1X1GA

Solution structure of the c-terminal ph domain of human pleckstrin 2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
129
Chain Sequence
GSSGSSGSLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin 2
publication title Solution structure of the C-terminal PH domain of human pleckstrin 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x1gA00
1DYNA 2KGXB 1FOEA 2HE7A 2L1CA 5DI9B 2DKPA 3PVUA 1M7RA 2Z0QA 1FHWA 5KCVA 1NU2A 1H4RA 5D3YA 1DDVA 5KQ1A 2D4QA 2GJYA 5C79A 2EJ8A 1J0WA 3O96A 4TKNA 1U5FA 2E2XA 1UPRA 2R09A 2J0JA 4YL8A 3F5RA 1PFJA 1SGHA 3AU5A 2D9VA 1V61A 5C5BB 1K5DB 1P6SA 2ADZA 2YT1A 5JHHA 4ZRKA 1W1DA 1U29A 1DDWA 4HAUB 2DLWA 1PLSA 2D9YA 5HE0A 2VKIA 2GCLA 2P8VA 3VOQA 2I1JA 2JP2A 5LONB 3ULBA 3A8PA 1MKEA 1Q67A 2LOXA 2DKQA 1OQNA 1SHCA 1XCGA 2FJLA 5JHGA 1U2BA 2VSZA 1MK9B 1P3RA 1WG7A 2LKOA 2ROVA 3WYFB 1XX0A 2D9WA 3OANA 4EJNA 1E5WA 3X23A 2UZRA 4DBBA 2RNRB 2DFKA 1V5UA 5C16A 1GC6A 4IAPA 4IOYX 1UNRA 1TXDA 2M14A 1W1HA 4H8SA 2DN6A 2LG1A 3SUZA 4K2OA 1AWEA 2EMSA 1X11A 1WVHA 1ZVRA 4A6FA 2YS5A 4HAVB 2MDXA 1V89A 3FEHA 4WVFB 3UZTA 4MK0A 2Z0OA 2MWNB 2RVBB 2Y8FA 5CLLB 3QIJA 3A8QA 3KSYA 2YRYA 1LB1A 1XKEA 1K5GB 4A5KA 3GYOA 2I1KA 2K2UA 4L6EA 2CAYA 4KHOA 1I7AA 2DHIA 1U5GA 4ZRIA 1X05A 3PEGA 3ODOA 1M7EA 1QC6A 1UNPA 4D0NB 2R0DA 1B55A 3PVWA 2BCJA 2J0MA 4GZUA 4DX90 1OY2A 2J0KA 3SYXA 2EMTA 1UNQA 2DYNA 5JP4A 4HAXB 3VIAA 1NTVA 2QKLA 4HB4B 5LOPB 3PP2A 3T06A 4KHBB 3BJIA 3SO6A 3U7DA 2HTHB 4BBKA 3U8ZA 4A6FB 4IFSA 3P7ZA 5D3VA 4TYZA 1BTKA 3D8FA 2D9XA 1DBHA 4P7IA 1WJMA 5KQ4A 1XD4A 5EFXA 4YONA 5DH9B 3SV1A 1XR0B 4HDQA 4CYEA 4HHVA 3HQCA 4WJ7A 2XQNM 4KAXB 4Y94A 3PG7A 2DX5A 2G35A 2Q13A 4DXAB 5HE3A 1FHOA 4ZRJA 1UEFA 4NY0A 1EVHA 1ISNA 1NTYA 2YVCA 3DXEA 1MIZB 4A6KA 2OTXA 5L81A 2DX1A 3D8EA 1KZGA 3RCPA 2AEHA 2W2XD 3LJUX 2RUKB 3AU4A 2ROZB 5DHAB 3IVFA 1WI1A 4CHJA 1FB8A 4GMVA 5J3YA 5DIFB 1V5MA 1X1GA 1Z87A 4F7UP 3SNHA 1W1GA 2MKRA 5HE1A 2RSGA 1TQZA 2AL6A 3V5WA 1ZC4B 2CY4A 2KUPA 4EMOA 2D2QA 3N7CA 5FI1A 1ZSQA 2NZ8B 3FM8C 1MPHA 1TJ6A 2ELBA 3GYPA 3P6AA 3MDBC 2MFQA 3FSSA 2K2JA 1MK7B 2RGNB 4HAYB 2IYBA 3TCAA 1UPQA 4KHAA 4XWXA 2COAA 4GXBA 4F7HA 1U5DA 3F0WA 4DX8A 2N0YA 1KZ7A 3PZDA 4EKUA 3ZDTA 1EAZA 2J59M 4A6HA 3DXCA 3G9WA 1EF1A 2K00A 4B6HA 1LW3A 4HB2B 2H7EA 1U27A 1QQGA 2V76A 3NSUA 1EGXA 4NSWA 1V5PA 2GS0A 4CHMA 1BWNA 3QWMA 1GG3A 2H7DA 4MT7A 1NI2A 3M1IB 2W2XC 2Z0PA 4Z2NA 4GMXB 2D9ZA 4KVGB 2YSZA 2GCJA 3WA0A 4F7GA 2VRWB 1WGUA 2RLOA 5FI0A 2QKMA 2DYQA 5DHFB 1RJ2A 2IFSA 4HATB 1U5EA 4WSFA 2ELAA 2COFA 3ODXA 2I5CA 2Y7BA 4MY6A 2D10A 3HW2B 4GN1A 1WGQA 3ODWA 5CLQB 3TW1A 1X86A 1OMWA 2L2IA 2M38A 3PVLA 3MPXA 4HAZB 1FAOA 1DDMA 3KRWA 1I2HA 1PMSA 2YS3A 1DROA 3BINA 1WJ1A 1ZM0A 2Y8GA 3A98B 3KZ1A 2I5FA 3AJ4A 3TVVA 2YS1A 2P0HA 2W2WA 2LOZA 2P0DA 1N3HA 2OQBA 4C0AA 2YT0A 5D3XA 2LYDA 5GOWB 5D3WA 2N23A 3KY9A 2DHKA 5D27A 1MAIA 3D8DA 1H10A 3CXBB 2UZSA 2CODA 2P0FA 5JLJB 5J3QA 2CY5A 1P5TA 1Y5OA 1GC7A 1AQCA 2NMBA 1X1FA 2EC1A 2PZ1A 1J19A 1BTNA 1FGZA 1BAKA 1RRPB 4HDOA 1ZC3B 4HB3B 3ZVRA 4HB0B 3ML4A 4K2PA 5HE2A 1XODA 1MIXA 2UVMA 3KRXA 1KI1B 1IRSA 1FHXA 4PQ0A 4PNKA 4Z2MB 3HK0A 4K81A 2KCJA 5C5BA 5C6RA 4HAWB 3DXDA 5J3TA 3PSCA 2DA0A 2X18A 3QBVB 2DTCA 4GPTB 3TFMA 2DHJA 3TO1A 2D11A 1FGYA 3CIKA 1Y19B 2COCA 2CRFA 4K17A 2YF0A 3ULCA 2ZPYA 1V88A 2LULA
