1X1GA

Solution structure of the c-terminal ph domain of human pleckstrin 2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
129
Chain Sequence
GSSGSSGSLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal PH domain of human pleckstrin 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pleckstrin 2
total genus 14
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x1gA00
2YS5A 3P6AA 3LJUX 2YRYA 2DTCA 1EF1A 2DLWA 4EMOA 3FM8C 3CXBB 2K2UA 1KI1B 1U29A 2D10A 1U5EA 2ZPYA 3WA0A 4BBKA 5D3VA 5D3WA 1RRPB 3SUZA 2HTHB 1BTNA 2DHJA 3GYOA 4GPTB 2H7DA 4CHMA 2YS3A 1K5GB 2UZSA 1N3HA 2D2QA 4YL8A 1H10A 5DI9B 3SNHA 4GMVA 3ULCA 4Z2NA 5LONB 1PFJA 2R09A 2BCJA 2D9WA 1FOEA 1U5GA 2COAA 1DDVA 2IFSA 2J0MA 2P8VA 2EMSA 4KHOA 4K2OA 4DBBA 4P7IA 1B55A 2LULA 3SO6A 3X23A 1OMWA 3CIKA 5KQ1A 2DX5A 3AU4A 2VKIA 2DA0A 1AWEA 3VOQA 3HW2B 2EMTA 2J59M 1Z87A 4DX8A 2D9YA 2GJYA 4EJNA 1LW3A 3KY9A 2DYQA 2K00A 3KSYA 4NY0A 5HE1A 2PZ1A 1KZ7A 2GS0A 3D8EA 5JP4A 1V89A 4NSWA 2D9VA 3ODWA 2FJLA 2YT1A 1KZGA 3D8FA 3OANA 1ZC3B 2Z0PA 4HB2B 2YSZA 3PP2A 5C6RA 2RVBB 1ZC4B 2YS1A 2Z0QA 3SYXA 5DIFB 2I5CA 1W1HA 4A5KA 2LOXA 2L1CA 1V5PA 1TQZA 1MKEA 1U5FA 1EAZA 2Y8GA 2MDXA 4MY6A 5DHAB 1NI2A 3BJIA 4IOYX 4HDQA 4HATB 4HB4B 1XD4A 3P7ZA 3ML4A 2D4QA 2I1JA 1FAOA 1FHXA 4ZRIA 3QIJA 1UNRA 2W2XD 3KRWA 1FHWA 2G35A 4B6HA 2IYBA 2ROZB 3MPXA 3VIAA 1TJ6A 2UZRA 1GG3A 1WGQA 1QC6A 1SGHA 3A98B 2AEHA 2P0FA 3UZTA 1EGXA 1P3RA 2COCA 2ELBA 5C79A 3PZDA 1UPRA 1XX0A 2LYDA 2LOZA 4K81A 1P5TA 4HB3B 2NMBA 4K2PA 5J3TA 2H7EA 2Q13A 4K17A 4TYZA 2CY4A 4ZRKA 3PSCA 2ADZA 3O96A 2CRFA 2DYNA 2MKRA 4KHAA 2JP2A 4GMXB 2KCJA 2UVMA 4L6EA 4HHVA 2LKOA 3SV1A 1GC6A 3ZDTA 2XQNM 3IVFA 2I5FA 4KHBB 4PNKA 2CODA 3TCAA 5HE0A 1DDMA 1WGUA 3PG7A 4F7GA 4ZRJA 4TKNA 3F0WA 1ZM0A 1MPHA 1FB8A 2LG1A 5FI1A 5FI0A 2X18A 4PQ0A 3U7DA 2KGXB 1UNQA 1X86A 1E5WA 3GYPA 4GZUA 2N0YA 3KZ1A 1XCGA 3DXCA 5CLLB 1AQCA 5C5BB 2N23A 1DYNA 3TW1A 2RNRB 4GXBA 3TVVA 4MK0A 3KRXA 2R0DA 1XKEA 1XR0B 4C0AA 3NSUA 1BTKA 4HAWB 5LOPB 5EFXA 2NZ8B 4XWXA 3BINA 1OY2A 3ZVRA 