YAKA 4TKMA 3FBTA 3T4XA 1NAHA 4Y6PA 2JD1A 5BNIA 1U4OA 1ADFA 1DRWA 4Y8VA 3OQBA 3D4NA 4NR0A 1NQAO 4B79A 3FWZA 3TOXA 4CM7A 2EIHA 3LQFA 2I3GA 4AJPA 1ISHA 3GHYA 2BFOA 2VRCD 5JDIA 3SLKA 4ALJA 3K8ZA 2EF1A 2H6EA 1E1KA 1ZFNA 1PS9A 2JJYA 1BMDA 4DQVA 3U5TA 3WXBA 4MP3A 1ZXBA 2AE1A 1BVUA 1OBFO 3FI9A 4L8VA 1AHIA 4FC7A 2OBYA 3LK7A 2XXJA 2VYVD 3H5RA 2I65A 4MIOA 5B1YA 3H3JA 3PDUA 5BSHA 1V6AA 3LDHA 3FR8A 2HCTA 4ZQEA 3VKVA 1O6ZA 4EDFA 4B7UA 3EVNA 3WR5A 5DN9A 2Z95A 1I3LA 2VUUA 2HSDA 1DHRA 2EWMA 3AOGA 1VKOA 1OZAA 4B4OA 4YR9A 3GZ4A 3JYOA 1T2AA 4N18A 5K6AC 1SOVA 2NTVA 2NWQA 4GMGA 1BXGB 1OC4A 1X1TA 2Q46A 4D42A 2WYVA 5KVCA 5AXAA 1SEPA 3VZQA 1EVZA 1GADO 4Q3AA 4R3NA 4J16A 3K9QO 1VL0A 5H83A 4I5FA 4UVIA 1YBVA 3ADPA 2R00C 2D4AA 4AG3A 1Q0HA 3UCXA 1Q7BA 2Y0DA 3AY3A 4Z9FA 3JD1A 1S7CA 1PJQA 3GAFA 1Y5MA 3TJRA 1WAMA 1M6WA 4YJGA 2RCYA 2CDBA 1R37A 2PK3A 4UVGA 4R5MA 1TVEA 2GUGA 4BUCA 4CMJA 5FEUA 5DBGA 1O9BA 5LCXA 3L6DA 2PFGA 4BO1A 3OMLA 1B26A 1NYTA 5THQA 3ZH2A 2UAGA 1KEWA 1JU9A 3JQFA 5BR7A 4FSHA 2Q49A 1DDOA 5IDWA 2TMDA 1DFHA 4ND3A 1T4DA 3ZU3A 4IS3A 4R5HA 3Q9NA 3S2IA 1G1AA 5JYDA 2CDAA 1F8GA 4A10A 3QWAA 3WJAA 3KSDO 4QECA 3HWRA 4FFNA 1K89A 3WQQA 3V2GA 2P2SA 3W8FA 3B1KA 1B15A 2VHZA 1UXKA 4RDIA 2D3TA 4TMFA 3F5QA 5F5NA 3CZRA 2C5AA 4Z6KA 1YB4A 1RYDA 2QYTA 1HDCA 1C0KA 1LXCA 1Q0QA 3QVTA 2RHCA 1E92A 1FXSA 4NDNE 1LX6A 4GPD1 3FTNA 4CM9A 2A92A 3JQ8A 1GCUA 2B4TO 4OXYA 3OECA 2FR8A 3BMCB 5KJFA 4JJGA 5IDQA 4IS2A 3HSKA 5DDIP 1IOLA 1CETA 1H9BA 3M2TA 4I5EA 1GEEA 1EK5A 4E5PA 4CMBA 3ZNQA 3I5MA 4MKXA 1BGVA 1R4NB 4AJEA 4MKRA 3OEYA 5A05A 4CR6A 1SEVA 3GZNB 5COQA 3DL2A 4Z3DA 4EJ0A 4UEOA 3NV9A 4A03A 1JA9A 3FWNA 5TX7A 1PL8A 3CPSA 1X0VA 2NTJA 3LF1A 2PGJA 4IMRA 3PYLA 5IN4A 2Q1TA 1BW9B 1ZW1A 4QX6A 3M1LA 3QVXA 1I2CA 4FFLA 1X15A 4A26A 1I10A 3A28A 3LU1A 3G0OA 1YJ8A 1AXGA 5DCUA 3K31A 3DDNA 1ZK1A 4XR4A 3GFGA 2NU7A 3L6OO 4ALIA 2H1SA 4UVHA 4E6PA 2A9FA 4X54A 2Q4BA 3O8QA 3RC9A 4YRDA 5DF1A 5EJ2A 2I6TA 1F14A 3VHRA 4LRSB 4NU5A 3L4SO 3X2EA 1QYCA 4R9SA 1W0CA 4AJIA 3UGKA 4DC1A 3QV1A 1BSVA 1Y81A 1ZCJA 2GYYA 4W9NA 2WYWA 1MV8A 4DA9A 3GNSA 1SAYA 4RCVA 4NPCA 1SB9A 1GPJA 3AFNA 2YUTA 3Q0EA 5KVSA 1N9GA 2A94A 2FPIA 5TC4A 4A2CA 2V6FA 1TI7A 1XA0A 4F3YA 4G81A 3GEGA 3IKTA 3PQDA 5ITWA 2YZ7A 2BGLA 2EXXA 1I36A 4CQLA 3RUFA 2V7PA 4JNKA 2VRCA 2GNAA 3G1UA 1Y1PA 4QT0A 5L4LA 1NQOA 4BNMA 1PWXA 1HWYA 4XIJA 3DQPA 1I24A 5A4DA 5TS3A 1YS4A 4GSLA 3AI2A 4ZQGA 3FPLA 4A73A 3R0IA 2VYVA 1KC3A 3W8EA 5ILGA 1OFGA 3EYWA 4I08A 3O26A 2Q4EA 1M75A 4E4YA 3P7MA 1AUPA 2GN4A 3I4FA 4JBGA 4NH4A 2X4GA 2P9GA 2P4HX 5IZCC 2OUIA 2PH5A 1T2DA 1MG5A 1J5PA 1LC0A 4FGWA 3AI3A 4MVJH 1EE2A 4WCFA 4BO8A 2YJZA 2VHWA 3BTUA 1NFFA 2OHXA 2X0IA 4OM8A 2PKRA 3OEWA 3HDJA 1XR3A 2QYSA 1RJWA 3BHMA 2WMDA 4Z0HO 4PFJA 2PR2A 3ZWCA 2Y0EA 3OA2A 4WLUA 1QMGA 1HYGA 4DPKA 3D1LA 4CUKA 1C1DA 1CRWG 1G6KA 5K9ZA 5KIAA 2FZWA 4CLOA 3NDRA 4GKBA 5JC8A 3K2EA 3MTJA 8LDHA 1X0XA 1NTOA 3AK4A 4G5HA 1LRKA 3ZWAA 4D43A 1KY4A 3BMQA 3LLVA 4LMRA 1IUKA 1E7RA 4CUJA 4AICA 1HL3A 1CF2O 1LI4A 1R4MB 2FR1A 2YFQA 4HNGA 3PWZA 5GMOA 2HRZA 1LDYA 1CQIA 1YB5A 4O6VA 5G4KB 4B3JA 4IBOA 1DJNA 3BXXA 4RVSA 1E3WA 3BZUA 3PZRA 1CDOA 1JQBA 5JMPA 1PS0A 3KTDA 1ADBA 3SX2A 4P4GA 2X5OA 5G2OA 3EZYA 3QVOA 4PZEA 1ZXLA 3A9WA 5JY6A 4FJ2A 2A35A 3PRJA 