1X1EA

Crystal structure of tt0495 protein from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
MERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title Crystal Structure of TT0495 protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 85
structure length 239
sequence length 239
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x1eA00
4L4RA 4DLAA 2NSDA 4E13A 3TFOA 1YONA 3ZW8A 1WAMA 1DEHA 3I5MA 1NPYA 1UXGA 3TOZA 5BT9A 3C1AA 3ETGA 4RVGA 3DR3A 4EZBA 1A4UA 1PQPA 1R4MB 3I9KA 1DDOA 2NU7A 1T26A 1VL8A 3GPIA 3F4LA 3G3EA 4HKTA 3ZHZA 1UZNA 4BV9A 4YVFA 4EITA 2Q3EA 3QA9A 2HUNA 3CPSA 1BW9A 1E1MA 3NT4A 4ALJA 1E6EA 4WJZA 1UDBA 3IMFA 2J5QA 1FDTA 3ETDA 1SCUA 5A4DA 2FZEA 1DHRA 4EUHA 2BMAA 5KJ6A 2G5CA 3NAQA 5A5FA 2PLAA 3QE3A 1O9BA 1Y8RA 1HDZA 4PFJA 1TA4A 4OQZA 1YVEI 3VC7A 4EEXA 1A9ZA 3TDKA 4G5HA 4WGGA 1SC6A 1X15A 2FY8A 4ND5A 1WXDA 3VTFA 2PA3A 3D5QA 3LLVA 2O23A 5G0TA 4AJNA 4DREA 4XRRA 3JQFA 3PHJA 2PD6A 2UDPA 2A9FA 2R00A 1R0LA 2X6TA 2A92A 3B1JA 4M87A 4TVBA 3A1NA 1CWUA 1MXHA 3KB6A 4OO3A 4CJXA 4J3FA 1PJCA 4Q39A 1M66A 4GWGA 2NNLD 2Y67A 1PIWA 4E30A 1P31A 2Q1TA 2G76A 1HRDA 4ND1A 2C29D 4DLLA 3K96A 4Q3NA 1TVEA 3N7UA 3JCZA 5TLSA 3OICA 4XGIA 4X54A 4D3SA 1TT5B 1W0CA 1IOLA 1JW9B 2AEJA 1P1RA 2B37A 1NPDA 1ADFA 3RVDA 3ZWCA 1ZO8A 4BGIA 1LNQA 2DLDA 4PGFA 3MJ4A 2Q45A 3JTMA 2YY7A 1DC4A 4FFMA 5B4VA 5CEFA 5DOVA 4Z9FA 1LRKA 3E82A 3ROQA 3HUDA 5AVOA 4AJJA 3EW7A 4YYZA 4Z0TA 1DLJA 4NU5A 3WMXA 2TMDA 1SAYA 3ZNQA 1Y9EA 4CQLB 5JYEA 3JQFC 4E32A 2P9GA 4B4UA 3DBVO 4BNGA 2GDZA 2PH3A 3EGOA 2GN8A 4JX8A 2PKRA 4MJLA 5DP1A 2DUWA 1ISJA 4FGSA 3UFXA 2Q1UA 1KEUA 2NV6A 3JYQA 5TC4A 4M49A 2VNSA 4WEOA 2DVMA 2VHZA 3WTCA 2SCUA 2YYYA 1NFFA 2VUUA 1YB4A 1FJHA 1RM5A 1HSOA 1LQTA 3KBOA 4RPGA 5HWSA 2IEBA 4U8GA 1PWZA 4FFPA 3H8VA 1XA0A 2BFAA 2EGHA 2YV3A 3P7MA 4YAIA 4E5KA 2WMDA 1O5IA 3DWFA 3WNVA 2BF7A 1IPEA 3IP1A 3PHGA 1I01A 2DBRA 3KUXA 3R0IA 1VKNA 2VHYA 1BDBA 2YDYA 3GQVA 4CV2A 5DBGA 5L51A 1H2BA 1YXMA 5AOVA 3COSA 3GRKA 3JD4A 1DIRA 3L4BA 4U6SA 4HX5A 4CLRB 3HHPA 3NRCA 3G17A 1HYHA 1P1KA 2FN7A 3JQ6A 3L6EA 3Q0EA 4MP3A 3UCFA 3VVBA 1LSJA 3ADOA 1P0CA 1X0XA 1NBOA 2Y0DA 4WCFA 3RSHA 2JD2A 4JJGA 4ND3A 4XQGA 1B16A 4ZRNA 1LA2A 1YQGA 3AWDA 2W98A 4EUFA 5ILOA 2AXQA 1RM4A 4KWIA 4QO8A 3ZZNA 3IKTA 2X1HA 3WQRA 1GDHA 1N2SA 1H6AA 2I76A 1SOVA 1Q1NA 5B12A 1XU7A 1D1TA 1EVYA 1N1EA 1PJTA 1ZH8A 5TS3A 1NFRA 1HE4A 5DBIA 5LCXA 4MP6A 3DTTA 3VH4A 4QFCA 5CG1A 2WDZA 1EUZA 1KVTA 2G82A 2NQTA 4TRJA 5EQFA 5ILGA 3WXBA 4BNTA 3ASVA 3NX4A 4GX2A 1UP4A 2PGLA 5DN9A 5KJEA 4IQ0A 2UYYA 3RC2A 4AJOA 1H9AA 4ROSA 5T57A 4WCFC 4XR4A 1A7KA 1MC5A 3F4BA 2W2KA 1PX0A 1MG5A 3V1TC 1KETA 3VKVA 1J49A 3MTJA 4HADA 1A4IA 1GTMA 1VSUA 2EF1A 2EGGA 2DC1A 3L6OO 3DBHB 1Y81A 2RHCA 2CDBA 4NI5A 3HJAA 4AG3A 4NJMB 4RPLA 4RZHA 3CMMA 5DDIP 1SZJG 2FPGA 2UUOA 2HAEA 4URFA 5H83A 4ZGWA 5KJ1A 2IRWA 3B20A 4JNKA 1HE3A 4E2ZA 4ZQBA 4PLZA 3SJ7A 1MXFA 4CMCA 2Q99A 3WGYA 1OBFO 1F14A 4D3DA 4FD3A 5AYVA 3UN1A 2JCYA 1UJMA 3UW3A 5TT0A 3GGOA 1LDYA 5G0VA 5LDHA 1CEQA 4MVJA 1HWYA 3KYCA 4R51A 1F12A 4L73A 4CM9A 2C7GA 1I2CA 1BDMA 4TMFA 1M76A 9LDBA 1XLTA 4IDBA 1PEDA 1G0OA 1PR3A 2IZZA 3SC6A 4OJNA 4EUEA 4FBGA 3VZSA 3LT2A 3WDSA 3QHAA 1AE1A 4GBJA 3GA0A 4CUKA 1R37A 4B4VA 4D46A 5JDCC 3HN2A 1HEUA 3SVTA 1MUUA 1MGOA 4IXTA 3BMNA 1BWSA 3JYOA 3NT5A 3QWFA 4QECA 1PS0A 1NVMB 4ID9A 3IQDB 4ZA2A 5L95A 4HFJA 3TZKA 3PWZA 4I5EA 4CLOA 5A9RA 1FF9A 3DO5A 2P68A 3KETA 1YQXA 1WP4A 2ILTA 1QYVA 1LXCA 4GKVA 4M89A 1P74A 5DCYA 3D5TA 4GVXA 2JFGA 3M1LA 5CPBA 4YA6A 4RQTA 4YWJA 2NVUA 3ULKA 1CJCA 2C2XA 4BKQA 4S3MA 2OBYA 3PWSA 1UP7A 1LDEA 1EFKA 3IIEA 4N7RA 5KVQA 2X22A 3LT1A 3JQ7A 2P4HX 4D41A 2EKQA 4IS2A 4H16A 4MVJE 5BNTA 2A35A 1QV6A 1KC3A 4MINA 4R1SA 4OXKA 5TNXA 4BNZA 2EEZA 2ZTLA 4FS3A 1QYCA 4D3FA 2CSUA 2DTXA 1DBVO 1BVRA 4J4HA 1GZ4A 2ZQZA 3IP3A 4CUZA 2VUSA 1UZLA 1PS8A 4PLTA 1EMDA 1OAAA 1MC4A 3I3OA 1DC5A 1E5LA 3I23A 5JC1A 1XU9A 4U0KA 1HXHA 1NWCA 5G4LA 3VZRA 4JJFA 4RCVA 1NQ5A 2Q4BA 4CM3A 2F00A 4GH5A 1PL7A 2GR9A 2I9PA 3S55A 1H5QA 1U2GA 4XR9A 2Y1EA 3WGHA 3N58A 4IJWA 4AJHA 1LDNA 1ZEMA 2E6UX 3CSDA 3QVSA 4CQMA 3ZDFA 3B1KA 3ANMA 4OXNA 4J2OA 2AQKA 2H5LA 3C1OA 3WB9A 3QW2A 3QVOA 5HRUA 3D4OA 4WOKA 4FB5A 1O89A 1QSGA 4YDRA 1ISIA 4FPXA 3L4SO 2NVBA 3OF2A 4W4TA 5A3JA 4KTTE 4AJIA 1E77A 1A7AA 3ZV3A 5BSGA 2EP5A 4RPHA 4WLFA 4DGSA 1QLHA 3L9XA 3PJGA 1R4MA 3G49A 1M6WA 4DC1A 3H9EO 4XRGA 4UEJA 1DJQA 2GZ3A 2I99A 3RUIA 5ADHA 1U3WA 4Y98A 2EG9A 5U4QA 3RJ5A 2CMDA 1WLYA 3BHJA 5G4KB 4IBOA 3RFVA 4BL5A 4ALIA 2J5RA 5DZSA 3IAHA 4KDEA 3O26A 3ZV5A 1TB4A 4WPGA 2GERA 3IKVA 4MOWA 4DLBA 2OMEA 3GZNB 4BNNA 1A71A 1S6YA 2JFFA 4AL4A 3KYBA 4ITUA 2P4QA 3PI7A 1AHIA 2FPPA 3FBTA 3WGZA 1AXEA 4CV0A 5T67A 3UH1A 1NASA 2A94A 4HXYA 4OGWA 1BHSA 3RC1A 1A9YA 1DHTA 4IIUA 5G0WA 1HT0A 3CINA 4M1QA 3RU9A 1VRWA 2B5WA 1JU9A 3CIFA 4OYRA 4ALMA 1ZCJA 2BI8A 4KUEA 4IJKA 4M86A 4MP8A 4CMGA 1QR6A 1ZFNA 4WCFB 3VZPA 1IB6A 6ADHA 1B26A 3K2BA 5COQA 4Z3KA 3HZZA 1NTOA 3NYWA 4DYVA 2X4GA 2PTGA 2GD1O 3H2ZA 5DP2A 2HLPA 2IYOA 3K31A 3OETA 1DRWA 2QIOA 4DA9A 4YAGA 1YS4A 3U62A 4GAEA 1NPTO 1WWKA 3I4CA 5A9TA 