1X1EA

Crystal structure of tt0495 protein from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
MERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title Crystal Structure of TT0495 protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 85
structure length 239
sequence length 239
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x1eA00
4OSOA 3B1KA 3RUDA 1EQUA 4OAQA 2ZCVA 3MCVA 2VZ9A 1NVMB 1HYGA 2D8AA 2EW2A 3VH2A 5FEUA 2VT2A 3S2FA 4F6LA 2AG8A 1LRJA 4YAKA 4ND2A 2VYND 3VOSA 4J2OA 1T24A 4BNNA 4FC6A 2CD9A 3GOHA 4P22A 4DYVA 2P9GA 2GZ2A 3SVTA 4DQUA 5HBRA 1BXKA 4XQ9A 1BMDA 1PX0A 1R16A 1DIGA 3BA1A 3PHHA 4J4BA 2A9FA 2CUKA 3TJRA 3ZGYA 4UUPA 3PI7A 1Y8RA 4FD3A 1N2SA 3NJ4A 3MJEA 1X7HA 1Y8QB 1Y7TA 5C37A 4FGSA 3TOZA 1ONPA 1ENYA 4L75A 1P3DA 1FJHA 3IOYA 5G0SA 1M6WA 3IMFA 4RPJA 1YB1A 4XZ3A 3CZMA 4IIUA 3GNQA 4H7PA 2EKQA 1ZCJA 1DHTA 1NFFA 2YYYA 3I52A 3PRJA 4DL9A 4MIEA 1PWZA 1O0SA 3WQRA 2GZ1A 3HFGA 2DTXA 3TL3A 4CJXA 4WLUA 2AQIA 4XDYA 1YDEA 1V0JA 3GEDA 1KC3A 4KMSA 2W2LA 4D3FA 4PVCA 3U5TA 1EUDA 4HFNA 2VZ8A 1O89A 1JAXA 1GZ3A 1JLLA 1PL6A 4ZHSA 5A9SB 4ND1A 1Y5RA 1J6UA 4QEDA 5EN4A 4HV4A 4ZJUA 3BMOA 1SOWA 4LVCA 1X14A 2IRWA 4I5FA 1SZJG 3VC7A 5ER9A 3PHIA 1A9ZA 1Q0HA 1E92A 4WCFB 3UUWA 1MP0A 4XRGA 4IXTA 2O23A 1P31A 2O48X 3VPHA 2RIRA 4TVOA 3KEOA 5FF9A 3K2BA 2HKIA 5A3JA 4XDZA 2YFQA 4FQ8A 4AL4A 4CM1A 3TFOA 2EP7A 2D0IA 2H9IA 3FNHA 3ZWNA 1PU2A 1I01A 1XG5A 3AOGA 3O8QA 4AJEA 3ZHBA 4CV2A 1VL6A 1R4MB 1WZIA 2O3TA 1DLJA 1D3AA 4JX8A 1ZKMA 3UAGA 1MV8A 2HMUA 2QIOA 4RVUA 5EINA 2WE8A 2AEFA 3C3XA 4RZHA 3TZCA 3L4BC 1N5DA 1WMAA 2BFMA 2VT3A 3QVOA 4RQUA 3QA9A 4XKJA 5A02A 5L7WA 1WP4A 3LLVA 4KQXA 1W4ZA 1DFHA 5JDIC 2DT5A 3ULKA 5JYDA 1ISGA 4CL3A 3QY9A 4R1SA 2XXBA 3GGOA 5JE8A 1EUCA 2YQ4A 4ALMA 4DMLA 2WMDA 1VJ1A 4ZRMA 5JC1A 2V65A 2ZB3A 1I32A 1NR7A 4RPHA 4TRJA 4BKUA 4BNIA 3VDQA 1EFLA 4KZPA 2DPHA 3L6OO 3K31A 1HYEA 2ZIZA 1G1AA 4R1NA 3UXYA 3KO8A 1I3LA 1FDWA 1TEHA 1UAGA 5L7YA 3VPGA 4IGFA 3AM3A 3GH3A 3IL2A 4CLOA 3KYCA 3K30A 3QW2A 3G3EA 2GCGA 2VHZA 4PG4A 4IDDA 4B7XA 3ZU5A 1R4NA 4PLFA 4E32A 2X1HA 1YVEI 4E31A 1QLJA 1OI7A 1YJQA 4JBHA 1AXGA 1NM5A 1QYCA 4KUHA 3WGQA 1C0PA 4Y67A 3UCEA 3WGHA 1A9YA 5BSGA 2AHRA 3G0OA 3SJ7A 5GZ1A 5F5LA 1AXEA 4Z9FA 2DKNA 2ET6A 1CYDA 3UCFA 3L6DA 1H6DA 3KZVA 2J3JA 3GF4A 4AJKA 4BV9A 3C85A 3AFNA 2QQ5A 4RDHA 5JS6A 4XB1A 3GRPA 3ROQA 1O9BA 4OKNA 1T2DA 3JYQA 3EZLA 4M54A 2AE1A 2PFGA 2I9PA 1YJ8A 2HU2A 2WD7A 1MB4A 3ORFA 5CG1A 4KDFA 1DBVO 1JKJA 1U3UA 1GYPA 3WLFA 3TZKA 3C8MA 1JDJA 5DULA 5IDWA 4Y6SA 1R0LA 3GRKA 2VOJA 4ROSA 4IMPA 4IPTA 4RVGA 1Q7GA 3ZNPA 3AI2A 2Q99A 4CQMA 3C1TA 1GUFA 2JFGA 3I3OA 3GZNA 1NFQA 3FSRA 1DIBA 1NHGA 2OORA 4BNZA 2FSSA 1KERA 2I67A 2VNSA 1BG6A 4NMHA 5I9NA 3JQGB 1B0AA 1EDZA 4WPGA 4EI2A 4DPKA 2X7HA 2RBEA 3CPSA 2BHLA 4KP7A 4NU6A 1BDBA 4UVGA 3RU7A 2AQHA 1PGJA 3AY6A 4E2ZA 4U0JA 2J3IA 2BGMA 1SBYA 1F17A 4FBGA 4GWGA 4DYDA 4DUPA 3ONFA 4TVBA 1NWCA 3DMTC 2CZCA 4YCAA 1HSZA 4YPOA 1YBAA 4FOOA 4OH1A 1CDOA 5GY7A 3I4FA 4TSKA 4BGVA 1LRLA 2X0IA 3QLJA 1EBFA 2GN8A 3JQEA 2X0NA 2X6TA 3H8VA 5CDYA 3TL2A 1ZEJA 2VYNA 1EK5A 3QQPA 4R5HA 3AI1A 2PGLA 4FCCA 3CXRA 2D5AA 4RZIA 1X15A 4D46A 4LMRA 4M8SA 1QMGA 2DBRA 2PZMA 3UF0A 1IOLA 4KWIA 5F1OA 5IXSA 4ALJA 3RUIA 1I3NA 4RF3A 1DJQA 4MP3A 4WASA 1GFSA 3PZRA 3OICA 3BZUA 1NWHA 1E3JA 3WX0A 3WNVA 4J43A 4WEOA 2FP4A 3V2GA 2ZQZA 3I5MA 3T7CA 2OOSA 1ZSNA 2Q49A 3NGLA 5F21A 4RL6A 5LCXA 1ZNQO 3ROPA 1JW9B 4YYZA 4UEKA 5G0TA 3NT5A 5I8ZA 1IE3A 2X9VA 3EZYA 1OAAA 3W4KA 4QUKA 2GR9A 3WMXA 4E5YA 4PLYA 1J4AA 3U3XA 2C2XA 3COSA 2Q3EA 3AUSA 4QFCA 2D1YA 5HWSA 2O4CA 3ZH2A 3JQ8A 4J2HA 2NSDA 2P4QA 4BS9A 3IKVA 4BKRA 2YW9A 4G65A 3EW7A 1IHXA 2O3QA 2LDXA 2VHVA 1Q0LA 1JTVA 2BLLA 4IDFA 4PZCA 4UULA 4E12A 2C2YA 5A9SA 2JAHA 4KTVE 4NBRA 2NM0A 4BNMA 3D4NA 3LVFO 5LDGA 1O5IA 3E03A 4C4OA 3CINA 3GMSA 1ZK0A 4WCFA 4CQLB 5IF3A 2DUUA 5T64A 5A9RA 3R0IA 1QYDA 1S6YA 3B1JA 3FWNA 4BNUA 4E33A 1EMDA 3FR8A 3JQ7A 4IIVA 1C0IA 4MVJE 4CLRB 5CDGA 3DFZA 3OEYA 1P1JA 1MFPA 4GMGA 5BSFA 4J4TA 4AFNA 1R4MA 4NBVA 2UAGA 1TT5A 1Z75A 2ZTUA 2C0CA 3H2ZA 4PLVA 4RPGA 1NAHA 1HSOA 3RFVA 4GH5A 4Q3EA 3QIVA 1R12A 3E9NA 5JCJD 1Z7EA 3FNFA 1SNYA 3ZDFA 2GRAA 3AU9A 4MVJG 2FHSA 3EVNA 3U4CA 3VTFA 2P9CA 2P9EA 5EERA 2Y67A 3IUSA 3JV7A 3N7UA 3PJDA 5ER6A 4L74A 3WS7A 4B7UA 5TT0A 5T6BA 3V2UA 1VE9A 5EMHA 1MC5A 1GL3A 2UYYA 4L4RA 4N5LA 1FDSA 2HSDA 1LC0A 2QG4A 1K6JA 2I6TA 7MDHA 5TNXA 3LZ6A 3VHRA 3QSGA 4CLEA 3K92A 4NK4A 4PG8A 1LUAA 1ADBA 4FN4A 1UXGA 4C7KA 1PS0A 2EIHA 1E0DA 1KEUA 2YUTA 2DC1A 3SJUA 1QORA 4HNHA 1UXHA 4GX2A 3WGZA 5JYEA 4RPKA 1ZEMA 4D41A 4IS3A 5JFOA 2C59A 1GPDG 4D45A 4S3MA 2BELA 1E1MA 3IKTA 4R1UA 2GDZA 4A26A 4I1IA 4CV3A 2EGHA 1I2ZA 3KYDA 1I8TA 4EEZA 2YV2A 3DBRB 3WB9A 1VM6A 3ZNNA 2AA3A 3DOOA 4AJJA 4CM7A 4J0FA 3CZRA 4OIMA 4CL8A 3IQDB 2V6FA 1XYGA 4Q3BA 2R00A 2HAEA 5I7EA 3LC2O 1KY4A 3PHGA 3PFFA 3PJGA 2EF1A 4DIBA 1QG6A 1YE3A 3LT1A 2PY6A 4JP2A 1ZBQA 3ABIA 1B26A 5IN5A 1LQUA 3ZZNA 1ZXBA 2Q50A 2ZTLA 2NQTA 2DBVO 1ONNA 1JAYA 4D3SA 2E4AA 4IJUA 3RJ9A 1EVIA 2DVMA 2VRCD 4J9UE 1PJ4A 1U4SA 4HXYA 4OSPA 4S1VA 1L1FA 3WXBA 3G17A 