3CZMA 1F06A 1Y8QB 4UEJA 3GA0A 4BNHA 4O0LA 1JN0A 3I9JA 1J0XO 2EW2A 2B36A 4HXYA 3WGHA 1ZK4A 3H9GA 4MVJI 1XKQA 4CV0A 4UUMA 3GNTA 4GQAA 3KETA 4J49A 4DLBA 2D8AA 3OJLA 2JFGA 3LZ6A 4RPHA 3W4IA 4L76A 4Z0TA 4IDBA 1IY8A 3AM5A 3EUWA 4DIBA 4R3WA 4WK6A 4EBFA 3FCOA 2E6UX 1PQWA 5ENDA 3P5SA 3E8XA 2Y1OA 2D5AA 3I1JA 2X58A 5CFZA 1H0KA 2PA3A 1RWBA 1X13A 3GHHA 3GR6A 4OL9A 4UVEA 3VPGA 1IPFA 4LCEA 3F9IA 3DZFA 3M6IA 3K92A 1G0NA 3KYCB 2TMGA 1DJQA 1YKFA 3H6KA 1ZSYA 2A4KA 2P91A 3UFXA 4FJ0A 3GNQA 2Q2VA 1T1RA 3GY0A 1ARZA 3AOEA 3M2PA 3FF4A 4P22A 4P38A 1YJQA 4R4JA 3FN4A 4RQTA 4S3MA 3HN7A 3WYBA 2X9GA 5DOVA 4DUPA 3GMDA 4C4OA 3RJ9A 3RU9A 1I3KA 1E6EA 2YDXA 1MB4A 2CFCA 1BXGA 3WTCA 1H2BA 3OHSX 4FBGA 4CM4B 1VSUA 2VT3A 1ZEJA 2EKLA 4IQ8A 3ICCA 3NJ8A 4OOEA 3UUWA 3OM9A 3VH2A 4TZTA 1Y5RA 3O03A 4JCOA 1B16A 1LLQA 4WGGA 1ONNA 4E2YA 4ZA2A 1P1KA 1PJCA 4J2HA 4KTVE 1DC6A 3H4VA 3PWKA 5FFFA 5CDSA 3B6ZA 4IPTA 2PKQP 3GOHA 1ISJA 2XAAA 2CF6A 3H9EO 2O3SA 3HB4X 4ALMA 4DREA 3QE3A 4YB8A 2FOIA 4BGVA 3H3FA 1WNTA 3F4LA 4ZHSA 5DZSA 5L4NA 1WW8A 3HJAA 4GVLA 4RF2A 3WYEA 5EPOA 1NQTA 2B5VA 2Y99A 3JQGB 4M86A 3TF5A 5JW6A 3E03A 4Q3NA 1ULSA 1P3DA 1HYEA 1YQDA 5F1PA 3VAZA 3C3XA 4MVJF 5HRUA 2B0JA 3WQRA 4D3DA 1NNUA 2CUKA 3S55A 4PCVA 5CPBA 4BB6A 1D1TA 2Y67A 4NBWA 5EIOA 1IULA 3UXYA 3GGOA 4KDFA 1BVRA 3OIFA 4IDAA 1A9YA 4R9RA 3U49A 4CLEA 2O7SA 4XX0A 5L53A 1A7AA 1A72A 4PZCA 3F3SA 2Y1FA 5KJEA 3L6EA 4EGFA 1C0LA 2DU8A 4NIMA 8ADHA 1WPQA 4PN3A 3CEAA 2GN9A 4YJHB 4W9NC 1EBUA 2NTNA 4OIMA 1KIFA 3JD0A 3OP4A 4ONEA 5TRTA 1O94A 2YDYA 1QV7A 2EGHA 3ADOA 3BMCA 2BRUA 3U9LA 1PJSA 5KJCA 1XCBA 1NVTA 2DAPA 5EESA 4DIOA 3L77A 4BKOA 5KVVA 4RVGA 4C7KA 2FZEA 1PJ4A 3S2GA 1H6CA 2QW8A 4YT2A 4CQMB 4RZIA 3O9ZA 5TSDA 1R4NA 1Z6ZA 5A9TA 4MVJA 4BNJA 3GZNA 4MDHA 3JD3A 3PLRA 1UDAA 3LT0A 1UUFA 4YACA 4U7WA 1SC6A 4CLHA 3SJ7A 4DYVA 5L40A 1C1XB 2VHXA 1Z74A 3HFGA 1ZMTA 3E1KA 3DBLB 3F5SA 1I2ZA 4BQPA 1BW9A 2H9IA 2YHIB 3K6JA 1M76A 5IF3A 1MC4A 3GVCA 4RO0A 2GSDA 1E7QA 1GUFA 1P0CA 3QQPA 1EVYA 2O3RA 4D0SA 4IZHA 3VPSA 3PDJA 4D3FA 3H5NA 3VDQA 1J6UA 3PIDA 4WCFC 5KKCA 3TRIA 1MA0A 4PG7A 4BGUA 2AEJA 2VZ9A 1BG6A 2G1UA 1ZIDA 4Y6RA 5LDGA 3EK2A 3KHUA 5DP2A 4FN4A 1M2WA 4W7HA 3PTZA 1OOEA 2C7GA 4LVUA 3H9QA 2IEDA 1ORRA 2FRDA 1KEUA 3HN2A 4ND4A 2JKVA 4AL4A 1HRDA 4J7CA 2JAHA 2D2IA 3RUDA 4II2A 3FR7A 2ZCVA 1V0JA 3QVSA 3ZU4A 4DPMA 3DFZA 5B4TA 2VWHA 4J7XA 1PEDA 3DOOA 4CMHA 2DBVO 1PGQA 3LC2O 1Z82A 4HUJA 4CMCA 2UDPA 1ZNQO 4JBIA 2W98A 2POQX 3KSUA 3PXXA 5BSFA 1AN9A 1V3UA 4RJTA 1LC3A 1MFPA 2CF5A 4TRNA 4DIFA 4E13A 3EW7A 1E3EA 4Q3DA 4MVJG 4DL9A 3FNGA 1IZ0A 1E7WA 5JFOA 2EERA 2QHXA 1T24A 4W7IA 3WYCA 3SJUA 3MOGA 4E2WA 1DIBA 2EKPA 1XYGA 3CTMA 4FJ1A 4M54A 4XKJA 4TRRA 3IAHA 4H7PA 3ZV3A 2JCYA 4R1SA 3INGA 3STHA 1RM5A 2Y1CA 1EUCA 4OSPA 5GZ3A 1PU2A 3OJ0A 3FNEA 1R66A 2NVWA 1D3AA 4OXNA 1Z45A 1YGYA 1M67A 2RIRA 3HNPA 4GLOA 3GEMA 3BMNB 3PEFA 3V1UA 2VHVA 2WJPA 1E1MA 5ICMA 3TNLA 5AXDA 1I2BA 1XDWA 2I5PO 1VE9A 3HDQA 4P4LA 3KXDA 2AQ8A 2X1HA 4IIUA 1PQUA 3DHEA 4TSKA 4YJFB 3ZWOA 2OMEA 3P2YA 2DTDA 4WLFA 4RF5A 3PHIA 4TVBA 3KVOA 3RFVA 1D8AA 3MJEA 3N74A 1VM6A 1E7SA 2YW9A 4CQMD 2GD1O 1DSSG 1T1SA 3AY6A 4PLFA 4BO0A 3GUYA 4E5KA 1XIVA 5T57A 3UVEA 2BELA 4CM5A 1D4FA 3AY7A 2DC1A 4YAIA 3S8MA 5A06A 1P1HA 3OQ1A 3JQ6A 5CDGA 3AW9A 3NGXA 2HK7A 3GUCA 3KO8A 3HG7A 4Q39A 1R4MA 3RU7A 3FPCA 4WLVA 3AOEC 1A5ZA 3KOUA 4CM3A 2AQHA 5AXBA 5G4KA 4Z0PA 4DYDA 2DUWA 5EERA 4DWVA 1IPEA 5COBA 4AJHA 4PLVA 1UP7A 4HKTA 5JCJD