3F5RA 3PVUA 2KUPA 4KVGB 3ODXA 4A6HA 2CY5A 2MWNB 1MIZB 1V5MA 4HAUB 1P6SA 1ZSQA 1DBHA 1SHCA 3A8PA 1FHOA 2VSZA 1X05A 3M1IB 2ELAA 2RLOA 1IRSA 5HE2A 2HE7A 1XODA 2Y8FA 5DH9B 2COFA 1J0WA 2VRWB 4HAXB 4WJ7A 5D3YA 2ROVA 2DN6A 1V5UA 3V5WA 5JLJB 2OQBA 1MIXA 1M7RA 4A6FA 3MDBC 1MK9B 3PEGA 2I1KA 2DKPA 4Z2MB 2L2IA 4WSFA 3PVLA 2MFQA 2J0JA 3HK0A 4HDOA 5J3YA 1W1GA 1X1GA 1K5DB 1QQGA 3ULBA 1M7EA 1WJMA 1WJ1A 2E2XA 3HQCA 1DDWA 4HAZB 2J0KA 3T06A 4F7HA 1V88A 2M14A 5CLQB 1EVHA 3ODOA 2P0HA 2K2JA 3TFMA 2DKQA 5C16A 2DX1A 4EKUA 1Q67A 2P0DA 4H8SA 1OQNA 1H4RA 2DHIA 1WVHA 1UEFA 1FGZA 1I7AA 2QKLA 4MT7A 2RUKB 1ISNA 1I2HA 5D27A 1FGYA 3FSSA 1BWNA 3U8ZA 1J19A 1ZVRA 4A6KA 2EC1A 4IAPA 5JHHA 5D3XA 1NTVA 2YVCA 1PMSA 2GCLA 2QKMA 2M38A 5KCVA 3TO1A 3DXDA 1RJ2A 1BAKA 1MK7B 1V61A 1GC7A 4CHJA 2Z0OA 1U2BA 1MAIA 5J3QA 2YT0A 3DXEA 3D8DA 2YF0A 3QWMA 1X11A 5JHGA 4WVFB 2GCJA 2Y7BA 1WG7A 2D9XA 5KQ4A 3QBVB 3N7CA 2CAYA 5L81A 5GOWB 1W1DA 1Y5OA 4Y94A 1DROA 4DX90 1LB1A 1PLSA 3G9WA 2D11A 2EJ8A 2AL6A 4A6FB 2RGNB 5HE3A 3WYFB 1TXDA 2OTXA 4HAYB 4KAXB 1WI1A 1Y19B 3A8QA 4F7UP 2DHKA 4IFSA 2DFKA 3PVWA 1U5DA 4HB0B 1NTYA 1UNPA 4HAVB 1NU2A 3AJ4A 5DHFB 4CYEA 4D0NB 1X1FA 2RSGA 3FEHA 2V76A 2W2WA 4DXAB 4GN1A 1U27A 2W2XC 3AU5A 1UPQA 4YONA 5C5BA 2D9ZA 3RCPA
chains in the Genus database with same CATH superfamily
2YS5A 3P6AA 3LJUX 2YRYA 2DTCA 4GOUA 1EF1A 2DLWA 4EMOA 3FM8C 3CXBB 2K2UA 2KR0A 1KI1B 1U29A 2D10A 1U5EA 2ZPYA 3WA0A 4BBKA 3FVCA 5D3VA 5D3WA 1RRPB 3SUZA 2HTHB 1BTNA 2DHJA 3GYOA 4GPTB 2H7DA 4DIXA 2YS3A 4CHMA 1K5GB 2UZSA 1N3HA 2D2QA 4YL8A 1H10A 5DI9B 3SNHA 4GMVA 3ULCA 4Z2NA 5LONB 1PFJA 2R09A 2BCJA 2D9WA 1FOEA 1U5GA 2COAA 1DDVA 2IFSA 2J0MA 2P8VA 2EMSA 4KHOA 4K2OA 4DBBA 3HSAA 4P7IA 1B55A 2LULA 3SO6A 3X23A 1OMWA 3B77A 3CIKA 5KQ1A 2DX5A 3AU4A 2VKIA 2DA0A 1AWEA 3VOQA 2ZKMX 3HW2B 2EMTA 2J59M 1Z87A 4DX8A 2D9YA 4GNKB 2GJYA 4QJ5B 4KHBA 4QXAB 3A58A 3U12A 4EJNA 1LW3A 3KY9A 2DYQA 2K00A 3KSYA 4NY0A 5HE1A 2PZ1A 1KZ7A 2GS0A 1ZYIA 3D8EA 5JP4A 1V89A 4NSWA 2D9VA 3ODWA 3DCXA 2FJLA 2YT1A 1KZGA 3D8FA 