4GGOA 3PHLA 1GYPA 2QYSA 4BGEA 5K0ZA 4B4OA 3F1LA 1R0SA 1ZBQA 4HNHA 3U4CA 3SC4A 4GVLA 5L9AA 5L4SA 1JAYA 4CMJA 3GGGA 3JQDA 4BNUA 1L1FA 1N5DA 4BO9A 3ZN2A 4CM8A 1U4OA 4FOSA 3KYDB 4A2CA 1NHGA 3EHEA 1PJLA 4TZTA 3ROMA 1QMGA 4XIJA 3PQEA 4RPJA 3RASA 1IULA 2CNBA 3RWBA 3ZNNA 4J2HA 3WYEA 3OSUA 3MJTA 4J16A 4A27A 2VWPA 3RD5A 5ICSA 3DZJA 3FR7A 4EBFA 2EERA 4PRKA 4CLHA 3KHUA 3ST7A 2HMTA 2EWMA 2J5KA 2JAHA 1J6UA 3ROPA 3WICA 2QHXA 1N7HA 1MFPA 2Q2WA 2CY0A 3IUSA 5KVVA 4D45A 4CM6A 4A03A 4OKNA 4NBUA 3GDOA 1IYZA 3ANLA 4OSPA 1HTBA 5BR7A 4DTIA 2CD9A 1CERA 3EMKA 2HK9A 3ETEA 4CM5A 2VQ3A 4EDFA 4Y9DA 3K5PA 1VL6A 3A28A 1VLLA 5BSFA 4R1TA 3HSKA 4FOOA 4DPMA 4E4YA 1ZMOA 1K6XA 3V2HA 1JKJA 5A3VA 1QV7A 2V6FA 5JDIA 1IL0A 4E0BA 4Z9XA 2JHFA 1O8CA 4IDFA 2V65A 1EUCA 3HDJA 1PZHA 3GDFA 4MIYA 1XGKA 5LC1A 3EYWA 4NU6A 5B37A 1Z82A 3LVFO 4FQ8A 1RJWA 4DUPA 3F1KA 5KKCA 3TF5A 4CLRA 3SLGA 3NDRA 1NR7A 4CM4B 1UH5A 2O3SA 3KSZO 3ZWVA 3CMCO 4AICA 2C82A 3A14A 1N92A 3DXFA 4XB1A 1ONOA 2Q2QA 4IIVA 1NQTA 5L3ZA 3VDQA 1Z7BA 3U4IA 2C0CA 5TJ9A 4JBIA 3EVTA 4EJ0A 4PRLA 2GCGA 1JDJA 3E18A 5U9CA 3OQ6A 3PPIA 2XF8A 3QVTA 4CODB 3BIOA 3C7AA 1B8UA 2PK3A 3E9QA 3VPXA 2VYNA 2VOJA 3PLRA 2C20A 1CETA 5AXDA 2DBVO 1Q0LA 2DQ4A 5EMHA 3RUAA 5THQA 4FFNA 4A73A 4D0SA 1KEPA 3LC7O 4BO3A 3OEWA 3ZNPA 3KEOA 4RLHA 3F46A 1OC2A 5HS4A 1PR9A 5GZ1A 1UZMA 3GFBA 3OBBA 2DBQA 2D2IA 1V8BA 3UXYA 2WJPA 4JLWA 4RVUA 5C37A 3U4DA 2P9CA 5I7VA 3R3JA 3NTRA 2W2LA 2WD8A 4E31A 1NVGA 1WPQA 3HB5X 3GN1A 2Y99A 4W9NC 3ZHYA 2X0RA 3DBHA 3OEYA 2NU8A 4CMHA 4TWRA 2VCYA 3Q9UA 5ENDA 1GYQA 3H2SA 2X0IA 1LRJA 4Q9NA 3PIDA 4NJMA 1U8XX 3JQCA 4WNCA 4CL8A 3B1FA 7ADHA 4BO0A 5IDYA 1WMBA 3RKUA 1V9LA 3Q3CA 2P5YA 3AUTA 5KVSA 3H7AA 1P1JA 3K6JA 3A06A 1HZJA 2H63A 1HLDA 4K6FA 4J4BA 1F8FA 3BTVA 4B7XA 4BNIA 2WM3A 2E37A 3ZU5A 2VRCA 4LRSB 4IDAA 1CDOA 1KEVA 3PZRA 4WLOA 4DPKA 5CDGA 3F6YA 1O94A 1DFGA 2W90A 1PJQA 5F3RA 3ONFA 1XKQA 3U5TA 3IL2A 3H5AA 1ZNQO 1KVSA 1ZVMA 4R68A 3NJ8A 5H82A 4CV3A 4BQPA 2XOXA 2O2SA 1D8AA 1UAGA 1DPGA 2AG8A 3Q1LA 4IJUA 4UUMA 3DZKA 3P19A 3VPSA 4TRMA 5CFZA 3AY6A 4Z0HO 3AY7A 1JVSA 3IUPA 4E33A 1U5CA 3AUAA 3H3FA 1KIFA 3W8EA 3WNQA 2TMGA 5G0UA 2D1YA 2Q46A 3GG2A 4IQGA 1NHWA 2EKPA 4BO6A 1XQ6A 2HDHA 1YJQA 1I32A 3GT0A 1DIAA 2I3AA 4U7WA 4DXHA 1GPJA 3DHNA 2NACA 3D0OA 4XEHA 1PQWA 2O3UA 1BSVA 3KO8A 4P4LA 4L75A 3M2TA 3DB2A 2O3JA 1K5HA 5JCXA 1GAEO 4PG4A 4FSHA 1PGNA 2X23A 1KBZA 2PD3A 2B0JA 4J49A 3TWOA 1PZEA 3G1TA 4NMHA 4JIGA 4DMLA 4E12A 1GD1O 4BO5A 4ALLA 1RYEA 5HM8A 1U7HA 4BKOA 1PTJA 5L40A 3EZLA 2HJSA 2HKIA 4NBWA 4YPOA 3DMYA 4E2XA 2Y0CA 4YCAA 5DCUA 2D5CA 1VC2A 2HRZA 1PJSA 3H9UA 4MKXA 3GOHA 2FZWA 4Y8VA 3GVIA 1K6IA 4IGEA 3KOUA 4R4JA 3PJDA 2G1UA 3INGA 5ER9A 1R66A 1V6AA 2HQ1A 1SO8A 5FWNA 1Q7GA 4BKRA 4NIMA 3LU1A 4P8RA 5BSEA 4QUKA 1CRWG 3H65A 4XYLA 2PGDA 3W4IA 1WZIA 3FWNA 3NGXA 2GZ2A 4CM8B 5H81A 3DDNA 3U4HA 1M2WA 4NR0A 4ZN6A 2OHXA 2HK7A 1TXGA 1LLDA 3PZBA 1T2CA 1O95A 3H9JA 4I5FA 4BNKA 5IJZA 5JW6A 4K28A 4HFRA 2GNAA 3C8MA 3WFJA 1ZSVA 5JYDA 4Q3BA 3W4KA 1P77A 5DF1A 4NBRA 4QFDA 3VZQA 2ZTUA 3P2OA 4LRTB 3S8MA 4PLCA 3W6ZA 4BNHA 1V3UA 1TEHA 9LDTA 4AJLA 4L76A 4DVJA 2D5AA 3CH6A 3QWIA 1HDXA 4UVIA 4OL9A 1DIGA 1HZZA 4NZ9A 1FDUA 1ZW1A 3L6DA 1GR0A 3UAGA 1T2FA 3RAJA 3G79A 2E49A 2O3QA 2HMVA 3PVZA 3PJEA 5TGDA 2W8ZA 2EKLA 3RUEA 2AE2A 2CUKA 3ANNA 3M2PA 2UV8A 4D0RA 1E6UA 3D64A 3ZWWA 1LDMA 5JCJA 1DLIA 2OZPA 3DBLB 1RM0A 3ZWOA 3GK3A 1KVUA 5G4KA 4C4OA 3PDUA 4ZQGA 2PFGA 4J1NA 3PDJA 2JD1A 1ONNA 2EW2A 5A05A 3UGKA 3BMOA 5C7OO 3PGXA 1PGQA 2Y68A 1U7TA 3GZNA 1GV1A 1OFGA 2YW9A 3SBOA 4HV4A 2O4CA 3ZGYA 4EW6A 5C7IO 1I3LA 2DFDA 4TVOA 1C0PA 2NVWA 5L7YA 2Q49A 2I5PO 5TF4A 3WX0A 4BB5A 1ZIDA 1ZK4A 4B3JA 4CV1A 2FPIA 3TL2A 3H5NA 2LDBA 1V3TA 3BTOA 1JN0A 1TI7A 1HE2A 2YZ7A 4UEKA 1T25A 4LN1A 4GQAA 4IJVA 4UVGA 4I9NA 1JLLA 1P1HA 1X0VA 4FGWA 3VVCA 1SEVA 4QO7A 3QVWA 4YRAA 4G2NA 1PJ3A 3AU9A 3OJEA 4KWHA 4CQMD 5JAQA 3DZHA 4R9RA 3QWAA 3TRIA 1H6DA 1LBEA 1M67A 2GRAA 3DONA 1R4NA 4PVCA 2YQ4A 3M6IA 3KVOA 1SOWA 4GX1A 1AHHA 3Q6IA 3QP9A 1K89A 4AJPA 3MTGA 1YB1A 3DL2A 3JD1A 3ROKA 2IXAA 2ZCVA 1EDOA 3KYDA 4NFHA 4R3WA 5TSDA 1KC1A 5FEUA 3ZCXA 5GZ3A 5IAAA 4BO8A 4GLLA 3JQAB 4BNVA 4GMGA 5KKAA 1K0UA 4BNYA 3GVCA 3FCOA 1F17A 3KLPX 2NM0A 3WOHA 4ALKA 3EAGA 3JQBC 1VL0A 4PG7A 2X58A 2H6EA 2XXBA 1S7CA 3KZVA 4A5OA 3FNHA 3T4EA 5EQDA 4EJMA 5EL0A 3T7EA 5COBA 5JDCA 3WLEA 2Y1FA 1JKFA 2AEMA 4KUHA 4H3VA 1YRLA 3LC1O 3DFZA 3GC6A 4RF3A 4A7PA 3EC7A 4K1LA 3WIDA 2PGJA 3HWRA 1DO8A 1B8PA 1XIVA 1PZFA 4XJSA 1PU2A 4L9RA 5KJCA 2DTEA 5IG2A 4D42A 3MJCA 3U09A 5J23A 2B83A 4XA8A 4XX0A 4NJOA 3A4VA 4DBVO 5HS6A 1YL7A 1P0FA 3INTA 1EVJA 4ZICA 3M1AA 1YH3A 2OGUA 3FI9A 3O8QB 3BAZA 2AQIA 3SX2A 2Z5LA 1E3SA 2QRJA 4GSLA 3WLFA 1YDEA 3T7CA 1E7QA 3LDHA 3LLSA 2X86A 3JQGA 4U5QA 2OP0A 5JS6A 4CM4A 3JD2A 1NR1A 1LEHA 3FSRA 1V0JA 4Z3DA 2I66A 4R01A 2LDXA 3AY3A 4BNXA 4F46A 3UCXA 3W6UA 5COAA 4FN4A 2BKAA 1GV0A 1P44A 2IZ0A 3RC7A 1UXKA 1H0KA 1NP3A 1HKUA 4CR6A 1NAHA 3FPCA 4Q3EA 1ZSYA 2BGLA 3NTOA 1U3UA 1I3KA 1E1KA 1U3VA 3LQFA 4IQ8A 3G0OA 4TKLA 4TRNA 4BNLA 1HDGO 2RIRA 3PLNA 2VWQA 3F3SA 4IZHA 4RJTA 