chains in the Genus database with same CATH superfamily
2IYFA 3V2IA 1JQAA 3HDHA 2O9JA 2CYCA 3T5BA 3M9XA 4Q9LA 4BVGA 3NZEA 3KEQA 3RQIA 1QRTA 3EWIA 3FPHA 4X5OA 3TX2A 3D7LA 1HMYA 3PC3A 2OXIA 3UNXA 2R7LA 1Y8QA 1VP3A 1QH8B 4FDAA 4FX5A 2VOJA 2XLCA 4HGRA 4GBJA 4BMXA 3NTRA 3WFZA 2HAEA 4DC9A 2JCVA 1YDWA 2A14A 2FZ5A 2QD1A 2HCFA 2V5VA 4IWYA 4AJ4A 2HQOA 8OHMA 1M72A 1RM3A 1ZM7A 2VHUA 4XFKA 3GDFA 5DXJA 2HK8A 1C9DB 3QU4A 4J90A 5EJAA 4C05A 5CDHA 2OVBA 1PV2A 4WKPA 1H6DA 2B5WA 4FGJA 1XRRA 3G2IA 3KB6A 5FAXA 3UENA 1IJEA 2DFVA 3W7AA 3W1VA 4O4LB 4H6WA 4DLTA 3FVTA 4KPFC 4D0GA 1CJCA 1JLKA 3UOGA 4N7RA 4QXMA 4QSHA 4BFZA 5KDOA 1CWUA 4PYQA 3WHKA 2I67A 3UO8B 2O2IA 1BFUA 2G67A 4ZEOA 3W4JA 1UEIA 5ESXA 3HEAA 1ZRHA 4OHCA 1HT2E 1SU7A 2FJPA 1JIQA 2QEQA 2R8BA 3PQFA 4WY8A 4BYMA 4JVLA 2PRZA 2WG1A 4YI3A 3OEED 5EXSA 4EMTA 1LDBA 4PYOA 2Q3EA 4X20A 2LDBA 1TTHA 2R84A 1RC1A 3OJFA 3M33A 5IXSA 1NNI1 3U1BA 3VC1A 1JZSA 1PR4A 3AJAA 2O2YA 2ESRA 2FEXA 4AJOA 1YKGA 1ZCFA 3KQQA 4ZYLA 2WG2A 4OP2A 5KQPA 5C34B 3KV3O 2LKDA 3WNDA 1IOWA 2AD1A 3HFSA 4OFBA 5FV7A 2V8OA 4TXLA 2P6PA 2VN8A 4XARA 2ZSFA 4OMUA 4NE7A 4NE9A 1DO0A 2V74B 2H08A 2QGFA 4PWYA 1AMNA 4CM4A 3VKUA 4UPVA 3WWZA 5LU8A 1H85A 1JQJC 1MIHA 2RHLA 3N6VA 4C22A 1A7JA 3PIRA 4UREA 5GV7A 3LWBA 1FS5A 2D06A 4TKUB 4WOCA 1AT1A 3NBMA 3WV5A 4XPIB 2ZI9A 3B5EA 3PUXA 4PQFA 2P68A 4GGPA 4I4LA 1O9GA 4QBIA 3ZXYA 2VWPA 2CKMA 1ZM4A 2M1XA 3AETB 1P4GA 3CV3A 4P33A 2H18A 3EIXA 4OLFA 5DT2A 4CCYA 4EEXA 4DJEC 2CL5A 1X7WB 2ZI4A 3CZ9A 2GAIA 1ZWLA 4ZAVA 3QE2A 1T2UA 5GVSA 4RY9A 4UOEA 2WU1A 4YMIA 3T7CA 3Q3EA 3QX3A 3EIEA 3MTGA 3SU8A 4BU1A 3MTQA 1ISGA 1K3TA 1N3IA 3A1EA 2FPLA 5CX1B 5F9FA 1ES9A 1KO4A 1V4NA 1GPLA 1W35A 2D8MA 2GCGA 2X6TA 2QZ4A 4EVIA 4LAFA 1UEXC 4LDAA 2ATCA 1JFSA 2XOXA 1ISMA 3O0DA 4PGGA 5F7ZA 2C92A 5DNAA 3L7OA 4ZOEA 3TL6A 1JHQA 1MT3A 4HHEA 1Y9AA 4M9ZA 3TVDA 1LD3A 4GKJB 3KUKA 2VSNA 2ZJZA 2IKQA 2WP8J 4WZZA 4PHFA 4KC0A 4P32A 1ZVJA 5AOAA 3LTNC 2DM6A 2LKCA 4ML3A 3A0UA 3TUIC 1GRVA 1M2FA 4L4RA 1GL7A 3T41A 4WESA 4W82A 2GPJA 4P2BA 2GXUA 3DUWA 2R7NA 4Q9IA 5ADWA 1G17A 5TDHA 3A04A 2II6A 5C8DA 1KXJA 5LDHA 2NPFA 1HV8A 1K5DA 4TN5A 3PGXA 1YH3A 4L73A 4RK6A 3S2UA 2ZI3A 3SC2B 4JLWA 3B8EA 2EC5A 1XDSA 1YJCA 1AQ6A 3HRHA 4OLJA 3AT1A 5F2OA 2O3JA 2AWOA 3MSXA 1D2EA 3UG6A 1V3VA 2ZUFA 2NSHA 3EISA 5LMUB 1D2RA 2C57A 4TL7A 2QL5A 4NABA 1UPUA 4M0DA 4C0XA 3AVTA 2AB0A 2BMVA 5EIEA 1ITZA 1PEKE 2O0KA 2PXXA 1P0IA 2G5GX 1M6YA 2J0EA 2ZTSA 1ORDA 2FY8A 2Y2UA 3N2LA 5ALXA 1F6BA 1R5NA 3TZEA 1GTMA 1EUYA 2YY7A 3KQYA 2ALJA 3IJPA 2PG3A 1RHKA 1HYBA 3RW9A 3F98A 4BGEA 4DR4B 2C20A 1XQXA 2GAOA 3FIJA 4Q21A 3BK1A 4BE9A 3OA0A 2IXGA 4UHFA 1YUMA 1JZQA 1IBRA 4X7BA 4BV9A 1GHTA 2I3AA 2ZWVA 4MS4B 3P0FA 4EHAA 3N0TA 3P2OA 4EJSC 2Y76A 2CW5A 5B57C 5JH7A 5DW3A 4EM6A 4FZJA 5ICGA 4HS9A 2PLFA 3PFFA 1ZEMA 4PO9A 3HM2A 2ZE7A 4RSGA 1TQDA 2GHQA 4IJMA 1VYTA 4Y2YA 1I7QB 2COUA 1EFRA 1NIJA 1QYXA 4J0CA 1VLMA 4PPGA 3EA0A 4OJQA 5ECDA 3G85A 1FFBA 2GI4A 4FNMA 4IV0A 2QVYX 5AJUA 1XELA 5M3BA 4UE6A 1QFZA 1VJGA 5A3SA 5A03A 4BXOA 2OB2A 1ECFA 4BL5A 3NDJA 4BV2A 4DXHA 