4GQAA 1IUKA 4ND4A 2J8ZA 1EDOA 3WJAA 5ICSA 3H3FA 2B4TO 4UAGA 4YT5A 2Z95A 2NU6A 3I9NA 4NHEA 4YRAA 3RUEA 5C5IA 6ADHA 1HZZA 3E18A 4KUEA 5A1TA 1FDUA 4RVDA 1GEEA 5EESA 1YKFA 1LBEA 1ZVMA 3CTMA 3F4LA 3ITDA 5JMPA 3VZPA 4LISA 1GZ4A 2TMGA 1JN0A 3OECA 4Q9NA 5B4VA 3WMWA 5C3MA 3CUKA 4MVJA 3NGXA 3KLMX 1A72A 2PD6A 2WTBA 3I9KA 3BTOA 4XJSA 4ZQBA 1XKQA 4EUHA 2X5JO 2VHXA 2YDYA 3WJ7A 3WBBA 3AW9A 2NVUA 4BQPA 2YJZA 1V3TA 4U0KA 5A05A 1FDVA 4Z9XA 2VUSA 5IDYA 1I2BA 3WYEA 4HP8A 4OM8A 3BHMA 4RO0A 1M2WA 5KJ6A 1SC6A 3JQFA 3E82A 3QVWA 1A4UA 1WMBA 5J23A 1LU9A 2GPTA 2VUTA 3RAJA 1HYHA 4OGWA 1YDWA 3F47A 1BTOA 5COQA 1HTBA 2V6GA 1EFKA 1NASA 3KOUA 4UUMA 4BMVA 1XU7A 3DHEA 4FFOA 2A94A 3BMOB 3DAFA 4GGOA 3PYMA 4JJIA 3K9QO 1OZAA 1J49A 1E1NA 3Q0EA 1CIVA 4LVUA 1RYDA 2A4KA 3WWYA 1M75A 4RVHA 3HE3A 4DBZA 4KOAA 3WIEA 1MXFA 4L73A 3HJAA 4NBTA 4XYMA 1Z6ZA 2UUOA 1PR3A 3O8QB 4ZA2A 4ZQEA 1GUYA 1UAYA 4BB6A 4JGBA 5HS6A 2EP5A 4ITUA 4D7AA 2SCUA 3H9UA 2POQX 5KJEA 1EVYA 1RM3A 1E7SA 1UXJA 5T67A 2X4GA 3ZCXA 2E37A 5ITVA 1ZSVA 1XLTA 3E9QA 3HWRA 3VPSA 2DM6A 3RSHA 4YVFA 1VJ0A 1R0SA 3FHLA 5G0WA 4DPMA 5U1PA 2DQ4A 3V8BA 2O4UX 2BKAA 4CQLA 4TZTA 5K6AC 2EKPA 2JD0A 2CDBA 4UVIA 4CLRA 4GKVA 1NVGA 2ZTMA 3OQ1A 3VH4A 4EEXA 5GMOA 2ILTA 1V8BA 3WGOA 2WYVA 3VDRA 4YQZA 3V1YA 1QR6A 1V9LA 4UUNA 4E4YA 1YL7A 3PTZA 1JU9A 1X1TA 4RDIA 4RVFA 3GN2A 3VTZA 4I8XA 1DEHA 3OJOA 2NVBA 4GX5A 4L4SA 1MG5A 5TSDA 1R4NB 1PQPA 3NAQA 2PZJA 1IZ0A 3AFMA 4N5MA 3PQFA 5AXAA 4LSWA 3EHEA 1EUZA 3DZKA 2PV7A 1IL0A 1ZK1A 3CEAA 3F46A 4U6SA 3M2PA 4INAA 4EGFA 3DBHA 4MPDA 3U49A 1UXKA 1T2FA 1P45A 2UV8A 5TF4A 4BOYA 4BQRA 2IYPA 2OL4A 1IPEA 3PJFA 3JQCA 5DDIP 4NBWA 3STHA 4CMEA 1PIWA 2FSVA 4K26A 3ROMA 4OQZA 5KVCA 4R54A 2IXBA 1PJBA 1HE4A 3F4BA 1MUUA 2Q46A 4XEHA 3GUCA 5COAA 3R6DA 1E3WB 2OBNA 4CMHA 3JD1A 2VUUA 1B2LA 4WLEA 4PLZA 2NNLD 3O03A 4Z3KA 2EV9A 5CFZA 4W6ZA 1Z45A 4P38A 2GLXA 2IE0A 1NAIA 1SAYA 1NR1A 3JQ6A 1P0FA 4BO0A 4CQMD 1EBUA 3ETGA 3QWAA 9LDBA 5L4LA 5DBFA 3DBRA 3DBLB 3OQBA 3FWZA 1R15A 1O94A 3V5NA 1XQ6A 2WYUA 4CQMB 3BMQA 3D7LA 3GNTA 4XGNA 1CEQA 4ZRNA 5ILGA 3LYLA 4XR9A 1QKIA 1V3VA 1GUZA 1GPJA 3GDFA 5L51A 1U9JA 5JXWA 1ISIA 4OJNA 4QTZA 2BF7A 4YACA 4AJLA 4YJDA 3ZWCA 2VTEA 5C7OO 1SB8A 1U7HA 4MVJP 1TVEA 4UVDA 3SX2A 1UR5A 4P4NA 3JSAA 4YDRA 4HADA 1CRWG 4CMCA 4E30A 1LRKA 5G4KB 3QVSA 2FOIA 3CKYA 3S2IA 1L7DA 4GMFA 4QFDA 3RFXA 4CV0A 3BAZA 4WUVA 2IODA 3GR6A 1E7RA 1UZMA 4WNCA 4CMKA 3PHJA 5BR7A 2VRCA 4CR7A 4EW6A 2QZ9A 2JFHA 3ADPA 1MGOA 5L9AA 3NT4A 4A03A 3LC1O 5B1YA 2QYSA 1HDCA 1Z7BA 5FI5A 1HXHA 1JWAB 2AMFA 3QVXA 4FS3A 4CODB 1XCBA 3VVCA 3ZWAA 3OJFA 5JSFA 5T8KC 3RQSA 2G82A 3ZNOA 3KETA 4TZKA 3WBFA 4BO1A 2Y1FA 3VZSA 4NFSA 4W82A 5TT1A 4BKPA 5TS3A 4CM4B 4R5MA 4A0SA 1DIRA 2J5KA 5BNIA 1Z74A 1H2HA 4EJMA 2AW5A 3P2YA 4Q3DA 1E7YA 4XQEA 2P5YA 4XD2A 1VL8A 1ZMOA 5B4TA 2ZQYA 3PGJA 2NU9A 4B8WA 2FPPA 2FWMX 5I9MA 1PJQA 1F8GA 4AJ1A 1DSSG 1X0XA 4UVEA 1YB4A 3H2SA 5IZ4A 3HN2A 4E5PA 1YQXA 4OO3A 1IHYA 4WCDA 3JQ8B 4Z0PA 5KJFA 3E5MA 3QRWA 2HRZA 1CJCA 4M49A 4FPXA 3X2EA 1I5RA 3U4HA 1BHSA 3DC2A 3GAFA 1PZFA 1CQIA 1ISMA 1XHLA 3PXXA 3LQFA 3WYCA 3NYWA 1N9GA 3PZBA 3WTCA 4BO3A 4NG5A 3ZWVA 2GERA 3A06A 5A5FA 2B35A 2O2SA 2QRLA 1IZ9A 1P44A 2VCYA 1WWKA 1W8DA 3PWKA 5CPBA 5KIAA 2HK7A 1W0CA 3EAGA 4GLLA 2B83A 3G1UA 3ICCA 3JQ7B 1AE1A 1YBMA 1YOVB 3ZU4A 1K6XA 2NU7A 1KY5A 2FRDA 1XGKA 4RCVA 4CMGA 2NADA 2W90A 4AJNA 4MJLA 2FR8A 3KVOA 3A9WA 1T2AA 2IEDA 1KBZA 3NUGA 4LCJA 5DBGA 1TT5B 1NTOA 4EBFA 2BH9A 3LLSA 1AGNA 2IDZA 3GPIA 1VJTA 3H9JA 1ADGA 4TRRA 1LDNA 2BD0A 1PL7A 4FJ1A 2GUGA 1PR9A 1V35A 4XRRA 2JFFA 1XIVA 4JQCA 3H3JA 3WGYA 2BI8A 4IJWA 1PJ2A 4J6FA 3D3WA 1NXQA 3WFIA 2B69A 4KUGA 1KEWA 1QXSA 1QSGA 1B16A 4NJMB 1TLTA 3HUDA 4P4LA 3W4JA 3G49A 4TRMA 1B8VA 4J91A 4U7WA 1JKIA 2QRKA 3HG7A 2NACA 2X5OA 3JYNA 1GV1A 3ZWXA 3QWIA 3L07A 3U4IA 2Y0DA 3BMCB 4RJTA 1HDZA 1LSJA 1P1IA 1VI2A 2I65A 3Q1LA 2ZKLA 3RWBA 4MIYA 1IB6A 4DC0A 2Q2VA 3U09A 5I7SA 3NTRA 4YRBA 4BUCA 2HRBA 3JD4A 5IZCA 1LSOA 1N92A 1P1RA 4F46A 3D5TA 5JPIA 3KYDB 4R9SA 2JAPA 4YEDA 1FXSA 3GDOA 3B20A 4J7CA 3L77A 1I0ZA 1I24A 4DXHA 3RROA 1VL0A 4YRDA 4D44A 2P2SA 3LC7O 3PP8A 4OHUA 4H16A 1GU7A 1T1RA 2CNBA 5BNTA 1E3WA 3DMYA 2AEMA 2ZATA 1QYVA 5A3VA 5C7LO 4JJGA 5G2OA 5F1KA 1UP6A 2DTDA 1PJSA 2NUAA 1ULUA 2F00A 3PFWO 4J90A 4DLAA 2P91A 1PS9A 3VVBA 3BYZA 5FFFA 4EITA 3CE6A 2Q2QA 2X0JA 1ZMTA 3K73O 3OFSA 3DBLA 4XYEA 5TJ9A 1QV7A 4J49A 2HO5A 4DWVA 5IG2A 3OSUA 4YBZA 4CMJA 3QP9A 3V2HA 3K2EA 3CMMA 5JO0A 1AHIA 1RPNA 4BO4A 3QJ5A 1YONA 3I83A 3RIHA 2X86A 2CVZA 4X54A 4ONEA 4MP8A 2QZZA 2YFHA 3D64A 4I9HA 4PCVA 2QYTA 3MWDB 4PLCA 4TKLA 3ZV5A 3BMNA 3AOEA 4XWYA 1XA0A 4CLDA 2WM3A 2YV3A 4Q39A 4BVAA 4MVJD 5G4KA 2JJYA 3FI9A 4UEOA 4FB5A 3NEPX 1TI7A 3PQDA 3RUHA 4DRYA 4R01A 1LLCA 4WE3A 5TQVA 4ZN6A 4URFA 3UFXA 4IINA 3I6IA 4FFRA 3F6YA 3JD0A 4RV9A 3JQBA 2I5PO 2OHXA 3N74A 4G81A 4MVJF 4CUJA 4DPLA 5IXYA 1NQ5A 3I9JA 2PZKA 3EY4A 2NVUB 3T7EA 1B3RA 1D7OA 1HF3A 1ZSYA 4MIOA 1V6AA 2HK8A 4YTEA 2EWMA 1D1TA 4PG7A 5AXDA 3DBVO 1E77A 1Q2XA 1VC2A 3ZWWA 2YV1A 4TWRA 3JQ9A 3WQSB 3O26A 1U1IA 4DC1A 1MC4A 4E6PA 4CM4A 5I7FA 