chains in the Genus database with same CATH superfamily
1DYNA 2KGXB 1FOEA 2HE7A 2L1CA 5DI9B 2DKPA 3PVUA 5LG4B 1M7RA 2Z0QA 1FHWA 5KCVA 1NU2A 1H4RA 2RRFA 5D3YA 1DDVA 5KQ1A 2D4QA 5I2SA 2GJYA 5C79A 2EJ8A 1J0WA 3O96A 4TKNA 4QJ4B 1U5FA 2E2XA 4GNKB 1UPRA 2R09A 2J0JA 4YL8A 3F5RA 1PFJA 1SGHA 3AU5A 2D9VA 1V61A 5C5BB 5M4YB 1K5DB 1P6SA 2ADZA 2YT1A 5JHHA 4ZRKA 1W1DA 1U29A 1DDWA 4HAUB 2DLWA 1PLSA 2D9YA 2NBVA 5HE0A 2VKIA 2GCLA 2P8VA 3VOQA 2I1JA 2JP2A 5LONB 3ULBA 3A8PA 1MKEA 1Q67A 2LOXA 2DKQA 1OQNA 1SHCA 1XCGA 2FJLA 5JHGA 2R2YA 1U2BA 2VSZA 1MK9B 1P3RA 1WG7A 2LKOA 2ROVA 3WYFB 1XX0A 2D9WA 3OANA 4EJNA 1E5WA 3X23A 2UZRA 4DBBA 2RNRB 4QXAB 2DFKA 1V5UA 5C16A 1GC6A 4IAPA 3NW8A 4IOYX 1UNRA 1TXDA 2M14A 1W1HA 4H8SA 4L1RA 2DN6A 2LG1A 3SUZA 4K2OA 1AWEA 2EMSA 1X11A 3NWFA 1WVHA 4QJ3B 1ZVRA 4A6FA 2YS5A 3HIEA 4HAVB 2MDXA 1V89A 3FEHA 4WVFB 3UZTA 4MK0A 2Z0OA 2K49A 2MWNB 2RVBB 2Y8FA 5CLLB 3QIJA 3A8QA 3KSYA 2YRYA 1LB1A 1XKEA 1K5GB 4A5KA 3GYOA 2I1KA 2K2UA 4L6EA 2CAYA 4KHOA 1I7AA 2DHIA 1U5GA 4ZRIA 1X05A 3PEGA 3ODOA 1M7EA 1QC6A 1UNPA 2FJUB 4DIXA 4D0NB 4D6WA 2R0DA 1B55A 3PVWA 2BCJA 2J0MA 4GZUA 4DX90 1OY2A 2J0KA 3SYXA 2EMTA 1UNQA 2DYNA 5JP4A 4HAXB 3VIAA 1NTVA 2QKLA 4HB4B 5LOPB 3PP2A 3T06A 4KHBB 3BJIA 3SO6A 3U7DA 2HTHB 4BBKA 3U8ZA 4A6FB 4IFSA 3P7ZA 5D3VA 3A58A 3U12A 4TYZA 1BTKA 3D8FA 2D9XA 1DBHA 4P7IA 1WJMA 5KQ4A 1XD4A 5EFXA 4YONA 5DH9B 3SV1A 3OHMB 1XR0B 4HDQA 4CYEA 4HHVA 3HQCA 4WJ7A 2XQNM 4KAXB 3HSAA 4Y94A 3PG7A 2DX5A 2G35A 2Q13A 4DXAB 5HE3A 1FHOA 4ZRJA 1UEFA 4NY0A 1EVHA 4GOUA 1ISNA 1NTYA 3NWAA 2YVCA 3DXEA 1MIZB 4A6KA 2OTXA 5L81A 2DX1A 3D8EA 1KZGA 3RCPA 1MI1A 2AEHA 2W2XD 3LJUX 2RUKB 3AU4A 2ROZB 5DHAB 3IVFA 1WI1A 4CHJA 1FB8A 4GMVA 2Z14A 5J3YA 5DIFB 1V5MA 1X1GA 1Z87A 4F7UP 3SNHA 1W1GA 2MKRA 5HE1A 2RSGA 1TQZA 2AL6A 3V5WA 1ZC4B 2CY4A 2KUPA 4EMOA 2D2QA 3N7CA 5FI1A 1ZSQA 2NZ8B 3FM8C 1MPHA 1TJ6A 2ELBA 3GYPA 3P6AA 3MDBC 2MFQA 3FSSA 4KHBA 2K2JA 2KIGA 1MK7B 2RGNB 4HAYB 2IYBA 3TCAA 1UPQA 4KHAA 4XWXA 2COAA 4GXBA 2K8EA 4F7HA 1U5DA 3F0WA 4DX8A 2N0YA 1KZ7A 3PZDA 5I2MA 4EKUA 4QJ5B 5IRSA 3ZDTA 1EAZA 2J59M 4A6HA 3DXCA 3G9WA 1EF1A 2K00A 4B6HA 1LW3A 4HB2B 2H7EA 1U27A 1QQGA 2V76A 3NSUA 1EGXA 4NSWA 1V5PA 2GS0A 4CHMA 1BWNA 2Z4DA 3QWMA 1GG3A 2H7DA 4MT7A 1NI2A 3FVCA 3M1IB 2W2XC 2Z0PA 4Z2NA 4GMXB 2D9ZA 4KVGB 2YSZA 2GCJA 3WA0A 4F7GA 2KIEA 2VRWB 1WGUA 2RLOA 5FI0A 2QKMA 2DYQA 5DHFB 1RJ2A 2IFSA 4HATB 1U5EA 4WSFA 2ELAA 2COFA 3ODXA 2I5CA 2Y7BA 1T77A 4MY6A 2D10A 3HW2B 4GN1A 1WGQA 3ODWA 4OSNA 5CLQB 3TW1A 1X86A 1OMWA 2L2IA 2M38A 3PVLA 3MPXA 