5KNCA 3AESB 4KQGA 1RI2A 1H2FA 3HYSA 4UMFA 2W00A 2FYTA 3N2IA 1XA3A 5D6OA 1UBRS 3HPQA 1JKJB 2W6ZA 3LQQA 2X0EA 5BNZA 1XZIA 3MT9A 2VXOA 3FPJA 4Q01A 4YT5A 4J3JA 2ANCA 3VJMA 2PRYA 3F67A 5GM1A 5JSYA 2F3SA 4BTVA 3DDZX 2QTGA 4XGIA 3RPEA 1F7VA 2RSLA 3V4RA 3RVBA 4CXMA 3VPBA 3X1ZA 4FD2A 4Q9JA 4ZCTA 2YZMA 1NBWB 1MJGM 2HHCA 2HU2A 1H4VB 2DVMA 2ZR8A 3IVAA 4OG2A 4HWTA 4E31A 3DAPA 1KYIA 2AC2A 1EBFA 1PD0A 1KP2A 3NBAA 1PTJA 4BX9A 1DP4A 2BP7B 2VP9A 2OCAA 3CCFA 1STOA 2GTIA 2ODEA 5A4KA 1RP1A 4IY1A 1SBHA 4GP7A 4ZCQA 3UTDA 2WD8A 1N92A 1M5TA 2J4FA 1VQ1A 3OOEA 1UP4A 4AUKA 3SEAA 2NTEA 3QTLA 4PZUA 4U7JA 2VHJA 3CCBA 4E5YA 5DW0A 3M5CA 3CE9A 5A2GA 4K7JA 2VHYA 3GT0A 2VBCA 3RIHA 1QZXA 2AFRA 3W6NA 3O75A 1RLOA 4OX9Y 1XEXA 3NWPA 1DRJA 4H31A 1K5GA 3RRXA 3BL8A 4LFCB 4AIRA 1GQOA 1GA6A 2E21A 3BXHA 1Z47A 4HNAA 5D5PA 1AQUA 1CD5A 1WD7A 1EI9A 1BYUA 2EV9A 3I32A 2WUFA 3PV0A 4MWZA 2BYTA 2BR4A 4J0JA 3PDWA 5ALJA 4LWOA 5JJBA 2PL5A 4XWYA 3UOWA 4RK5A 4IIGA 5MGBA 4CMKA 2XI4A 1PX2A 3IIEA 3KPUA 4KXUA 3V8NA 4U7DA 5FPSA 2PZKA 2F1HA 1F0YA 4RVHA 1IUOA 2EDCA 1LU9A 1VL1A 3E4CA 1E3MA 2PY6A 1L7VC 2IPAB 2PD4A 3UA4A 3VC2A 4LDRA 2OO3A 1K9VF 1QGOA 5CVDA 4CM8B 4H7EA 5E9AA 1SVOA 3F7MA 1J06A 2C59A 2QTLA 1WMDA 1H94A 3V4VB 4O4JB 2PKYX 3DTVD 4P5DA 1RJFA 1ZESA 1O58A 1TJ5A 4N8SA 3TW0A 3VU3A 5DXFA 2YXLA 5K3FA 3AVWA 4X71A 3GN1A 2ZB8A 3AZPA 4FFDA 1E7YA 1BE8A 3NDBB 4KBYA 1NT4A 1R0XA 1YQEA 5TMBA 5B1DA 4FKMA 1L8QA 1QFJA 2IYUA 4J29A 4S0ZA 3OZBA 5DULA 2JH8A 5TEVA 2ZDHA 4BKUA 1VXOA 1R9MA 5TVGA 2JVKA 3TW4A 1M6HA 4G4JA 1URPA 4UQOA 3WG9A 4QVIA 5FTLA 5B3AA 1THMA 1JRLA 3IOYA 4XQ9A 1IN6A 2FLWA 3ZDZB 2AIRA 3N9IA 1ENZA 1AXEA 5GV8A 4I7EA 3TDKA 3H97A 4MR8A 5JZOA 1HQDA 4ZKEA 2OORA 1CUDA 1JYSA 2OZVA 3IC5A 4HSEA 4K9SA 5H3CA 2QM7A 3AR8A 3TTTA 3WL6A 5HRCA 3ZE1B 4CKBB 3SI7A 2GN8A 1XDZA 1XVAA 5JCXA 2ZSUA 3WK8A 1RE0A 2C5EA 3WNVA 1KZHA 1L0BA 2QV0A 1QU3A 5IN5A 2X9NA 3TEFA 1RKXA 3HV2A 1E9SA 1G7RA 4W5OA 4KDRA 2F9MA 2X40A 3CEPB 3CIFA 1U8TA 3RJMA 3WKBA 1NLMA 2Q50A 1L5LA 4UM5A 1OWMA 5FDFA 3JATA 1FMJA 2CXPA 2P75A 1CUIA 1BWPA 3WMGA 2ZS8A 3D3QA 3RYTC 4MWGA 2HWXA 1MABB 2MR6A 2HW8A 2CDRA 2FPPA 1LX7A 2DP4E 3G88A 4ZVSA 1OILA 5P21A 4K9KA 1Z0SA 3CF6R 4MPTA 5KAMA 1PE0A 1F2DA 1RWWA 3BAZA 5E2IA 3FUWA 3NO4A 5EOVA 4DEVA 1AKQA 2VF4X 1Y8RA 4JK3A 1UODA 3T8YA 4DCMA 2PANA 3G13A 5IZ4A 3PU6A 2QRLA 2CL0X 2C2OA 4AMYA 3D8HA 2F59A 4JJKA 4C4TA 3MJ4A 4ARZA 4KNYA 1C8KA 1OAKA 1TECE 2HUNA 3O3NB 3M1YA 3THSA 3FCUB 1P91A 1RVV1 4AN1A 5FUBA 4YAFA 4BWGA 3HYCA 4HNSA 4QJ5A 3PD1A 2X2PA 4MPDA 3ITDA 5KTYA 3SHTA 3OZUA 4IFIA 1FSFA 1P7VA 3DEYX 3NHZA 1ZM3A 4IXDA 3V4OA 4CT4B 3I01M 1V9LA 2PUVA 4C5AA 2ODQA 4F6CA 2QD5A 1JMVA 5T8KC 4P98A 3ZY4A 4LYEA 3T4EA 5HSGA 2KSQA 5I7WA 1AO3A 4KH1A 1RXCA 3ZBUA 1JEAA 4BVKA 2BGMA 4TYWA 3K9HA 3E22A 3G8AA 5EUQB 3THWB 2HADA 3QTTA 2ZTHA 1PX0A 2BFWA 4QHYA 1NOIA 1B41A 2Z8YA 4EDHA 4D9JA 2NO0A 4CFYA 1Y7PA 5FBKA 1PZEA 2Y0BA 3SOZA 3V4FA 3ZI0A 4CM6A 1S6YA 3TUJC 3MCAA 4DTIA 1L4BA 2D1SA 5FBLB 1UBEA 1Z5NA 5A5EA 1E6WA 1R00A 1Z88A 2NADA 2XY4A 3A1NA 2R65A 1L5KA 4JV5B 1T26A 3KWFA 3ORFA 4NNPA 4XCVA 1CSEE 2EDAA 4CEJA 1M54A 3E9NA 5AKKA 3WMRA 4DSNA 4YRZA 4DR5B 2XNHA 1QGUA 1T6ZA 4RORA 1AKEA 4RZSA 2YUIA 2EKDA 5H9VA 3U3KA 3ID6C 4PLPA 1HG0A 3VZPA 4C20A 2ZXUA 5DTJA 1J56A 2C9BA 