1E5LA 3OBBA 5L7TA 3F5SA 4WEQA 2YHIA 3DAGA 4ESOA 1A71A 3Q9NA 2EGGA 4PLTA 1H6BA 4Y98A 4R68A 3ENNA 4YB8A 2R2GA 1MG0A 1I30A 1YGYA 4DVJA 3L9WA 1OC4A 4FW8A 1L7EA 2HK9A 4UVHA 1VSUA 3RC7A 3IS3A 1HDOA 4YJHA 5ES3A 2E6UX 3PLRA 1IY8A 3AWDA 2RCYA 3PJEA 4BGEA 3SEFA 1PGQA 4Q3NA 3UCXA 3PIDA 5FWNA 5JAZA 1FMCA 3TF5A 1M66A 3OJLA 2GGSA 4J7XA 2P5UA 4IQ8A 5L3ZA 4D0RA 3IP1A 4ALIA 1LA2A 3IJPA 3MWEB 3ZV4A 2I99A 1TA4A 1E5QA 1I3KA 1P9LA 5CEJA 3W8FA 4AJ2A 2O3JA 3DZHA 4O6VA 2C07A 4XX0A 3H4VA 3VH1A 4JN6B 1HKUA 3ZU3A 5GZ3A 5IJZA 5L45A 2X23A 4P4GA 1UZNA 2Q1UA 2WE7A 2YHUA 5HS4A 3TZQA 4GBJA 2Q1TA 5C7IO 2VWHA 4YA6A 3FNEA 4BV8A 4DLBA 3RC9A 5G4LA 3H5NA 3X2FA 5HA5A 4BO8A 3D4OA 4W9NC 5L40A 1YB5A 3DZFA 1YOVA 3OA2A 3OJEA 1U8XX 3RKRA 1YL6A 4QX6A 1M6HA 2E82A 3JD2A 4MINA 2BFOA 3PYLA 3ICPA 3TQHA 1HDXA 3S2GA 1NYTA 2HDHA 4NFHA 1WAMA 1XQ1A 3IUPA 2OO5A 2Y66A 2Y0EA 3OIGA 4JXKA 3GUYA 5DP1A 5FI3A 1DIHA 1PL8A 4PG6A 1MA0A 1N7HA 3ONEA 1G6KA 1D1SA 4CR8A 4MKZA 4D3DA 4O5OA 3MJCA 1ZJYA 2NTVA 4NJOA 4KWHA 4E0BA 3P19A 4BNJA 3GDGA 5JDCC 1WPQA 2GN4A 1KVTA 1YS4A 3H9EO 5JMWA 4ID9A 2EERA 3Q9UA 2GN6A 3OA0A 1ENOA 3EMKA 3FRJA 4KDEA 4CV1A 3D4PA 5KCZA 3MJSA 3DBHB 4J4HA 4NJMA 1GCUA 3BXXA 4TRNA 3DFUA 4BNWA 1I3MA 1E6UA 3AJRA 3AY3A 5CDUA 5KOIA 2G0TA 1F0YA 4XYBA 4DQVA 4K28A 4WGGA 1UP4A 1PJCA 1H9BA 1P74A 4WKGA 3B1FA 1K3TA 2UDPA 2YY7A 1YQDA 3BMCA 5LC1A 2JCYA 1I2CA 1BWSA 4O0LA 2EJWA 2CDCA 3ETDA 1GYRA 5A06A 3FN4A 5DCWA 3JD3A 3SLKA 3WGGA 1PGPA 4II2A 3WDSA 3JCZA 1I36A 3ANLA 4WOJA 1VRWA 2AQKA 4ILKA 1B8PA 4CM8A 4BGIA 2ZB7A 4CMIB 2A92A 3L4BA 1RJWA 1PTJA 5HM8A 3M1AA 3OM9A 2JCXA 1R66A 3AI3A 3ZHXA 2EKLA 2E48A 4R9RA 1RWBA 2HUNA 4CM3A 3RCBA 4AICA 4I5GA 1E3LA 5JDIA 3BMQB 1PJLA 1EE9A 4ZQHA 2XOXA 3WQQA 2JCVA 1OMOA 2C7GA 3DB2A 4GSLA 2A35A 4CMAA 4U5QA 4Y9DA 1BXGA 3SBOA 2RAFA 3IIEA 4A73A 1GTMA 2O3UA 4YR9A 1U3TA 4Z9YA 2B5VA 2C5AA 4RPLA 3UGKA 1NPYA 4AG3A 1F8FA 1CQJA 4K9DA 3JQAD 4WK6A 4ALNA 3DHNA 1HLPA 4DIFA 3FTPA 2Y93A 2AEJA 3N58A 1GQYA 2X5KO 1PSDA 3NTOA 9LDTA 4FSHA 4XA8A 4NI5A 4BNGA 4D42A 1EVZA 4RF4A 1A4IA 4L4XA 5K9ZA 3HZZA 1HDYA 5ADHA 1LEHA 3A28A 3KUXA 2JL1A 3PQEA 2PA3A 1ML3A 4MKRA 2D5CA 5AOVA 1HT0A 3OHSX 5TRTA 5B4UA 1NVTA 1WDLA 4U6QA 2Q1SA 3PHLA 3JYPA 4EUEA 1ZK4A 2VHWA 1HZJA 2W2KB 1F12A 3O9ZA 2X9NA 3PVZA 3H9QA 1C1XB 1ULSA 3EUWA 5CP8A 1FDTA 1WDMA 1F14A 3QE3A 2VWPA 3PGXA 1NQAO 4EYEA 4LN1A 4BIIA 2FPGA 4RGBA 4R69A 1MLDA 3ZV6A 4UUOA 1UDBA 5KVQA 4RLSA 3DL2A 1PGOA 1ZFNA 3E8XA 1ENZA 3I4CA 5EQFA 1B3BA 5IDXA 2H1SA 4W7HA 4OOFA 4HKTA 3L6EA 4E21A 3RVDA 3PPIA 2XAAA 2Y05A 3DAPA 4YWJA 4B3IA 4W4TA 1N9GB 3H5RA 1YWGO 2P4HX 4PRKA 1K5HA 3WNQA 1CERA 1Z82A 2DU8A 5KVSA 5BSEA 1T1SA 4IZIA 5DP2A 1KVUA 3DMTA 4PGFA 1A7AA 3M2TA 2HLPA 1E7MA 3RBVA 1RM0A 1UDCA 1H9AA 1X7GA 4IMRA 1DDOA 5COBA 4IQGA 2Z1NA 4IY1A 1DOHA 3U9LA 2ZYGA 2WD8A 5A4DA 5CDSA 2PKQO 4O59O 3UICA 1E6WA 3FD8A 3PYXA 3O38A 2B0JA 1E6EA 4TKMA 3C7AA 1HDRA 4DA9A 2B37A 1SMKA 2J5RA 1QV6A 1LDBA 1W6UA 1H5QA 3K6JA 1BDMA 4II3A 4OYRA 4ZU3A 3M1LA 5U9CA 4FGWA 3D3WB 1NNUA 4ALLA 3ROKA 3ONDA 2HJRA 4PLPA 3K8ZA 5ITWA 2GF2A 2EHDA 2H6EA 1LDYA 4AJIA 3K96A 3TSCA 3LT2A 4I5EA 1UDAA 5JO9A 1U5CA 4OXNA 1RYEA 5G0UA 4MO2A 5I7VA 2IEBA 3U4DA 3HB5X 3H9GA 4BKQA 1BVUA 3VPFA 4NIMA 3KTDA 4BO6A 1LLDA 4ZQFA 2CVQA 1SPXA 3Q2IA 1JVBA 4IZHA 2LDBA 2PD3A 1V3UA 2PD4A 1G0OA 1HE3A 2G1UA 2IZ1A 4M86A 3GHHA 3SC4A 3C24A 4G2NA 3OQ6A 1BXZA 2BMAA 4JROA 4JNKA 3DXFA 4JIGA 3RBXA 3D5QA 4JBIA 4CM6A 4E3ZA 2FZEA 1FK8A 1WZEA 3GPDG 1LQTA 2VNAA 5KJCA 4BNYA 3W6UA 4DMMA 2XPCA 3EVTA 3RUAA 2C54A 2AQ8A 2W4QA 2E49A 3WOHA 1P1HA 3Q2KA 1KVQA 2ZJ0A 1OBFO 3GFBA 1LLQA 1DO8A 2DFVA 4BNLA 4RQTA 3DTYA 2GSDA 2BFAA 3E48A 1XU9A 1RM5A 2WEKA 1DFGA 3T4EA 2B4RO 2V6BA 3ZWOA 3T4XA 1UZLA 2ZYAA 4CMIA 1ZUD1 4W99A 2IZ0A 1QYXA 1T4DA 4RF2A 3GGPA 3AUTA 3AUUA 3CH6A 2X8LA 3HB4X 4GLOA 2X0RA 4R3NA 4IJVA 3L0DA 3ZV3A 4N5NA 3I9MA 3DOJA 5ILOA 4TQGA 4O1MA 1KVRA 2HQ1A 3GVIA 1U5AA 3PIIA 4BNFA 1EZ4A 1R0KA 3HHPA 4NZ9A 4XGKA 5DOVA 4FR5A 2GNAA 3W1VA 1Q0QA 3FBGA 2P68A 3BMNB 3C1OA 1T25A 1GAEO 4GSKA 4BKOA 4F6CA 1I10A 1NFRA 5KWEA 1T4BA 1DRWA 1X7DA 5JAQA 3RU9A 3GZ4A 1JKFA 4CM9A 1PEDA 3FNGA 4UEJA 3VZQA 1A27A 4DIOA 1H0KA 4DGSA 5HRUA 3JQAA 5TJHA 2V6MA 4JLWA 4GWKA 3WR5A 5CG2A 3VAZA 4LRTB 4PRLA 1I33A 3QVTA 1XSEA 4IBOA 4JJFA 2O7QA 4XCVA 1SEVA 4YAIA 2G76A 2C29D 4KQWA 5CDTA 5JLAA 2PWZA 3H7AA 3GN1A 1EQ2A 1Y9EA 3KSZO 1O6ZA 2OFPA 4J9VA 5EQDA 4A10A 4DREA 4Z6KA 1IULA 3RI3A 4N18A 4MVJM 4GGPA 1LXCA 4KTTE 5TC4A 1H2BA 3ZW8A 5CAEA 5CEFA 2Y1OA 3NX4A 2W2KA 3MZ0A 3BTVA 2DTEA 3AK4A 2YHIB 1NX6A 4WNIA 1C1XA 3QWFA 4GI2A 3KSUA 1K0UA 4J1NA 5DCYA 1XWFA 1XDWA 1B7GO 1ZW1A 4GKBA 1P33A 3FCOA 5IAAA 4YJHB 4LSMA 5H83A 3LT0A 2X9GA 4GX0A 4PIVA 5DBIA 1GR0A 2O3RA 1VKOA 3OF2A 4YXFA 1MXHA 4YAJA 1Y5MA 3GEGA 3NRCA 3LF2A 2HMWA 3TRIA 5IN4A 3INGA 1R6DA 4CUKA 4WCFC 2QRJA 1RKXA 3LU1A 3UKOA 3ZNQA 4B79A 1N1EA 4BO2A 2H63A 1BRMA 3D1LA 3ADOA 3P2OA 3RUCA 5F3RA 2EW8A 2CF5A 2ZCUA 1EEHA 1ADFA 2EXXA 3FPCA 1GADO 2X58A 3ANNA 4NU5A 4FIZA 3A4VA 4TMFA 2DLDA 1KIFA 3PWZA 1SEPA 2YZ7A 2PLAA 1GD1O 4NFYA 1NQTA 4RORA 1A5ZA 5TX7A 5DNAA 4MVJI 4OXYA 1Z73A 