4AFNA 2FR8A 3OHSX 3L77A 1OC4A 4ZD6A 5TT1A 4CPDA 4YACA 3EDMA 3H9GA 3GR6A 4B4WA 1YO6A 1E3WA 4ILKA 4R3NA 1ENPA 2NADA 2ZB8A 3E9MA 4RVSA 3KSDO 4YAJA 3GEGA 2OORA 4J1TA 3UVEA 2FWMX 1ADBA 3HE3A 4M55A 1Y7TA 2X9VA 4RF5A 4JBGA 4N5MA 1YKFA 4IPTA 1XR3A 1U2DA 4N5LA 1LI4A 2XPCA 5CDTA 1GZ6A 1HLPA 3PHIA 1NAIA 1GZ3A 4HY3A 2ZYAA 1JTVA 4R54A 4TSKA 5AQ1A 3H5RA 4ZQHA 1ZUD1 4HWKA 3TNLA 1X7DA 5JPIA 3JSAA 1LX6A 2VNAA 4IDEA 1U5AA 3B6ZA 5A02A 4O5OA 1D4FA 3V2UA 3X2FA 1N9GB 1E0DA 1U28A 1W4ZA 4ND4A 5IXYA 2NWQA 2ZTVA 3C3XA 5EPOA 1Y5MA 2FOIA 5TIIA 5CP8A 1YDWA 4GX5A 2IDZA 3Q2KA 3ICPA 3DAPA 1KYQA 4QSMA 1JA9A 3I1JA 5FI5A 3E6AA 4XGNA 3ZI0A 1VJ0A 4YAKA 2V7PA 4XDZA 1BXKA 4DIOA 4UVHA 2E82A 5G0SA 3K9QO 4I9HA 4KMSA 1GQYA 1I3NA 2IZ1A 4BNWA 1XEAA 1NYTA 2Y1CA 2I65A 4FJ0A 3S2IA 3BZUA 3HADA 4Q3AA 3KLMX 5G2OA 4CMAA 3ORFA 1Q2XA 1BVUA 3CUKA 3SLKA 4IS3A 1FDVA 3WGIA 4FFOA 3PGJA 3RBXA 2QRLA 5CPFA 4E3ZA 3UUWA 1B2LA 1ID1A 3AOGA 1X7HA 3ZWXA 5L45A 5L53A 4XQEA 4L74A 5FI3A 3DQPA 3V2GA 4QTZA 3W1VA 5DULA 1HDRA 1LU9A 4MPDA 1SPXA 1UDAA 1GEGA 2X0JA 2E4AA 4CR7A 2GN9A 4GX0A 4G65A 4IDDA 2WWRA 5U1PA 2V6MA 1B14A 3FHLA 3DMTA 4PG6A 1DAPA 1E1NA 1YJ8A 1Z6ZA 2VN8A 3QV1A 1E3IA 1WVGA 1EZ4A 3BMOB 4C7KA 2AEFA 2VUTA 1U1IA 1WDKA 5GMOA 4B8WA 3H3JA 4Q3DA 5ER6A 4P4NA 3PWKA 1YQDA 4I8XA 4E5YA 2X9NA 4NHEA 3VDRA 4JBHA 3MOIA 3WBBA 1KY4A 4WNIA 4PG8A 3HDHA 2P9EA 2X5JO 4O6VA 2J3IA 5CAEA 5TRTA 2PY6A 3FN4A 3R1IA 3PFWO 1VJ1A 4I5DA 4J91A 3WJ7A 3X2EA 4YT4A 5JAMA 4IM7A 3GMSA 1LQUA 3SJUA 2Y1OA 4UEOA 5JAIA 2ET6A 2X5OA 1F8GA 4DQXA 2FRDA 4PZEA 5JXWA 4R1NA 1JVBA 2VRCD 4OH1A 2UUPA 3ITDA 4BO4A 2GO1A 2QG4A 4HBGA 2PZLA 1IZ9A 4AJ4A 1OI7A 1R4NB 2OP1A 1NXQA 2Z1NA 4DPLA 3DMTC 3NV9A 4PLGA 1HYGA 2NU9A 1H9BA 5ITWA 2C7VA 2OOSA 4MVJF 5EINA 5DBFA 2HJRA 4QX6A 1B7GO 2ZYDA 1ZMTA 1H94A 2Z95A 2CF6A 2PKQP 4F6CA 4INAA 2IEDA 1UR5A 1CF2O 1T2EA 1YOVB 5DT9A 3OQBA 5HBRA 4EI2A 4YR9A 3HFSA 4J43A 2EP7A 4HFNA 4NDNE 4NFSA 4YQYA 5KIAA 3GZ4A 3LC2O 1IUKA 4J9VA 3TZQA 2B36A 1LUAA 3QSGA 4HUJA 4AJ2A 3TQHA 2C54A 1CQIA 3KRTA 5T8KC 3DBRA 2HK8A 1HSZA 1VE9A 3RROA 2BFPA 1ONPA 3OJFA 2DUUA 4MVJG 4UULA 1U8FO 3FWZA 4R5HA 4B3IA 5IZ4A 2RH8A 3ZU3A 3K2EA 4U6QA 4R16A 4E6PA 2JL1A 5THKA 3EY4A 3OFSA 4PVDA 2ZATA 5EN4A 5KTKA 1WDMA 4I08A 3CTMA 4XB2A 4OAQA 3HQ4O 8LDHA 4BMNA 4OSOA 2VT2A 1OMOA 4LMPA 4KQWA 4BGUA 1I5RA 2F1KA 3I9NA 3L9WA 3LYLA 1U3TA 4YJFB 4LCEA 4BOYA 4OHUA 1HE5A 5I8ZA 3DBLA 1LSOA 3HNPA 3SXPA 1DRVA 4IZIA 4TKMA 4UUNA 3TPCA 3UICA 2BGMA 3W8FA 3FNEA 1GQQA 5KNLA 4JQCA 1C0IA 1H6CA 1LRLA 3BTSA 4WECA 4EJ6A 2GGSA 4J7UA 2R2GA 2BH9A 2WD7A 5IF3A 1BTOA 1NVTA 4D7AA 2VTEA 3NDIA 2NU6A 5CG2A 4IMPA 3HB4X 4FR5A 3PRJA 1T1SA 2VZ8A 4GLOA 4K6CA 1UXIA 3C7DB 3AM4A 3NKLA 4NBTA 1NFQA 3JQGB 2EHDA 2FP4A 5MGBA 4TRRA 3AI1A 4HP8A 2BGKA 1SNYA 5B1YA 4XZ3A 3MJVA 3RJ9A 3NUGA 1A5ZA 4W9NA 4CL3A 2WEKA 2ZYGA 3I6QA 2IYPA 4E21A 1HYEA 3U49A 2UAGA 4RZIA 4CMIA 5K9ZA 1C1DB 4CLDA 3PEFA 4L4XA 1NX6A 2B4RO 2D0IA 3PXXA 1EVIA 3D3WB 3BMCB 3GFGA 1PZGA 3KTDA 1SMKA 4J1SA 4K26A 3A9WA 2BD0A 3B70A 4G81A 1GEEA 1HDCA 4FJ2A 4R69A 1XCBA 4YQZA 4RVFA 1E3WB 1YL6A 1ENZA 4BHTA 3JQAA 4ZQFA 1VJTA 1VSVA 1O0SA 3BTUA 3AK4A 2QW8A 1I8TA 4YT2A 5A1TA 4PG5A 3L07A 4GKBA 4QQRA 1W6UA 2WYUA 2NTNA 4CMKA 4MVJI 4ONEA 5K6AA 1WW8A 1XELA 1EK5A 1GU7A 3UOGA 4D44A 4II2A 1B0AA 2WSBA 2CFCA 3JD3A 4A0SA 3AI3A 1LTHR 1P45A 3QJ5A 1MP0A 4Y67A 3I52A 1G6KA 2J8ZA 2D59A 5F1PA 1E5QA 2WYVA 4LCJA 5T64A 3EVNA 3IJPA 1H6BA 3WTBA 5JC8A 1ADGA 4XIYA 1VPDA 5A9SB 1HETA 5FYDA 3ZWYA 1T2DA 5JY1A 1MB4A 3S2EA 3PYLA 5CEEA 1N8KA 4RQUA 4DRYA 3Q9NA 4BQRA 3OIFA 1Z45A 4O59O 1J5PA 2YHIB 3H6KA 3NTQA 4S1VA 5AXAA 1YWGO 5I7SA 2Y1DA 3STHA 1DJNA 5JMWA 1QG6A 2I3GA 2AE1A 3WSVA 4DWVA 3D3EA 1ZK3A 1OOEA 3O8QA 2AA3A 3AM3A 3E9NA 2EJVA 1FDSA 1UP6A 1I30A 5K6AC 3PQDA 3LF2A 3HDYA 3ONEA 1XQ1A 3WJAA 2VYVA 1DC3A 4CMBA 3K92A 4CR8A 1PSDA 3DZFA 5JNLA 4IGFA 3CZMA 4GSKA 2HCTA 1E3JA 3RC9A 4WE3A 4LVCA 3O4RA 4I5GA 5IDQA 1ZEJA 2DM6A 2WE7A 1Z75A 3OECA 4LMRA 4BO1A 3WWYA 4OM8A 1LLUA 4EYEA 1E7WA 2YUTA 3PJFA 3N74A 1GCUA 2FR0A 1EBFA 3GUCA 3ZNOA 3SEFA 1GQ2A 2D8AA 2DPGA 2JKVA 1B3BA 2D4AA 1Q0QA 4GWKA 3W4JA 4CM7A 1BXGB 3ENNA 2Z1MA 1YE3A 4PN3A 2V6BA 2IXBA 2VRBA 3FTPA 3JQ9C 2POQX 2JJYA 5I7FA 2EXXA 5JO9A 1JQBA 2RBEA 3FF4A 2OO5A 1HDOA 1Q7BA 1PGOA 4WCDA 3GN2A 5BNFA 4ALNA 1G1AA 1MX3A 2WYWA 1KVQA 5C5IA 4L8VA 1J4AA 4MIEA 1C1XB 1GCOA 2YHUA 3JQ8B 3GMDA 3F9IA 3GRPA 3NEPX 4OIMA 4YT5A 5A04A 4NG5A 2Q2VA 5C7LO 3AU8A 1EUDA 5I9MA 3MWDB 4MVJD 2C5AA 2QYTA 5JE8A 4Q3CA 5BNIA 4CM9D 2DAPA 5CDUA 2VOEA 4WLEA 5L4LA 2AHRA 4AVYA 3TL3A 4PZCA 5CEJA 3K73O 1UAYA 1SB9A 2Q50A 3BA1A 2Q1SA 3C1TA 1Z73A 2NQ8A 2ZIZA 3HFGA 3ZWBA 3PYXA 4NQZA 1VI2A 2H9IA 3U3XA 3GDGA 1L7DA 4FIZA 3RFXA 1ARZA 1UXJA 3DC2A 3WQSB 2Q4EA 4CM1A 2ZB3A 1N9GA 3FTNA 3OJ0A 5KVCA 5FFFA 1Z74A 1NWHA 1E3EA 4BIIA 4FDAA 4XQ9A 1ENOA 4YRBA 2DBZA 3ZV4A 2GYYA 2NUAA 2B5VA 1YBVA 2BHLA 1ADCA 1UDCA 2NLOA 3IS3A 4J7CA 1N1GA 4XYGA 1Y8QB 1FDWA 4MVJP 3LF1A 3KM0A 4WEQA 3IOYA 2FSVA 3DBRB 3KEQA 1DIBA 4J1QA 1PWXA 1FMCA 4JCOA 4PLYA 3CKYA 4RF2A 3UHAA 1PJ2A 2J3HA 2BI7A 3GG9A 1PS9A 4TQGA 4KUGA 4YJGA 3WSWA 1AGNA 