1X1GA

Solution structure of the c-terminal ph domain of human pleckstrin 2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
129
Chain Sequence
b'GSSGSSGSLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin 2
publication title Solution structure of the C-terminal PH domain of human pleckstrin 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x1gA00
2COCA 1U29A 1AWEA 3HQCA 3HW2B 2PZ1A 5C6RA 2DYQA 2YT0A 1X86A 2D11A 1OY2A 3VOQA 5DH9B 5DHFB 2EMSA 1XR0B 2EC1A 2P0FA 3PZDA 3P6AA 2J0KA 1I2HA 5DHAB 1SGHA 2L2IA 3PEGA 2ELAA 1RJ2A 4HAYB 4GPTB 1FAOA 2ELBA 1V89A 2Q13A 4KHOA 2D2QA 4HAVB 3KZ1A 1WJ1A 1DDWA 5FI0A 4K2OA 2JP2A 3ULCA 1ISNA 4HB0B 2N0YA 2NZ8B 3AU4A 1W1HA 3SO6A 4F7UP 1NI2A 2COFA 4P7IA 3UZTA 1GC6A 1KZGA 3TO1A 2X18A 4K2PA 1KI1B 3DXCA 3KRWA 3P7ZA 2BCJA 3ZDTA 1ZM0A 2YF0A 4HDQA 4L6EA 4H8SA 1Q67A 2LOZA 2MKRA 2MWNB 4B6HA 2K2UA 4WSFA 4HATB 1WJMA 1NU2A 3SYXA 2ADZA 3PVLA 3MPXA 2J0JA 4C0AA 5C5BB 1GC7A 1IRSA 4DX8A 3WA0A 2DKQA 3D8FA 2W2XD 1Z87A 2W2XC 1OMWA 2GJYA 4EJNA 1LW3A 4HAXB 1W1GA 1BTKA 1DYNA 1MK9B 1FB8A 2CRFA 2IFSA 1P5TA 1GG3A 3O96A 2Y8FA 3QWMA 1ZC3B 3DXDA 2VSZA 2D9ZA 4A5KA 3ODWA 1BAKA 2G35A 2HE7A 2YRYA 3TCAA 1B55A 1K5GB 2ROZB 2YT1A 3KY9A 1X05A 1TJ6A 2K00A 5FI1A 4Y94A 3U7DA 1UNQA 4BBKA 5D27A 5J3TA 5D3XA 2I5CA 3NSUA 2VRWB 3IVFA 1MPHA 3TW1A 1U5DA 4HB4B 3LJUX 2DHJA 1FGYA 3WYFB 1EAZA 2RSGA 1X1FA 2R0DA 2NMBA 4Z2MB 3BJIA 2DHKA 3G9WA 2DN6A 1WI1A 2CY4A 4Z2NA 2N23A 5L81A 1BWNA 1FOEA 3F5RA 5HE3A 4MK0A 4PNKA 2H7DA 5HE2A 1U2BA 4MT7A 3T06A 2DYNA 4F7HA 2J59M 1DDMA 3KRXA 1WGQA 1MIXA 2D9VA 1FHWA 4CYEA 2KGXB 5J3QA 1ZVRA 4DXAB 1XCGA 4KAXB 5JHGA 2D9XA 2IYBA 1ZC4B 1N3HA 4HDOA 5DIFB 2Z0OA 1FHXA 3PP2A 5JP4A 4F7GA 3CIKA 5KQ4A 4NY0A 2HTHB 2YSZA 5C5BA 1KZ7A 1DDVA 2Y8GA 4GN1A 3TVVA 3AJ4A 4KHBB 1BTNA 1TQZA 2YVCA 4GZUA 5C16A 3SUZA 2ROVA 1H4RA 4D0NB 3SV1A 2D9WA 1V5UA 2RLOA 5LONB 2AL6A 2EJ8A 2I1JA 1SHCA 2CY5A 3QIJA 4PQ0A 1WGUA 4GMXB 4IAPA 5D3VA 3VIAA 2YS1A 2MFQA 3HK0A 1XX0A 2K2JA 3PVUA 3CXBB 2DHIA 4IFSA 1Y5OA 2OTXA 3FSSA 2YS3A 2DX5A 2LOXA 1J0WA 3M1IB 2I1KA 4A6FB 2D4QA 1NTVA 3KSYA 2D9YA 5LOPB 2RNRB 2GCLA 4KVGB 1V5PA 4GXBA 1PMSA 2MDXA 4HB2B 5CLLB 4YONA 2DX1A 2Z0QA 3MDBC 3PVWA 4GMVA 3FEHA 5J3YA 1FHOA 2CODA 1EGXA 4XWXA 5HE1A 2R09A 1MK7B 4A6KA 2GCJA 3D8EA 2KCJA 2DFKA 1M7EA 1M7RA 3ODXA 2D10A 5KCVA 1UNRA 1PFJA 2I5FA 2LG1A 4ZRIA 3A98B 1PLSA 3BINA 1EVHA 3AU5A 5JLJB 3TFMA 4ZRKA 1XD4A 2P0HA 1DBHA 1FGZA 2P8VA 2DTCA 3A8QA 1EF1A 1MAIA 3ODOA 1K5DB 5HE0A 1J19A 3DXEA 1TXDA 3SNHA 4K81A 2DKPA 4MY6A 5D3YA 2RVBB 5DI9B 5D3WA 2KUPA 1UEFA 5CLQB 3N7CA 1DROA 1U5EA 3FM8C 2CAYA 2GS0A 2H7EA 2RUKB 4YL8A 1MKEA 3ULBA 4DX90 1RRPB 2LULA 3RCPA 2V76A 2AEHA 4A6HA 1OQNA 3U8ZA 2XQNM 2EMTA 2VKIA 2YS5A 1AQCA 2RGNB 1MIZB 1LB1A 1V61A 1WG7A 3QBVB 2FJLA 4HAZB 3V5WA 1H10A 4NSWA 1V88A 3ML4A 5KQ1A 5EFXA 3GYOA 2J0MA 2L1CA 4IOYX 2W2WA 4WJ7A 1E5WA 2UZRA 3PG7A 4A6FA 2QKMA 4KHAA 2UVMA 4HB3B 1U5FA 2LKOA 5JHHA 4CHJA 2COAA 2LYDA 1ZSQA 1U27A 2QKLA 3F0WA 1UPQA 2Z0PA 1P6SA 2P0DA 2M14A 1UNPA 3A8PA 4HHVA 4TYZA 1WVHA 1QQGA 2ZPYA 2OQBA 1V5MA 2Y7BA 2UZSA 1Y19B 4CHMA 2M38A 1P3RA 2E2XA 4ZRJA 5GOWB 4HAWB 4EMOA 4K17A 1NTYA 3X23A 2DLWA 3PSCA 5C79A 1XKEA 1I7AA 4EKUA 4DBBA 1X1GA 1X11A 1W1DA 4TKNA 4HAUB 3ZVRA 1XODA 4WVFB 3D8DA 1U5GA 2DA0A 1UPRA 3OANA 3GYPA 1QC6A