4Z0HO 2R6JA 1PZGA 1WNTA 3ZN2A 5DF1A 2I76A 1VKNA 3E9MA 4XR4A 3P5SA 4Z0TA 3HDQA 5BSHA 1X0VA 3OH8A 2OMEA 2Q1WA 3GNSA 3I6QA 5KJ1A 4YJFA 5EIOA 4HUJA 3G79A 4QO7A 3QV1A 3FF4A 3MJTA 4NPCA 4B3JA 1GYQA 3GLQA 1WW8A 2VHYA 5L53A 1YQGA 4BL5A 2PGJA 1A7KA 2QW8A 4P8RA 2VYVD 5JBIA 3IP3A 3TDKA 1B8UA 3R1IA 1ZXLA 2Q45A 2G17A 1LSSA 3RKUA 1QYWA 3E1KA 2ZJ1A 2JD2A 4AJOA 2BGKA 3EGOA 1O95A 4YJGA 4BHTA 2Y1CA 2UUPA 4EJ6A 4C7JA 1UUFA 2YDXA 5B37A 1O8CA 3H5AA 3KM0A 4EDFA 2B4QA 2RHRA 1NHWA 2O3SA 3MTJA 4FFPA 1ZZEA 4J16A 4RLHA 5AXBA 1JA9A 4CM5A 3WLEA 3DO5A 3P7MA 8LDHA 2HJSA 2NLOA 1C1DB 3RC1A 2W8ZA 3WSWA 1DRUA 5CEEA 4BNTA 4E2WA 1W73A 2R00C 4EUFA 3DZBA 3WICA 3U0BA 4GVLA 2WWRA 4CM8B 1E3IA 1OOEA 2D59A 3JYOA 1T26A 5EL0A 3GVPA 4FOSA 2HMTA 3V1TC 4QT0A 4CUZA 2Y1DA 4XGIA 3I1JA 4XIYA 5F5NA 1IYZA 1KEPA 2FR0A 5K6AA 1DIAA 2W98A 4YQYA 5MGBA 4M1QA 5DOZA 4XJTA 2IYOA 3H6KA 1ORRA 2D4AA 1MX3A 5DN9A 3A14A 4BMSA 4OL9A 3ANMA 1WDKA 4ZVVA 1H93A 4RF5A 4BMNA 3Q3CA 3ETEA 5JAMA 5JAIA 5ENDA 1BXGB 2Q4EA 2PKQP 4BNXA 1ARZA 4DTIA 1H6CA 3UOGA 1PQWA 2CFCA 2F1KA 3JTMA 3KEQA 5IFLA 4JP3A 1PJ3A 3U62A 1BW9B 1XEAA 3S8MA 3ZWPA 6LDHA 2GASA 2B5WA 3GVHA 4YT4A 3W8EA 1HWYA 4OKIA 1UJMA 2PR2A 4MKXA 5L4SA 3ST7A 5L4NA 4I9UA 3BHIA 1WVGA 1N8KA 2O7SA 1KETA 1XELA 5DT9A 2CDAA 3EC7A 1DB3A 1YL5A 2DPGA 2I3AA 3QHAA 1LSUA 2FN7A 4CR6A 1AN9A 1LC3A 2Z1MA 3HQ4O 1HLDA 1DAPA 1PZHA 2BGLA 2JHGA 4OOEA 5EPOA 5K0ZA 4LCEA 5I8WA 5AVOA 3DTTA 4PVDA 2EEZA 2PH3A 4YT2A 1DHRA 2J3KA 4H3VA 3KV3O 3JQFC 4I5DA 4WLVA 2GN9A 4HY3A 3VKUA 4J7UA 3I9LA 1ENPA 1GZ6A 4YAEA 5AXCA 2B36A 4R16A 4K6CA 1YH3A 2ZB4A 1TXGA 4LK3A 4LRSB 1UXIA 2XF8A 4Q3AA 4IS2A 5FYDA 4AJPA 1VPDA 4NR0A 1OFGA 4BO5A 3WGIA 4WOKA 3DR3A 2DUWA 4Q3CA 2DAPA 2I3GA 5BQFA 1SCUA 4E2XA 2JKVA 2OBYA 2HCTA 2VQ3A 3CIFA 4GL4A 1ADCA 1ZK3A 2NTNA 4HFRA 3GGGA 3KRTA 3F5QA 2OP1A 5THKA 1C0KA 3S1LA 4M89A 3FR7A 1N1GA 2XXJA 4I9NA 3NDRA 5G0VA 2FMUA 4A2CA 4HNGA 5TGDA 2OGUA 5T57A 3GC6A 4OMUA 1LNQA 5JY1A 5JC8A 5AYVA 1GEGA 1Y8QA 3PK0A 2VOEA 3G1TA 4HFMA 4GAEA 4J0EA 1Q7CA 1H94A 1PQUA 1HETA 3K5PA 4IDAA 4NK5A 4NH4A 4CPDA 4PZDA 2CY0A 1EK6A 3ASVA 4B4OA 5T8KA 2O50A 4L0QA 3HDJA 4IXWA 1PGNA 2FZWA 2WDZA 1WXDA 3C7CB 1Q7BA 1SOVA 3B70A 4BO9A 2C7VA 4YT8A 3H65A 1P1FA 1E3SA 3GA0A 2OUIA 4J1SA 4XYGA 1QLHA 4OQYA 3HSKA 1U2GA 4MDHA 3SLGA 1Y6JA 3ASUA 2FR1A 2BRUA 3ZWBA 1AUPA 1Y1PA 2JD1A 2Y99A 4B3HA 1P0CA 1GQQA 5THQA 1HE5A 3BHJA 3DEYX 3HDYA 4QECA 1NPTO 1ZO8A 1NBOA 2EJVA 4O63O 4J1TA 3WTBA 4B4UA 3NV9A 1GCOA 1NQOA 2O2YA 4XQGA 2WYWA 4FC7A 3RJ5A 5L95A 3F1LA 1P77A 2VWGA 4CMEC 5A5EA 2WJPA 3VH3A 3C1AA 4I08A 4EJ0A 3WFJA 1K6IA 4GPD1 3RC2A 8ADHA 1UH5A 1Y9AA 3MOIA 3OJ0A 4NNJA 3DZJA 4WJZA 4E13A 3GAZA 1E7QA 4BGUA 1U8FO 3RD5A 3INRA 3FBTA 1DFIA 2VYVA 4JCOA 2FY8A 2PNFA 3KLPX 3QWHA 1HE2A 3I23A 1GY8A 3SC6A 3NT2A 4E5NA 2GYYA 3E5RA 3TZ6A 5U4QA 3PWSA 5HTOA 5CPFA 2NTJA 1KVSA 2D3TA 3HNPA 5BNFA 3F3SA 3HN7A 1F06A 1C1DA 1H6AA 2YQ5A 1J5PA 3DZIA 1DC5A 1T2CA 1D8AA 1B14A 3UH1A 5JW6A 1PS8A 3OETA 1GQ2A 1ZJZA 2NQ8A 4LMPA 1LDGA 3ZW9A 5MDHA 2CSUA 2C5EA 3GT0A 3M6IA 4W7IA 4A7PA 2I66A 1K89A 3TOXA 3W8DA 3VPXA 3R3SA 2DBQA 3RUFA 2PH5A 4RVSA 3UVEA 3KB6A 4A5OA 4XQCA 1DXYA 2PZLA 3MJVA 4UREA 4E2YA 2NWQA 4BNHA 2GO1A 4ND3A 1YRLA 4BNKA 2J6IA 3DWFA 1J0XO 3OIFA 1YBVA 4IJKA 5ICMA 1S7CA 1DRVA 4IGEA 3W6ZA 1HL3A 1ISJA 1TB4A 4MVJH 3Q6IA 4CM9D 3A1NA 1BW9A 2ZK7A 4WLOA 3LT4A 5AQ1A 1IPFA 3EYWA 3AY7A 4MP6A 1U2DA 3F1KA 3KSDO 4AJ4A 4QQRA 5B12A 3GY0A 3CMCO 3WWZA 1DC3A 4B4WA 1PZEA 3JQAB 2ZYDA 3ZI0A 2CMDA 1CF2O 1LLUA 2RHCA 5GZ6A 2UVDA 1ONOA 3LK7A 1NPDA 4H15A 4PZEA 1FF9A 4G5HA 1JWBB 1VSVA 2AG5A 1SB9A 4PG5A 3UHAA 4IDCA 5DCUA 3ZHZA 4Y8VA 3PEFA 4QSMA 3C7DB 2IZZA 3DZGA 1KC1A 1LI4A 3GVCA 5KTKA 2DBZA 4F45A 1Q1NA 2EG9A 2VN8A 4QXMA 1LX6A 3TZHA 1LTHR 4BO7A 3UW3A 4IM7A 2HMSA 4JK3A 3RBZA 3I9OA 3O4RA 4PLGA 1D4FA 2NVWA 3OP4A 1E3EA 1M76A 2QHXA 1TT7A 2X22A 3MEQA 4IDGA 5BT9A 3DHYA 3WG9A 5KNLA 4N54A 5KVVA 1U28A 1U3WA 3GFGA 3EDMA 3NKLA 3ZU2A 4TROA 4ND5A 4DLLA 3GK3A 3JQGA 3Q11A 4YAGA 7ADHA 1ID1A 5TIIA 3KXDA 3PLNA 4NDNE 3W4IA 1GDHA 1VLLA 2VZ0A 4E5MA 4L9RA 3HADA 5DZSA 5H82A 1PWXA 3VZRA 1C0LA 3WSVA 5JY6A 1Y8RB 3GHYA 1ISFA 3D0OA 1CETA 1SO8A 4GVXA 5A03A 2BFPA 5I9LA 2OZPA 4IUYA 1ZK2A 3FTNA 3OIDA 4JBGA 3L4SO 4IQ0A 4PN3A 4Y6RA 3GG9A 4ZD6A 2PGDA 2QX7A 3B6ZA 2GZ3A 4R3WA 4NQZA 4CLHA 1YXMA 4FFNA 4LW8A 1CWUA 4NBUA 4XYLA 2AXQA 1JQBA 3QWBA 2WSBA 3FPLA 2W2LD 3JYLA 4D43A 3TWOA 1ISHA 1QP8A 3MOGA 2GD1O 4HBGA 4PLWA 3INTA 3KHUA 3DOCA 4FJ2A 2Y1EA 3NTQA 2C82A 1BSVA 2Q2WA 4YJFB 4PFJA 3BTUA 3LDHA 3IC5A 4AJHA 1U7TA 2NV6A 4HFJA 1EVJA 2FPIA 4FDAA 4FFLA 1K2WA 1G0NA 3CSDA 1ZH8A 3SXPA 2G5CA 1BGVA 4N7RA 4QO8A 1AHHA 2OP0A 3IJRA 1U4OA 3TN7A 3AM5A 1WLYA 1B15A 4E5KA 1E1LA 4L76A 1DJNA 4M55A 1QRRA 1X13A 1DC6A 1MFZA 1OC2A 3DONA 3E6AA 4J3FA 3V1UA 4B8ZA 1E7WA 2CF6A 4FJ0A 4F3YA 2DFDA 4YJGB 3DDNA 2VTDA 4BB5A 5JNLA 1Y81A 5CHEA 3LSYA 2RH4A 3VKVA 4J1QA 5IZCC 2HMVA 3R3JA 4PLHA 1HEUA 3MTGA 1R37A 4D0SA 4WLFA 3ON5A 3HFSA 3UN1A 5A9TA 3ZHYA 4K1LA 3ITKA 5LDHA 2Y0CA 3KBOA 1KS9A 4MOWA 2NU8A 4ZICA 2TMDA 2Y68A 3AUAA 3GMDA 2JHFA 3LF1A 1KYQA 2AE2A 1N7GA 1KOLA 4DBVO 