3BMQB 3NJ4A 4DC0A 2BFMA 2QZ9A 4YBZA 3DOJA 4PLPA 2DPHA 1BGVA 3WMWA 2JFHA 3DFUA 1PJBA 3DHEA 3PQFA 1OZAA 4EEZA 2OL4A 4B7UA 4D43A 3NDJA 4GL4A 2ZQYA 3IJRA 5DNAA 1KY5A 4Y6RA 5JLAA 1MLDA 4YAEA 1E1LA 4A10A 2PZKA 2OBNA 3ENKA 4LISA 2R00C 4IXWA 2P5UA 1ULSA 3IDSA 5IN4A 5L7WA 5KOIA 1MA0A 2I67A 1D7OA 1M6HA 1XSEA 3AFNA 3BXXA 3E8XA 4R41A 3QWBA 2WD7B 4W99A 2PR2A 2W4QA 4DQVA 5TQVA 2Y93A 1DFHA 4JJIA 1EEHA 4LW8A 5IZCA 4QEDA 5KCZA 4DYDA 4LK3A 2VWHA 5L7TA 2BFOA 1EK6A 3LSYA 2PV7A 5JFOA 4I9UA 1P1IA 3CEAA 3FBGA 3GPDG 4IMRA 4PLHA 3JYLA 5CDSA 2CVQA 4Z9YA 1QYWA 4BMVA 4IDCA 1I2ZA 3JQBA 1R15A 1LC3A 4RL6A 4QXMA 2X9GA 4XYBA 3PYMA 3RI3A 4W7IA 3WGGA 2QZZA 3PP8A 3P5SA 4CMIB 2AMFA 1EE9A 4PLWA 2EV9A 4MDHA 4BGVA 3UKOA 3TN7A 5C3MA 1X1EA 4RV9A 2AQ8A 1ZK2A 2UVDA 3WG9A 3WGTA 5B4UA 3DHYA 3DEYX 3ZHXA 3VAZA 4B3HA 4YXFA 5F5NA 4M54A 3VPGA 1EBUA 3ON5A 3RCBA 4ESOA 4YJHB 2GN6A 1ZKMA 2G17A 2J3JA 2YQ5A 5DCWA 1YOVA 4HNGA 1NQAO 1QORA 5IZCC 4NBVA 4ND2A 4NFYA 1RM3A 1Q7CA 1W8DA 1GYRA 1T1RA 3VPFA 3TZCA 4B7CA 1EDZA 3LK7A 3MCVA 4RVDA 3RKRA 4MVJM 3WS7A 3WYCA 1LJ8A 4YJDA 4IDGA 1I10A 3VHRA 5A03A 1QKIA 1T4BA 4WUVA 4MVJH 5JSFA 5A5EA 2NTVA 2EW8A 4LVUA 3ZWAA 4M8SA 1RKXA 2AQHA 3GNQA 1F0YA 3QY9A 2CDAA 1V35A 1GY8A 3BHIA 2P91A 2Q1WA 1YBAA 2JD0A 1V3VA 1JKIA 1R0KA 3L4BC 1T24A 2OFPA 5CDYA 3DAFA 1HL3A 1H93A 3CE6A 4XD2A 2GUGA 3V1UA 4BO2A 3TSCA 1O6ZA 1A27A 4W6ZA 4J90A 4JGBA 5HA5A 1CIVA 3OA2A 4YJFA 4CLEA 1ENYA 2H1SA 4ZU3A 1H2HA 2YV2A 1ZJYA 3LT0A 6LDHA 3ADPA 3H4VA 3F47A 4OXYA 4NK4A 3ZH2A 3WFIA 2HU2A 2D3TA 4PIVA 1R12A 3GVXA 1LLCA 3QRWA 2VZ9A 4OMUA 5AXCA 5JAZA 3S2GA 1XYGA 3EZYA 4KQXA 3E5MA 5T5QA 4IY1A 4BNFA 1RPNA 3GH3A 1B8VA 1ML3A 4N5NA 5JO0A 1B15A 1E92A 1X1TA 2FMUA 4H7PA 4RF4A 4NPCA 1DOHA 1HF3A 3BHMA 1JWBB 1DXYA 1C3VA 2AW5A 3OMLA 4PLVA 4XGKA 5DOZA 1Z7EA 1ZXLA 3AOEA 4WK6A 3ICCA 5JMPA 2YV1A 3ZW9A 4FCCA 5A06A 3E03A 3AW9A 3DOOA 2I6TA 3WGQA 1ZK0A 4H15A 4YT8A 2O3RA 1C1DA 3VOSA 1CQJA 2RHRA 5JBIA 1N7GA 2FR1A 3V5NA 3DTYA 4R5MA 5TJHA 3L0DA 3T4XA 1U4SA 4EGFA 3D3WA 3BMCA 5LDGA 1PGPA 4FW8A 2GPTA 2J3KA 3VKUA 3ABIA 3HDQA 3DZIA 4GMFA 2C2YA 2JCXA 4WASA 4QT0A 4RPKA 3F5SA 4BNMA 3U9LA 1I36A 3GHYA 4BB6A 3I6IA 1ZK1A 4FC7A 4CLXA 4GGPA 5KWEA 4P38A 4XDYA 4RDHA 4ZJUA 4IUYA 3Q11A 1IPFA 4E5MA 2HO5A 4RLSA 3TZHA 2ZJ1A 1LDBA 4WLVA 5CHEA 1EFLA 3PHHA 2OXIA 1P3DA 4BVAA 1BW9B 1LDGA 1XDWA 2JHGA 1E7YA 3AOEC 2ZB4A 4DL9A 1YBMA 1XWFA 1EE2A 1X14A 3OA0A 4R1UA 3ZHBA 1FK8A 4CUJA 2CDCA 4F6LA 2VWGA 2RH4A 4KTVE 1Y8RB 2J6IA 5KJFA 3PIIA 4JROA 1K3TA 2YFQA 4TZKA 5A9SA 1GPDG 3RBZA 2DU8A 4MIOA 4Z6KA 4LSMA 4GPD1 4RORA 5GZ6A 1IZ0A 3UCEA 2PD4A 3UF0A 2O7QA 3D4NA 5JY6A 4A26A 3WR5A 4JP3A 3RUHA 1AUPA 2VHWA 3VPHA 1C14A 1BRMA 1YGYA 2PKQO 3BYZA 4KP7A 2C07A 2YHIA 4BMSA 4JP2A 1R6DA 2GSDA 1DIHA 3GEMA 3H9QA 1HDYA 4IINA 3VH2A 3S2FA 2B35A 1C0KA 4OOFA 3AFMA 1PQUA 1ISHA 3KV3O 4E5PA 1PJ4A 1IHYA 1Y6JA 2IODA 1IE3A 1LLQA 2AG5A 2VYND 3G1UA 4JN6B 4W82A 3TZ6A 3WWZA 3GF4A 4E2WA 4YJGB 4BUCA 3OQ1A 2BELA 4J9UE 3FRJA 2P2SA 3I83A 1E7RA 4KDFA 3WBFA 5F1OA 1D3AA 2Y66A 4J0EA 1FXSA 4N54A 4OQYA 2VZ0A 3I9MA 1J0XO 1DC6A 4JK3A 1B3RA 4R9SA 3JQAD 2GLXA 3VTZA 2JAPA 1JWAB 4XJTA 4KZPA 1QP8A 3TJRA 4GI2A 1WNTA 2PNFA 4BKUA 1KVRA 4BNJA 4DMMA 1YB5A 4O0LA 4FJ1A 3QLJA 2W2LD 4LSWA 3PK0A 1AXGA 4O1MA 3R3SA 1E7MA 3GY0A 1BXGA 1ISFA 2CVZA 1XG5A 3CZRA 1AN9A 1SBYA 4XKJA 3RFTA 3ZV6A 3FNGA 4L0QA 1NQOA 2B4TO 1CYDA 5I8WA 1KOLA 1IHXA 4DIBA 3MJSA 3RUFA 1XHLA 1A72A 2YDXA 4YB8A 1E6WA 3I9JA 3ITKA 1I24A 3JD0A 3OH8A 3O03A 1QYXA 2VHVA 3JQEA 2QX7A 3GGPA 1C1XA 3C24A 3JQ8A 3I4FA 1IY8A 2WTBA 5T8KA 4II3A 3RBVA 1W73A 3W8DA 4Y6PA 2CZCA 1T4DA 4B8ZA 1ZSNA 4RDIA 3D4PA 3AUUA 4UVEA 3WIEA 1GUZA 2B4QA 3ZWPA 5ITVA 4ZRMA 3O38A 3GLQA 3K8ZA 4PLFA 2VYVD 3FNFA 4NH4A 1WMAA 2ZJ0A 4C7JA 2O3TA 1X7GA 1X13A 2JCVA 2VHXA 1Q0HA 1K6JA 3EUWA 2WE8A 1QXSA 1D1SA 3NGLA 3QVXA 2PH5A 3ZU2A 1VM6A 5EERA 4YRDA 3C7CB 2O50A 4L4SA 3MWEB 3RUDA 5BQFA 1LSSA 2GN4A 1BG6A 1KERA 5ENVA 4ZVVA 5B4TA 1Y8QA 4E2YA 2CVOA 2FSSA 1M75A 2DKNA 3OJOA 1RWBA 1LSUA 2DTDA 3PFFA 4BO7A 5EESA 4D79A 5I9NA 4RO0A 3GNSA 2B69A 4NNJA 4FFLA 2GF2A 3OIDA 1ULUA 2HMUA 1BMDA 2CF5A 2PWZA 3DZGA 3OM9A 5MDHA 3KSUA 3BMQA 2GASA 1TT5A 3ONDA 1GADO 2HMSA 3V1YA 3DZBA 3QIVA 2BRUA 4AJ1A 2XAAA 1G0NA 2C59A 4NK5A 1F06A 1C0LA 1Y5RA 3E1KA 3HN7A 1DAOA 3LT4A 4I1IA 5EJ2A 2W2KB 3JYNA 3WGOA 4F45A 3OP4A 3P2YA 3GAZA 4BV8A 4CQLA 3WYBA 3FD8A 4AJEA 4J4TA 3MOGA 3DAGA 4DIFA 1TT7A 4WOJA 1Y1PA 5AXBA 1GL3A 3WQQA 1EQUA 1NNUA 2DT5A 3MZ0A 4J7XA 2Y0EA 1BXZA 1I3MA 2ZKLA 1LC0A 2QRKA 1WDLA 4AJKA 8ADHA 2VT3A 2X0NA 1KEWA 1UUFA 1JAXA 3GEDA 4WLUA 1PGJA 4CMEA 1I0ZA 4JXKA 4FFRA 4UUOA 1QRRA 3QWHA 2PZMA 3AM5A 5TX7A 3LZ6A 4FC6A 3KYCB 4UAGA 4LGVA 1Y9AA 2O2YA 2ZB7A 2ZK7A 5IDXA 3CXRA 3I9LA 5EIOA 4E5NA 2C5EA 5BSHA 4W7HA 3MJEA 5FF9A 2Y1GA 1ISMA 4XYMA 4XYEA 5IDWA 7MDHA 5F21A 2EIHA 5GY7A 3NT2A 2PZJA 4BKPA 4WLNA 1ZXBA 3VH3A 1P9LA 1MG0A 3VH1A 2X7HA 1P33A 1R16A 5IFLA 1SB8A 3BMNB 4PCVA 4YJHA 5L4NA 1QLJA 3DOCA 4PZDA 3OIGA 4DBZA 2RAFA 2GZ1A 2XXJA 3GNTA 1P1FA 1MFZA 1ORRA 5I9LA 3ZU4A 3KXDA 4CLOB 5JCJD 4CMEC 4MKZA 1GUFA 4F3YA 4J0FA 4Y6SA 4OOEA 1DRUA 2YFHA 