chains in the Genus database with same CATH superfamily
2COCA 1U29A 1AWEA 2YT2A 3HQCA 3HW2B 2PZ1A 5C6RA 2DYQA 2YT0A 3FVCA 1X86A 2D11A 1OY2A 3VOQA 2KR0A 5DH9B 5DHFB 2EMSA 1XR0B 2EC1A 2P0FA 3PZDA 3P6AA 2J0KA 1I2HA 5DHAB 1SGHA 2L2IA 3PEGA 2ELAA 1RJ2A 2Z13A 4HAYB 4GPTB 1FAOA 2ELBA 2K49A 3B77A 4D6WA 1V89A 2Q13A 4KHOA 2ZKMX 2D2QA 4HAVB 3KZ1A 1WJ1A 1DDWA 5FI0A 4K2OA 2JP2A 3ULCA 2KIGA 2NBVA 1ISNA 4HB0B 2N0YA 2NZ8B 3AU4A 1W1HA 3SO6A 4F7UP 1NI2A 2COFA 4P7IA 3UZTA 1GC6A 1KZGA 3TO1A 2X18A 4K2PA 1KI1B 3DXCA 3KRWA 3P7ZA 2BCJA 3ZDTA 1ZM0A 2YF0A 4HDQA 4L1RA 4L6EA 4H8SA 1Q67A 2LOZA 2MKRA 2MWNB 4B6HA 2K2UA 4WSFA 4HATB 1WJMA 1NU2A 3SYXA 2ADZA 3MPXA 3PVLA 2J0JA 4C0AA 5C5BB 1GC7A 1IRSA 4DX8A 3WA0A 3HIEA 2DKQA 3D8FA 2W2XD 1Z87A 2W2XC 1OMWA 2GJYA 4EJNA 1LW3A 2K8EA 5I2SA 4HAXB 1W1GA 1BTKA 1DYNA 1MK9B 1FB8A 2CRFA 2IFSA 1P5TA 3NWDA 1GG3A 3O96A 2Y8FA 3QWMA 1ZC3B 3DXDA 2VSZA 2D9ZA 4A5KA 3ODWA 3NWFA 1BAKA 2G35A 2HE7A 2YRYA 3TCAA 1B55A 1K5GB 2ROZB 2YT1A 3KY9A 1X05A 1TJ6A 2K00A 5FI1A 4Y94A 3DCXA 3U7DA 5LG4B 1UNQA 4BBKA 5D27A 5J3TA 5D3XA 2I5CA 3NSUA 2VRWB 3IVFA 1MPHA 2Z14A 3TW1A 1U5DA 4HB4B 3LJUX 2DHJA 1FGYA 3WYFB 1EAZA 2RSGA 3NW8A 1X1FA 2R0DA 2NMBA 4Z2MB 3BJIA 2DHKA 5IRSA 3G9WA 2DN6A 1WI1A 2CY4A 4Z2NA 2N23A 5L81A 1BWNA 1FOEA 3F5RA 5HE3A 4MK0A 4PNKA 2H7DA 5HE2A 1U2BA 4MT7A 3T06A 2DYNA 4F7HA 2J59M 1DDMA 3KRXA 1WGQA 1MIXA 2D9VA 1FHWA 4CYEA 2KGXB 5J3QA 1ZVRA 4OT1A 4DXAB 1XCGA 2KIEA 4KAXB 5JHGA 2D9XA 2IYBA 1ZC4B 1N3HA 4HDOA 5DIFB 2Z0OA 1FHXA 3PP2A 5JP4A 4F7GA 2FJUB 3CIKA 5KQ4A 4NY0A 2HTHB 2YSZA 5C5BA 1KZ7A 1DDVA 2Y8GA 4GN1A 3TVVA 3AJ4A 4KHBB 1BTNA 1TQZA 2YVCA 4GZUA 5C16A 3SUZA 2ROVA 1H4RA 4D0NB 3SV1A 2D9WA 1V5UA 2RLOA 5LONB 2AL6A 2EJ8A 2I1JA 1SHCA 2CY5A 3QIJA 4PQ0A 1WGUA 4GMXB 4IAPA 5D3VA 3VIAA 2YS1A 2MFQA 3HK0A 1XX0A 4QJ4B 2K2JA 3PVUA 3CXBB 2DHIA 4IFSA 1Y5OA 2OTXA 3FSSA 2YS3A 2DX5A 2LOXA 4QJ5B 1J0WA 3M1IB 1MI1A 2I1KA 4A6FB 2D4QA 1NTVA 3KSYA 2D9YA 5LOPB 2RNRB 2GCLA 4KVGB 2KUQA 1V5PA 5M4YB 4GXBA 1PMSA 2MDXA 4HB2B 5CLLB 4YONA 2DX1A 2Z0QA 3MDBC 3PVWA 4QXAB 4GMVA 3FEHA 5J3YA 2RRFA 3HSAA 1FHOA 2CODA 2R2YA 1EGXA 4XWXA 5HE1A 2R09A 1MK7B 4A6KA 2GCJA 3D8EA 2KCJA 2DFKA 1M7EA 1M7RA 3ODXA 2D10A 5KCVA 1UNRA 1PFJA 2I5FA 2LG1A 4ZRIA 3A98B 1PLSA 3BINA 1EVHA 4CSQA 3AU5A 5JLJB 3TFMA 4ZRKA 4GNKB 1XD4A 2P0HA 1DBHA 1FGZA 2P8VA 2DTCA 3A8QA 1EF1A 1MAIA 3ODOA 1K5DB 3U12A 5HE0A 1J19A 3DXEA 1TXDA 3SNHA 4K81A 2DKPA 4MY6A 5D3YA 4KHBA 2RVBB 5DI9B 5D3WA 3OHMB 2KUPA 1UEFA 5CLQB 3N7CA 1DROA 1T77A 1U5EA 3FM8C 2CAYA 2GS0A 4OSNA 4QJ3B 