2CHVA 3P0JA 3T9BA 2NQ2C 3OE7A 2BFAA 2P8JA 1V8DA 3K1JA 4R2KA 1KMMA 4DA0A 4IKPA 5FOUA 4LJ8A 5HQ3B 1JKXA 4M9RA 4C01A 2XTZA 5FLXA 2VDKB 3CHYA 2LCQA 3SZLA 5BVGB 4W5JA 5EAIA 2X0DA 3TNFA 3AP2A 4E5DA 5I9NA 3IOMA 3T9AA 3ISTA 4B2PA 3GRCA 1XVTA 2EBFX 5E2AA 1GSIA 1NBMA 3K2QA 5J4KA 5K0JA 5ITZB 4JFRA 3VR2D 3UK0A 3EXEB 4LX0A 1VIVA 2FP4B 4FOOA 3U16A 5EY5B 1RC0A 3AUUA 3BA6A 3CJTA 4O5AA 1LW7A 1OF1A 3UXEA 5HM6A 3M4XA 1CUGA 4H4EA 2VF5X 4UUBA 4MW7A 4W6QA 5C7OO 4AWAA 4ZPJA 5C81A 4A2QA 1H1DA 1L8XA 3RROA 3WGIA 3NW9A 2AQIA 2SCUA 1G1MA 2JASA 2QR3A 2Z8ZA 1ZK2A 3AL2A 4FBMA 5E4TA 3SX4A 5BOSA 5IDXA 1EYZA 1XCLA 4XJTA 2N1BA 2FXIA 4LDNA 4LEIA 1KMHB 4JI0B 4DUGD 4R31A 3A6LA 5G4LA 3WS7A 4UNSA 4PC6A 4J0DA 1VBNA 2X4DA 3QHAA 4LY9A 2OSVA 4ZAFA 1CFJA 5EUBA 1O0CA 4JLNA 3THOA 2XT0A 3AZQA 2VQEB 2RHTA 2B78A 2IT1A 2XYRA 3FWYA 2FMXA 1QCCA 5KEIA 4NV3A 4UJ5A 5ULLA 1SC3A 1G0OA 1BZYA 1M0WA 1UKBA 3KKEA 1J5EB 2GRAA 3UWMA 1UZNA 1BXRB 1NXOA 5EIBD 2VJMA 4W4TA 5A3VA 1CQJA 4NX2A 5GVRA 3TVTA 3WK6A 1F12A 2W2VA 4FYVA 4NL4H 4M1WA 2ID4A 3ZKWB 1WMAA 1JAZA 5A3RA 1KYWA 1TLTA 2VYFA 1NVWQ 1UBUS 4QT4A 2LE0A 2VJYA 1HE2A 4BHTA 2HWWA 4UXJA 3HR4A 2A9VA 1RQ7A 3AF1A 2D1YA 1WM1A 3T7TA 1NVDA 5D86A 2YFKA 2J4CA 2W6QA 1Q7TA 4F4DA 1U3UA 1M83A 4ZZIA 2D1RA 3I64A 1YDEA 4PYKA 5JNLA 3WGYA 5AVQA 4CLRB 4JQCA 4N76A 4Z4QA 2NUPA 3TWOA 1ZVKA 1S2MA 3ACDA 3LPDA 3HJHA 1PLJA 2JIZA 2RBKA 3HCEA 4KN5A 4TQAA 5JEDA 2W6JD 1IBMB 1XMSA 4IICA 1YJXA 4LBYA 5FNVA 3MELA 3G17A 2AYZA 2QZZA 2ONCA 2Z8XA 3SHVA 4OMFG 3LFUA 3WMFA 4A0SA 1P33A 3K7EA 1X9HA 4DIDA 4INOA 5LA6B 4YRIA 1ESMA 3IILA 4I81A 3K9CA 2A9KA 4EYOA 2JHPA 3EDRA 5F77A 1TU3A 2HH9A 1Z68A 5HPYB 3C7CB 5HQJA 2K2WA 4PRKA 2RG1A 4LE1A 1W4BA 4IXTA 3WI7A 3B2QA 3LBNA 1CJTC 4RM3A 5DM2A 4JL5A 1QTRA 4KNWA 1S2DA 4M1TA 3RFTA 5BMVB 3IXQA 5LWQA 1CEEA 2FFRA 4QFMA 3RI3A 4OBWA 4D8VA 1NL3A 1G5QA 2J31A 3JV7A 3JQEA 3VDMA 1EAMA 3UK2A 1EGMB 5IH3A 3QJ5A 2GBFA 1Z25A 3X1KA 1CS4C 3JQAA 4KN8A 3R7LA 3P2MA 4C7BA 2MSCB 3NHFA 4D79A 5JALA 1Q6ZA 4KQKA 2FG6C 2YV3A 4YTEA 3BZWA 4LJ7A 4O4JF 2N46A 5CIYA 4EJFA 1O0BA 1YOBA 4QPDA 1X1QA 2PRSA 1J8DA 1I4WA 4RM2A 3BRQA 1JPNA 3ZXIA 3EY4A 5FULA 3ANXA 1YIOA 3ZNPA 2QJWA 4BQOA 1AXRA 2AG5A 4KSCA 3IOCA 4R83A 5CDTA 1AX9A 3A9CA 4PYRA 3TLJA 1H1TA 1E4EB 2B69A 2GKGA 3STXA 4KXNA 3OLWA 2G9UA 2DHRA 1G7SA 1HXHA 3DC2A 4U6QA 4BUZA 2J87A 3ZWYA 4U0KA 5IXYA 1KZ7B 3TD6A 5FI5A 2BGJA 5A9RA 3U13A 1DBPA 4KHZA 3JYNA 3BH6A 1IAVA 4K9DA 5JHHB 2IIQA 3X2SA 1YS2X 1NP3A 3GMSA 5H16A 1NBIA 4XA8A 3FYCA 3QBEA 5TE9A 2O8BB 5BRNA 4NZOA 3E35A 4KXMA 3SNKA 2GCOA 5EMKA 5FPHA 1GPBA 3A3OA 5D87A 1K8RA 1YR7A 2YCLA 1NMSA 2PWAA 3I3OA 3OZEA 1AC5A 4UZEA 5LZ4A 4PO3X 2QX6A 4WASA 2E18A 3GNLA 4IFBA 2WD7B 2BM8A 2W2PA 3QEKA 3RVDA 4JUCA 3HXKA 3MLEA 1VHLA 3C3JA 4N9QA 4ANFA 3C1OA 4DLWA 1HEUA 4LYFA 4D02A 3GQVA 2MHCA 4ZYVA 3SDZA 1PZNA 2JVJA 3LWNA 5TV2A 1U5AA 1SPXA 4YROA 4GLFA 1I1NA 5U9CA 2PS1A 5LLTA 3MOIA 4GC9A 2E49A 4IOKA 3RRNA 1V4BA 3A4NA 1K6IA 2DPXA 3ZHQA 1UQTA 4LJLA 2JFQA 4O29A 4I3GA 5H5JA 2GUWA 2H1HA 3SM9A 5EIHA 3AVVA 5DCWA 3VBCA 1WCIB 2Y1KA 4F92B 2FPSA 3AFMA 3NB0A 4QGBA 4QJ3A 5I8WA 4U63A 3LP8A 1XK6A 4JKIA 4AQYB 1JBQA 2F8LA 2E5WA 2QRVB 4YQZA 5K3DA 1VHQA 3UICA 1AS0A 3OC6A 3RJZA 1ZAKA 1WIWA 4JJIA 3D8TA 1K92A 3N5CA 3KZKA 4YMUA 4F3TA 2Q3LA 