2ZTMA 5F5LA 4YTEA 3TOXA 3PTZA 2ZCUA 1KS9A 3RIHA 3U0BA 5JDIC 1NM5A 4K9DA 4OKIA 3ASUA 1EQ2A 2E48A 4Z0PA 2NVUB 4MO2A 4UREA 2G0TA 3D1LA 1E3LA 4P4GA 3E48A 2X5KO 4UVDA 3I9OA 3V8BA 3E5RA 3F5QA 4U0JA 3JYPA 1QYDA 3EK2A 3TFQA 3AI2A 2FHSA 2OUIA 3JQ7B 4YEDA 3K30A 5T6BA 2Y05A 3IC5A 1TLTA 4BS9A 1U9JA 3HG7A 3RUCA 4XCVA 2QQ5A 2YJZA 1I2BA 3GVPA 2O7SA 1ISGA 4WKGA 1DFIA 1VKOA 2DFVA 2BLLA 1GUYA 4HFMA 3MEQA 3RQSA 2HRBA 3ZWNA 1E7SA 3GVHA 5IN5A 4B79A 4MKRA 3JQ9A 3ZWMA 4O63O 4DQUA 1K2WA 1ZJZA 3FPLA 4XQCA 3RU7A 4XWYA 1PL6A 1PL8A 5I7EA 3C85A 1DSSG 1L7EA 1RYDA 2HSDA 1UXHA 4UUPA 4ZHSA 5ICMA 4RGBA 3INRA 4P22A 4ZQEA 2EJWA 3R6DA 5IXSA 3JV7A 3AJRA 5F1KA 2V6GA 2IE0A 2RCYA 1T2AA 2O4UX 2HMWA 2R6JA 3FR8A 3GHHA 2VTDA 2X8LA 4TROA 3GUYA 3D7LA 1ZZEA 1I33A 2A4KA 1YL5A 5ES3A 1MV8A 3S1LA 3O9ZA 1DB3A 4J6FA 3QQPA 4KOAA 4CQMB 3Q2IA 3AUSA 5HTOA 1GFSA 3OJLA 2NTJA 3GAFA 4RVHA 2O48X 1EVZA 4N18A 1WZEA 1SEPA
chains in the Genus database with same CATH superfamily
5CTJA 4ZEWA 2DMRA 2NSDA 1JQDA 2M6SA 1WAMA 3I5MA 4BFSA 1RYYA 1N2OA 4DXDA 5KZMB 5BT9A 3WL5A 3ETGA 4FDTA 4RVGA 3A3YA 4FFBB 1G5IA 1VLQA 1DI0A 1PQPA 3FBWA 2BM9A 3ANTA 1AK2A 1R8YA 3L6BA 1ZOPA 2NU7A 3GPIA 4FLMA 1VL8A 4ZQCB 3SQOA 2V0GA 3EGXA 5DLPA 4CF3A 4XUCA 3WLRA 3U3DA 2G71A 3TNJA 1NURA 4GGMX 1F2DA 1C80A 2IY8A 4EITA 5C4MA 3PKIA 1PSWA 2YTZA 5LBTA 3QA9A 4IYJA 3LYAA 1R74A 1SHZA 2E6KA 3E8SA 3T9DA 5JZ9A 5IS2A 1BW9A 2ZJZA 4DZRA 1RKQA 4V39A 2C1XA 5F7JA 4EX6A 3NT4A 4ALJA 3ER9A 1CQZA 4OHRA 1JIUA 1UQRA 4B0OA 2IK8A 1E62A 2QY9A 2HHAA 3IMFA 4IOKA 2RI0A 2G28A 1DHRA 2J9GA 3DBIA 2MHCA 3QBJA 2FDRA 4ZRDA 1ZL2A 5EWLB 3N2YA 5A5FA 4XASA 5B2EA 3WHKA 3OTOB 4MQEB 1Y8RA 1TIPA 1TA4A 3U7FB 1YVEI 2FCAA 4H6XA 3SF8B 1HKHA 1E60A 2ATCA 1YC2A 4WGGA 1FE8A 2QVLA 3TDKA 4BZXA 1RPAA 4ND5A 4AIRA 5KOJB 1AK9A 4EA8A 3JPWA 1GWNA 2W6PA 1YA8A 3KUDA 5EIBC 4DREA 3IESA 2LBPA 4OH7A 1YDHA 5F77A 2VJOA 5DNEA 3LGSA 3UYLA 3TEFA 1R0LA 2M98A 2X6TA 3B1JA 4M87A 4TV8A 5B1SA 4QHSA 1UOPA 3HYLA 3RHTA 2JLUA 2O2DA 3OZTA 3W7BA 4OO3A 1GQSA 5CLHA 2FEWB 1FRNA 5AVTA 4E5UA 1ECGA 1U8EA 3JZFA 2XV1A 1CLEA 1M66A 4NSNA 4DS3A 5A5GA 3KQKA 3E3MA 3G2NA 2NNLD 4I4IA 5IBQA 2RB5A 5CVDA 1YR7A 3NG1A 2Q5QA 4LHZA 4FM9A 5EKXA 4G5SA 3VYSB 1HRDA 4Z4HA 4EI8A 4EY6A 5KINB 4MR8B 5M3BA 3I6MA 4Q3NA 3FZEA 5CM2Z 3HI6A 4B0PA 5KWSA 3N7UA 1MAWA 5JT1A 1H8HD 3IQXA 3OICA 1HTTA 1MRZA 4O2AA 4PNHA 2BEJA 2YVAA 5CJPA 1MR3F 4Z9AA 2Q9BA 2VXYA 1SH7A 3IV9A 4MI6A 4HRVA 1A97A 1I1NA 1P1RA 1X8LA 2B37A 2W2NA 2W6CX 3MILA 1SQSA 2GPYA 3RVDA 4B3SB 3NBMA 1RYNA 5AHOA 1LD3A 2BZ0A 5HK8A 3OCCA 1Q6YA 2CE2X 5GJWC 5GWXA 2YY7A 3VAYA 5KTYA 5ALNA 3WMRA 1PTJC 4UNNA 5DOVA 3C4JA 3ROQA 4KFSA 2RGBA 5AVOA 2I2AA 3EW7A 4LQ4A 4LJKA 5BWNA 4HTFA 4AUEA 2OECA 4NU5A 5JYEA 1SAYA 3I4LA 3ED1A 4E46A 2I34A 2O6HA 4QDKA 4K8RB 1B00A 4B4UA 3DBVO 2FKAA 2XT6A 4X45A 1E98A 2R68A 3L93A 2GN8A 5DK4A 4RQAA 1UC9A 5DP1A 1XFAA 3HR4A 2DUWA 4FX5A 1ISJA 4X63A 3SG0A 3A6DA 5B3KA 2GRJA 4M49A 2OXRA 4Q4CA 4YRKA 4L3OA 1JJVA 4XEUA 4ZAFA 2W83A 5FUXA 3WTCA 4BJHB 5B3JC 1NULA 3KBOA 5JNSA 3QM1A 1VSTA 2V96A 4GIBA 4E88A 2QVCA 1UM8A 3LLUA 1PYOA 1QDLB 5EXPA 1JKJB 5IC5A 1EP1B 4ARCA 1J42A 2AYXA 2YV3A 3P7MA 1PT7A 1XO1A 1W49A 1ZGZA 4KQ2A 4C4TA 2RH5A 1IPEA 1NXSA 1Y48E 1I01A 4IEIA 3KLBA 3KUXA 4Y2YA 1PEYA 3STVA 4Y9UA 4DMGA 2IBTA 2YDYA 3W6OA 4B3CA 5KOYA 1KMMA 2G77B 5L51A 3IPCA 3PKZA 1C3JA 1U3CA 3NC4A 1RWMA 3K70C 1MVOA 1DIRA 1OZFA 2YYAA 3JD4A 4RHFA 5YASA 3UMYA 2ZVDA 3ZDZB 2PKCA 1O96B 2GKGA 3HHPA 3LBIA 4AYWA 1HYHA 1P1KA 4I55B 4MP3A 1XVLA 1HZZC 1XZGA 1LSJA 5H9VA 1N6NA 2XLBA 1N2CA 1P0CA 3ADOA 4DT1A 1PN3A 2JD2A 2XF2A 4Y1RA 5EP4A 5J2UB 2JGFA 2JIMA 4ZZ2A 3SR3A 4AX4A 4RS3A 4ZRNA 3IB3A 3KP1A 1LA2A 2QTTA 1IVYA 2OHHA 2E4VA 2OESA 3CU5A 4YI5A 4X92A 1P8JA 2VP4A 2PSDA 3AV3A 5E7IA 3B5IA 4AN1A 2G9VA 1QFYA 2J48A 3WQRA 2ZIVB 5JZMA 3O1JC 4EARA 3AKCA 4N0MA 4DDKA 2D2FA 1ZD2P 4G0OA 1H4TA 5I5EA 1XU7A 1LY1A 1PJTA 2Z30A 2D8MA 2R60A 5EWJA 3J7TA 1SUFA 1VL2A 2R8RA 4FLEA 5JARA 1TRKA 5LCXA 3W9BA 4IXDA 2GETA 1IY2A 1M9NA 2HFJA 1P5ZB 2QF7A 3DTTA 1PZMA 2J9RA 4ZVSA 2ZSEA 3M1IA 3U80A 5CG1A 1AU9A 1KVTA 2NQTA 2Q3DA 2BFBA 2BN4A 4NZOA 4TRJA 5GP1A 1ODJA 3T1TA 1K8QA 1M6VB 3P0IA 2ESRA 2H1VA 3NX4A 1UKZA 3T3PB 2VZLA 3DE5X 2KLBA 3DQQA 4FFDA 2ZJ4A 2IW3A 1D04A 4RZ3A 4TMWA 5J5AA 4ED9A 1UP4A 3OLWA 3IPRA 1LLFA 4BU0A 5LP1A 4X24A 3KQNA 2LCFA 4W9MC 1ORIA 4FCVA 4ROSA 1QOQB 3NBYC 4WCFC 1MC5A 3QBEA 4HUQB 3UV3A 4K03A 5EYPA 2NP6A 2GJAA 1KETA 1U9CA 2VC2B 4G09A 1A4IA 1XA4A 4L7QA 1B73A 1VSUA 2ZI6A 4K9KA 4YALA 1LPPA 1JSXA 3UBMA 1GTSA 1Y81A 3SNKA 3NWPA 2X41A 5HRCA 1WHSB 1XRNA 2CDBA 1O6BA 3G7UA 2I4NA 3HJAA 4PQGA 1YQEA 1MJ5A 2H1WA 3L7IA 3EXAA 3OLQA 1KSHA 1V11B 3CMMA 2C2MA 3NVDA 4NJMB 2O8CA 1MB9A 3GUUA 1SZJG 2FPGA 3L0OA 4URFA 5H83A 4RSGA 3LK6A 5D3MB 4ZGWA 3B20A 4LZNA 3UJHA 3L5KA 4UOZA 1HE3A 4DR1B 1W9MA 1F48A 5HMMA 3NIGB 4ZQBA 4NC9A 4WFIA 4DV4B 3SJ7A 3VKHA 3DPIA 3K9CA 4REMA 2GHTA 2QNIA 1WV0A 3KIPA 3WGYA 3PPWA 3RRMA 2YWBA 1UJ4A 4AY2A 4IRMA 1UJMA 1VCMA 3H83A 3NH9A 4Q4JB 3PNYA 1J70A 1L7MA 5CNIA 5EXDA 5E1MA 1IZ8A 4WN9B 5LZ7A 1Z6PA 4C5CA 3KYCA 4R51A 5D7NA 4I6EA 2H54A 