2H7EA 2RUKB 4YL8A 1MKEA 3ULBA 4DX90 1RRPB 2LULA 3RCPA 2V76A 2GUMA 2AEHA 4A6HA 1OQNA 3U8ZA 4DIXA 2XQNM 2EMTA 2VKIA 2YS5A 1AQCA 2RGNB 1MIZB 1LB1A 1V61A 1WG7A 3QBVB 4GOUA 2FJLA 4HAZB 3V5WA 1H10A 4NSWA 1V88A 3ML4A 5KQ1A 5EFXA 3GYOA 2J0MA 2L1CA 4IOYX 2W2WA 4WJ7A 1E5WA 2UZRA 3PG7A 4A6FA 2QKMA 4KHAA 2UVMA 4HB3B 1U5FA 2LKOA 5JHHA 4CHJA 2COAA 2LYDA 1ZSQA 1U27A 2QKLA 3F0WA 1UPQA 2Z0PA 1P6SA 2P0DA 2M14A 1UNPA 3A8PA 4HHVA 4TYZA 1WVHA 1QQGA 2ZPYA 2OQBA 3A58A 1V5MA 2Y7BA 2UZSA 1Y19B 4CHMA 2M38A 2Z59A 1P3RA 2E2XA 4ZRJA 5GOWB 4HAWB 4EMOA 4HSIA 4K17A 1NTYA 2Z4DA 3X23A 3NWAA 2DLWA 3PSCA 5C79A 1XKEA 1I7AA 5I2MA 4EKUA 4DBBA 1X1GA 1X11A 1W1DA 4TKNA 4HAUB 3ZVRA 1XODA 4WVFB 3D8DA 1U5GA 2DA0A 1UPRA 3OANA 3GYPA 1QC6A 1ZYIA
chains in the Genus database with same CATH topology
2COCA 1U29A 1AWEA 3HQCA 3HW2B 2PZ1A 5C6RA 2DYQA 2YT0A 1X86A 2D11A 1OY2A 3VOQA 5DH9B 5DHFB 2EMSA 1XR0B 2EC1A 2P0FA 3PZDA 3P6AA 2J0KA 1I2HA 5DHAB 1SGHA 2L2IA 3PEGA 2ELAA 1RJ2A 4HAYB 4GPTB 1FAOA 2ELBA 1V89A 2Q13A 4KHOA 2D2QA 4HAVB 3KZ1A 1WJ1A 1DDWA 5FI0A 4K2OA 2JP2A 3ULCA 1ISNA 4HB0B 2N0YA 2NZ8B 3AU4A 1W1HA 3SO6A 4F7UP 1NI2A 2COFA 4P7IA 3UZTA 1GC6A 1KZGA 3TO1A 2X18A 4K2PA 1KI1B 3DXCA 3KRWA 3P7ZA 2BCJA 3ZDTA 1ZM0A 2YF0A 4HDQA 4L6EA 4H8SA 1Q67A 2LOZA 2MKRA 2MWNB 4B6HA 2K2UA 4WSFA 4HATB 1WJMA 1NU2A 3SYXA 2ADZA 3PVLA 3MPXA 2J0JA 4C0AA 5C5BB 1GC7A 1IRSA 4DX8A 3WA0A 2DKQA 3D8FA 2W2XD 1Z87A 2W2XC 1OMWA 2GJYA 4EJNA 1LW3A 4HAXB 1W1GA 1BTKA 1DYNA 1MK9B 1FB8A 2CRFA 2IFSA 1P5TA 1GG3A 3O96A 2Y8FA 3QWMA 1ZC3B 3DXDA 2VSZA 2D9ZA 4A5KA 3ODWA 1BAKA 2G35A 2HE7A 2YRYA 3TCAA 1B55A 1K5GB 2ROZB 2YT1A 3KY9A 1X05A 1TJ6A 2K00A 5FI1A 4Y94A 3U7DA 1UNQA 4BBKA 5D27A 5J3TA 5D3XA 2I5CA 3NSUA 2VRWB 3IVFA 1MPHA 3TW1A 1U5DA 4HB4B 3LJUX 2DHJA 1FGYA 3WYFB 1EAZA 2RSGA 1X1FA 2R0DA 2NMBA 4Z2MB 3BJIA 2DHKA 3G9WA 2DN6A 1WI1A 2CY4A 4Z2NA 2N23A 5L81A 1BWNA 1FOEA 3F5RA 5HE3A 4MK0A 4PNKA 2H7DA 5HE2A 1U2BA 4MT7A 3T06A 2DYNA 4F7HA 2J59M 1DDMA 3KRXA 1WGQA 1MIXA 2D9VA 1FHWA 4CYEA 2KGXB 5J3QA 1ZVRA 4DXAB 1XCGA 4KAXB 5JHGA 2D9XA 2IYBA 1ZC4B 1N3HA 4HDOA 5DIFB 2Z0OA 1FHXA 3PP2A 5JP4A 4F7GA 3CIKA 5KQ4A 4NY0A 2HTHB 2YSZA 5C5BA 1KZ7A 1DDVA 2Y8GA 4GN1A 3TVVA 3AJ4A 4KHBB 1BTNA 1TQZA 2YVCA 4GZUA 5C16A 3SUZA 2ROVA 1H4RA 4D0NB 3SV1A 2D9WA 1V5UA 2RLOA 5LONB 2AL6A 2EJ8A 2I1JA 1SHCA 2CY5A 3QIJA 4PQ0A 1WGUA 4GMXB 4IAPA 5D3VA 3VIAA 2YS1A 2MFQA 3HK0A 1XX0A 2K2JA 3PVUA 3CXBB 2DHIA 4IFSA 1Y5OA 2OTXA 3FSSA 2YS3A 2DX5A 2LOXA 1J0WA 3M1IB 2I1KA 4A6FB 2D4QA 1NTVA 3KSYA 2D9YA 5LOPB 2RNRB 2GCLA 4KVGB 1V5PA 4GXBA 1PMSA 2MDXA 4HB2B 5CLLB 4YONA 2DX1A 2Z0QA 3MDBC 3PVWA 4GMVA 3FEHA 5J3YA 1FHOA 2CODA 1EGXA 4XWXA 5HE1A 2R09A 1MK7B 4A6KA 2GCJA 3D8EA 2KCJA 2DFKA 1M7EA 1M7RA 3ODXA 2D10A 5KCVA 1UNRA 1PFJA 2I5FA 2LG1A 4ZRIA 3A98B 1PLSA 3BINA 1EVHA 3AU5A 5JLJB 3TFMA 4ZRKA 1XD4A 2P0HA 1DBHA 1FGZA 2P8VA 2DTCA 3A8QA 1EF1A 1MAIA 3ODOA 1K5DB 5HE0A 1J19A 3DXEA 1TXDA 