1XD8A 1HRKA 1Z2PX 2ZUCA 1E5TA 1XUOA 3B1XA 2VAMA 2WRZA 5E95A 4GYJA 2YQ4A 4OMDA 1E6LA 2OBFA 3P4UA 1EHIA 4XWAA 2NQ8A 3RAGA 1NJ8A 4DZRA 3EFEA 2OG2A 2R25B 2CBGA 3ETNA 4GR5A 2YINC 2GEBA 2KW5A 2MMCA 5EG5A 1UAYA 4EI2A 5MGNA 4OYHA 4PU0A 2VNJA 2ZIUB 3I2IA 1Z83A 2XXAB 2EFCB 3ZTYA 3FLAA 2ZRMA 4FMCB 2B4KA 1GXSA 3BMOB 4CMEA 1MIOA 1N0VC 1QGED 4CL8A 5G0UA 3GRZA 1X1BA 3R41A 2FQQA 1U9ZA 3LVQE 5B36A 5CCEA 6GPBA 5HJ2A 4PSCA 5HXAA 4DCOA 2VTDA 3EGEA 3AFIA 1OA0A 3WNCA 2VJOA 4HAYA 4JSYA 1CZHA 1DQZA 2V1UA 4P7GA 1U7XA 2A6PA 1M7HA 2PSSA 3LPAA 5KHAA 4J6EA 3UHAA 2QU8A 4CEHB 3R3HA 1QHHA 1S02A 4LHZA 2PJZA 2QSYA 4GE0A 4RFSA 2BGIA 3WTBA 3K20A 1ENYA 4UQPA 2CYBA 2QGNA 3NHYA 1A82A 3ZCRA 4BLOA 2JZOA 1ESEA 2J9FA 4Y6LA 5DSXA 1KOJA 4F5YA 2VP6A 3ZU2A 4QBKA 3UMGA 1R8XA 2ZI7A 4KI0A 2JARA 5FV4A 2PQMA 1SD2A 4DT1B 5IVKA 3HRIA 4ER0A 1LW6E 1UMDA 5HBGA 3RTEA 3LTEA 4R1PA 3T1YB 2Y0CA 2ORYA 2XRYA 4IWNA 1YMVA 2ZXEA 2OV6A 3PG5A 1CDEA 1RR6A 4HDSB 5BYAA 1E5LA 1P45A 3C24A 3VAYA 4EPVA 1S2GA 2I80A 2IYVA 1I2AA 3QRWA 1JR4A 3MBKA 1I9GA 2HHAA 4PAMA 5E0KB 2QPAA 2GTPA 2QT1A 3Q2IA 1W36B 1X8XA 1G20B 4GL4A 4DJFC 3ANYB 3BT7A 3CH6A 2JF0A 1JDJA 2I54A 1QYWA 3OCYA 5LP6A 4N6GA 2ZPTX 1F2TB 1D5CA 1BD4A 1NI4A 2X8BA 3U3JA 1DI0A 4LCJA 1JLRA 4PY2A 5AESA 1AY0A 2DBZA 1PDWA 5BP7A 3Q5GA 1EE9A 1S4QA 3NPMA 4IVQA 2AE2A 1OUMA 5E9QA 3PB3A 1GGKA 4H3VA 4E3WA 4DCPA 2XE4A 2VQFB 2OBLA 3P9RA 3N2KA 3X43A 1XRJA 1F2UB 4BNWA 4PSUA 4CKCA 4C4YA 1PR1A 3E23A 4JMPA 3KZVA 2HO5A 2EJWA 1NN0A 3MLAA 4B9AA 1W0JD 4G0WA 4DCSA 5LB2A 1UBHS 3MIZA 2FX5A 3VPFA 1OTHA 3K6KA 2RE8A 3HDTA 3NIBA 4EHFA 2M98A 2P9ZA 1OIWA 4XGKA 1J2JA 1IFXA 4FE7A 3AW8A 5EEHA 2HIAA 4XGNA 4ZC8A 4H1UA 5LQCA 1HDXA 2DGDA 1P62B 2GBPA 1TEXA 3DF7A 2DBRA 4YVFA 5G1PA 2XYVA 3PVZA 2XDQB 2QW1A 3GA5A 2H1VA 3PQ4A 2LPMA 4JUAA 4RMIA 1IG3A 5AM1A 5K4GA 1EVIA 3UMSA 1Z0ZA 5EHGA 1ORVA 2RC6A 4H7JA 1RYEA 1YE5A 4A0GA 5C1OA 1JVNA 3ZHOA 5ELXA 4ND2A 1E1QA 1G2OA 2NU9B 1DL5A 2WHYA 1Y98A 4KQEA 1LF0A 3I5UA 4LYAA 3AR4A 221PA 4BNDA 4NNOA 4F9FA 4DDVA 1T3HA 1S0UA 2HPAA 4E33A 4B74A 4E6EA 4WY2A 2VZLA 4FGKA 3NHKA 1E1YA 2X3UA 4CMIA 3TEJA 2HDOA 2HPHA 3GG9A 3ZW7A 2XGMA 1KNXA 1QO9A 4I6JA 3LC0A 2O59A 3T7IA 2HMAA 5TJHA 5LA6F 1IXSB 4HDMA 2H2WA 2XUPA 4OQYA 4ER6A 1KH1A 3K30A 3QMPA 3TTVA 5JXIA 2DWOA 3OWOA 4NBVA 5AM5A 4FHZA 1W52X 2IODA 3ASZA 4IGFA 1IB6A 1P72A 3LF2A 3QFFA 5BRJA 6CHYA 1IBLB 2OGUA 1M2GA 4NPAA 3T7JA 3HJRA 3QVVA 4WBNA 4IDDA 1R0KA 4JQOA 5A1JA 1I4OA 1CG6A 1K5PA 4WV3A 3NBYC 1LJ8A 4JSRA 4MS1B 5TY0A 4MGEA 5F21A 4F04A 4EF6A 1PD1A 1Z39A 3V4PB 5FJIA 1UBOS 3OOSA 5BSRA 2CZQA 1RXVA 1EA7A 2J1LA 2VUSA 1NV8A 2ZJ1A 3G9UA 1SB8A 3GRPA 1ODIA 5C7LO 1NUQA 1JI3A 2VNAA 5IFKA 1FSZA 5DP1A 5CG2A 1QHNA 1PO7A 3O92A 4G0YA 4IDOA 3EMKA 1GQQA 3JSAA 1M2VB 2C7PA 1R0YA 4O4HA 1GTJ1 3ZWNA 2V4UA 4OAPA 3V2HA 1L3CA 2CWWA 4GOKA 2YHAA 1M0TA 2CE7A 3COZA 2YIJA 3BJMA 2P4UA 4WD3A 1UQRA 5TF4A 4EJSB 3BKWA 5JXGA 3SM3A 2QV7A 2QN8A 4WERA 2ZJ5A 3P0IA 1ZBDA 3SSNA 2FSVC 3IO3A 3Q0TA 3E9ZA 4J4TA 4M46A 1NXWA 4RHUA 1H5QA 4JGBA 4MO9A 3ZG6A 5LVAA 4NG4A 4JI5B 2FCAA 2HMWA 1U8FO 2O2SA 4R1NA 4JDUA 1M1YA 2JAQA 2QLBA 5F4BA 4EY7A 4QO7A 1GG5A 2UYYA 1Q1ZA 2EFGA 1PL0A 1PTKA 3CH7A 1WOYA 1Q2XA 1WDKA 4E70A 1K0UA 2FZKA 5E3JA 5CHYA 1I5RA 1XWIA 2XJ9A 3U60B 4FBLA 4O0MA 3Q7RA 