3RUPA 3GEBA 1LPNA 1X92A 1XLTA 2PRJA 4IDBA 4HATA 2I1VB 3KE9A 4HDNA 2XIQA 5UKDA 4RV5A 5AVXA 2P69A 1N78A 3SC6A 3PEEA 4OJNA 3HU1A 5EPEA 3GROA 4FBGA 3EXEA 1IXKA 1YHZA 4M7RA 4M9SA 1FP2A 3F7TA 3ZVNA 4RWEA 2QV0A 2UYQA 1JS1X 2E1PA 2H07A 3EPPA 1T35A 2G70A 1SD1A 1EK0A 2I78A 1R37A 5LQSA 3SVTA 1MUUA 1QCYA 2Z08A 2XE4A 3NT5A 3QWFA 4ENRA 3MTIA 2NU7B 2YWRA 3C8HA 5HZHA 3G8AA 1FNMA 2C2GA 3EGXB 4R0NA 3UMJA 3RAEC 3U4AA 1VECA 2PQMA 4EHDA 3HY6A 4ZT3A 4HFJA 3RK1A 5AI9A 1O54A 3PWZA 3UWPA 1L2TA 3FOZA 2CBGA 4C0WA 2XRZA 3GFRA 1K27A 4ZMBA 3DOEA 3GT3A 4KRFA 4NENA 5AR1A 2P3SA 1WP4A 1LCIA 2ILTA 5FEMA 3KQPA 1K3UB 4M89A 1P74A 3B13B 4R84A 2IFTA 3FYTA 1D5CA 1HDEA 3ORQA 1SHTX 1R6VA 2AF3C 4GVXA 4S1PA 1JNXX 1G2PA 3CLRD 4YA6A 3S1SA 4YWJA 2NVUA 2R7MA 1C8KA 2IHVA 1E5TA 5HW0A 2RKOA 2MDTA 2BHSA 4AKEA 4R2IA 2MSNA 2OBYA 1UP7A 4IFTA 4J3JA 1Q22A 4WHMA 5AUNB 4EO7A 4QPNA 1T1GA 4RKQA 5KVQA 5LN1A 2LD4A 4UU0A 3JQ7A 3JARB 4GZ6A 5T6MA 5H5JA 2P4HX 1OVGA 1XMVA 3QFFA 3R7NA 3ZY5A 5F7XA 1OLXA 1HNXB 5BNTA 4MINA 1WUJS 3H8SA 3CH5A 4RX1A 3PIRA 2QN6A 4IICA 2QMQA 1R8SA 2JIDA 4ENVA 1M2OB 2CSUA 2DTXA 2ST1A 4HGOA 1QHSA 5ETJA 2ZQZA 4FYXA 4NS1A 2WUFA 1EMDA 1ITZA 4HD8A 4YUWA 1WXIA 4ZYWA 2AFIB 4RXTA 5HIMA 1Z6QA 1DC5A 3I23A 3NONA 1SCQA 2UZ1A 1KYYA 3IBGA 3LOUA 3KC2A 3MJFA 4QGHA 4BLUA 4WNAA 3WGKA 5JV5A 3DFMA 4R2JA 2ZRFA 2BGTA 3GNLA 3KAJA 3TBKA 3VZRA 4JJFA 2CJWA 3TDNA 4UMVA 5CH8A 5KTPA 2HHCA 1U7DA 3E5HA 1GHTA 4XXHA 1ZD8A 3HY3A 1C4WA 2X9QA 2F59A 3A6GA 3D7MA 3I42A 4Z7OB 3HKBB 1C7JA 1PL7A 1RPJA 1Z6GA 2ZROA 3GUVA 2H0AA 1DVRA 1GN9A 5KMGA 4DMKA 4XR9A 3GBSA 2Y1EA 4QXRA 1D2RA 1THGA 4ZV4A 2HOQA 2C5BA 2VCEA 4JB0A 1AH2A 3RVSA 1C3XA 4J1TC 1ZEMA 2XSZA 2Y1XA 4QNNA 3HSSA 1P2DA 4CQMA 1NYRA 5DYIA 2FOXA 4IKOA 2H1IA 2YVUA 1HUQA 4J2OA 4JJ8A 4WA7A 3QW2A 1O7JA 4ANFA 5EJ7A 3ABSB 1NN3A 1Q1ZA 1U2DC 2GI4A 2O0LA 2OAQ1 3TZLA 3PS9A 5A3JA 2GJKA 4W4TA 3LWNA 3CKKA 5DYNA 4PC2A 1O3YA 4AJIA 1QQ7A 1QCDA 3EA5A 3H6HA 3OT1A 1U5BA 2XGGA 5CGQB 5GJCA 4Q05A 1QLHA 3WVNA 2OHJA 2QUHA 1NSFA 3AXTA 3SBXA 3A36A 4E1BA 1WS6A 4UD6A 1DJQA 3FY4A 2I99A 4TS9A 4E15A 5ADHA 3TECE 3KT0A 4A8JC 3RJ5A 1Y3HA 2F9LA 1FBNA 3OVMA 4AXBA 1THZA 3I0MA 3RFVA 5HKLA 1EI9A 3W2FA 1NW9B 1JFTA 4Y2GA 1YDMA 2H5EA 1KK0A 3DWIA 4QEZA 3DMFA 4NOMA 4LMBA 3THOA 4X61A 4MOWA 3ESRA 3V4RA 2FFHA 4PW0A 4B85A 4EYSA 3GL9A 2GHIA 2EYUA 3QYFA 2WSLA 4DCOA 4L8WB 2P4QA 2Q29A 1AHIA 2QMUA 2FPPA 3FBTA 3N8HA 3PI7A 4P54A 2WNHA 3ESZA 4OGWA 3RC1A 2DH6A 4CDMA 1BHSA 4X1IA 4MGHA 1QGED 2F3SA 1DHTA 2W2PA 4LQLA 3RU9A 4M1QA 4BVEA 4Z2AA 3WV4A 1B74A 1YA6A 5HKBA 4CTMA 3O8BA 4DCNA 4JGIA 4TUYF 2HBQA 4S1NA 1A9XA 1UBRS 2HIMA 4QOJA 4B5LA 4DT1B 2IZ6A 4ESEA 1X42A 3NHMA 1QR6A 1ZFNA 3QTBA 4HAWA 1IB6A 3EVDA 4MB0A 5COQA 4OY3A 2MSKA 3RSFA 2VKQA 4Y1RB 6ADHA 1NTOA 3EJWA 3HB1A 4EHJA 2IHNA 1WKVA 3OETA 3QU5A 1LWNA 4A6PA 4IHAA 6ABPA 3SVZA 4GXNA 5FAXA 1MW9X 3OESA 5DWDA 3AL0C 4GAEA 3THWB 3T3EA 1Z13A 3I4CA 2AJCA 3BWXA 3N6XA 5A9TA 2R48A 3ETCA 3PHLA 4DA4A 1ZR2A 2QYSA 2BGJA 4BGEA 3JAMA 1NP6A 1C1HA 1ZBQA 1P62B 4S0XA 3HMKA 5EWJB 3U4CA 3UAXA 5JEDA 5L9AA 1KDRA 2DJIA 4HB4A 5IMBA 4BNUA 1XXHE 1N5DA 1TEXA 3OFVA 5G02A 2HTEA 3ADKA 4R1OA 4A2CA 1NHGA 2R1VA 2ZRAA 1W44A 1XKLA 1XJWA 1QMGA 1RWQA 3EHEA 3EWSA 3ROMA 2HJGA 2GPAA 2Y9MB 5EQJB 1FFYA 2PRZA 3HXTA 4R0VA 1U6KA 3TL6A 3MAJA 4O4IA 4TTJA 4C4AA 2QP9X 1MA3A 1KYTA 3L8YA 4IUDS 1MIOA 5JVDA 2RD2A 1CUZA 4RDCA 3T54A 3MJTA 3KB2A 2VWPA 3LG2A 1M3SA 3FR7A 1P4AA 3SS7X 2EERA 4KSBA 3DM9B 4GOKA 3KHUA 1DS6A 4RH1A 4MKFA 1P0IA 2RC6A 3HMQA 1LH0A 4S1OA 3IEVA 2FRDC 3GZJA 2XW6A 4O3MA 4G9GA 3QXCA 1QOPB 3OE7D 1A7UA 5HFNA 3T6KA 2Q2WA 1TNDA 4HNRA 4RSHA 1OU0A 3BIWA 1GT91 1V8PA 3M4NA 4JVLA 4KXXA 2V7BA 1KYWA 4NBUA 4JUAA 1YJ5A 4A03A 1UPUA 1IYZA 3CEPB 3R3WA 5ERXA 1UMBA 2CL5A 4YDHB 1E3TA 5BR7A 2CD9A 4M0LA 2JLBA 2ZFUA 3KSRA 1U0OC 2HK9A 2RAUA 4WIAA 3MW8A 3PXBA 4Y9DA 1HYQA 1KYXA 4F85A 2XTZA 1F3OA 3KLNA 3ZGVA 4H77A 2C2KA 2LW7A 3MRSA 1W25A 3CRNA 3IEIA 1NF3A 4C30A 2B25A 3I1YA 4WX2B 3V2HA 1SXJB 1N3BA 1AM4D 2FMKA 1JHZA 4C7XA 2DH5A 4MO9A 3S2SA 3C6KA 3KCQA 2V65A 1EUCA 2EX0A 4HZIA 4MRRA 5KYUB 1PZHA 1G2QA 4K9NA 4D5GA 4OQDA 5LC1A 2EFEB 1UJ6A 1EVLA 1C8VB 3EYWA 4EAQA 3R8FA 4YIKA 3U44B 1NBMD 5K0SA 5FFNA 2B61A 1RJWA 1Z38A 4CEIB 1A9QA 3RSOA 4WZBE 4CLRA 3TF5A 1F4LA 4KR3A 4DLXA 2UYCA 3MGBA 4OFXA 3VZCA 1US8A 5C7YA 1T5IA 3ZWVA 4ZAXA 3SXUA 1MX5A 3A14A 4ECEA 1E2LA 2I6SA 2XX3A 4RBNA 4LI0A 3WNBA 1IN7A 1JIKA 1KQPA 3CUEF 1NQTA 5DMXA 1T9GS 4PHFA 4Q4DA 4RMHA 1Z7BA 3U4IA 1A8SA 5L3ZA 3VDQA 1TU0A 2PV0A 4YCBA 4NJEB 1OA0A 2GCGA 1LK5A 3SJCA 3C3EA 3EDCA 4Y6OA 4ARSA 3A8TA 3PPIA 4Z8XA 2OHVA 2B1RA 1CJVC 2G8NA 2I22A 1E32A 2FUG1 1NXPA 4OF4A 1C3EA 1B8UA 2PK3A 2ZDQA 4LWZA 3E9QA 4ZHSA 5KTTA 2C20A 5E2BA 3SC2A 3BK7A 4N7MA 2VJAA 2Z04A 4H3SA 4ESVA 2HU8A 2HRQA 4MW6A 3D02A 3E4CA 3LRXA 2CV0A 3ZNPA 3KEOA 4RLHA 5CFQA 1V5GA 1SBQA 2IPAB 3C8DA 3FZQA 1XCLA 1T3GA 5GZ1A 2F55A 1UZMA 2WM2A 3GFBA 3OBBA 4QXOA 3UXYA 3P0HA 2AR7A 4KAJA 2B21A 4AF6A 2B7LA 3JTEA 4LYGA 5C37A 2YBEA 5A0VA 5LIRA 2QAJA 5TARA 3B53X 1BMFA 3C2QA 4WBSA 2XJ9A 3VOBA 4AY4A 3FSGA 1R6UA 1DE0A 4JUDX 2M9MA 2QMZA 2W2LA 