3SNHA 4K81A 2DKPA 4MY6A 5D3YA 2RVBB 5DI9B 5D3WA 2KUPA 1UEFA 5CLQB 3N7CA 1DROA 1U5EA 3FM8C 2CAYA 2GS0A 2H7EA 2RUKB 4YL8A 1MKEA 3ULBA 4DX90 1RRPB 2LULA 3RCPA 2V76A 2AEHA 4A6HA 1OQNA 3U8ZA 2XQNM 2EMTA 2VKIA 2YS5A 1AQCA 2RGNB 1MIZB 1LB1A 1V61A 1WG7A 3QBVB 2FJLA 4HAZB 3V5WA 1H10A 4NSWA 1V88A 3ML4A 5KQ1A 5EFXA 3GYOA 2J0MA 2L1CA 4IOYX 2W2WA 4WJ7A 1E5WA 2UZRA 3PG7A 4A6FA 2QKMA 4KHAA 2UVMA 4HB3B 1U5FA 2LKOA 5JHHA 4CHJA 2COAA 2LYDA 1ZSQA 1U27A 2QKLA 3F0WA 1UPQA 2Z0PA 1P6SA 2P0DA 2M14A 1UNPA 3A8PA 4HHVA 4TYZA 1WVHA 1QQGA 2ZPYA 2OQBA 1V5MA 2Y7BA 2UZSA 1Y19B 4CHMA 2M38A 1P3RA 2E2XA 4ZRJA 5GOWB 4HAWB 4EMOA 4K17A 1NTYA 3X23A 2DLWA 3PSCA 5C79A 1XKEA 1I7AA 4EKUA 4DBBA 1X1GA 1X11A 1W1DA 4TKNA 4HAUB 3ZVRA 1XODA 4WVFB 3D8DA 1U5GA 2DA0A 1UPRA 3OANA 3GYPA 1QC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COC A;  1U29 A;  1AWE A;  3HQC A;  3HW2 B;  2PZ1 A;  5C6R A;  2DYQ A;  2YT0 A;  1X86 A;  2D11 A;  1OY2 A;  3VOQ A;  5DH9 B;  5DHF B;  2EMS A;  1XR0 B;  2EC1 A;  2P0F A;  3PZD A;  3P6A A;  2J0K A;  1I2H A;  5DHA B;  1SGH A;  2L2I A;  3PEG A;  2ELA A;  1RJ2 A;  4HAY B;  4GPT B;  1FAO A;  2ELB A;  1V89 A;  2Q13 A;  4KHO A;  2D2Q A;  4HAV B;  3KZ1 A;  1WJ1 A;  1DDW A;  5FI0 A;  4K2O A;  2JP2 A;  3ULC A;  1ISN A;  4HB0 B;  2N0Y A;  2NZ8 B;  3AU4 A;  1W1H A;  3SO6 A;  4F7U P;  1NI2 A;  2COF A;  4P7I A;  3UZT A;  1GC6 A;  1KZG A;  3TO1 A;  2X18 A;  4K2P A;  1KI1 B;  3DXC A;  3KRW A;  3P7Z A;  2BCJ A;  3ZDT A;  1ZM0 A;  2YF0 A;  4HDQ A;  4L6E A;  4H8S A;  1Q67 A;  2LOZ A;  2MKR A;  2MWN B;  4B6H A;  2K2U A;  4WSF A;  4HAT B;  1WJM A;  1NU2 A;  3SYX A;  2ADZ A;  3PVL A;  3MPX A;  2J0J A;  4C0A A;  5C5B B;  1GC7 A;  1IRS A;  4DX8 A;  3WA0 A;  2DKQ A;  3D8F A;  2W2X D;  1Z87 A;  2W2X C;  1OMW A;  2GJY A;  4EJN A;  1LW3 A;  4HAX B;  1W1G A;  1BTK A;  1DYN A;  1MK9 B;  1FB8 A;  2CRF A;  2IFS A;  1P5T A;  1GG3 A;  3O96 A;  2Y8F A;  3QWM A;  1ZC3 B;  3DXD A;  2VSZ A;  2D9Z A;  4A5K A;  3ODW A;  1BAK A;  2G35 A;  2HE7 A;  2YRY A;  3TCA A;  1B55 A;  1K5G B;  2ROZ B;  2YT1 A;  3KY9 A;  1X05 A;  1TJ6 A;  2K00 A;  5FI1 A;  4Y94 A;  3U7D A;  1UNQ A;  4BBK A;  5D27 A;  5J3T A;  5D3X A;  2I5C A;  3NSU A;  2VRW B;  3IVF A;  1MPH A;  3TW1 A;  1U5D A;  4HB4 B;  3LJU X;  2DHJ A;  1FGY A;  3WYF B;  1EAZ A;  2RSG A;  1X1F A;  2R0D A;  2NMB A;  4Z2M B;  3BJI A;  2DHK A;  3G9W A;  2DN6 A;  1WI1 A;  2CY4 A;  4Z2N A;  2N23 A;  5L81 A;  1BWN A;  1FOE A;  3F5R A;  5HE3 A;  4MK0 A;  4PNK A;  2H7D A;  5HE2 A;  1U2B A;  4MT7 A;  3T06 A;  2DYN A;  4F7H A;  2J59 M;  1DDM A;  3KRX A;  1WGQ A;  1MIX A;  2D9V A;  1FHW A;  4CYE A;  2KGX B;  5J3Q A;  1ZVR A;  4DXA B;  1XCG A;  4KAX B;  5JHG A;  2D9X A;  2IYB A;  1ZC4 B;  1N3H A;  4HDO A;  5DIF B;  2Z0O A;  1FHX A;  3PP2 A;  5JP4 A;  4F7G A;  3CIK A;  5KQ4 A;  4NY0 A;  2HTH B;  2YSZ A;  5C5B A;  1KZ7 A;  1DDV A;  2Y8G A;  