3OANA 1ZC3B 2Z0PA 4HB2B 2YSZA 3PP2A 5C6RA 2RVBB 1ZC4B 2YS1A 2Z0QA 3SYXA 5DIFB 2I5CA 1W1HA 4A5KA 2LOXA 2L1CA 1V5PA 1TQZA 1MKEA 1U5FA 1EAZA 2Y8GA 2Z59A 2MDXA 4MY6A 5DHAB 1NI2A 3BJIA 4IOYX 4HDQA 4HATB 4HB4B 1XD4A 3P7ZA 3ML4A 2D4QA 2I1JA 1FAOA 1FHXA 4ZRIA 3QIJA 1UNRA 2W2XD 3KRWA 1FHWA 2G35A 4B6HA 2IYBA 2ROZB 3MPXA 3VIAA 1TJ6A 2UZRA 1GG3A 1WGQA 1QC6A 1SGHA 3A98B 2AEHA 2P0FA 3UZTA 1EGXA 1P3RA 2COCA 2ELBA 5C79A 3PZDA 1UPRA 1XX0A 2LYDA 2LOZA 4K81A 1P5TA 4HB3B 2NMBA 4K2PA 5J3TA 2H7EA 2Q13A 3OHMB 4K17A 2CY4A 4TYZA 5IRSA 4ZRKA 3PSCA 2ADZA 3O96A 2FJUB 2CRFA 2DYNA 2MKRA 4KHAA 2JP2A 4GMXB 5M4YB 2KCJA 2UVMA 4L6EA 4HHVA 2LKOA 3SV1A 1GC6A 3ZDTA 2XQNM 3IVFA 2I5FA 4KHBB 4PNKA 2CODA 3TCAA 5HE0A 1DDMA 1WGUA 3PG7A 4F7GA 4ZRJA 4CSQA 4TKNA 3F0WA 1ZM0A 1MPHA 1FB8A 3HIEA 2GUMA 2LG1A 5FI1A 5FI0A 4HSIA 2X18A 4PQ0A 2RRFA 3U7DA 2KGXB 1UNQA 1X86A 1E5WA 3GYPA 4GZUA 2N0YA 3KZ1A 1XCGA 3DXCA 5CLLB 1AQCA 5C5BB 2N23A 1DYNA 4OSNA 3TW1A 2RNRB 4GXBA 3TVVA 4MK0A 3KRXA 2R0DA 1XKEA 2Z13A 1XR0B 4C0AA 3NSUA 1BTKA 2K49A 4HAWB 5LOPB 2K8EA 5EFXA 2NZ8B 2YT2A 4XWXA 3BINA 1OY2A 3ZVRA 3F5RA 3PVUA 2KUPA 4KVGB 3ODXA 4A6HA 2CY5A 2MWNB 1MI1A 1MIZB 1V5MA 1P6SA 1ZSQA 4HAUB 1DBHA 1SHCA 3A8PA 1FHOA 2VSZA 1X05A 3M1IB 5LG4B 2ELAA 2RLOA 1IRSA 5HE2A 2HE7A 1XODA 2Y8FA 5DH9B 4L1RA 2COFA 1J0WA 2VRWB 4HAXB 3NWFA 3NWDA 4WJ7A 5D3YA 2ROVA 2DN6A 1V5UA 1T77A 3NW8A 3V5WA 5JLJB 2OQBA 1MIXA 1M7RA 4A6FA 3MDBC 1MK9B 3PEGA 2I1KA 2DKPA 4Z2MB 2L2IA 4WSFA 3PVLA 2MFQA 2J0JA 3HK0A 4HDOA 5J3YA 1W1GA 1X1GA 1K5DB 1QQGA 3ULBA 1M7EA 1WJMA 1WJ1A 2E2XA 3HQCA 5I2SA 1DDWA 4HAZB 2J0KA 3T06A 4F7HA 1V88A 2KUQA 2M14A 5CLQB 1EVHA 3ODOA 2KIGA 2P0HA 2K2JA 3TFMA 2DKQA 5C16A 2DX1A 4EKUA 2KIEA 1Q67A 2P0DA 1OQNA 4H8SA 1H4RA 2DHIA 1WVHA 1UEFA 1FGZA 1I7AA 2QKLA 4MT7A 2RUKB 1ISNA 1I2HA 5D27A 1FGYA 3FSSA 1BWNA 3U8ZA 1J19A 1ZVRA 4A6KA 2EC1A 4IAPA 5JHHA 5D3XA 1NTVA 2YVCA 1PMSA 2GCLA 2QKMA 4QJ3B 2M38A 5I2MA 5KCVA 3TO1A 3DXDA 1RJ2A 1BAKA 1MK7B 1V61A 1GC7A 4CHJA 2Z0OA 1U2BA 1MAIA 5J3QA 2YT0A 3DXEA 3D8DA 2YF0A 3QWMA 1X11A 