4HAZB 1FAOA 1DDMA 3KRWA 1I2HA 1PMSA 2YS3A 1DROA 3BINA 1WJ1A 1ZM0A 2Y8GA 3A98B 3KZ1A 2I5FA 3AJ4A 3TVVA 2YS1A 2P0HA 2W2WA 2LOZA 2P0DA 1N3HA 2OQBA 4C0AA 2YT0A 5D3XA 2LYDA 5GOWB 5D3WA 2N23A 3KY9A 2DHKA 5D27A 1MAIA 2Z13A 3D8DA 1H10A 3CXBB 2UZSA 4OT1A 2CODA 2P0FA 1ZYIA 5JLJB 5J3QA 2CY5A 1P5TA 1Y5OA 1GC7A 2ZKMX 2Z59A 1AQCA 2NMBA 1X1FA 2EC1A 2PZ1A 4CSQA 4HSIA 1J19A 1BTNA 1FGZA 1BAKA 1RRPB 4HDOA 1ZC3B 4HB3B 3ZVRA 4HB0B 3ML4A 4K2PA 5HE2A 1XODA 1MIXA 2UVMA 3B77A 3KRXA 1KI1B 1IRSA 1FHXA 4PQ0A 4PNKA 2KR0A 4Z2MB 3HK0A 4K81A 2KCJA 5C5BA 5C6RA 2GUMA 4HAWB 3DXDA 2KUQA 5J3TA 3PSCA 2DA0A 2X18A 3QBVB 2DTCA 4GPTB 3TFMA 2DHJA 3TO1A 2D11A 3DCXA 1FGYA 3CIKA 1Y19B 2COCA 2CRFA 4K17A 2YF0A 3ULCA 2ZPYA 3NWDA 1V88A 2YT2A 2LULA
chains in the Genus database with same CATH topology
1DYNA 2KGXB 1FOEA 2HE7A 2L1CA 5DI9B 2DKPA 3PVUA 1M7RA 2Z0QA 1FHWA 5KCVA 1NU2A 1H4RA 5D3YA 1DDVA 5KQ1A 2D4QA 2GJYA 5C79A 2EJ8A 1J0WA 3O96A 4TKNA 1U5FA 2E2XA 1UPRA 2R09A 2J0JA 4YL8A 3F5RA 1PFJA 1SGHA 3AU5A 2D9VA 1V61A 5C5BB 1K5DB 1P6SA 2ADZA 2YT1A 5JHHA 4ZRKA 1W1DA 1U29A 1DDWA 4HAUB 2DLWA 1PLSA 2D9YA 5HE0A 2VKIA 2GCLA 2P8VA 3VOQA 2I1JA 2JP2A 5LONB 3ULBA 3A8PA 1MKEA 1Q67A 2LOXA 2DKQA 1OQNA 1SHCA 1XCGA 2FJLA 5JHGA 1U2BA 2VSZA 1MK9B 1P3RA 1WG7A 2LKOA 2ROVA 3WYFB 1XX0A 2D9WA 3OANA 4EJNA 1E5WA 3X23A 2UZRA 4DBBA 2RNRB 2DFKA 1V5UA 5C16A 1GC6A 4IAPA 4IOYX 1UNRA 1TXDA 2M14A 1W1HA 4H8SA 2DN6A 2LG1A 3SUZA 4K2OA 1AWEA 2EMSA 1X11A 1WVHA 1ZVRA 4A6FA 2YS5A 4HAVB 2MDXA 1V89A 3FEHA 4WVFB 3UZTA 4MK0A 2Z0OA 2MWNB 2RVBB 2Y8FA 5CLLB 3QIJA 3A8QA 3KSYA 2YRYA 1LB1A 1XKEA 1K5GB 4A5KA 3GYOA 2I1KA 2K2UA 4L6EA 2CAYA 4KHOA 1I7AA 2DHIA 1U5GA 4ZRIA 1X05A 3PEGA 3ODOA 1M7EA 1QC6A 1UNPA 4D0NB 2R0DA 1B55A 3PVWA 2BCJA 2J0MA 4GZUA 4DX90 1OY2A 2J0KA 3SYXA 2EMTA 1UNQA 2DYNA 5JP4A 4HAXB 3VIAA 1NTVA 2QKLA 4HB4B 5LOPB 3PP2A 3T06A 4KHBB 3BJIA 3SO6A 3U7DA 2HTHB 4BBKA 3U8ZA 4A6FB 4IFSA 3P7ZA 5D3VA 4TYZA 1BTKA 3D8FA 2D9XA 1DBHA 4P7IA 1WJMA 5KQ4A 1XD4A 5EFXA 4YONA 5DH9B 3SV1A 1XR0B 4HDQA 4CYEA 4HHVA 3HQCA 4WJ7A 2XQNM 4KAXB 4Y94A 3PG7A 2DX5A 2G35A 2Q13A 4DXAB 5HE3A 1FHOA 4ZRJA 1UEFA 4NY0A 1EVHA 1ISNA 1NTYA 2YVCA 3DXEA 1MIZB 4A6KA 2OTXA 5L81A 2DX1A 3D8EA 1KZGA 3RCPA 2AEHA 2W2XD 3LJUX 2RUKB 3AU4A 2ROZB 5DHAB 3IVFA 1WI1A 4CHJA 1FB8A 4GMVA 5J3YA 5DIFB 1V5MA 1X1GA 1Z87A 4F7UP 3SNHA 1W1GA 2MKRA 5HE1A 2RSGA 1TQZA 2AL6A 3V5WA 1ZC4B 2CY4A 2KUPA 4EMOA 2D2QA 3N7CA 5FI1A 1ZSQA 2NZ8B 3FM8C 1MPHA 1TJ6A 2ELBA 3GYPA 3P6AA 3MDBC 2MFQA 3FSSA 2K2JA 1MK7B 2RGNB 4HAYB 2IYBA 3TCAA 1UPQA 4KHAA 4XWXA 2COAA 4GXBA 4F7HA 1U5DA 3F0WA 4DX8A 2N0YA 1KZ7A 3PZDA 4EKUA 3ZDTA 1EAZA 2J59M 4A6HA 3DXCA 3G9WA 1EF1A 2K00A 4B6HA 1LW3A 4HB2B 2H7EA 1U27A 1QQGA 2V76A 3NSUA 1EGXA 4NSWA 1V5PA 2GS0A 4CHMA 1BWNA 3QWMA 1GG3A 2H7DA 4MT7A 1NI2A 3M1IB 2W2XC 2Z0PA 4Z2NA 4GMXB 2D9ZA 4KVGB 2YSZA 2GCJA 3WA0A 4F7GA 2VRWB 1WGUA 2RLOA 5FI0A 2QKMA 2DYQA 5DHFB 1RJ2A 2IFSA 4HATB 