4GN1 A;  3TVV A;  3AJ4 A;  4KHB B;  1BTN A;  1TQZ A;  2YVC A;  4GZU A;  5C16 A;  3SUZ A;  2ROV A;  1H4R A;  4D0N B;  3SV1 A;  2D9W A;  1V5U A;  2RLO A;  5LON B;  2AL6 A;  2EJ8 A;  2I1J A;  1SHC A;  2CY5 A;  3QIJ A;  4PQ0 A;  1WGU A;  4GMX B;  4IAP A;  5D3V A;  3VIA A;  2YS1 A;  2MFQ A;  3HK0 A;  1XX0 A;  2K2J A;  3PVU A;  3CXB B;  2DHI A;  4IFS A;  1Y5O A;  2OTX A;  3FSS A;  2YS3 A;  2DX5 A;  2LOX A;  1J0W A;  3M1I B;  2I1K A;  4A6F B;  2D4Q A;  1NTV A;  3KSY A;  2D9Y A;  5LOP B;  2RNR B;  2GCL A;  4KVG B;  1V5P A;  4GXB A;  1PMS A;  2MDX A;  4HB2 B;  5CLL B;  4YON A;  2DX1 A;  2Z0Q A;  3MDB C;  3PVW A;  4GMV A;  3FEH A;  5J3Y A;  1FHO A;  2COD A;  1EGX A;  4XWX A;  5HE1 A;  2R09 A;  1MK7 B;  4A6K A;  2GCJ A;  3D8E A;  2KCJ A;  2DFK A;  1M7E A;  1M7R A;  3ODX A;  2D10 A;  5KCV A;  1UNR A;  1PFJ A;  2I5F A;  2LG1 A;  4ZRI A;  3A98 B;  1PLS A;  3BIN A;  1EVH A;  3AU5 A;  5JLJ B;  3TFM A;  4ZRK A;  1XD4 A;  2P0H A;  1DBH A;  1FGZ A;  2P8V A;  2DTC A;  3A8Q A;  1EF1 A;  1MAI A;  3ODO A;  1K5D B;  5HE0 A;  1J19 A;  3DXE A;  1TXD A;  3SNH A;  4K81 A;  2DKP A;  4MY6 A;  5D3Y A;  2RVB B;  5DI9 B;  5D3W A;  2KUP A;  1UEF A;  5CLQ B;  3N7C A;  1DRO A;  1U5E A;  3FM8 C;  2CAY A;  2GS0 A;  2H7E A;  2RUK B;  4YL8 A;  1MKE A;  3ULB A;  4DX9 0;  1RRP B;  2LUL A;  3RCP A;  2V76 A;  2AEH A;  4A6H A;  1OQN A;  3U8Z A;  2XQN M;  2EMT A;  2VKI A;  2YS5 A;  1AQC A;  2RGN B;  1MIZ B;  1LB1 A;  1V61 A;  1WG7 A;  3QBV B;  2FJL A;  4HAZ B;  3V5W A;  1H10 A;  4NSW A;  1V88 A;  3ML4 A;  5KQ1 A;  5EFX A;  3GYO A;  2J0M A;  2L1C A;  4IOY X;  2W2W A;  4WJ7 A;  1E5W A;  2UZR A;  3PG7 A;  4A6F A;  2QKM A;  4KHA A;  2UVM A;  4HB3 B;  1U5F A;  2LKO A;  5JHH A;  4CHJ A;  2COA A;  2LYD A;  1ZSQ A;  1U27 A;  2QKL A;  3F0W A;  1UPQ A;  2Z0P A;  1P6S A;  2P0D A;  2M14 A;  1UNP A;  3A8P A;  4HHV A;  4TYZ A;  1WVH A;  1QQG A;  2ZPY A;  2OQB A;  1V5M A;  2Y7B A;  2UZS A;  1Y19 B;  4CHM A;  2M38 A;  1P3R A;  2E2X A;  4ZRJ A;  5GOW B;  4HAW B;  4EMO A;  4K17 A;  1NTY A;  3X23 A;  2DLW A;  3PSC A;  5C79 A;  1XKE A;  1I7A A;  4EKU A;  4DBB A;  1X1G A;  1X11 A;  1W1D A;  4TKN A;  4HAU B;  3ZVR A;  1XOD A;  4WVF B;  3D8D A;  1U5G A;  2DA0 A;  1UPR A;  3OAN A;  3GYP A;  1QC6 A; 
#chains in the Genus database with same CATH topology
 2COC A;  1U29 A;  1AWE A;  2YT2 A;  3HQC A;  3HW2 B;  2PZ1 A;  5C6R A;  2DYQ A;  2YT0 A;  3FVC A;  1X86 A;  2D11 A;  1OY2 A;  3VOQ A;  2KR0 A;  5DH9 B;  5DHF B;  2EMS A;  1XR0 B;  2EC1 A;  2P0F A;  3PZD A;  3P6A A;  2J0K A;  1I2H A;  5DHA B;  1SGH A;  2L2I A;  3PEG A;  2ELA A;  1RJ2 A;  2Z13 A;  4HAY B;  4GPT B;  1FAO A;  2ELB A;  2K49 A;  3B77 A;  4D6W A;  1V89 A;  2Q13 A;  4KHO A;  2ZKM X;  2D2Q A;  4HAV B;  3KZ1 A;  1WJ1 A;  1DDW A;  5FI0 A;  4K2O A;  2JP2 A;  3ULC A;  2KIG A;  2NBV A;  1ISN A;  4HB0 B;  2N0Y A;  2NZ8 B;  3AU4 A;  