5JHGA 4WVFB 2GCJA 2Y7BA 1WG7A 2D9XA 5KQ4A 3QBVB 3N7CA 2CAYA 5L81A 5GOWB 1W1DA 1Y5OA 4Y94A 1DROA 4DX90 1LB1A 1PLSA 4D6WA 3G9WA 2R2YA 2D11A 2EJ8A 2AL6A 4A6FB 2RGNB 5HE3A 3WYFB 1TXDA 2OTXA 2Z14A 2NBVA 4HAYB 4KAXB 1WI1A 1Y19B 3A8QA 4F7UP 3NWAA 2DHKA 4IFSA 2DFKA 3PVWA 1U5DA 4HB0B 1NTYA 1UNPA 4HAVB 1NU2A 3AJ4A 5DHFB 4CYEA 4D0NB 1X1FA 2RSGA 3FEHA 2V76A 2W2WA 4DXAB 4GN1A 1U27A 2W2XC 4OT1A 3AU5A 1UPQA 4YONA 5C5BA 2D9ZA 3RCPA 4QJ4B 2Z4DA
chains in the Genus database with same CATH topology
2YS5A 3P6AA 3LJUX 2YRYA 2DTCA 1EF1A 2DLWA 4EMOA 3FM8C 3CXBB 2K2UA 1KI1B 1U29A 2D10A 1U5EA 2ZPYA 3WA0A 4BBKA 5D3VA 5D3WA 1RRPB 3SUZA 2HTHB 1BTNA 2DHJA 3GYOA 4GPTB 2H7DA 4CHMA 2YS3A 1K5GB 2UZSA 1N3HA 2D2QA 4YL8A 1H10A 5DI9B 3SNHA 4GMVA 3ULCA 4Z2NA 5LONB 1PFJA 2R09A 2BCJA 2D9WA 1FOEA 1U5GA 2COAA 1DDVA 2IFSA 2J0MA 2P8VA 2EMSA 4KHOA 4K2OA 4DBBA 4P7IA 1B55A 2LULA 3SO6A 3X23A 1OMWA 3CIKA 5KQ1A 2DX5A 3AU4A 2VKIA 2DA0A 1AWEA 3VOQA 3HW2B 2EMTA 2J59M 1Z87A 4DX8A 2D9YA 2GJYA 4EJNA 1LW3A 3KY9A 2DYQA 2K00A 3KSYA 4NY0A 5HE1A 2PZ1A 1KZ7A 2GS0A 3D8EA 5JP4A 1V89A 4NSWA 2D9VA 3ODWA 2FJLA 2YT1A 1KZGA 3D8FA 3OANA 1ZC3B 2Z0PA 4HB2B 2YSZA 3PP2A 5C6RA 2RVBB 1ZC4B 2YS1A 2Z0QA 3SYXA 5DIFB 2I5CA 1W1HA 4A5KA 2LOXA 2L1CA 1V5PA 1TQZA 1MKEA 1U5FA 1EAZA 2Y8GA 2MDXA 4MY6A 5DHAB 1NI2A 3BJIA 4IOYX 4HDQA 4HATB 4HB4B 1XD4A 3P7ZA 3ML4A 2D4QA 2I1JA 1FAOA 1FHXA 4ZRIA 3QIJA 1UNRA 2W2XD 3KRWA 1FHWA 2G35A 4B6HA 2IYBA 2ROZB 3MPXA 3VIAA 1TJ6A 2UZRA 1GG3A 1WGQA 1QC6A 1SGHA 3A98B 2AEHA 2P0FA 3UZTA 1EGXA 1P3RA 2COCA 2ELBA 5C79A 3PZDA 1UPRA 1XX0A 2LYDA 2LOZA 4K81A 1P5TA 4HB3B 2NMBA 4K2PA 5J3TA 2H7EA 2Q13A 4K17A 4TYZA 2CY4A 4ZRKA 3PSCA 2ADZA 3O96A 2CRFA 2DYNA 2MKRA 4KHAA 2JP2A 4GMXB 2KCJA 2UVMA 4L6EA 4HHVA 2LKOA 3SV1A 1GC6A 3ZDTA 2XQNM 3IVFA 2I5FA 4KHBB 4PNKA 2CODA 3TCAA 5HE0A 1DDMA 1WGUA 3PG7A 4F7GA 4ZRJA 4TKNA 3F0WA 1ZM0A 1MPHA 1FB8A 2LG1A 5FI1A 5FI0A 2X18A 4PQ0A 3U7DA 2KGXB 1UNQA 1X86A 1E5WA 3GYPA 4GZUA 2N0YA 3KZ1A 1XCGA 3DXCA 5CLLB 1AQCA 5C5BB 2N23A 1DYNA 3TW1A 2RNRB 4GXBA 