4OXKA 4ZQGA 4EZBA 4CLXA 1NP3A 3GQVA 5EJ2A 4ALKA 1U3VA 3WGTA 4HWKA 3EK2A 4Y6PA 4B4VA 5A04A 1JVSA 4CLOB 3KYBA 3KYCB 4W9NA 3NDIA 1XR3A 2RH8A 5TLSA 5KKAA 4XIJA 5JCJA 1C3VA 4M87A 2Q4BA 3NDJA 3PDUA 4DQXA 4IDEA 1DAOA 5H81A 2VRBA 1DPGA 2CVOA 1KEVA 2ZTVA 3D3EA 5F1PA 4WECA 2J5QA 4Z3DA 3L9XA 3BTSA 5JCXA 2PKRA 2BI7A 1LDEA 3TNLA 4BNVA 2J3HA 2VWQA 3DQPA 3WYBA 2OXIA 2ZB8A 2C20A 3IDSA 4HX5A 3AOEC 4R1TA 4GX1A 1LJ8A 5ENVA 3NJ8A 1PJTA 4R4JA 4B7CA 3WIDA 3S2EA 4U8GA 3F9IA 4K6FA 5JDCA 1E1KA 2WD7B 4CMBA 5KKCA 5T5QA 3TPCA 3JQDA 4IDBA 3RFTA 4A27A 2D2IA 3RASA 3JQBC 3IAHA 1ZIDA 1DC4A 1GV0A 3GG2A 1UP7A 1T2EA 3HDHA 4R51A 1HRDA 3PDJA 2IXAA 3S55A 3GEMA 3OMLA 1HDGO 1BVRA 3ZWYA 3BIOA 4LGVA 3MJ4A 5IDQA 1DLIA 1EE2A 4R41A 1RM4A 2H5LA 3AU8A 3JQ9C 1P1KA 4WLNA 3GZNB 3AM4A 2V7PA 4FFMA 4XB2A 3ENKA 1C14A 2Z5LA 4L8VA 3ZWMA 1M67A 4D79A 1YO6A 4ZGWA 1LDMA 2Y1GA 2PTGA 3OEWA 3GVXA 4AVYA 2PK3A 1X1EA 3TFQA
chains in the Genus database with same CATH superfamily
3NTLA 1G60A 1EQUA 1MJ5A 4OXXA 3D6TB 4BQQA 1RAAA 3MCVA 4EB8A 2WWGA 1XTQA 1NVMB 1OGIA 1U7PA 1XVLA 4LZZA 8MHTA 1HYGA 1BDHA 3OE4A 3K20A 1A76A 2CMKA 3BXHA 5K2MA 1EFAA 4HLNA 3FYUC 4PAOA 4ND2A 2VYND 2O8EB 1JLKA 1IC6A 3S44A 2C7QA 3W3AA 3G9XA 4FC6A 4GXTA 2IK8A 3JAKA 3N07A 3R0ZA 1U81A 2XF2A 2GKGA 4DQUA 4RWEA 1U8YA 1BXKA 4XQ9A 5IDVA 2REOA 4MV1A 1N77A 3OAAA 5T4BA 4YCNA 3BA1A 1YS7A 4RHEA 3TLEA 5IKEA 2FV8A 4RD1A 3TJRA 2C31A 5J2TA 1E8NA 3TL6A 5JZMA 3FWHA 2QM7A 4MUIA 3CY6A 3PI7A 4UUPA 4BZPA 1N2SA 2DCMA 2Q1YA 3V6LA 1CKEA 1X80A 3MJEA 3MINA 5FA6A 4JBLA 1IIRA 1Y7TA 5BUCA 5K4HA 4M4SA 2IF0A 3GOQA 4C0KA 2QTNA 4N5IX 4WL0A 5BV1A 2H2FA 2ISQA 2BRUC 2CYAA 3QPDA 5EVJA 2HC9A 4UCQA 3AKDA 1P3DA 1FJHA 4E1BA 1Z4QA 3G13A 1T3SA 1M6WA 4KQJA 4RPJA 4B85A 4R3UC 1XZIA 4IIUA 3KQPA 4H7PA 5DX1A 3SHTA 5BPHA 4ETMA 4XJVA 2OO5C 1ZCJA 1X3LA 1GZSA 1T4MA 1UFVA 5CFMA 1B76A 1X7ZB 1PWZA 2WOJA 5HFNA 3WQRA 2GZ1A 1GRVA 1OXUA 2BFDA 1KDYA 4DBLC 2DPLA 1NL3A 2C1ZA 1EBBA 5JNUA 4XDYA 1V0JA 1R9JA 3VUEA 1F5NA 4PONA 2W2LA 3QVUA 4KIJA 4EFMA 1D6NA 5KNCA 3U5TA 4HFNA 5ARCA 1JAXA 3E5HA 2VXOA 2OBBA 2VCHA 4R0NA 4DE5A 1Y5RA 2MIIA 4MA5A 3T9CA 1ZNXA 3NYIA 2ZZNA 1SOWA 4WFIA 4LVCA 2K2QB 5FOTA 2PUTA 2X5XA 4MR9A 1BQEA 1US8A 2IRWA 4I5FA 5F73A 1SZJG 2HEGA 3VC7A 3PHIA 4KXMA 5FNVB 2ATCA 4WCFB 1MP0A 4PQEA 1EM8A 4WH0A 5EP2A 2Y76A 1WV0A 2O48X 4I3HA 3VPHA 1JU3A 2VJYA 1YB6A 1KDVA 4LZLA 5EJ9A 2HKIA 5A3JA 4UDXX 1E61A 4R40A 4CM1A 5HYVA 3TFOA 1W9HA 2AJCA 2VK4A 3K0CA 3ML1A 4X63A 4BJ3A 2QP9X 3JS5A 1R4MB 1WZIA 1PR0A 1YS1X 1DLJA 1ESMA 1V2GA 1XZJA 3BGOS 3O8NA 4N0MA 1H9CA 1IJEA 2AC4A 2FSPA 1HUQA 1B6RA 2GBLC 2L42A 2WWXA 4M83A 4EJFA 2R8XA 2A5YB 3HDGA 1MV8A 5C5EA 3QU7A 1O0CA 2QIOA 1N33B 3K1AB 1X39A 2JASA 1I5OA 1YD7A 3TW0A 4MV3A 3TZCA 3LI2A 3O4JA 1N5DA 4FHCA 1SXJC 5B6JA 5D5PA 1SUWA 5HW0A 3G8YA 1AMUA 1ZHOA 2J5XA 2GCEA 1AA6A 4N7BA 5A02A 1YZGA 2CE2X 2Z5VA 2QT0A 4Z2YA 1E69A 1K92A 4KQXA 3UJDA 1DFHA 4MK4A 3SIWA 1KDRA 1UT8A 3AX6A 1ISGA 2MYUA 1JJAA 1WCWA 2I8LA 2WSIA 3GT4A 4FDVA 4TS3A 5DHPA 6YASA 3K70D 4RM3A 4ALMA 2QTVA 2WMDA 3LQRA 4J3NA 4AWAA 2H08A 2V65A 2ZB3A 1I32A 1NR7A 2RHBA 3WK6A 1ZRSA 3FDZA 2GZRA 4A5SA 3DAHA 2A9QA 4FFVA 3VDQA 2DPHA 3L6OO 4OPMA 5F9FA 1DKQA 1OI3A 2BM0A 2ZIZA 3MBKA 2A0YA 4QUGA 4HNTA 1JEDA 1TEHA 4WFKA 3NMUF 2SKEA 3PXCX 2R6CA 3IUBA 4IGFA 3D8UA 3KB2A 4LPSA 4WHMA 3NEAA 2WWWA 5FNZA 2VHZA 1CB0A 3F71A 1AK2A 2JGAA 4ZU1X 4B7XA 3ZU5A 4GBMA 4PLFA 4E32A 1RXWA 2CJFA 2X1HA 4OQDA 1QLJA 2D1FA 1OI7A 5CLIA 4KUHA 4OK3A 3PXDA 2A6PA 1EDDA 1L6RA 2B1QA 4W1PA 5BSGA 1ZD5A 3G2JA 1U5BA 3AZQA 3PNYA 3R4VA 3PFIA 3CNLA 1F0PA 2E4VA 1QVRA 3SQNA 1QX3A 1TU0A 1IVSA 1IRXA 2HWUA 2OPBA 1D5WA 2C5BA 4GMXA 1KI6A 1FYWA 3C85A 5JS6A 4OM7A 5B58T 4US0R 3W78A 3KXLA 3NYQA 4G09A 5C8YA 1O9BA 1G7TA 1XMJA 4IEEA 4JFAA 4NS1A 1LW7A 1T2DA 2FPSA 1MQAA 3L02A 5K0CA 1TQ8A 2NP7A 4JL5A 1FXUA 1YJ8A 3P71T 4KACA 3VU1A 5B2EA 3ORFA 1GG8A 4LC1A 5CG1A 4DV5B 2QZSA 1DBVO 1YRBA 3HU5A 4DZRA 2C99A 2QLBA 1BJRE 1JEAA 2BHSA 2Q1XA 3ZUGA 5CITA 1GYPA 3NHLA 3NHKA 3C4VA 1BH6A 3C6MA 2Z58A 4Y6SA 1R0LA 1FNSA 3B1VA 3GRKA 1GQSA 3FLMA 1Q74A 1HQYE 2GJ8A 5H80A 4ESVA 3VNRA 1NBIA 1FFGA 2OEPA 3EDYA 4ROSA 3MK31 1TO6A 2G72A 3FYCA 1Q7GA 2JJ8A 4CQMA 2C9DA 2OZKA 1GUFA 3I42A 4RL4A 4Z1MA 2PYZA 4C87A 3I3OA 4MI9A 1GZ7A 2XIQA 3EUFA 3HMKA 2XHZA 3BC1A 3FNQA 2AFVA 2R86A 1KO7A 3BWCA 3JX9A 4IJMA 5EMNA 4G0VA 2X7HA 2V58A 1MPXA 3CPSA 5DPMA 4KP7A 3UMFA 1N32B 2O0LA 3UXHA 4WJKB 3BGVA 1TJ3A 2AQHA 2Q5CA 1PGJA 4JJ7A 2ERYA 5AOAA 1TO1E 2L19A 2GEKA 3M6FA 2R25B 3CZ4A 4FBGA 4K9PA 4WKNA 1LV8A 1Z36A 3AETA 2XW6A 1N3IA 3T5MA 2WOOA 3QKRA 4TVBA 16PKA 1DTEA 3C97A 3DMTC 4D9HA 4YCAA 2JFUA 2Y1XA 2W11A 4YPOA 1YBAA 2CYCA 4ZT4A 1JFSA 1CHDA 3I4FA 4WGFA 4KPUA 4HLCA 2OGSA 4LQDA 1SCJA 1BKSB 2E7ZA 2QRZA 3WNCA 4HT3B 1TIKA 4ZIRB 2QT9A 2GN8A 4M1YA 1KK1A 4OGFA 2WLSA 5CDYA 5B53A 4OQNA 1EK5A 4HTFB 5GM1A 4R5HA 1SVLA 2H11A 4IVQA 1TCBA 4MS4B 1O54A 4FCCA 4HDKB 1TZCA 1QIHA 2DFPA 1PW5A 4CDNA 4LXUA 1X15A 4LMRA 5CNJA 3VHLB 1QVZA 2C9YA 2NAPA 2PZMA 1GLGA 2FEAA 3EZ9A 5F1OA 2OFFA 4ALJA 5HKBA 2ZVPX 4Q66C 1I3NA 3RUIA 3IT1A 1CUUA 1DJQA 4KN5A 4JKOA 