1W1H A;  3SO6 A;  4F7U P;  1NI2 A;  2COF A;  4P7I A;  3UZT A;  1GC6 A;  1KZG A;  3TO1 A;  2X18 A;  4K2P A;  1KI1 B;  3DXC A;  3KRW A;  3P7Z A;  2BCJ A;  3ZDT A;  1ZM0 A;  2YF0 A;  4HDQ A;  4L1R A;  4L6E A;  4H8S A;  1Q67 A;  2LOZ A;  2MKR A;  2MWN B;  4B6H A;  2K2U A;  4WSF A;  4HAT B;  1WJM A;  1NU2 A;  3SYX A;  2ADZ A;  3MPX A;  3PVL A;  2J0J A;  4C0A A;  5C5B B;  1GC7 A;  1IRS A;  4DX8 A;  3WA0 A;  3HIE A;  2DKQ A;  3D8F A;  2W2X D;  1Z87 A;  2W2X C;  1OMW A;  2GJY A;  4EJN A;  1LW3 A;  2K8E A;  5I2S A;  4HAX B;  1W1G A;  1BTK A;  1DYN A;  1MK9 B;  1FB8 A;  2CRF A;  2IFS A;  1P5T A;  3NWD A;  1GG3 A;  3O96 A;  2Y8F A;  3QWM A;  1ZC3 B;  3DXD A;  2VSZ A;  2D9Z A;  4A5K A;  3ODW A;  3NWF A;  1BAK A;  2G35 A;  2HE7 A;  2YRY A;  3TCA A;  1B55 A;  1K5G B;  2ROZ B;  2YT1 A;  3KY9 A;  1X05 A;  1TJ6 A;  2K00 A;  5FI1 A;  4Y94 A;  3DCX A;  3U7D A;  5LG4 B;  1UNQ A;  4BBK A;  5D27 A;  5J3T A;  5D3X A;  2I5C A;  3NSU A;  2VRW B;  3IVF A;  1MPH A;  2Z14 A;  3TW1 A;  1U5D A;  4HB4 B;  3LJU X;  2DHJ A;  1FGY A;  3WYF B;  1EAZ A;  2RSG A;  3NW8 A;  1X1F A;  2R0D A;  2NMB A;  4Z2M B;  3BJI A;  2DHK A;  5IRS A;  3G9W A;  2DN6 A;  1WI1 A;  2CY4 A;  4Z2N A;  2N23 A;  5L81 A;  1BWN A;  1FOE A;  3F5R A;  5HE3 A;  4MK0 A;  4PNK A;  2H7D A;  5HE2 A;  1U2B A;  4MT7 A;  3T06 A;  2DYN A;  4F7H A;  2J59 M;  1DDM A;  3KRX A;  1WGQ A;  1MIX A;  2D9V A;  1FHW A;  4CYE A;  2KGX B;  5J3Q A;  1ZVR A;  4OT1 A;  4DXA B;  1XCG A;  2KIE A;  4KAX B;  5JHG A;  2D9X A;  2IYB A;  1ZC4 B;  1N3H A;  4HDO A;  5DIF B;  2Z0O A;  1FHX A;  3PP2 A;  5JP4 A;  4F7G A;  2FJU B;  3CIK A;  5KQ4 A;  4NY0 A;  2HTH B;  2YSZ A;  5C5B A;  1KZ7 A;  1DDV A;  2Y8G A;  4GN1 A;  3TVV A;  3AJ4 A;  4KHB B;  1BTN A;  1TQZ A;  2YVC A;  4GZU A;  5C16 A;  3SUZ A;  2ROV A;  1H4R A;  4D0N B;  3SV1 A;  2D9W A;  1V5U A;  2RLO A;  5LON B;  2AL6 A;  2EJ8 A;  2I1J A;  1SHC A;  2CY5 A;  3QIJ A;  4PQ0 A;  1WGU A;  4GMX B;  4IAP A;  5D3V A;  3VIA A;  2YS1 A;  2MFQ A;  3HK0 A;  1XX0 A;  4QJ4 B;  2K2J A;  3PVU A;  3CXB B;  2DHI A;  4IFS A;  1Y5O A;  2OTX A;  3FSS A;  2YS3 A;  2DX5 A;  2LOX A;  4QJ5 B;  1J0W A;  3M1I B;  1MI1 A;  2I1K A;  4A6F B;  2D4Q A;  1NTV A;  3KSY A;  2D9Y A;  5LOP B;  2RNR B;  2GCL A;  4KVG B;  2KUQ A;  1V5P A;  5M4Y B;  4GXB A;  1PMS A;  2MDX A;  4HB2 B;  5CLL B;  4YON A;  2DX1 A;  2Z0Q A;  3MDB C;  3PVW A;  4QXA B;  4GMV A;  3FEH A;  5J3Y A;  2RRF A;  3HSA A;  1FHO A;  2COD A;  2R2Y A;  1EGX A;  4XWX A;  5HE1 A;  2R09 A;  1MK7 B;  4A6K A;  2GCJ A;  3D8E A;  2KCJ A;  2DFK A;  1M7E A;  1M7R A;  3ODX A;  2D10 A;  5KCV A;  1UNR A;  1PFJ A;  2I5F A;  2LG1 A;  4ZRI A;  3A98 B;  1PLS A;  3BIN A;  1EVH A;  4CSQ A;  3AU5 A;  5JLJ B;  3TFM A;  4ZRK A;  4GNK B;  1XD4 A;  2P0H A;  1DBH A;  1FGZ A;  2P8V A;  2DTC A;  3A8Q A;  1EF1 A;  1MAI A;  3ODO A;  1K5D B;  3U12 A;  5HE0 