1U5EA 4WSFA 2ELAA 2COFA 3ODXA 2I5CA 2Y7BA 4MY6A 2D10A 3HW2B 4GN1A 1WGQA 3ODWA 5CLQB 3TW1A 1X86A 1OMWA 2L2IA 2M38A 3PVLA 3MPXA 4HAZB 1FAOA 1DDMA 3KRWA 1I2HA 1PMSA 2YS3A 1DROA 3BINA 1WJ1A 1ZM0A 2Y8GA 3A98B 3KZ1A 2I5FA 3AJ4A 3TVVA 2YS1A 2P0HA 2W2WA 2LOZA 2P0DA 1N3HA 2OQBA 4C0AA 2YT0A 5D3XA 2LYDA 5GOWB 5D3WA 2N23A 3KY9A 2DHKA 5D27A 1MAIA 3D8DA 1H10A 3CXBB 2UZSA 2CODA 2P0FA 5JLJB 5J3QA 2CY5A 1P5TA 1Y5OA 1GC7A 1AQCA 2NMBA 1X1FA 2EC1A 2PZ1A 1J19A 1BTNA 1FGZA 1BAKA 1RRPB 4HDOA 1ZC3B 4HB3B 3ZVRA 4HB0B 3ML4A 4K2PA 5HE2A 1XODA 1MIXA 2UVMA 3KRXA 1KI1B 1IRSA 1FHXA 4PQ0A 4PNKA 4Z2MB 3HK0A 4K81A 2KCJA 5C5BA 5C6RA 4HAWB 3DXDA 5J3TA 3PSCA 2DA0A 2X18A 3QBVB 2DTCA 4GPTB 3TFMA 2DHJA 3TO1A 2D11A 1FGYA 3CIKA 1Y19B 2COCA 2CRFA 4K17A 2YF0A 3ULCA 2ZPYA 1V88A 2LULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DYN A;  2KGX B;  1FOE A;  2HE7 A;  2L1C A;  5DI9 B;  2DKP A;  3PVU A;  1M7R A;  2Z0Q A;  1FHW A;  5KCV A;  1NU2 A;  1H4R A;  5D3Y A;  1DDV A;  5KQ1 A;  2D4Q A;  2GJY A;  5C79 A;  2EJ8 A;  1J0W A;  3O96 A;  4TKN A;  1U5F A;  2E2X A;  1UPR A;  2R09 A;  2J0J A;  4YL8 A;  3F5R A;  1PFJ A;  1SGH A;  3AU5 A;  2D9V A;  1V61 A;  5C5B B;  1K5D B;  1P6S A;  2ADZ A;  2YT1 A;  5JHH A;  4ZRK A;  1W1D A;  1U29 A;  1DDW A;  4HAU B;  2DLW A;  1PLS A;  2D9Y A;  5HE0 A;  2VKI A;  2GCL A;  2P8V A;  3VOQ A;  2I1J A;  2JP2 A;  5LON B;  3ULB A;  3A8P A;  1MKE A;  1Q67 A;  2LOX A;  2DKQ A;  1OQN A;  1SHC A;  1XCG A;  2FJL A;  5JHG A;  1U2B A;  2VSZ A;  1MK9 B;  1P3R A;  1WG7 A;  2LKO A;  2ROV A;  3WYF B;  1XX0 A;  2D9W A;  3OAN A;  4EJN A;  1E5W A;  3X23 A;  2UZR A;  4DBB A;  2RNR B;  2DFK A;  1V5U A;  5C16 A;  1GC6 A;  4IAP A;  4IOY X;  1UNR A;  1TXD A;  2M14 A;  1W1H A;  4H8S A;  2DN6 A;  2LG1 A;  3SUZ A;  4K2O A;  1AWE A;  2EMS A;  1X11 A;  1WVH A;  1ZVR A;  4A6F A;  2YS5 A;  4HAV B;  2MDX A;  1V89 A;  3FEH A;  4WVF B;  3UZT A;  4MK0 A;  2Z0O A;  2MWN B;  2RVB B;  2Y8F A;  5CLL B;  3QIJ A;  3A8Q A;  3KSY A;  2YRY A;  1LB1 A;  1XKE A;  1K5G B;  4A5K A;  3GYO A;  2I1K A;  2K2U A;  4L6E A;  2CAY A;  4KHO A;  1I7A A;  2DHI A;  1U5G A;  4ZRI A;  1X05 A;  3PEG A;  3ODO A;  1M7E A;  1QC6 A;  1UNP A;  4D0N B;  2R0D A;  1B55 A;  3PVW A;  2BCJ A;  2J0M A;  4GZU A;  4DX9 0;  1OY2 A;  2J0K A;  3SYX A;  2EMT A;  1UNQ A;  2DYN A;  5JP4 A;  4HAX B;  3VIA A;  1NTV A;  2QKL A;  4HB4 B;  5LOP B;  3PP2 A;  3T06 A;  4KHB B;  3BJI A;  3SO6 A;  3U7D A;  2HTH B;  4BBK A;  3U8Z A;  4A6F B;  4IFS A;  3P7Z A;  5D3V A;  4TYZ A;  1BTK A;  3D8F A;  2D9X A;  1DBH A;  4P7I A;  1WJM A;  5KQ4 A;  1XD4 A;  5EFX A;  4YON A;  5DH9 B;  3SV1 A;  1XR0 B;  4HDQ A;  4CYE A;  4HHV A;  3HQC A;  4WJ7 A;  2XQN M;  4KAX B;  4Y94 A;  3PG7 A;  2DX5 A;  2G35 A;  2Q13 A;  4DXA B;  5HE3 A;  1FHO A;  4ZRJ A;  1UEF A;  4NY0 A;  1EVH A;  1ISN A;  1NTY A;  2YVC A;  3DXE A;  1MIZ B;  4A6K A;  2OTX A;  