4R8RA 4KGDA 3I9V6 1HPLA 1T5DX 2ZROA 1AV6A 4QXQA 3BZUA 1BHQ1 1E3JA 3BXZA 4DDKA 2BC9A 1IDOA 1B43A 3GJ0A 2FP4A 3V2GA 4ZAVA 4FYWA 2J9RA 3LTEA 4YJ3B 1ZSNA 4BX3A 5DM1A 2NMVA 3ESAA 3ZCUA 2V5VA 5FEMA 1NMYA 2BGNA 5LCXA 4YYZA 1YFZA 5I8ZA 1GO2A 1P9RA 1QYRA 2WM8A 3W4KA 3QYFA 2DP4E 2GR9A 2JAXA 1J4AA 3E0QA 3EZ7A 5EEGA 1OI2A 1NUSA 3R3HA 3U3XA 3ROGA 2PX0A 3EVBA 2EQAA 1H1TA 3WFZA 4JMLA 1YCDA 3KB8A 3JQ8A 4M7WA 3U4QB 4BS9A 3LDFA 2YW9A 5IXJA 2QNRA 2D5LA 3G5LA 1UWLA 4H9GA 4RHFA 3OPXA 5G41A 5IVHA 2QMOA 2I87A 1OLXA 1AKNA 3CT4A 5ELMA 5LB2A 3GP8A 2NM0A 1EIZA 3PG5A 5KO2A 4ZMRA 2CB9A 1JI0A 4LE1A 1HTWA 1J07A 3BB4A 4V3CA 5LDGA 3DOHA 3GMSA 4CQLB 1T6ZA 1JHRA 2DUUA 4PYJA 4JUBA 3TGPA 5A9RA 2ZDGA 1BA3A 3HGQA 1QYDA 3HJNA 3R0QA 4UEQA 4E33A 3LTNC 3FR8A 4O02B 4MO9A 4CKEA 4MVJE 4NJEB 4UTVA 1FIUA 4XUDA 4NHOA 1ODLA 1PYGA 4B8YA 2ZI4A 4ZOLF 4E4TA 4Q1BA 5TGTA 2A9OA 3RS7A 1MFPA 3WAKA 4DM3A 5BSFA 3FYTA 2VNIA 4QFBA 1AKEA 4NBVA 2UAGA 2WJJA 3H2ZA 2DR0A 4WBNF 1E2GA 1FRNA 2JJ1A 1IN8A 2KX7A 3EFOA 3O94A 4KFSA 1I80A 3ZD8A 4H27A 3ELYA 1TRHA 2Q29A 4KXUA 5JCJD 3FNFA 4QVIA 4C7OB 4GP9A 5LYJF 5ICFA 1I94B 3EVNA 2ODBA 1NP7A 3VKGA 1Z5VA 3ZDRA 1CY8A 1OZGA 3OF5A 4ENWA 3PJDA 1YHYA 4EHDA 1N0VC 3BL5A 3FOCA 5CLHA 2GEJA 5TT0A 3F78A 2QWXA 5BQOA 1YJAA 1VE9A 3NETA 4A6DA 4L4RA 4HB4A 1AUVA 1ECLA 2HWYA 3PNLA 2QG4A 4IIGA 721PA 4MV0A 4BWGA 4HNAB 1T4CA 7MDHA 4ML3A 3B3JA 2A5DA 4QZVA 1OFUA 1X77A 5IT0A 2BOVA 2FK8A 2H54A 2V54A 4D9BA 3WMGA 1JKMA 1KJZA 3VNQA 5AVZA 5I7WA 3TAUA 5YASA 5HSGA 2QAGB 3DEAA 5IAEA 3ONNA 5FL7D 1N3BA 3L43A 4RD6A 4PHHA 4MS3B 2UUAB 4TKUB 1XZFA 4I4TF 5JYEA 1UXHA 4D81A 2ZE6A 2M1ZA 1VJGA 5DM2A 3IURA 4D41A 2VSYA 3DGEC 5H16A 4GW3A 4TPKA 2YC2C 5DGIA 4D45A 3X1WA 2BELA 2IH4A 5FTMA 2HPVA 3COZA 4M0DA 4NMMA 3LNCA 3QKWA 4KXLA 1Y9DA 3VHXB 2GDZA 2HU8A 4P1ZA 3K35A 1XJ5A 2DQYA 4DY4A 1ND6A 5I4IA 4DR2B 4CV3A 1OX4B 2EGHA 2PX3A 4IFIA 1O94D 1TUGA 1I2ZA 1ZI8A 2AFIB 1I8TA 2P67A 4PCLA 1XHFA 2AJDA 4CKXA 2NT4A 3EGEA 4DMGA 3WB9A 4EFNA 1WG8A 1T5LA 1JG6A 2WHQA 1U7ZA 4JJ8A 4KAXA 1LBSA 3EH2A 4CL8A 4LVOA 3EFHA 4CEJB 4RXUA 4R2LA 5KI6A 3F3KA 3WGMA 4UAVA 2WNSA 4N3AA 1I6MA 2HAEA 4KQEA 3LC2O 4LY6A 3VKFA 1KY4A 3PHGA 2V9ZA 3PJGA 3PNOA 4NFLA 3ND6A 5F4ZA 1COZA 3LT1A 2QJTA 2HSJA 3NDPA 3IXQA 3OE7D 4TKVA 4QQKA 1XAGA 4P7BA 1EAYA 1ACLA 4KVGA 3R0VA 4M0KA 3GZTB 2XQIA 4HS9A 5GV8A 1FUUA 2ZTLA 3ZLJA 3ASYA 1ZBDA 2E4AA 1OYYA 1EFCA 2VRCD 1Q16A 1WW3A 3P4YA 4P3OA 1U4SA 4HXYA 4S1VA 1L1FA 2XCSB 4GRAA 5A4MS 4GLBA 2PWYA 3SBEA 5BRJA 1EDOA 1M8PA 4P5PA 2DG2A 1RJGA 3H3FA 1VXOA 4FGLA 5CNMA 2B4TO 2HXGA 2I2FA 2P0AA 2QE7A 2B8WA 3LHFA 4YJ2F 2Z95A 1XDSA 3I9NA 4NZYA 1VKHA 3UYLA 4UHBA 1GNLA 2DHEA 3IV9A 1EDEA 4H7IA 2HWKA 3GYGA 1R0RE 3VVLA 3ICEA 3E18A 3KT0A 5HQ3A 3AR7A 2G1PA 5JZ9A 5H3CA 2HA4A 1QK4A 5K8LA 1S2OA 5KYWB 3MWDA 2O2ZA 3K9FC 4OYYA 4YH1A 3FPEA 3CTMA 2RGBA 3ITDA 3TQCA 2FWRA 3AWIA 1T5OA 2TMGA 3AINA 3FCYA 3OUZA 2R6R1 4C89A 3OECA 3ZGOA 2ICAA 1F2TB 3O3OB 2O8CA 3CUKA 2IHJA 3MFQA 3OD5A 1CVRA 2DJIA 4O4JA 4U7TB 1KO4A 3WGJA 1G3QA 2WYHA 3AGPA 2VDWA 3I9V1 3I9KA 4LWOA 3EBPA 1G8PA 3G1WA 3BTOA 1L4YA 1REQB 3S27A 3G85A 5TQ2B 3CNBA 2PX5A 3PDHA 4ZQBA 3UZUA 4ETNA 3O4FA 1GKLA 1WCIB 1JEEA 2VHXA 2YDYA 1JV2B 3CO5A 3ILYA 3QJYA 1PAUA 2NVUA 5ALJA 1FFXA 1Z0DA 2YJZA 2Q9CA 3ABQB 4JC8A 4YI3A 1V3TA 2XVAA 4U0KA 2QL5A 3NPAA 3C6BA 2VSQA 2D0PB 4I55A 1TJNA 2VUSA 5C1BA 2O06A 1OGYA 3V33A 2GSWA 2MU1A 1XXHA 2V7TA 4DCOA 4QM7A 3ZJVA 3H5OA 5AVYA 1M7HA 4RO0A 1CR4A 4ZT3A 2IIBA 5KJ6A 1O97D 1HYHA 4KGXA 1QP7A 4HB3A 3F47A 2VDQB 2INGX 1TVMA 1EGAA 1XFAA 1NASA 1UM9A 1Y3CE 1AQYA 5D87A 1GNRA 3DHEA 4C4AA 3DAFA 5K3SA 3N8HA 1O95C 3LHSA 2F62A 3F73A 3FHCB 4RMIA 4TLDA 2I2DA 1NUTA 2ECPA 1VRCA 1O5OA 4B2PA 1JR6A 4AKHA 4ZYZA 1NKSA 4LVUA 1LPNA 1RYDA 3AIKA 1F8XA 3ZDEA 4TYWA 2BFBB 4ITRC 4PSKA 1XKLA 1DZIA 2WZQA 1A7UA 4TUYF 2G9RA 4FDUA 4NEQA 3T3MB 1Q0UA 2XRMA 1ZWLA 2D3WA 1Z8NA 2QZJA 1FP4A 3D6VA 4JEHA 1USKA 4FR2A 4LZWA 1S9HA 1UAYA 3MWEA 2GBGA 4D6YA 4KWCA 2OA0A 2EP5A 2XDAA 3VPBA 4YUVA 1UJ6A 1QS0A 2A0KA 2QKYA 4KMRA 2BN4A 2Q3CA 4IVNA 5LQUA 4OI4A 2QMYA 3FWYA 5ITVA 1LKZA 2W2VA 3OI7A 1ZSVA 4BLTA 4EB3A 2IKQA 3VPSA 4IVRA 2DM6A 3FGOA 2P2ZA 5EJIA 3ABZA 1VJ0A 1R0SA 2M98A 4YVFA 3ECAA 5G0WA 5HF5A 5ICCA 3OPMA 1H42A 1M2GA 3PD0A 4D02A 1VHQA 2LXNA 4G67A 2EKPA 2JD0A 4M9SA 5K6AC 2VAMA 1PFQA 1V8PA 4FHFA 3UEOA 1G6OA 4CLRA 4GKVA 3C8DA 3HL4A 2ZTMA 4GZMA 3RRNA 1VI5A 4D9CA 4WBNA 3RADC 4L27A 3IA7A 3R7BA 3SS8A 4GNRA 5GMOA 1HYBA 4EEXA 1GDDA 1HNNA 1V8BA 2APJA 5T4EA 3VDRA 1UPCA 4A8TA 1AKWA 1DWUA 1JSXA 2A5LA 1O6CA 1WA5A 1QR6A 1E79A 5LYJA 4UUNA 4MEAA 4GKJB 1R6VA 1QE5A 3PPYA 3CNEA 3PFKA 4RVFA 3P4UA 2R4TA 5E4FA 1D4OA 1UEXC 4I8XA 1DEHA 1ZITA 4G8BA 2NVBA 1V5WA 2Y0PA 3N70A 4K9NA 3S28A 1FNNA 7MHTA 1W0JA 1ACMA 2VC2B 3NAQA 2PZJA 1YQQA 1IZ0A 1SUFA 1Z4IA 3OEHD 2OC9A 3DKPA 1MCZA 2ERXA 2A1UA 1IL0A 1IDN1 2I22A 2RBGA 1ZK1A 4ZEWA 1Z17A 4F4IA 1GVHA 1MOSA 4EOGA 4Q18A 4INAA 1SRRA 3DBHA 3GRUA 1SZPA 2Y2VA 2Q3HA 1P45A 3E8SA 2UV8A 4C6RA 3BWXA 1U0FA 3OHMA 4I4TA 3GUHA 2VJOA 4PRZA 1SVKA 4BQRA 3RV3A 4OGKA 4ZV4A 3ROMA 3EGCA 1HORA 2OGZA 3ANXA 3PUHA 1J9EA 5KVCA 