3TVVA 4MK0A 3KRXA 2R0DA 1XKEA 1XR0B 4C0AA 3NSUA 1BTKA 4HAWB 5LOPB 5EFXA 2NZ8B 4XWXA 3BINA 1OY2A 3ZVRA 3F5RA 3PVUA 2KUPA 4KVGB 3ODXA 4A6HA 2CY5A 2MWNB 1MIZB 1V5MA 4HAUB 1P6SA 1ZSQA 1DBHA 1SHCA 3A8PA 1FHOA 2VSZA 1X05A 3M1IB 2ELAA 2RLOA 1IRSA 5HE2A 2HE7A 1XODA 2Y8FA 5DH9B 2COFA 1J0WA 2VRWB 4HAXB 4WJ7A 5D3YA 2ROVA 2DN6A 1V5UA 3V5WA 5JLJB 2OQBA 1MIXA 1M7RA 4A6FA 3MDBC 1MK9B 3PEGA 2I1KA 2DKPA 4Z2MB 2L2IA 4WSFA 3PVLA 2MFQA 2J0JA 3HK0A 4HDOA 5J3YA 1W1GA 1X1GA 1K5DB 1QQGA 3ULBA 1M7EA 1WJMA 1WJ1A 2E2XA 3HQCA 1DDWA 4HAZB 2J0KA 3T06A 4F7HA 1V88A 2M14A 5CLQB 1EVHA 3ODOA 2P0HA 2K2JA 3TFMA 2DKQA 5C16A 2DX1A 4EKUA 1Q67A 2P0DA 4H8SA 1OQNA 1H4RA 2DHIA 1WVHA 1UEFA 1FGZA 1I7AA 2QKLA 4MT7A 2RUKB 1ISNA 1I2HA 5D27A 1FGYA 3FSSA 1BWNA 3U8ZA 1J19A 1ZVRA 4A6KA 2EC1A 4IAPA 5JHHA 5D3XA 1NTVA 2YVCA 1PMSA 2GCLA 2QKMA 2M38A 5KCVA 3TO1A 3DXDA 1RJ2A 1BAKA 1MK7B 1V61A 1GC7A 4CHJA 2Z0OA 1U2BA 1MAIA 5J3QA 2YT0A 3DXEA 3D8DA 2YF0A 3QWMA 1X11A 5JHGA 4WVFB 2GCJA 2Y7BA 1WG7A 2D9XA 5KQ4A 3QBVB 3N7CA 2CAYA 5L81A 5GOWB 1W1DA 1Y5OA 4Y94A 1DROA 4DX90 1LB1A 1PLSA 3G9WA 2D11A 2EJ8A 2AL6A 4A6FB 2RGNB 5HE3A 3WYFB 1TXDA 2OTXA 4HAYB 4KAXB 1WI1A 1Y19B 3A8QA 4F7UP 2DHKA 4IFSA 2DFKA 3PVWA 1U5DA 4HB0B 1NTYA 1UNPA 4HAVB 1NU2A 3AJ4A 5DHFB 4CYEA 4D0NB 1X1FA 2RSGA 3FEHA 2V76A 2W2WA 4DXAB 4GN1A 1U27A 2W2XC 3AU5A 1UPQA 4YONA 5C5BA 2D9ZA 3RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS5 A;  3P6A A;  3LJU X;  2YRY A;  2DTC A;  1EF1 A;  2DLW A;  4EMO A;  3FM8 C;  3CXB B;  2K2U A;  1KI1 B;  1U29 A;  2D10 A;  1U5E A;  2ZPY A;  3WA0 A;  4BBK A;  5D3V A;  5D3W A;  1RRP B;  3SUZ A;  2HTH B;  1BTN A;  2DHJ A;  3GYO A;  4GPT B;  2H7D A;  4CHM A;  2YS3 A;  1K5G B;  2UZS A;  1N3H A;  2D2Q A;  4YL8 A;  1H10 A;  5DI9 B;  3SNH A;  4GMV A;  3ULC A;  4Z2N A;  5LON B;  1PFJ A;  2R09 A;  2BCJ A;  2D9W A;  1FOE A;  1U5G A;  2COA A;  1DDV A;  2IFS A;  2J0M A;  2P8V A;  2EMS A;  4KHO A;  4K2O A;  4DBB A;  4P7I A;  1B55 A;  2LUL A;  3SO6 A;  3X23 A;  1OMW A;  3CIK A;  5KQ1 A;  2DX5 A;  