5L81 A;  2DX1 A;  3D8E A;  1KZG A;  3RCP A;  2AEH A;  2W2X D;  3LJU X;  2RUK B;  3AU4 A;  2ROZ B;  5DHA B;  3IVF A;  1WI1 A;  4CHJ A;  1FB8 A;  4GMV A;  5J3Y A;  5DIF B;  1V5M A;  1X1G A;  1Z87 A;  4F7U P;  3SNH A;  1W1G A;  2MKR A;  5HE1 A;  2RSG A;  1TQZ A;  2AL6 A;  3V5W A;  1ZC4 B;  2CY4 A;  2KUP A;  4EMO A;  2D2Q A;  3N7C A;  5FI1 A;  1ZSQ A;  2NZ8 B;  3FM8 C;  1MPH A;  1TJ6 A;  2ELB A;  3GYP A;  3P6A A;  3MDB C;  2MFQ A;  3FSS A;  2K2J A;  1MK7 B;  2RGN B;  4HAY B;  2IYB A;  3TCA A;  1UPQ A;  4KHA A;  4XWX A;  2COA A;  4GXB A;  4F7H A;  1U5D A;  3F0W A;  4DX8 A;  2N0Y A;  1KZ7 A;  3PZD A;  4EKU A;  3ZDT A;  1EAZ A;  2J59 M;  4A6H A;  3DXC A;  3G9W A;  1EF1 A;  2K00 A;  4B6H A;  1LW3 A;  4HB2 B;  2H7E A;  1U27 A;  1QQG A;  2V76 A;  3NSU A;  1EGX A;  4NSW A;  1V5P A;  2GS0 A;  4CHM A;  1BWN A;  3QWM A;  1GG3 A;  2H7D A;  4MT7 A;  1NI2 A;  3M1I B;  2W2X C;  2Z0P A;  4Z2N A;  4GMX B;  2D9Z A;  4KVG B;  2YSZ A;  2GCJ A;  3WA0 A;  4F7G A;  2VRW B;  1WGU A;  2RLO A;  5FI0 A;  2QKM A;  2DYQ A;  5DHF B;  1RJ2 A;  2IFS A;  4HAT B;  1U5E A;  4WSF A;  2ELA A;  2COF A;  3ODX A;  2I5C A;  2Y7B A;  4MY6 A;  2D10 A;  3HW2 B;  4GN1 A;  1WGQ A;  3ODW A;  5CLQ B;  3TW1 A;  1X86 A;  1OMW A;  2L2I A;  2M38 A;  3PVL A;  3MPX A;  4HAZ B;  1FAO A;  1DDM A;  3KRW A;  1I2H A;  1PMS A;  2YS3 A;  1DRO A;  3BIN A;  1WJ1 A;  1ZM0 A;  2Y8G A;  3A98 B;  3KZ1 A;  2I5F A;  3AJ4 A;  3TVV A;  2YS1 A;  2P0H A;  2W2W A;  2LOZ A;  2P0D A;  1N3H A;  2OQB A;  4C0A A;  2YT0 A;  5D3X A;  2LYD A;  5GOW B;  5D3W A;  2N23 A;  3KY9 A;  2DHK A;  5D27 A;  1MAI A;  3D8D A;  1H10 A;  3CXB B;  2UZS A;  2COD A;  2P0F A;  5JLJ B;  5J3Q A;  2CY5 A;  1P5T A;  1Y5O A;  1GC7 A;  1AQC A;  2NMB A;  1X1F A;  2EC1 A;  2PZ1 A;  1J19 A;  1BTN A;  1FGZ A;  1BAK A;  1RRP B;  4HDO A;  1ZC3 B;  4HB3 B;  3ZVR A;  4HB0 B;  3ML4 A;  4K2P A;  5HE2 A;  1XOD A;  1MIX A;  2UVM A;  3KRX A;  1KI1 B;  1IRS A;  1FHX A;  4PQ0 A;  4PNK A;  4Z2M B;  3HK0 A;  4K81 A;  2KCJ A;  5C5B A;  5C6R A;  4HAW B;  3DXD A;  5J3T A;  3PSC A;  2DA0 A;  2X18 A;  3QBV B;  2DTC A;  4GPT B;  3TFM A;  2DHJ A;  3TO1 A;  2D11 A;  1FGY A;  3CIK A;  1Y19 B;  2COC A;  2CRF A;  4K17 A;  2YF0 A;  3ULC A;  2ZPY A;  1V88 A;  2LUL A; 
#chains in the Genus database with same CATH topology
 1DYN A;  2KGX B;  1FOE A;  2HE7 A;  2L1C A;  5DI9 B;  2DKP A;  3PVU A;  5LG4 B;  1M7R A;  2Z0Q A;  1FHW A;  5KCV A;  1NU2 A;  1H4R A;  2RRF A;  5D3Y A;  1DDV A;  5KQ1 A;  2D4Q A;  5I2S A;  2GJY A;  5C79 A;  2EJ8 A;  1J0W A;  3O96 A;  4TKN A;  4QJ4 B;  1U5F A;  2E2X A;  4GNK B;  1UPR A;  2R09 A;  2J0J A;  4YL8 A;  3F5R A;  1PFJ A;  1SGH A;  3AU5 A;  2D9V A;  1V61 A;  5C5B B;  5M4Y B;  1K5D B;  1P6S A;  2ADZ A;  2YT1 A;  5JHH A;  4ZRK A;  1W1D A;  1U29 A;  1DDW A;  4HAU B;  2DLW A;  1PLS A;  2D9Y A;  2NBV A;  5HE0 A;  2VKI A;  2GCL A;  