1B42A 3FNIA 1H1DA 3A1EA 2MR5A 1HE4A 5FYQA 1K5PA 2FPOA 4XEHA 1LVHA 1RWWA 2WIBA 1V9SA 4MS1B 4Z4FA 1P18A 2OBNA 2O7VA 2KBEA 2VUUA 4ZAZA 1Y6FA 2AXPA 4LJSA 4GI5A 4BB9A 3O03A 2A5JA 2W71A 4Y0AA 1JKJB 2IHVA 2PZ8A 3PR1A 4B6PA 3MXTA 3CVWA 1JFRA 1TLFA 3LS2A 4W6ZA 4B6JA 5LU9A 1G6HA 1XZNA 3KOYA 4RKFA 3GBSA 2Y2UA 4HLUC 4C1BA 2ATIA 3JQ6A 5HQJA 3FOEC 4UBIA 4KBFA 1THZA 3WGLA 2O8FB 1X9IA 1GUBA 3QXHA 5F9HA 3DBLB 3LUPA 3Q0TA 3FWZA 2IS1A 5AI0A 4YRNA 2ODTX 3M33A 2ID4A 5C31A 2WYUA 3V5NA 4HYEA 5ULLA 3SY8A 4Y6OA 3BMQA 4M9RA 4FDLA 4ZRNA 2CLEB 3LYLA 3NKFA 2PUVA 1V3VA 1MEJA 1GPH1 2GWHA 4FMBB 2QUBA 1F7UA 1M74A 3HXLA 3R6LA 4QTZA 3SSAA 2VBIA 1DJMA 1R10A 3FLBA 2A3RA 2P2YA 4JI3B 4X66B 1U7HA 3EZ2A 2YWDA 1UMCA 4UVDA 4DZTA 1W0KD 4J7AA 1C8LA 1TVKA 1CRWG 4IJ6A 2HADA 4M37A 4AQDA 2LP4Y 1MB9A 3BRWD 3T0GA 4XIIA 1M1YE 3QVSA 1R0XA 3G8CA 2FOIA 3S2IA 1JXOA 4MQEA 1OJLA 3DM9B 5HF9A 3D81A 4GMFA 4CG2A 5JSZA 4YJ2A 1AM4D 3LPDA 2FGKA 4I3FA 5LWHA 3P9NA 3K1YA 4RA6A 2WP8J 4JQSA 2OVFA 1QE3A 4EW6A 5KOYA 3ITEA 1MGOA 1YR2A 3NT4A 4A03A 3LC1O 4ZZIA 1XZEA 4RX1A 3QE0A 4B9EA 3CZCA 1Z7BA 3PUYA 4FMDB 4OIFA 5FI5A 3C8HA 3NWPA 2Q9AA 1W46A 3P9PA 2AMFA 3R6TA 1VBNA 2A7XA 2YZGA 1WZNA 1XCBA 2WFAA 3OQIB 3VVCA 3ZWAA 4BVGA 3AVTA 5J47A 3LPCA 4GEKA 3TUZC 5EMMA 3LOQA 1AKMA 1B1AA 5I3ZA 1OT5A 3KETA 1XKXA 3PCRB 4FQ7A 2IE8A 3M7IA 4B6OA 5EE3A 4KK3A 4W82A 1THMA 4BKPA 5AM4A 3EPHA 1DPFA 4Q6WA 2I7CA 1UJBA 4INPA 4GHWA 2FEPA 2ZU6A 2Z2XA 3BULA 3SFTA 4ZZ3A 3I0MA 1WCV1 4UPEA 2PJDA 2AW5A 1Q14A 2V45A 3PD1A 4Q1VA 4U7PB 3EXEA 1NP6A 4Y1RA 5CH5A 1EUQA 2DB3A 1SQGA 1VL8A 1QONA 5B4TA 3R3YA 1U3FA 1AF4A 2NO5A 1KAGA 5FOWA 2A3NA 2FWMX 1DINA 1V71A 3L8ZA 2JIOA 4J1TC 2R66A 4JYMA 1TF7A 4TS1A 2AT1A 1OX5A 1WHTA 3G5AA 1BEEA 1TGYA 4S1TA 1E60A 3HN2A 3CYFA 3GLHE 1TQDA 2ZS9A 4TMWA 3ZTYA 1G7SA 4KQIA 3IGFA 1L7VC 3U60B 4WCDA 4Q5IA 4ZP1A 3RARA 2BUCA 3K09A 4Z0PA 1G5RA 3QRWA 3RU2A 2N9UA 1CJCA 4KQFA 3ELBA 5EJMA 2QQFA 3EPJA 1FNDA 4QOJA 3DC2A 3GAFA 1C0EA 1ISMA 1V96A 2ZKIA 5F2KA 1XHLA 1TCCA 2ZYTX 3PXXA 4NP6A 1AKUA 1NC3A 1RKUA 1KAQA 4HB0A 4A82A 2H07A 2FHPA 5MN4A 1Q15A 3LUHA 4JI0B 4JI6B 1RAEA 4KI7A 2HI0A 3OCXA 5A5FA 4GOOD 3CF4A 3L79A 3ORQA 2X15A 4TUYA 4E08A 5KIAA 4WESB 3SSOA 3UATA 2O5CA 4GLLA 3G1UA 1AE1A 3P2MA 1K6XA 1JSLA 1JFFA 2JIZD 4DG9A 4TV9B 2D54A 3QUAA 4WFQA 1ZGZA 4LXHA 3S2SA 1UBGA 3B48A 4MJLA 4AJNA 3KQNA 3K53A 3A9WA 1YRHA 1FVHA 1S96A 2IEDA 1KBZA 4K3UA 3REQB 1TT5B 3NWEA 1CP2A 3GD5A 2BH9A 3U17A 3RW9A 1DKNA 3QXSA 2IDZA 1FTGA 1ZGJA 3H9JA 2JH9A 3A6KA 1ADGA 3NP9A 1Z0KA 4HTAA 4JKIA 4EY7A 1M34A 1UIRA 3QLVA 2YWXA 4K9RA 4FDTA 4C2UA 2GUGA 1PR9A 2YRXA 1P39A 3WGYA 3SYMA 5KTTA 1GSHA 5K01A 1PJ2A 1TJ4A 4J6FA 1N0HA 1U3GA 3EA5A 2A67A 3D2LA 4WSOA 2BMFA 2GM5A 3LH5A 3WFIA 2J31A 1S3SA 3U1VA 1FDOA 2B69A 3NVAA 3I73A 3Q41A 2MYPA 1XFDA 1Z2NX 2RH9B 3CO0S 2IU6A 4KNVA 3TIGA 3B12A 3QE9Y 4D57A 3GUZA 1YBFA 3TCXB 4KW7A 4DCNA 3DF9A 3FZQA 4MWOA 3HUDA 3PF9A 4P4LA 3W4JA 1KA9H 4BUZA 4ZYVA 4LDNA 2FZCA 2HF7A 4AZ0A 1BHO1 1DBPA 2X9QA 3VR5H 4H1WA 3BICA 5AK0A 3G5UA 3KE9A 3OPVA 4BPRA 2X5OA 4CIWA 2A9KA 2XYRA 4IL5A 1RZUA 4QRDA 4OJTA 4FN5A 3NTUA 3IP7A 2C9MA 5JG7A 4AP6A 1G16A 2IOFA 3MGKA 4RJTA 1HDZA 1N36B 3CEHA 1RKQA 3WGUA 3IPLA 1OU0A 3TQIA 2VSOA 1RWPA 3MERA 3SGLA 3AR8A 4WN9A 3WMFA 4C03A 1Z28A 4XCQA 2WUGA 2PIDA 1Y8AA 3G6WA 4I1SA 1HT2E 1KR2A 5E3IA 5LBUA 4ZZ1A 3KK0A 5BR1A 1Q3HA 3A6JA 4R2HA 2OSBA 5IZCA 3V4RA 5JPIA 3QENA 2XRFA 2ZANA 4PFKA 4JUFA 4QNRA 1N8SA 1FXSA 3NWBA 3FPFA 3HKDA 3L77A 4CQNA 4HNSA 4DXHA 1PR6A 3U26A 3DW1X 1SOAA 1AK9A 1VL0A 4FLEA 1C3OB 4DJDC 2FJPA 2ADMA 1IEWA 3BVPA 1T1RA 3T5PA 1E3WA 4LZJA 4CL2A 2AEMA 1RKVA 5HKAA 3T15A 5JNSA 2V4MA 1AVTA 2ZBVA 3LZDA 1FRVA 5F1KA 5K0NA 2AOUA 2DMRA 2QRMA 3DCYA 5HF8A 4AO7A 3AV0B 3I1FA 1U1FA 5BSMA 2BKXA 4ZDJA 3RQIA 1E5XA 3CUEF 5BVHB 1I4EB 1YI0A 2P91A 5FADA 1XZGA 2EKDA 1PS9A 3QX7A 3TH5A 2DE0X 1TEZA 2ODNA 3O0DA 1NVFA 2FCRA 5J59A 3CE6A 3BWMA 4FWBA 4KQ2A 3UT0A 4DBLE 1ZU4A 3LQ2A 4QGAA 2CFTA 1V5IA 2HTFA 5IULC 4CEHB 1EP2B 1N1DA 2O8NA 4TMYA 4DWVA 5A6SA 1RHUA 4QOSA 4YBZA 2QTMA 4CMJA 2ZCJA 3KL4A 1Q7RA 1OA0A 2Q5EA 1Y7HA 3GRAA 1RPNA 1YONA 3I83A 2VQ6A 1M5UA 1Z07A 1J8FA 2G28A 2X86A 4AYWA 4X54A 1TJYA 1FFBA 5L3QB 5LQJA 4OHMA 2PMFA 3B3GA 4UU8A 2LKCA 1O6GA 4WFJA 2PSFA 3LUJA 4FZVA 3AOEA 4P5EA 3HRKA 1QFJA 1P2BA 3PQ3A 4YCCA 1ORHA 3Q8KA 1JEYB 4WOBA 4QGBA 4AYXA 3FSGA 4TYQA 4L50A 5G1NA 3UB3A 1BVHA 1JDNA 1JX6A 4UEOA 3Q6NA 1TI7A 1UPAA 4LDQA 4HAWA 3EJ6A 5BYJA 4R01A 2BWJA 3U6KA 2QX8A 2VG8A 2AI2A 4WE3A 4DSTA 4URFA 4N0QA 2GCOB 5F7ZA 3UFXA 4DCTA 4AROA 3I6IA 4FFRA 1HFJA 3JD0A 5FI0B 3LPMA 2I5PO 5LB4A 5IJAA 1K8ZB 3N7AA 4REMA 3PUZA 3DDOA 4MVJF 4EJSB 1QU3A 3GO4A 1ULHA 1NQ5A 5FB3A 1RRGA 5TXGA 3UKDA 1OQAA 3I9JA 2PZKA 2IPAB 1D7OA 4XOIA 4A23A 1MTZA 4MIOA 5B3KA 2P7IA 1RE1A 1Z37A 1YNOA 2EWMA 2X0KA 4Y9TA 2DQSA 4YTEA 5GGYA 1SXJE 3A58B 1V41E 3B6JA 121PA 2HLDA 1X7WB 4A2WA 4PEVA 4TWRA 3DMHA 3ZZ1A 3PUXA 4DLPA 2O8DB 1QIFA 2ZT7A 3WQSB 3VOTA 2Q27A 5BYKA 1MBZA 3DE7X 1G8HA 1JQJC 4P2GA 4KSYA 1UPBA 3HN6A 1E5LA 1Z0FA 1DEOA 3OBBA 3T7IA 2HRRA 3F5SA 4P98A 2O5EA 1ES9A 4G0YA 4RIIA 4UFNA 4WEQA 3DAGA 