2VJDA 1ZICA 3GYBA 1NVGA 5IKMA 1TVKA 2H06A 2L17A 4LYJA 4D4GA 2RGDA 2W93A 5EKTA 2P4SA 1ESCA 3LH5A 4MVYA 4YHHB 1CUUA 2QW0X 4TWRA 2XVYA 3Q9UA 2AG0A 5ICEA 5LZ4A 1FVHA 1F6DA 2X0IA 1JSZA 4F6RB 2NXCA 3FVQA 4JC5A 4LG1A 3QNMA 1ECBA 2QXTA 3HK2A 2UZ1B 5HUQA 1JPVA 4WNAB 5B1HA 1I1HA 1JKMA 2P5YA 2Z2IA 1GSOA 3G5LA 1P1JA 4IHJA 4P84A 4PC1A 3G5AA 1X2EA 1ORWA 3A06A 1JHDA 3A0UA 3HEAA 3PFKA 4BC1A 5JH7F 4ZAGA 2JIZA 1GCIA 4E5DA 1XMJA 1P61B 1ZOIA 2OCPA 3DXXA 4JSYA 3A1FA 1GPLA 1F8FA 1TTHA 2Q9AA 4G5XA 4TT3D 1JHVA 1HDIA 4IIEA 2GDJA 1RMTA 5GZ6A 2GAJA 2MR5A 5CYOA 3ZU5A 2VRCA 4ARAA 3PZRA 1N4DA 4WLOA 2IZ5A 2J7KA 3FOWA 3I34X 4KDCA 4LIPD 2GWHA 4YH1A 2EJBA 3ONFA 5AOBA 4PYQA 3H5AA 2AWNA 4C4YA 3BAFA 4H1UA 3CLHA 1FFAA 1HNNA 1FFSA 1I2DA 2NV0A 4BQPA 1A5AB 4HLUA 4JR2A 5HTKA 1QZTA 2O2SA 2R7AA 2WDPA 4YYEA 5LUAA 1MZPA 3T12A 1DPGA 1YASA 4QELA 1QCZA 3DZKA 1GA4A 1XD2A 2ANCA 1P2TA 1X2BA 2H65A 3OT1B 4DANA 3AY6A 4PWYA 5CFZA 1KDVA 4YJKA 1JVSA 4S12A 3O73A 2P9FA 5K0EA 1UCFA 1DTEA 3WNQA 1HR0B 2P6MA 1QK4A 2ZWMA 1XALA 2Q46A 3AG6A 4RULA 2EKPA 1X7YA 3GUZA 2PR7A 2QTMA 1Y8CA 1RRGA 4MWOA 4Y6LA 4EECA 1E96A 5KNCD 3GEIA 3OOJA 2Q3MA 1I32A 3Q6MA 4L5CA 2FNAA 2OFXA 5T41A 3RTDA 3E27A 3UYKA 4B17A 3GCWA 4ZOLA 1GPJA 3O2QB 3U1TA 3DHNA 1EJ0A 1VE7A 1E9AA 3D0OA 3ND7A 4R8KA 3IQIX 1KNXA 2BDUA 3SYKA 4A6XA 1BH6A 2KSQA 1U0GA 4RCZA 1FEZA 2OQ2A 5EIFA 4MAFA 3RSGA 3ZYZA 2EAUA 2O3JA 5NULA 5JCXA 5JUWA 3NVKI 1SOMA 1CKEA 4RABA 5CCEA 3ZD6A 3O74A 7REQB 1JEQA 4I1OA 3IVMA 5BW5A 1DEKA 1N6HA 1KBZA 2R79A 3LSTA 5I4KA 2B1JA 2WKQA 3O31A 4YRIA 3TWOA 1PZEA 1SKQA 3NM4A 4BVLA 3DLIA 5JOQA 5IJXA 5CAEB 4MEBA 1XDDA 3GA7A 4BO5A 3CJRA 1P4JA 5FI0B 1JDPA 5HM8A 4BKOA 1PTJA 5AKXA 4NV1A 4XSHA 3NVAA 4ZI3A 1XZCA 4EATA 4OLAA 3DMYA 1U65A 1UWVA 5IP5A 3S68A 3CVUA 3SJAA 3HV0A 2Y0CA 3KU4A 2GPNA 1Q7EA 1TTQB 2IA5A 1PEAA 2XRFA 1V7CA 4KI7A 3M5CA 3WRYC 4UNRA 4O2BF 1WSWA 1O87A 3GOHA 2Z2XA 1EFCA 3GJYA 5BY2A 1WETA 1SHLA 4F9TA 3QLVC 3KOUA 5EHZA 3PJDA 3FX2A 3INGA 2VJMA 4G2TA 1ZVJA 1QQ6A 1IG3A 1RLIA 4PONA 1I6WA 3LU1A 4FKMA 4P8RA 2V0NA 2PKXA 1GPH1 2NSJA 1CRWG 3HKCA 4RIGA 5B3JA 4XYLA 5JXIA 1Z5ZA 5LOVF 4MWZA 4Q4LA 3U4HA 2OG1A 4TN1A 1ST3A 4KVFA 4C6TA 3PZBA 1C4OA 2VF5X 1T2CA 2GLUA 2FDXA 4ZVOA 4ZOEA 3LUFA 4O4IB 3H4MA 3NNNA 4OQQA 4GW3A 1M6EX 3SXJA 2O2JA 3T7DA 2W6NA 4AMVA 1SIWA 4B8YA 5JYDA 3W4KA 1VJ5A 3QBDA 3IUNA 2V7QD 4P31A 2C8JA 4XD7A 3T99A 5LZ2A 1W9HA 3RHSA 3CNEA 2R96A 3K6RA 2Q62A 2XEDA 4GS5A 4IKPA 3AETA 3KJGA 4IDOA 5CLGA 2Y6UA 4M1SA 1T0PA 4PFQA 2Z5VA 4PLCA 1TEHA 1Z5NA 3QWIA 5FNVA 5EKSA 1CB7A 1RMYA 2QLTA 1USWA 2YOFA 3VMFA 4OL9A 1HZZA 3DVQX 4JELA 4F38A 1GR0A 1ES9A 1T2FA 2ZI9A 2PL3A 3VGPA 2P75A 2LTAA 1EUYA 2X8AA 1WM1A 4EF5A 2Y71A 3PJEA 4NU8X 5TGDA 1Z0KA 3RUEA 2CUKA 4FMPA 3EPLA 2F3PA 1FCJA 5B3AA 1RHKA 2UV8A 3T3MB 4UFNA 4RTSA 2R8ZA 3T9FA 3PITA 5ITZA 5JCJA 5FUYA 3ZZTA 2C92A 1KIAA 4GC5A 2V5AA 1NVBA 3M1YA 1D2EA 3AX6A 5DGHA 1OV6A 5AJWA 3Q1KA 5IH3A 1JEDA 2FWAA 1TYZA 5G4KA 1AB5A 2R1UA 3FJ1A 4C4OA 4OI2A 2EFHB 2PFGA 3PDJA 2VUIB 3UGKA 2QAGC 5A05A 2A14A 4NOLA 5BRNA 4EI9A 5C7OO 1N33B 2K6GA 1PGQA 2A9PA 1JR2A 5K20A 2Y68A 1EUCB 1U7TA 3GZNA 5LVAA 1C4XA 2QN9A 3PU6A 1RRMA 3IXQA 4ZARA 1RYFA 1NVKA 4B3JA 3KOXA 2UXCB 2QXYA 4WXEA 3K4QA 4JVSB 4D96A 3QVMA 4QYSA 1TEVA 5E9WA 4OJQA 3AKDA 2HT6A 2LDBA 4AJKA 3K09C 4QQNA 4ZHQB 1NOJA 4MGKR 4PYJA 4ATNA 4GQAA 1PV2A 3P4YA 1RLMA 1SKMA 5HE8A 1XMOB 5F4BA 5F78A 3CHYA 4UE3S 4I9NA 4KPUA 3ZDEA 1JLLA 1X0VA 2PMDA 2XUZA 1XZBA 2ZR8A 3G0GA 1L4KA 3B9BA 4FGWA 4HLDA 4LZWA 4U2EA 3SYRA 4HBZA 4DJJA 5LP6A 3A6PC 3OM8A 2AS0A 3Q3EA 2XGJA 1PNTA 2GD2A 2QK4A 3A1SA 1Y82A 3AU9A 4A1OA 2ONZA 3COJA 4RVCA 5KNCH 1E9SA 2JZNA 3QWAA 1QVVA 1R0ZA 2K2QB 3GJ5A 3BD6A 4W8HA 3DONA 5FHRA 1XHEA 1R4NA 2IP1A 4J0GA 5AJXA 5CNKA 1V37A 3DVLA 4IILA 4DHEA 2O2EA 1ZITA 5AKEA 4IGAA 1AUXA 3ECSA 3BQ9A 5JMOA 1AHHA 1VG1A 2OO3A 1TQ4A 4RMNA 3X44A 4P5PA 4JV5B 4JFRA 1FQJA 1K89A 2FN3A 3MTGA 4BAGA 3TLZA 3JD1A 5FPKA 3W7VA 1EXVA 3DM5A 2IXAA 3UHPA 2FXIA 4FT2A 1XMQB 5TSDA 3KYDA 2NYAA 4NFHA 4QUHA 1KC1A 5C80A 2XBLA 3HFJA 4MGZR 2NZ8A 3HUUA 2W2OA 1ETUA 4GLLA 5ALRA 3W9YA 1KRXA 4HOYA 4GMHA 3PUIA 2GEUA 4HRYA 4G85A 1K0UA 1Y4AE 4NEGA 5CX1B 3WO0A 4LGYA 1F17A 4EUSA 4JC0A 1GNVA 3RHZA 1F6WA 4MH0R 1QB8A 4GXRA 4ALKA 3EAGA 5CB4A 1A3CA 1TVKB 1P19A 1GDDA 2X58A 3CLSD 3O7MA 4HDRA 4HDSB 3FNHA 1GNQA 3DL4A 5L3SB 1WF3A 1J20A 4N5HX 3N7TA 4GD3Q 1F1BA 2PX8A 1PNQA 4HN4B 1BE0A 2R1TA 4MW2A 3AFIA 3DNPA 1VCNA 1JKFA 4MA4A 2XWJI 4KUHA 1BCSB 5IXJA 2HN9A 3QXHA 2C2BA 1E9DA 5CVCA 3EC7A 5K6TA 5FLXA 2OAP1 1Y3CE 5HM6A 1PZFA 3CS3A 2AZXA 2ZRNA 3W77A 2WU8A 4IHJB 4DWOA 1TYAE 4PBRA 4AKIA 1PE0A 2DTEA 5IG2A 4D42A 5IF9A 4W9RA 5DEOA 3PCXA 1APBA 2BGIA 2E0IA 4RAQA 4XA8A 2CMGA 4XX0A 3A4VA 4X1OA 3OOWA 5HCIA 5AW9A 2ERXA 2BFFB 5EXXA 4H7HA 3V8EA 2P27A 3EUEA 1EGHA 3G85A 4TMVA 4HNAB 4PSAA 3EG9A 3G0IA 2O8BB 1XAHA 5CD9A 3G68A 1QBGA 4M98A 1FP6A 2BTOA 2GEKA 1BA3A 3GYGA 4YUXA 5ELXA 3ONVA 2YN0A 2ZZMA 5ES4B 3CUWA 3SX2A 1DC8A 2QRJA 3WLFA 5HCUA 4D3DA 3MUEA 2OWEA 2AI2A 4IMIB 3LDHA 4YJ3F 2IIQA 1ACMA 2CCKA 1FXUA 4L0DA 3CUUA 4CM4A 1NR1A 2YXPX 3SE7A 1XD2B 3QKRB 1RWXA 