2P8V A;  3VOQ A;  2I1J A;  2JP2 A;  5LON B;  3ULB A;  3A8P A;  1MKE A;  1Q67 A;  2LOX A;  2DKQ A;  1OQN A;  1SHC A;  1XCG A;  2FJL A;  5JHG A;  2R2Y A;  1U2B A;  2VSZ A;  1MK9 B;  1P3R A;  1WG7 A;  2LKO A;  2ROV A;  3WYF B;  1XX0 A;  2D9W A;  3OAN A;  4EJN A;  1E5W A;  3X23 A;  2UZR A;  4DBB A;  2RNR B;  4QXA B;  2DFK A;  1V5U A;  5C16 A;  1GC6 A;  4IAP A;  3NW8 A;  4IOY X;  1UNR A;  1TXD A;  2M14 A;  1W1H A;  4H8S A;  4L1R A;  2DN6 A;  2LG1 A;  3SUZ A;  4K2O A;  1AWE A;  2EMS A;  1X11 A;  3NWF A;  1WVH A;  4QJ3 B;  1ZVR A;  4A6F A;  2YS5 A;  3HIE A;  4HAV B;  2MDX A;  1V89 A;  3FEH A;  4WVF B;  3UZT A;  4MK0 A;  2Z0O A;  2K49 A;  2MWN B;  2RVB B;  2Y8F A;  5CLL B;  3QIJ A;  3A8Q A;  3KSY A;  2YRY A;  1LB1 A;  1XKE A;  1K5G B;  4A5K A;  3GYO A;  2I1K A;  2K2U A;  4L6E A;  2CAY A;  4KHO A;  1I7A A;  2DHI A;  1U5G A;  4ZRI A;  1X05 A;  3PEG A;  3ODO A;  1M7E A;  1QC6 A;  1UNP A;  2FJU B;  4DIX A;  4D0N B;  4D6W A;  2R0D A;  1B55 A;  3PVW A;  2BCJ A;  2J0M A;  4GZU A;  4DX9 0;  1OY2 A;  2J0K A;  3SYX A;  2EMT A;  1UNQ A;  2DYN A;  5JP4 A;  4HAX B;  3VIA A;  1NTV A;  2QKL A;  4HB4 B;  5LOP B;  3PP2 A;  3T06 A;  4KHB B;  3BJI A;  3SO6 A;  3U7D A;  2HTH B;  4BBK A;  3U8Z A;  4A6F B;  4IFS A;  3P7Z A;  5D3V A;  3A58 A;  3U12 A;  4TYZ A;  1BTK A;  3D8F A;  2D9X A;  1DBH A;  4P7I A;  1WJM A;  5KQ4 A;  1XD4 A;  5EFX A;  4YON A;  5DH9 B;  3SV1 A;  3OHM B;  1XR0 B;  4HDQ A;  4CYE A;  4HHV A;  3HQC A;  4WJ7 A;  2XQN M;  4KAX B;  3HSA A;  4Y94 A;  3PG7 A;  2DX5 A;  2G35 A;  2Q13 A;  4DXA B;  5HE3 A;  1FHO A;  4ZRJ A;  1UEF A;  4NY0 A;  1EVH A;  4GOU A;  1ISN A;  1NTY A;  3NWA A;  2YVC A;  3DXE A;  1MIZ B;  4A6K A;  2OTX A;  5L81 A;  2DX1 A;  3D8E A;  1KZG A;  3RCP A;  1MI1 A;  2AEH A;  2W2X D;  3LJU X;  2RUK B;  3AU4 A;  2ROZ B;  5DHA B;  3IVF A;  1WI1 A;  4CHJ A;  1FB8 A;  4GMV A;  2Z14 A;  5J3Y A;  5DIF B;  1V5M A;  1X1G A;  1Z87 A;  4F7U P;  3SNH A;  1W1G A;  2MKR A;  5HE1 A;  2RSG A;  1TQZ A;  2AL6 A;  3V5W A;  1ZC4 B;  2CY4 A;  2KUP A;  4EMO A;  2D2Q A;  3N7C A;  5FI1 A;  1ZSQ A;  2NZ8 B;  3FM8 C;  1MPH A;  1TJ6 A;  2ELB A;  3GYP A;  3P6A A;  3MDB C;  2MFQ A;  3FSS A;  4KHB A;  2K2J A;  2KIG A;  1MK7 B;  2RGN B;  4HAY B;  2IYB A;  3TCA A;  1UPQ A;  4KHA A;  4XWX A;  2COA A;  4GXB A;  2K8E A;  4F7H A;  1U5D A;  3F0W A;  4DX8 A;  2N0Y A;  1KZ7 A;  3PZD A;  5I2M A;  4EKU A;  4QJ5 B;  5IRS A;  3ZDT A;  1EAZ A;  2J59 M;  4A6H A;  3DXC A;  3G9W A;  1EF1 A;  2K00 A;  4B6H A;  1LW3 A;  4HB2 B;  2H7E A;  1U27 A;  1QQG A;  2V76 A;  3NSU A;  1EGX A;  4NSW A;  1V5P A;  2GS0 A;  4CHM A;  1BWN A;  2Z4D A;  3QWM A;  1GG3 A;  2H7D A;  4MT7 A;  1NI2 A;  3FVC A;  3M1I B;  2W2X C;  2Z0P A;  4Z2N A;  4GMX B;  2D9Z A;  4KVG B;  2YSZ A;  2GCJ A;  3WA0 A;  4F7G A;  2KIE A;  2VRW B;  1WGU A;  2RLO A;  5FI0 A;  2QKM A;  2DYQ A;  5DHF B;  1RJ2 A;  