4A8HA 1UMCA 3D0QA 1TAUA 3I1FA 1FCJA 4DMHA 2WUGA 3GPCA 1QNFA 2QMHA 4E5NA 3UJNA 2WVHA 2AYYA 5J5VA 3BQ9A 2RH4A 5CYGA 3FKJA 4OHYA 3PJEA 5EYPA 4DLSA 2JK0A 2Z3WA 3AM3A 5FA6A 1MQ9A 4WKNA 2RAVA 4LYJA 5JAQA 1LK0A 1SXJB 1N6LA 4XSHA 4BO2A 4TVOA 2AJLI 4Q4HB 2YZ2A 4FFRA 1O89A 4JUDX 5EWLA 4ISCA 4D3SA 1MZVA 1G16A 1II8B 1W4AA 4B6FA 1V25A 3WXMA 1OASA 3UHJA 2WMYA 4F2WA 1GQ2A 3FDZB 4BN5A 5IKEA 2ZATA 2Q5OA 4YYZA 5FRDA 3TFQA 2BFDB 3RJTA 2EL7A 3UV6A 5J4YA 3PF8A 5F2EA 2LIPA 5IT5A 4DBLC 2YMQA 4I66A 3Q12A 5K1ZA 3CURA 1C9KA 4FFOA 4RPJA 1XLTA 2BDUA 1MO5A 3KELA 5AK4A 5DI3A 1DTWA 4L07A 3TOCA 2WF9A 2Z4TA 3PUJA 4FNGA 3HEMA 2X8LA 1P4RA 4JZYA 5CFQA 2O3UA 1IQUA 4I8XA 4MHSA 3E7WA 2NVUB 4E11A 3PSAA 1YSCA 2BZ0A 4L16A 2P9HA 4XD7D 1AUVA 1ZN2A 4ZWNA 3DLAA 1DO2A 4HWSA 1IXYA 5L95A 1ZVVA 2FWNA 5KCMA 4TX1A 1TB4A 2GPYA 3GF4A 2HXGA 3DZCA 4HP8A 4NYIQ 3HKCB 4Q34A 3D64A 4QXRA 5KDLA 1JYEA 4C7XA 4EHDA 2UVPA 1AUOA 1SQ5A 4RTNA 1R6XA 3A4IA 3H5WA 4FMCF 1E2JA 2FR0A 2G72A 2W48A 1FDSA 1MLDA 2PTGA 1ZG3A 3AHIA 3FUTA 3K05A 1RM0A 3L3BA 4KYTA 3BILA 1VMAA 4AVYA 2Q3BA 1Z5UA 2QAGB 5KDDA 4RA6B 1R15A 1Q1EA 3PHGA 1NXVA 4M0PA 3OPMA 1Y7TA 4QPNA 5F9HA 2L0XA 3ZDCA 4DV2B 2B1QA 2QTNA 1BHSA 2VCEA 4QU5A 3SQDA 4DLKA 3ND7A 3H18A 4ERNA 4X6XA 3B1JA 1N0HA 4KN6A 4R2JA 4JXJA 1KAHA 4EB6A 4CTNA 4X45A 4QTTB 1S4MA 1VZ3A 2QIOA 1LA2A 3E0QA 4A6PA 5HUQA 4YWHA 2IC5A 3OMXA 1OFTA 3HB0A 2GR9A 2C3OA 3DVLA 4M0FA 3NTQA 2CK3D 5BPHA 2G71A 4DV5B 1TM2A 4WZAA 1BU8A 4CL0A 5EHXA 1XZAA 4K9PA 4Q3BA 1A9OA 2HT1A 1CUSA 4DC0A 2I8AA 4LQLA 1OHHA 1RAEA 4ESOA 2JNWA 4FDTA 3TLMA 1T5DX 3HA7A 2QN6A 3M5PA 2CLKB 4KG7A 5K4AA 5HKKD 3T9CA 1W85A 3GQBB 5LP6C 5T6MA 2B4AA 3F4KA 3SZOA 3CWQA 2J5BA 4L6IA 2C99A 2HEIA 1WD5A 4QYSA 2XEDA 1DKMA 5E38A 2C88A 4LXUA 1HG1A 3ICWA 2BFNA 3OU7A 3JX9A 1JHPA 1SN7A 1H8EA 4P3XA 2IZ5A 5KMGB 3VNBA 1PGPA 4CNQA 4X44A 1F0NA 2J0VA 3LOQA 2YY5A 4QIHA 4R8RA 1GZDA 2W4IA 2C7OA 1FQOA 2ZRDA 1XD2B 2ON6A 3GVXA 1NG1A 5JDIC 1JS1X 1RKBA 4WMLA 1PJTA 4H35A 1S8AA 1XO1A 1SUDA 1XMXA 3S4YA 4TLMB 4C4SA 1O0SA 1Z18A 3NI2A 5CDFE 1G8GA 2M9MA 4J7AA 4UVDA 4I4NA 4MVJD 2K7ZA 1E1CA 2IY9A 1N7HA 4D0RA 3KR0A 5L6LB 1SFRA 4Z2YA 3ZLUA 1KS2A 4RY0A 1R0RE 2Q5JA 5IK2A 3PFHA 4EGAA 1GGHA 4TVKA 5IT9A 5IKPA 1ZA1A 4ZZ3A 2P40A 1E5VA 4MYUA 2JFPA 5CLIA 3TZBA 3DONA 4URHA 5HKBA 1YTUA 4YIKA 2XCIA 1Y1TA 4DUYB 1I33A 1PRYA 5T64A 2QMZA 1FRQA 4LJ6A 4XQ0A 1C14A 2YHSA 5KUTA 2WEKA 4QDXA 2FK8A 5JXHA 3LW8A 1CCWA 2C9MA 2EYUA 4OF4A 1RYZA 1J8QA 2WTBA 3LHIA 1CC1S 2JA1A 3R1IA 4B7CA 2JGDB 2ACKA 3CWCA 5ARCA 3P9QA 4M8IA 5B53A 1GQSA 2G0TA 1U1FA 4N7BA 5I7RA 3MFQA 4GOND 4AXBA 4B6OA 4HDOB 4JR1A 3EQ2A 3F2VA 3GH3A 1G8PA 3TQFA 2OEPA 1DFGA 2ODTX 3LO8A 1CLEA 2JFXA 2IHBA 4RZXA 4MAAA 1MENA 3ESYA 3EZGA 3NWOA 3M8KA 3OM0A 3PEVA 3N75A 3PQ3A 4PLZA 4KUGA 2JLVA 1WXFA 1SIOA 3EWNA 4H6VA 4BECA 3P9PA 2ISCA 1JEQA 2A78A 5CURA 3A10A 3H42B 3EFHA 1AJEA 2RHGB 1WX1A 2Q0SA 2ZJFA 3EFBA 4WPGA 5FTJA 1CE8B 2P2LA 5F1YA 3V1YA 1OX5A 4Z1OA 1Z28A 4B84A 3JQFC 3AH8A 2HN9A 3O91A 4TMWA 4IO1A 4WOJA 1NKTA 2ERYA 3TN7A 5DCLA 2IIPA 3D6JA 1CJBA 5REQA 3ESRA 1A8HA 1U04A 2RBEA 4RPIA 1OXXK 3P5BA 3OUTA 4CF6A 3HVRA 1SWWA 4HWPA 3DLTA 1WXDA 1BX1A 4ZI2A 3ZDXB 3GUZA 2YWXA 1K8XB 4LDQA 5CVEA 3M4JA 2CVQA 2Q1SA 3U5ZB 1DAKA 4PLHA 5C7YA 1G21E 1LBHA 4OQFA 3S99A 