3LY7A 1N2IA 2I66A 4HLNA 1TTTA 2WWIA 3SI7A 1AUOA 1DARA 5B30A 1FSFA 2HX1A 3KR2A 1NRIA 2VF7A 4R9UC 4FN4A 1X7YB 2BKAA 4PX9A 1PFWA 4G1FA 2FEAA 1JDBB 1H0KA 3WKAA 4ZJPA 1NN1A 3F4KA 5TMPA 5EMLA 3FPCA 5BPFA 1KDTA 2BGLA 4UEWA 2AJTA 1MABB 3AW8A 3AEZA 1QYRA 4PO8A 3ZE7A 4BNLA 2BP7A 4ZDIA 2C9CA 4IZHA 3L77A 3ROXA 4ZD6A 5DTIA 3QHQA 3WYGA 4DLNA 2O57A 3BSYA 1DCFA 1JEQB 1N2HA 2ZRBA 1EWTA 4GC9A 2PLRA 1L4HA 3PXGA 1T5BA 2J6HA 1I13A 2OK8A 3H9GA 4DSNA 3NHPA 4CKWA 1DZIA 1DCMA 4RYLA 5E9JA 4UHFA 3X1XA 5TPWB 1E3WA 1MC8A 4C0QC 1FU7A 4DQ0A 3KSDO 5AHRA 2GO7A 3SSAA 4J1TA 3SSOA 4RL4A 3ZK8A 4C6HA 4LV5B 2BTQA 2FWMX 3I04M 2R8EA 3OWOA 4AWBA 5DLYA 2I2FA 5LQNA 1Y7TA 4HLCA 3BFPA 1K0FA 1L5ZA 2X9VA 2CE7A 5K3DA 3VOTA 2X8JB 4IMJB 4I1VA 2GK3A 4P6VF 4URWR 3OZIA 4N3NA 2ICAA 1G8YA 1U2DA 3VR4D 2XPCA 5CDTA 2WSIA 2F9MA 4JLPA 3EH2A 1XMSA 4CG1A 1GZ6A 5KAMA 3JX9A 1ZMBA 2PBFA 5JJBA 5KQRA 3WLIA 3E7WA 2ZGVA 3Q8KA 2AI3A 3OZWA 2WICA 1AMUA 5AQ1A 3OIVA 3H5RA 3CY6A 5A5VA 1KJ9A 1KI1A 4G4GA 1Y0BA 3RIYA 4HWKA 3RS4A 4BVGA 2GKSA 2NX2A 3D7RA 3N2ZB 1G8JA 5JPIA 2IIBA 3HKCB 2MOKA 3AEKA 2VCHA 3VC1A 3IEUA 1G64A 1VZ3A 5I3CA 1N9GB 2OWDA 4A8JA 1ZUWA 3KD3A 4AJ9A 3ND6A 2R6GA 1XZKA 4U3JB 2NWQA 1OTYA 2FOIA 3L8GA 1R0WA 3BWEA 4KKXB 1IHPA 5TIIA 1JB1A 2VPWA 4L5AA 2NUAB 1D0VA 2I9KA 2J3DA 5C8XA 2VNJA 4YJ2F 4IEFB 4EVRA 2IYAA 3N2IA 4IVPA 4YAKA 1ZAYA 3BUSA 4W8GA 4XDZA 5GIOE 4DIOA 2JF0A 2VBIA 3DHVA 4UVHA 2GBPA 4AY5A 2ZTHA 1F5SA 4BGDA 3AETB 3K9QO 4I9HA 4KMSA 2ISCA 1TZ2A 1DX4A 1Z0IA 1ZCFA 5H3LA 1XEAA 2Q8QA 5BVHA 2I65A 1AQLA 4LNUA 3HADA 4OUDB 4CTOA 2Q6VA 3SX0A 1ORDA 1MDFA 4BX3A 3BN3A 3JRWA 2BKLA 1PZXA 4AO7A 2GNPA 4TLCA 2JFOA 1DKQA 3E7PA 3DS8A 1PYGA 4PTZA 1AGXA 1XEXB 3AOGA 4GR4A 3H4TA 3ZCUA 3ZWXA 3HCWA 2M6KA 4RKEA 3VDNB 2FSGA 4XQEA 1M2HA 3LUGA 5FI3A 1F4PA 2WRZA 1T5SA 3OKFA 4QTZA 3F73A 4RVNA 3GB9A 3KFVA 3I6ZA 2QVBA 2I2BA 4TTAA 1SPXA 2BGRA 2X3YA 3CJTA 4M0CA 4AQYB 3VRHA 1PR6A 5AUPB 3ZXUB 4PS1A 2PLFA 3PDWA 4TOIA 4IDDA 3S40A 3T5CA 1PLLA 2CBZA 3GCXA 1B14A 1U7PA 3TXXA 5LLSA 1KO8A 2VN8A 3UXHA 3S70A 1PLJA 1YZFA 1I7NA 1EZ4A 3EGDB 3BK1A 1U1IA 4HGNA 4MA0A 5DXJA 1KTIA 3A3OA 4I50A 3PWKA 2WFMA 3L8MA 2X9NA 4NHEA 4JR0A 2V98A 1KR5A 2C8VA 3G8CA 4JBHA 1CUVA 3MF4A 2YXLA 5PGMA 3I9V1 2ISSD 3T41A 2DCMA 3HDHA 2Q0SA 2P9EA 3IELA 4JLNA 2J3MA 4Z1MA 4D8TA 3RARA 1FUKA 4I4CA 2GHQA 4J91A 1U2TA 1ZJ6A 4UCFA 5HXAA 2FQYA 4DV2B 3GLFB 2AFRA 2PIAA 5GTDA 4L08A 3SJUA 3KFLA 1V4NA 1JLLB 2Y1OA 3JVEA 2Y1LA 1F8GA 4DQXA 5KVSA 5LP6B 9MHTA 2FRDA 4PZEA 4RZQA 2J08A 1Q0UA 2BCJQ 5JMTA 2IHUA 3NWOA 3LDFA 3CF0A 2BDTA 4HAYA 4HBGA 3S8YA 4AN4A 1KYIA 4ER6A 4MCHA 3HABA 4H7JA 3N5CA 3FDFA 4LXYA 1GRVA 1BNCA 1NXQA 1R4NB 1Z6YA 2EKBA 2ZSKA 3N5KA 4DPLA 3H1EA 4CIYA 5F3WB 1HYGA 2NU9A 3FGOA 3PX2A 1GKYA 5ITWA 2IGTA 2NO0A 1E2PA 2F90A 3GJQA 5FOWA 4YUVA 4RKRA 3DYIA 1KAQA 4BVJA 2P2CA 4IGIA 4IIBA 2ZYDA 1ZMTA 1H94A 2A5LA 2QX4A 2P3OA 3RSZA 1P0PA 2CF6A 2VAVA 1GG9A 1HE8B 4UHBA 3ZVLA 3H2HA 1T2EA 1YOVB 2XTJA 1J06A 2J0QA 2PBLA 5HBRA 3TD2A 4DA8A 2EP7A 3C3DA 4YQYA 2KX7A 3GZ4A 2MJLA 3FPEA 3IERA 3MGKA 3BA6A 4YCJA 4J9VA 3WHLA 1KTVA 1TO2E 1M0WA 4GSYA 4HUJA 3AZPA 2PBZA 3LM8A 2O2XA 4B3XA 4QIHA 3ZS9A 4C0BA 2XGMA 3HWX1 2HU5A 5FTLA 4QXQA 4K2HA 3VTKA 3B3GA 2FPWA 2XCLA 5JHHB 2BFPA 2IC5A 3ANXA 3OJFA 4MR9B 1UAAA 3R9XA 2W22A 3VR4H 3WGUA 4YRPA 2WAXA 4XPIA 4IIYA 2RH8A 3WL7A 4ZZIA 1Q7TA 3SF0A 2AH5A 3K2EA 3OFND 4U6QA 1G5HA 1YZTA 4R16A 2GAOA 3NETA 3Q2OA 3KV1A 1KORA 4Q9AA 1YNSA 4INPA 3ZCSA 1SCJA 2ZATA 5I47A 2VSFA 5KTKA 4G5RA 2NMVA 1E4OA 3AHCA 8LDHA 2R5FA 5I51A 4REQB 5IC4A 4QUGA 3R7WA 3H1GA 3VHXA 4XDGA 2O2GA 1IUOA 1SVUA 1M1YE 3I9NA 1RPTA 3L9WA 3ND9A 4HHEA 4LF9B 2IXDA 3PFNA 3DKVA 1HE5A 2PUVA 3UA3A 1LSOA 1UMCA 3OEHA 2PSSA 1JDUA 3PDHA 4YRFA 1DRVA 4TKMA 2XCIA 2QUJA 4HVLA 1H9CA 2BGMA 4W5JA 3FNEA 3IMKA 4LUCA 3SZLA 4X62B 1S2NA 2FPRA 4JQCA 5KNLA 1H6CA 3BTSA 3ZYCA 2WOOA 1VBKA 3EG9B 3A9VA 3FPAA 5DHRA 3TTSA 3TI7A 2R2GA 4CKEB 3EFEA 3C87A 1QUEA 1AKEA 1BVYF 2BEKA 3WIBA 5IF3A 3VR2A 1NVTA 4IX9A 1E1CA 1RC1A 1OGYA 4IMPA 1N7JA 1OBVA 3T7IA 1CUAA 2WSSA 3PRJA 4FR5A 2DUJA 3F8WA 1JPUA 3SYMA 4ENUA 4RD3A 1GTG1 1NFQA 4INOA 3JWEA 3BJMA 2RBGA 3G2PA 2FYTA 5LD2C 4KFTA 1HNZB 2DOKA 1AY0A 3AI1A 2IYEA 4HP8A 2BGKA 1SNYA 3A4NA 1T5DX 4WDQA 2QTWB 2UYHA 2XLCA 3MJVA 3RJ9A 4TXJA 1A5ZA 3PX3A 1XNJA 2AXPA 3CLUD 2ZI5A 3VJKA 2DEUA 2WEKA 2Q7DA 4DRXA 1VMAA 2QN8A 2BY4A 1G9TA 4ZFNA 3D3KA 4E21A 1YQWA 2BKXA 2VJYA 2OM6A 4CMIA 3IP7A 1W4BA 4TL6A 4CLDA 2OFWA 5CCDA 2R86A 1FSSA 1R1DA 3HYCA 4H3HB 3MTEA 4L4XA 3P32A 2UU9B 1U11A 3CX6A 1SXIA 3GRAA 1IXYA 4BWFB 2ZUWA 3KTDA 1UXOA 2G25A 4QVKA 4J1SA 4YLGA 4I19A 1C7FA 3CRRA 4OXRA 4PXYA 4NCHA 1G21A 4PO1A 3EE6A 3G5UA 4ZV7A 3SS8A 1ND6A 4CKWB 6CHYA 1YJXA 1JFFB 1GPBA 1IK4A 1E3WB 1YL6A 4H1HA 1PSZA 2KJQA 3TD6A 4FNMA 1AD2A 3AYXB 3F7NA 2XEXA 5KQPA 2BTQB 1UKCA 3QU2A 4FQ7A 2MINA 1AQ6A 4PZAA 3FYSA 4CKCA 2AXNA 5IJWA 4K6GA 2H16A 3SDBA 2V97A 2WYUA 2ZANA 1O77A 3CZ5A 4J6EA 4MVJI 4DDHA 2YWEA 5K6AA 4PRZA 2A7QA 4OQLA 3BDVA 4KQCA 4DIKA 4II2A 1B0AA 1UC8A 2OLEA 1Z2NX 1GKIA 3JD3A 2QVGA 4X7BA 3IRVA 4A0SA 2IV2X 4NEQA 4JLVA 3BIXA 3FCYA 3QJ5A 1M83A 5AM4A