2IFS A;  4HAT B;  1U5E A;  4WSF A;  2ELA A;  2COF A;  3ODX A;  2I5C A;  2Y7B A;  1T77 A;  4MY6 A;  2D10 A;  3HW2 B;  4GN1 A;  1WGQ A;  3ODW A;  4OSN A;  5CLQ B;  3TW1 A;  1X86 A;  1OMW A;  2L2I A;  2M38 A;  3PVL A;  3MPX A;  4HAZ B;  1FAO A;  1DDM A;  3KRW A;  1I2H A;  1PMS A;  2YS3 A;  1DRO A;  3BIN A;  1WJ1 A;  1ZM0 A;  2Y8G A;  3A98 B;  3KZ1 A;  2I5F A;  3AJ4 A;  3TVV A;  2YS1 A;  2P0H A;  2W2W A;  2LOZ A;  2P0D A;  1N3H A;  2OQB A;  4C0A A;  2YT0 A;  5D3X A;  2LYD A;  5GOW B;  5D3W A;  2N23 A;  3KY9 A;  2DHK A;  5D27 A;  1MAI A;  2Z13 A;  3D8D A;  1H10 A;  3CXB B;  2UZS A;  4OT1 A;  2COD A;  2P0F A;  1ZYI A;  5JLJ B;  5J3Q A;  2CY5 A;  1P5T A;  1Y5O A;  1GC7 A;  2ZKM X;  2Z59 A;  1AQC A;  2NMB A;  1X1F A;  2EC1 A;  2PZ1 A;  4CSQ A;  4HSI A;  1J19 A;  1BTN A;  1FGZ A;  1BAK A;  1RRP B;  4HDO A;  1ZC3 B;  4HB3 B;  3ZVR A;  4HB0 B;  3ML4 A;  4K2P A;  5HE2 A;  1XOD A;  1MIX A;  2UVM A;  3B77 A;  3KRX A;  1KI1 B;  1IRS A;  1FHX A;  4PQ0 A;  4PNK A;  2KR0 A;  4Z2M B;  3HK0 A;  4K81 A;  2KCJ A;  5C5B A;  5C6R A;  2GUM A;  4HAW B;  3DXD A;  2KUQ A;  5J3T A;  3PSC A;  2DA0 A;  2X18 A;  3QBV B;  2DTC A;  4GPT B;  3TFM A;  2DHJ A;  3TO1 A;  2D11 A;  3DCX A;  1FGY A;  3CIK A;  1Y19 B;  2COC A;  2CRF A;  4K17 A;  2YF0 A;  3ULC A;  2ZPY A;  3NWD A;  1V88 A;  2YT2 A;  2LUL A; 
#chains in the Genus database with same CATH homology
 1DYN A;  2KGX B;  1FOE A;  2HE7 A;  2L1C A;  5DI9 B;  2DKP A;  3PVU A;  1M7R A;  2Z0Q A;  1FHW A;  5KCV A;  1NU2 A;  1H4R A;  5D3Y A;  1DDV A;  5KQ1 A;  2D4Q A;  2GJY A;  5C79 A;  2EJ8 A;  1J0W A;  3O96 A;  4TKN A;  1U5F A;  2E2X A;  1UPR A;  2R09 A;  2J0J A;  4YL8 A;  3F5R A;  1PFJ A;  1SGH A;  3AU5 A;  2D9V A;  1V61 A;  5C5B B;  1K5D B;  1P6S A;  2ADZ A;  2YT1 A;  5JHH A;  4ZRK A;  1W1D A;  1U29 A;  1DDW A;  4HAU B;  2DLW A;  1PLS A;  2D9Y A;  5HE0 A;  2VKI A;  2GCL A;  2P8V A;  3VOQ A;  2I1J A;  2JP2 A;  5LON B;  3ULB A;  3A8P A;  1MKE A;  1Q67 A;  2LOX A;  2DKQ A;  1OQN A;  1SHC A;  1XCG A;  2FJL A;  5JHG A;  1U2B A;  2VSZ A;  1MK9 B;  1P3R A;  1WG7 A;  2LKO A;  2ROV A;  3WYF B;  1XX0 A;  2D9W A;  3OAN A;  4EJN A;  1E5W A;  3X23 A;  2UZR A;  4DBB A;  2RNR B;  2DFK A;  1V5U A;  5C16 A;  1GC6 A;  4IAP A;  4IOY X;  1UNR A;  1TXD A;  2M14 A;  1W1H A;  4H8S A;  2DN6 A;  2LG1 A;  3SUZ A;  4K2O A;  1AWE A;  2EMS A;  1X11 A;  1WVH A;  1ZVR A;  4A6F A;  2YS5 A;  4HAV B;  2MDX A;  1V89 A;  3FEH A;  4WVF B;  3UZT A;  4MK0 A;  2Z0O A;  2MWN B;  2RVB B;  2Y8F A;  5CLL B;  3QIJ A;  3A8Q A;  3KSY A;  2YRY A;  1LB1 A;  1XKE A;  1K5G B;  4A5K A;  3GYO A;  2I1K A;  2K2U A;  4L6E A;  2CAY A;  4KHO A;  1I7A A;  2DHI A;  1U5G A;  4ZRI A;  1X05 A;  3PEG A;  3ODO A;  1M7E A;  1QC6 A;  1UNP A;  4D0N B;  2R0D A;  1B55 A;  3PVW A;  2BCJ A;  2J0M A;  4GZU A;  4DX9 0;  1OY2 A;  2J0K A;  3SYX A;  2EMT A;  1UNQ A;  2DYN