4ZV9A 3RLIA 3TVDA 3Q9NA 4WV3A 2QNBA 4D8WA 4ESOA 4AQ7A 3M6UA 3P27A 1GPUA 3M9WA 4RFSA 3PQ6A 1YI1A 1OC4A 3I04M 3L9WA 4LYAA 2ST1A 3NCHA 4RK7A 5KQPA 1VSUA 2R8PA 3FZEA 1QOPB 3KJZA 5BMVB 3NBKA 421PA 3AWDA 3PJEA 2RCYA 3TW8B 4C06A 1R0YA 1QCZA 2Q62A 3CBGA 4Q3NA 5FP0A 4I2VA 1SKUA 3PIDA 4BV2A 5JAZA 1FMCA 4OATA 4GOND 1AZWA 3OJLA 1CUWA 2H65A 2VDUE 1QQ7A 2R5WA 4RA9A 4YO8A 4W5JA 2YQZA 4E70A 1TA4A 1E5QA 3TUJC 3LP5A 1T0IA 1GRRA 2FUCA 1N7IA 1SRQA 3NLLA 5ABPA 3WP1B 3A25A 3H3XA 3GELA 4JN6B 5IJZA 2GEFA 2X23A 1E62A 4P4GA 1UZNA 1XHEA 4N1AA 2CMHA 2G4LA 3MWYW 2WUFA 2DY0A 3G2OA 4JLBA 5HS4A 5ALFA 1VLHA 4HNUA 2OBMA 3O5AA 1OZFA 2QJWA 3FNEA 4KL8S 2E5WA 3AC0A 5K3AA 1U99A 3AB7A 4RHCA 3RC9A 4BQIA 3Q8MA 1LD3A 5HCIA 3X2FA 2EBFX 2GAAA 5HA5A 1LTKA 2XGGA 3D4OA 4PPNA 2XZOA 5B2ZA 4W9NC 3I6MA 2PBZA 1Z16A 1OLSA 2PFKA 1Y63A 1ZJJA 3DZFA 3OA2A 3LUKA 4BMYA 4FP9A 3QSYA 4QX6A 4YMVA 2PYDA 3FYSA 1KQNA 2XRZA 2CNWA 2E82A 5EFZA 4MINA 2BFOA 4C88A 5IH3A 3WIOA 4E3WA 4C08A 2ZUTA 3QU4A 1NYTA 3EXHA 2K7ZA 1WAMA 3IULA 1HG1A 5ALDA 3WYDA 3IUPA 3CZ5A 1MAAA 5LL6P 1ISPA 5FPSA 1JHUA 4MWGA 3MPOA 3UY4A 1Q1QA 4JXKA 4RM2A 1YA8A 1DIHA 1SKYB 4UBLA 1JHOA 1MA0A 2HLNA 3ONEA 4CR8A 4HSGA 4PSCA 1DX9A 2NG1A 2QAGC 1BHJA 2VK2A 4WZAE 4DIEA 3W5IA 1XZCA 3T3OA 1W5SA 1I4TD 3QKIA 3TKLA 3U9SA 5KKNB 5CT4A 3MUNA 4KWHA 3RTAA 3P19A 3JY6A 2WKWA 2NSLA 4QTTB 2QQGA 1WPQA 2QX6A 1YS4A 3BIJA 5EKXA 4ID9A 4DT1B 2EERA 3FRJA 3RIMA 3UBTA 3D4PA 5KCZA 2EZ4A 4TRNA 3ZDYB 1RVDA 2DETA 3NATA 3W8RA 3B1ZA 1E6UA 1F60A 4YN3A 3AY3A 1G3UA 5EHNA 3KQYA 3LYUA 2SNIE 4ZDKA 4XYBA 3DULA 1O5TA 1XN1A 4DQVA 2XIJA 4ARZA 4M76B 3LUGA 3M9LA 2VA9A 3C5CA 3FVRA 5LP6B 5TF0A 1O6FA 2VKQA 1XC7A 2XRYA 2ZBGA 2YY7A 3STVA 4XLTA 3ROZA 3ZWQA 2C7BA 3HP4A 5BWBA 2JCYA 4KYVA 2R84A 3N2NA 4BDSA 1OXSC 4K6GA 4U63A 3G9UA 4OFWA 5TE9A 3RS8A 4PC3A 5KQSA 1GYRA 1Z56C 3G8BA 5DCWA 3JD3A 1XNJA 4NENB 1XAJA 3WDSA 1E0AA 3DP9A 3AUJB 3JCZA 1DTWA 1VBKA 4F4UA 1SGWA 1XQYA 4ILKA 4CM8A 3HKEA 1U3CA 1W30A 4X7RA 2XEDA 4GKAA 1AKTA 3WJ2A 2C4UA 2E4YA 1X74A 3IB6A 2XVZA 3C0KA 3KEFA 3ZZ0A 3M1AA 2YS7A 2YC4C 3HBMA 4Z4CA 2HUNA 1XJ0A 2OXRA 1IXSB 3A4MA 3NNNA 1G21B 4AICA 4JHXA 4CM3A 1X1DA 4X1IA 1PJLA 4BJ6A 3W5CA 5FULA 3CRZA 4BJ1A 5E9QA 3SIPA 2OECA 4ZQHA 2IYTA 3IO5A 4KLRA 3WQQA 5C4IA 1EPUA 1T9KA 1NJ8A 4CU5A 4GYKA 1ZJWA 5DM0A 1Z29A 3T7SA 1LJUA 3AHGA 2FEOA 3DB2A 3A7DA 3VU8A 5HJ2A 3EIFA 4EHNA 1H2FA 1X8KA 2RAFA 1VXRA 4IRUB 1OILA 3KKEA 1PD0A 2WKRA 2O3UA 1ZAYA 4YR9A 1PHPA 2B5VA 2HL6A 3QITA 3VC2A 3LKZA 4M1KA 5C32A 4AG3A 4D2IA 1DQZA 4WK6A 2BGWA 2IUYA 4ALNA 1YR1A 3DHNA 1HLPA 5EXPA 3GJ6A 4DIFA 1TAUA 4W1RA 4BFZA 2WUWE 4PYNA 3KFVA 4LSZA 2G0AA 2X5KO 1CE8B 2SKCA 4EI7A 1JQ5A 2BLNA 1HA3A 1N2BA 1KMCA 1SU6A 3BFPA 2Q4DA 5LOVA 2WQ6A 2JCSA 5DK4A 5KAPA 3H8JA 3ZVMA 1CCWA 1HDYA 3U40A 4MA4A 2JL1A 2HM7A 4MWEA 3JWHA 2JEZA 4MKRA 5AO9A 1JMVA 5JH7F 1U2RA 1YRYE 1GFZA 4KK4A 5TRTA 5I7HA 3V97A 3DUFA 4LIPD 1DXHA 4U6QA 5D1HA 2EC5A 4FCVA 5TY0A 3PHLA 3VI4B 4EUEA 4ZC1A 1O96A 2FMXA 4XVCA 4ZVQA 1CY4A 2G9QA 4BU0A 3A1WA 3T9BA 3IOBA 3AVOA 4G6ZA 5CP8A 2CFOA 2F43B 2ID8A 3EDOA 4MH0R 1F14A 1OWOA 3PGXA 1QFSA 1YC2A 4LN1A 3WKAA 4UD6A 3F90A 4HAOA 4PIMA 4RGBA 3DQQA 1MLDA 1PE0A 2Q0XA 1JIIA 4WOPA 2NU9B 4UUOA 2FPPB 1PK7A 2QMEA 5IANA 5KVQA 2NXEA 1O97C 1W5EA 1X70A 1PGOA 1K6MA 3RS3A 3SK0A 2C98A 2B1IA 3E8XA 3L40A 4C6SA 1L5HA 3WL7A 4Z2AA 1N0UA 1BCSB 1K5DA 2VYQA 5IDXA 2H1SA 4O2BF 4FT4A 4HEHA 1UWVA 4ZO7A 2V55B 4XWKA 4F84A 4YPVA 5KX5A 4EHJA 4E21A 3ZK8A 1LY1A 4Z1OA 4UBNA 4G0XA 4Q1AA 4PPQA 1LZKA 4KQGA 2GJAA 5AW7A 4AWXA 1Z4JA 1N9GB 1QLWA 1YWGO 3H5RA 2W6NA 4QTXA 2B98A 5G3YA 4EYQA 3CURA 4HNRA 1Z82A 4U3JB 1T13A 1G3IA 1Z0ZA 3M89A 2DULA 1WCXA 1RXEA 1UJ2A 3PHBE 2Y9PB 1T1SA 5BSEA 5K3OA 2AWNA 3IUJA 3U7GA 3M2TA 1SHTX 3D43A 3L06A 1KMHA 4H59A 1CUBA 3RBVA 5BORA 3OQOA 2DYKA 1H9AA 3H2KA 4IMRA 2Q5OA 4EYKA 1VGRA 4R1QA 1QVWA 2OSVA 4G0OA 4IQGA 3R3UA 4QRIA 2ZYGA 3OX3A 2WD8A 5CDSA 5ENDA 2AN3A 1T36B 4O59O 3RPEA 3OKPA 4LK2A 5B7GA 3PYXA 4WCVA 3FJ1A 2B0JA 2BCEA 1X38A 2B37A 1BXRB 1SMKA 3JARB 4ZVUA 4G4SP 3HBLA 5T4FA 3T06B 4ZCRA 1C1HA 1LDBA 1XX6A 4PZUA 3DTVA 1M3SA 3M1LA 1V3QE 3D3WB 4FGWA 4P3NA 5J63A 2ZRJA 3CCFA 5DHQA 3S0JA 3Q5EA 2ZIAA 2PQ6A 4RSHA 5LA6F 2H6EA 2OQIA 2VJKA 3KT3A 4O4IA 1IG3A 3BD6A 2QXYA 3K96A 5CM8B 1XZMA 5BPFA 1NATA 1UDAA 3MMSA 5JO9A 4OXNA 3Q87B 4RTPA 1RYEA 1PWEA 3G2LA 5ISMA 2AR0A 2VS1A 2YNMA 2IEBA 1NM5C 2FSGA 1S2LA 1Z6QA 1O4VA 2RJ3A 2B4YA 4BKQA 4PR3A 4YFVA 4ARCA 3KTDA 2XH8A 1V5GA 2E89A 2CVQA 3I1YA 1C80A 2J85A 2PKCA 3CKKA 4AMUA 3OHPA 1LBTA 3AEUB 4ZI2A 4H7DA 1G0OA 3GWZA 4OQLA 1GPLA 1AU9A 2A8YA 3MJDA 3CLTD 5AMXA 3GHHA 2VHCA 3OJWA 3C24A 2O1XA 4B3CA 1L8LA 2W2XA 3OQ6A 2J6CA 4U5XA 2BEWB 4BN4A 4F2DA 4B43A 5KTMA 2BMAA 4BXOB 1V8ZA 4JROA 3DXFA 2RGYA 2GYWA 4RYDA 4JBIA 2HGZA 5LZ9A 2V7EA 1FK8A 1NJ5A 1ZGGA 2FX2A 2RGCA 1I7NA 1QCCA 4LGCA 1S2GA 3GPDG 4EZEA 5MF6A 3O8OA 4LUCA 4DKXA 2QP3A 2DLNA 4AM8A 3RODA 5DYNA 2XPCA 2I6GA 1PFVA 2ZXEA 4JJ4A 3HWSA 4CKZA 2AGVA 2W4QA 4YUYA 2E49A 4AF8A 2P4SA 3SF8A 1DTSA 3WOHA 5AJUA 5KWVA 3B9PA 3WLPA 4B3MB 3H2GA 5DRTA 3MHTA 2FF7A 3FTCA 3H5LA 2EVWX 4FX2A 2BFAA 3E48A