3BFKA 1RJEA 2VA9A 3Q3JB 1XOIA 1Z63A 5D51S 1SR8A 2PZJA 2ZREA 4REMA 3KBOA 3HCWA 5KJ6A 1TZJA 4X3PA 5KWSA 2Q9CA 3EGVA 3I6YA 4NCJA 4QFBA 4FFSA 4AW9A 4TWBA 1VE6A 4NLLA 4R2HA 3UWSA 3UCEA 4OVKA 3SQXA 5IDYA 5MHTA 1PVOA 1QONA 3N0WA 3GGCA 2A59A 1RXUA 1EHYA 3WSWA 2JFFA 4ND6A 4TLCA 4AJNA 1KEEB 4HDCA 2VS1A 1HORA 2JHFA 1M1NB 4NXMB 3FVRA 3L0BA 1BE6A 1M8KA 4D7AA 2NUAA 1CIVA 2RBGA 3EMBA 2C1XA 3ZVLA 1X1RA 1NX6A 4L95C 3M6LA 3MMPA 1GGEA 2IIVA 3S68A 3EDOA 5BSVA 3VAAA 2BI4A 4L8WB 4KWHA 5C80A 3INYA 1L3IA 2KB0A 3AEUA 3PKJA 5F2NA 1GITA 3AEYA 3IB6A 4ND8A 4IIBA 4DMGA 1P2UA 1M2KA 2AZTA 4MV8A 4OK3A 1T4CA 2Z2YA 1ZIOA 3W6UA 2EP5A 1VLLA 3FDFA 5DT9A 4FIZA 5AW1A 1XF1A 4R16A 4M36A 5T5QA 1X92A 4PZ0A 2JBAB 4Y6QA 5G41A 4WLEA 1YBMA 2GVDC 1N4AA 1KOFA 1UKEA 5LC1A 2QY9A 1GR1A 1Y5LA 2ZU0C 3FJOA 1JXOA 3G0IA 4LC9A 3OQJA 1JF8A 4MEAA 4DNFA 4ZYXA 4KMOA 2Q29A 4QFCA 3RAEC 1LFAA 2Q1XA 1OJ7A 3NAMA 5DYIA 4LXYA 5SY9A 2CVZA 2H1LA 3RC8A 4K8OA 3QOXA 4DARA 5CFNA 1VHWA 4G5YA 3RS5A 1YRHA 2BFCB 3GWGA 2ZG6A 1FE8A 1JAHA 4KXQA 3CS3A 5DLPA 3TBKA 4O3MA 2PYZA 4HGOA 4DEXA 4QUGA 1I3OA 1QRRA 1YFLA 3NU1A 4TV8B 1U8EA 3QKUA 1Q74A 4QLAA 3Q4GA 3G2HA 2OESA 4R8SA 1KJQA 3CPEA 4WKOA 1AHHA 3B1WA 3WGQA 1ZUWA 3BXOA 4NI5A 4C0KA 5C1BA 1UWVA 2VXYA 3KVRA 3H2YA 4KX3A 1FLVA 4NFHA 1NLYA 2EP8A 2OQIA 2YBEA 3A06A 3DFIA 1B14A 4YRKA 2H7VA 3FETA 3T1HB 4LK3A 2J9RA 1T9KA 4RGYA 3W9YA 3I30X 1NPYA 2F48A 3ZNNA 5AVOA 4ER5A 5AW2A 5CW2A 4D44A 4AU1A 4G8BA 2XIJA 3GDGA 2C2YA 3K0AB 1JXQA 4ZREA 2OLKA 5IBPA 4EA8A 1JT2A 5I8PA 2FXVA 3PHJA 3QF4A 3PNPA 3SKYA 3VYTB 2GPTA 4FFVA 4AO7A 4IYRA 3Q3VA 3MJDA 2QSJA 1Y9DA 2I1WA 1Y6FA 2F6RA 1L7EA 1QKIA 1NBOA 3JQ8B 1JQDA 3DEKA 3LVRE 1GL3A 3L6RA 3L1IA 5E4YA 3U7IA 4DV3B 1U5BA 1W6UA 2JPDA 4EEKA 1X9IA 3IUYA 1UCFA 3LPMA 1QQTA 4JS0A 2ET6A 4MR7B 3WLAA 4YCSA 1DVRA 1W5SA 3KT8A 4J43A 1A27A 4ZI5A 3COYA 3KPYA 2UZIR 2YWRA 3UJ6A 5A4IS 1IONA 2XNSA 4TOIA 5JE8A 1CQWA 5FBQB 4BFLA 3DZHA 4NHOA 3LX6A 1EG2A 3JCZA 3REQB 4FPXA 2NO9A 4A6EA 3D6NB 5L4SA 1X2EA 3NHUA 2WM9B 3GELA 1MGPA 2GEKA 2QSUA 3NOVA 2XXBA 3QLVA 2W11A 4LXHA 4Q0MA 4RW0A 1N75A 1WP4A 2QVZX 4G0UA 4MZXA 3OZFA 1RCTE 5HMLA 2PUWA 3UK1A 5IAOA 4DQXA 3LPLA 2AXNA 2DSTA 3FOBA 2Z57A 3M6AA 3EDMA 2NACA 4BO5A 1GLVA 3RHZA 2BAGA 4D9CA 2VL7A 3F97A 1FRVA 2H63A 3KFLA 4V3CA 5HIJA 4LSZA 3BL5A 3F78A 4CQJA 1OI2A 5K0EA 4OQEA 3OICA 4QOHA 5CH5A 4YP7A 4KXYA 3HP1A 3O1JC 1MOPA 3ZWQA 2NP7A 3KL4A 4HPWA 2FN7A 1UXGA 1XZFA 1KDPA 2GAFA 2QRZA 4UE2A 2IOQA 2C7RA 1UJ5A 2HC9A 3TLZA 1ZMRA 1YS9A 5TJ9A 4FQ8A 3MB5A 5AXCA 4UNRA 3QVMA 4JP5A 2CCKA 4GWLA 1XMOB 4PCAA 4LHEA 3EQZA 4MW2A 4M89A 2WSIA 5E1DA 3CG4A 3PJRA 1DBIA 2VLIA 2AOWA 5DXAA 5EJ9A 1FX1A 2W6PA 5KYYA 2PX8A 1M74A 3GJTA 1SURA 3GJYA 3HJNA 1Y48E 1GR0A 1RAIA 5FL7D 4DLAA 1PQPA 1LRJA 2DFNA 4DQDA 1N25A 4YLYA 4JXZA 4DPLA 2ABWA 4XOIA 1AHNA 3C98A 5M2QA 4EKDA 2XUOA 3BD9A 1IK6A 4LK2A 1Q12A 3LL7A 1OXKB 2HJRA 3LUDA 3LK6A 3W79A 2AG0A 5CVVA 1UC9A 2JLYA 3ES9A 2C0QA 3OO0A 1DC3A 4HSGA 3NIDB 1UZAA 1U2SA 3PK0A 3UJCA 1NAIA 1ZRNA 3ZE6A 5B7GA 1EH5A 1RWNA 3AMVA 5J2UB 3RYHA 3JYQA 1KRWA 3NHPA 1E3SA 2XH8A 1Q16A 3VOSA 4FMBB 2EARA 3NV7A 3ZTTA 1IXZA 1XJQA 1Z0FA 1E2DA 3HXMA 1SH7A 4JYCA 1E2QA 5KQGA 2FLKA 1H0SA 1XZBA 2P78A 1AU9A 3WA6A 3TQOA 1X7ZA 2VYNA 1O8CA 1DWQA 4YAUA 4HAOA 1XKXA 4XDGA