A;  5JP4 A;  4HAX B;  3VIA A;  1NTV A;  2QKL A;  4HB4 B;  5LOP B;  3PP2 A;  3T06 A;  4KHB B;  3BJI A;  3SO6 A;  3U7D A;  2HTH B;  4BBK A;  3U8Z A;  4A6F B;  4IFS A;  3P7Z A;  5D3V A;  4TYZ A;  1BTK A;  3D8F A;  2D9X A;  1DBH A;  4P7I A;  1WJM A;  5KQ4 A;  1XD4 A;  5EFX A;  4YON A;  5DH9 B;  3SV1 A;  1XR0 B;  4HDQ A;  4CYE A;  4HHV A;  3HQC A;  4WJ7 A;  2XQN M;  4KAX B;  4Y94 A;  3PG7 A;  2DX5 A;  2G35 A;  2Q13 A;  4DXA B;  5HE3 A;  1FHO A;  4ZRJ A;  1UEF A;  4NY0 A;  1EVH A;  1ISN A;  1NTY A;  2YVC A;  3DXE A;  1MIZ B;  4A6K A;  2OTX A;  5L81 A;  2DX1 A;  3D8E A;  1KZG A;  3RCP A;  2AEH A;  2W2X D;  3LJU X;  2RUK B;  3AU4 A;  2ROZ B;  5DHA B;  3IVF A;  1WI1 A;  4CHJ A;  1FB8 A;  4GMV A;  5J3Y A;  5DIF B;  1V5M A;  1X1G A;  1Z87 A;  4F7U P;  3SNH A;  1W1G A;  2MKR A;  5HE1 A;  2RSG A;  1TQZ A;  2AL6 A;  3V5W A;  1ZC4 B;  2CY4 A;  2KUP A;  4EMO A;  2D2Q A;  3N7C A;  5FI1 A;  1ZSQ A;  2NZ8 B;  3FM8 C;  1MPH A;  1TJ6 A;  2ELB A;  3GYP A;  3P6A A;  3MDB C;  2MFQ A;  3FSS A;  2K2J A;  1MK7 B;  2RGN B;  4HAY B;  2IYB A;  3TCA A;  1UPQ A;  4KHA A;  4XWX A;  2COA A;  4GXB A;  4F7H A;  1U5D A;  3F0W A;  4DX8 A;  2N0Y A;  1KZ7 A;  3PZD A;  4EKU A;  3ZDT A;  1EAZ A;  2J59 M;  4A6H A;  3DXC A;  3G9W A;  1EF1 A;  2K00 A;  4B6H A;  1LW3 A;  4HB2 B;  2H7E A;  1U27 A;  1QQG A;  2V76 A;  3NSU A;  1EGX A;  4NSW A;  1V5P A;  2GS0 A;  4CHM A;  1BWN A;  3QWM A;  1GG3 A;  2H7D A;  4MT7 A;  1NI2 A;  3M1I B;  2W2X C;  2Z0P A;  4Z2N A;  4GMX B;  2D9Z A;  4KVG B;  2YSZ A;  2GCJ A;  3WA0 A;  4F7G A;  2VRW B;  1WGU A;  2RLO A;  5FI0 A;  2QKM A;  2DYQ A;  5DHF B;  1RJ2 A;  2IFS A;  4HAT B;  1U5E A;  4WSF A;  2ELA A;  2COF A;  3ODX A;  2I5C A;  2Y7B A;  4MY6 A;  2D10 A;  3HW2 B;  4GN1 A;  1WGQ A;  3ODW A;  5CLQ B;  3TW1 A;  1X86 A;  1OMW A;  2L2I A;  2M38 A;  3PVL A;  3MPX A;  4HAZ B;  1FAO A;  1DDM A;  3KRW A;  1I2H A;  1PMS A;  2YS3 A;  1DRO A;  3BIN A;  1WJ1 A;  1ZM0 A;  2Y8G A;  3A98 B;  3KZ1 A;  2I5F A;  3AJ4 A;  3TVV A;  2YS1 A;  2P0H A;  2W2W A;  2LOZ A;  2P0D A;  1N3H A;  2OQB A;  4C0A A;  2YT0 A;  5D3X A;  2LYD A;  5GOW B;  5D3W A;  2N23 A;  3KY9 A;  2DHK A;  5D27 A;  1MAI A;  3D8D A;  1H10 A;  3CXB B;  2UZS A;  2COD A;  2P0F A;  5JLJ B;  5J3Q A;  2CY5 A;  1P5T A;  1Y5O A;  1GC7 A;  1AQC A;  2NMB A;  1X1F A;  2EC1 A;  2PZ1 A;  1J19 A;  1BTN A;  1FGZ A;  1BAK A;  1RRP B;  4HDO A;  1ZC3 B;  4HB3 B;  3ZVR A;  4HB0 B;  3ML4 A;  4K2P A;  5HE2 A;  1XOD A;  1MIX A;  2UVM A;  3KRX A;  1KI1 B;  1IRS A;  1FHX A;  4PQ0 A;  4PNK A;  4Z2M B;  3HK0 A;  4K81 A;  2KCJ A;  5C5B A;  5C6R A;  4HAW B;  3DXD A;  5J3T A;  3PSC A;  2DA0 A;  2X18 A;  3QBV B;  2DTC A;  4GPT B;  3TFM A;  2DHJ A;  3TO1 A;  2D11 A;  1FGY A;  3CIK A;  1Y19 B;  2COC A;  2CRF A;  4K17 A;  2YF0 A;  3ULC A;  2ZPY A;  1V88 A;  2LUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...