A;  1J19 A;  3DXE A;  1TXD A;  3SNH A;  4K81 A;  2DKP A;  4MY6 A;  5D3Y A;  4KHB A;  2RVB B;  5DI9 B;  5D3W A;  3OHM B;  2KUP A;  1UEF A;  5CLQ B;  3N7C A;  1DRO A;  1T77 A;  1U5E A;  3FM8 C;  2CAY A;  2GS0 A;  4OSN A;  4QJ3 B;  2H7E A;  2RUK B;  4YL8 A;  1MKE A;  3ULB A;  4DX9 0;  1RRP B;  2LUL A;  3RCP A;  2V76 A;  2GUM A;  2AEH A;  4A6H A;  1OQN A;  3U8Z A;  4DIX A;  2XQN M;  2EMT A;  2VKI A;  2YS5 A;  1AQC A;  2RGN B;  1MIZ B;  1LB1 A;  1V61 A;  1WG7 A;  3QBV B;  4GOU A;  2FJL A;  4HAZ B;  3V5W A;  1H10 A;  4NSW A;  1V88 A;  3ML4 A;  5KQ1 A;  5EFX A;  3GYO A;  2J0M A;  2L1C A;  4IOY X;  2W2W A;  4WJ7 A;  1E5W A;  2UZR A;  3PG7 A;  4A6F A;  2QKM A;  4KHA A;  2UVM A;  4HB3 B;  1U5F A;  2LKO A;  5JHH A;  4CHJ A;  2COA A;  2LYD A;  1ZSQ A;  1U27 A;  2QKL A;  3F0W A;  1UPQ A;  2Z0P A;  1P6S A;  2P0D A;  2M14 A;  1UNP A;  3A8P A;  4HHV A;  4TYZ A;  1WVH A;  1QQG A;  2ZPY A;  2OQB A;  3A58 A;  1V5M A;  2Y7B A;  2UZS A;  1Y19 B;  4CHM A;  2M38 A;  2Z59 A;  1P3R A;  2E2X A;  4ZRJ A;  5GOW B;  4HAW B;  4EMO A;  4HSI A;  4K17 A;  1NTY A;  2Z4D A;  3X23 A;  3NWA A;  2DLW A;  3PSC A;  5C79 A;  1XKE A;  1I7A A;  5I2M A;  4EKU A;  4DBB A;  1X1G A;  1X11 A;  1W1D A;  4TKN A;  4HAU B;  3ZVR A;  1XOD A;  4WVF B;  3D8D A;  1U5G A;  2DA0 A;  1UPR A;  3OAN A;  3GYP A;  1QC6 A;  1ZYI A; 
#chains in the Genus database with same CATH homology
 2COC A;  1U29 A;  1AWE A;  3HQC A;  3HW2 B;  2PZ1 A;  5C6R A;  2DYQ A;  2YT0 A;  1X86 A;  2D11 A;  1OY2 A;  3VOQ A;  5DH9 B;  5DHF B;  2EMS A;  1XR0 B;  2EC1 A;  2P0F A;  3PZD A;  3P6A A;  2J0K A;  1I2H A;  5DHA B;  1SGH A;  2L2I A;  3PEG A;  2ELA A;  1RJ2 A;  4HAY B;  4GPT B;  1FAO A;  2ELB A;  1V89 A;  2Q13 A;  4KHO A;  2D2Q A;  4HAV B;  3KZ1 A;  1WJ1 A;  1DDW A;  5FI0 A;  4K2O A;  2JP2 A;  3ULC A;  1ISN A;  4HB0 B;  2N0Y A;  2NZ8 B;  3AU4 A;  1W1H A;  3SO6 A;  4F7U P;  1NI2 A;  2COF A;  4P7I A;  3UZT A;  1GC6 A;  1KZG A;  3TO1 A;  2X18 A;  4K2P A;  1KI1 B;  3DXC A;  3KRW A;  3P7Z A;  2BCJ A;  3ZDT A;  1ZM0 A;  2YF0 A;  4HDQ A;  4L6E A;  4H8S A;  1Q67 A;  2LOZ A;  2MKR A;  2MWN B;  4B6H A;  2K2U A;  4WSF A;  4HAT B;  1WJM A;  1NU2 A;  3SYX A;  2ADZ A;  3PVL A;  3MPX A;  2J0J A;  4C0A A;  5C5B B;  1GC7 A;  1IRS A;  4DX8 A;  3WA0 A;  2DKQ A;  3D8F A;  2W2X D;  1Z87 A;  2W2X C;  1OMW A;  2GJY A;  4EJN A;  1LW3 A;  4HAX B;  1W1G A;  1BTK A;  1DYN A;  1MK9 B;  1FB8 A;  2CRF A;  2IFS A;  1P5T A;  1GG3 A;  3O96 A;  2Y8F A;  3QWM A;  1ZC3 B;  3DXD A;  2VSZ A;  2D9Z A;  4A5K A;  3ODW A;  1BAK A;  2G35 A;  2HE7 A;  2YRY A;  3TCA A;  1B55 A;  1K5G B;  2ROZ B;  2YT1 A;  3KY9 A;  1X05 A;  1TJ6 A;  2K00 A;  5FI1 A;  4Y94 A;  3U7D A;  1UNQ A;  4BBK A;  5D27 A;  5J3T A;  5D3X A;  2I5C A;  3NSU A;  2VRW B;  3IVF A;  1MPH A;  3TW1 A;  1U5D A;  4HB4 B;  3LJU X;  2DHJ A;  1FGY A;  3WYF B;  1EAZ A;  2RSG A;  1X1F A;  2R0D A;  2NMB A;  4Z2M B;  3BJI A;  2DHK A;  3G9W A;  2DN6 A;  1WI1 A;  2CY4 A;  4Z2N A;  2N23 A;  5L81 A;  1BWN A;  1FOE A;  3F5R A;  5HE3 A;  4MK0 A;  4PNK A;  2H7D A;  5HE2 A;  1U2B A;  4MT7 A;  3T06 A;  2DYN A;  4F7H A;  2J59 M;  1DDM A;  3KRX A;  1WGQ A;  1MIX A;  2D9V A;  1FHW A;  4CYE A;  2KGX B;  5J3Q A;  1ZVR A;  4DXA B;  1XCG A;  4KAX B;  5JHG A;  2D9X A;  2IYB A;  1ZC4 B;  1N3H A;  4HDO A;  5DIF B;  2Z0O A;  1FHX A;  3PP2 A;  5JP4 A;  4F7G A;  3CIK A;  5KQ4 A;  4NY0 A;  2HTH B;  2YSZ A;  5C5B A;  1KZ7 A;  1DDV A;  2Y8G A;  4GN1 A;  3TVV A;  3AJ4 A;  4KHB B;  1BTN A;  1TQZ A;  2YVC A;  4GZU A;  5C16 A;  3SUZ A;  2ROV A;  1H4R A;  4D0N B;  3SV1 A;  2D9W A;  1V5U A;  2RLO A;  5LON B;  2AL6 A;  2EJ8 A;  2I1J A;  1SHC A;  2CY5 A;  3QIJ A;  4PQ0 A;  1WGU A;  4GMX B;  4IAP A;  5D3V A;  3VIA A;  2YS1 A;  2MFQ A;  3HK0 A;  1XX0 A;  2K2J A;  3PVU A;  3CXB B;  2DHI A;  4IFS A;  1Y5O A;  2OTX A;  3FSS A;  2YS3 A;  2DX5 A;  2LOX A;  1J0W A;  3M1I B;  2I1K A;  4A6F B;  2D4Q A;  1NTV A;  3KSY A;  2D9Y A;  5LOP B;  2RNR B;  2GCL A;  4KVG B;  1V5P A;  4GXB A;  1PMS A;  2MDX A;  4HB2 B;  5CLL B;  4YON A;  2DX1 A;  2Z0Q A;  3MDB C;  3PVW A;  4GMV A;  3FEH A;  5J3Y A;  1FHO A;  2COD A;  1EGX A;  4XWX A;  5HE1 A;  2R09 A;  1MK7 B;  4A6K A;  2GCJ A;  3D8E A;  2KCJ A;  2DFK A;  1M7E A;  1M7R A;  3ODX A;  2D10 A;  5KCV A;  1UNR A;  1PFJ A;  2I5F A;  2LG1 A;  4ZRI A;  3A98 B;  1PLS A;  3BIN A;  1EVH A;  3AU5 A;  5JLJ B;  3TFM A;  4ZRK A;  1XD4 A;  2P0H A;  1DBH A;  1FGZ A;  2P8V A;  2DTC A;  3A8Q A;  1EF1 A;  1MAI A;  3ODO A;  1K5D B;  5HE0 A;  1J19 A;  3DXE A;  1TXD A;  3SNH A;  4K81 A;  2DKP A;  4MY6 A;  5D3Y A;  2RVB B;  5DI9 B;  5D3W A;  2KUP A;  1UEF A;  5CLQ B;  3N7C A;  1DRO A;  1U5E A;  3FM8 C;  2CAY A;  2GS0 A;  2H7E A;  2RUK B;  4YL8 A;  1MKE A;  3ULB A;  4DX9 0;  1RRP B;  2LUL A;  3RCP A;  2V76 A;  2AEH A;  4A6H A;  1OQN A;  3U8Z A;  2XQN M;  2EMT A;  2VKI A;  2YS5 A;  1AQC A;  2RGN B;  1MIZ B;  1LB1 A;  1V61 A;  1WG7 A;  3QBV B;  2FJL A;  4HAZ B;  3V5W A;  1H10 A;  4NSW A;  1V88 A;  3ML4 A;  5KQ1 A;  5EFX A;  3GYO A;  2J0M A;  2L1C A;  4IOY X;  2W2W A;  4WJ7 A;  1E5W A;  2UZR A;  3PG7 A;  4A6F A;  2QKM A;  4KHA A;  2UVM A;  4HB3 B;  1U5F A;  2LKO A;  5JHH A;  4CHJ A;  2COA A;  2LYD A;  1ZSQ A;  1U27 A;  2QKL A;  3F0W A;  1UPQ A;  2Z0P A;  1P6S A;  2P0D A;  2M14 A;  1UNP A;  3A8P A;  4HHV A;  4TYZ A;  1WVH A;  1QQG A;  2ZPY A;  2OQB A;  1V5M A;  2Y7B A;  2UZS A;  1Y19 B;  4CHM A;  2M38 A;  1P3R A;  2E2X A;  4ZRJ A;  5GOW B;  4HAW B;  4EMO A;  4K17 A;  1NTY A;  3X23 A;  2DLW A;  3PSC A;  5C79 A;  1XKE A;  1I7A A;  4EKU A;  4DBB A;  1X1G A;  1X11 A;  1W1D A;  4TKN A;  4HAU B;  3ZVR A;  1XOD A;  4WVF B;  3D8D A;  1U5G A;  2DA0 A;  1UPR A;  3OAN A;  3GYP A;  1QC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...