3AU4 A;  2VKI A;  2DA0 A;  1AWE A;  3VOQ A;  3HW2 B;  2EMT A;  2J59 M;  1Z87 A;  4DX8 A;  2D9Y A;  2GJY A;  4EJN A;  1LW3 A;  3KY9 A;  2DYQ A;  2K00 A;  3KSY A;  4NY0 A;  5HE1 A;  2PZ1 A;  1KZ7 A;  2GS0 A;  3D8E A;  5JP4 A;  1V89 A;  4NSW A;  2D9V A;  3ODW A;  2FJL A;  2YT1 A;  1KZG A;  3D8F A;  3OAN A;  1ZC3 B;  2Z0P A;  4HB2 B;  2YSZ A;  3PP2 A;  5C6R A;  2RVB B;  1ZC4 B;  2YS1 A;  2Z0Q A;  3SYX A;  5DIF B;  2I5C A;  1W1H A;  4A5K A;  2LOX A;  2L1C A;  1V5P A;  1TQZ A;  1MKE A;  1U5F A;  1EAZ A;  2Y8G A;  2MDX A;  4MY6 A;  5DHA B;  1NI2 A;  3BJI A;  4IOY X;  4HDQ A;  4HAT B;  4HB4 B;  1XD4 A;  3P7Z A;  3ML4 A;  2D4Q A;  2I1J A;  1FAO A;  1FHX A;  4ZRI A;  3QIJ A;  1UNR A;  2W2X D;  3KRW A;  1FHW A;  2G35 A;  4B6H A;  2IYB A;  2ROZ B;  3MPX A;  3VIA A;  1TJ6 A;  2UZR A;  1GG3 A;  1WGQ A;  1QC6 A;  1SGH A;  3A98 B;  2AEH A;  2P0F A;  3UZT A;  1EGX A;  1P3R A;  2COC A;  2ELB A;  5C79 A;  3PZD A;  1UPR A;  1XX0 A;  2LYD A;  2LOZ A;  4K81 A;  1P5T A;  4HB3 B;  2NMB A;  4K2P A;  5J3T A;  2H7E A;  2Q13 A;  4K17 A;  4TYZ A;  2CY4 A;  4ZRK A;  3PSC A;  2ADZ A;  3O96 A;  2CRF A;  2DYN A;  2MKR A;  4KHA A;  2JP2 A;  4GMX B;  2KCJ A;  2UVM A;  4L6E A;  4HHV A;  2LKO A;  3SV1 A;  1GC6 A;  3ZDT A;  2XQN M;  3IVF A;  2I5F A;  4KHB B;  4PNK A;  2COD A;  3TCA A;  5HE0 A;  1DDM A;  1WGU A;  3PG7 A;  4F7G A;  4ZRJ A;  4TKN A;  3F0W A;  1ZM0 A;  1MPH A;  1FB8 A;  2LG1 A;  5FI1 A;  5FI0 A;  2X18 A;  4PQ0 A;  3U7D A;  2KGX B;  1UNQ A;  1X86 A;  1E5W A;  3GYP A;  4GZU A;  2N0Y A;  3KZ1 A;  1XCG A;  3DXC A;  5CLL B;  1AQC A;  5C5B B;  2N23 A;  1DYN A;  3TW1 A;  2RNR B;  4GXB A;  3TVV A;  4MK0 A;  3KRX A;  2R0D A;  1XKE A;  1XR0 B;  4C0A A;  3NSU A;  1BTK A;  4HAW B;  5LOP B;  5EFX A;  2NZ8 B;  4XWX A;  3BIN A;  1OY2 A;  3ZVR A;  3F5R A;  3PVU A;  2KUP A;  4KVG B;  3ODX A;  4A6H A;  2CY5 A;  2MWN B;  1MIZ B;  1V5M A;  4HAU B;  1P6S A;  1ZSQ A;  1DBH A;  1SHC A;  3A8P A;  1FHO A;  2VSZ A;  1X05 A;  3M1I B;  2ELA A;  2RLO A;  1IRS A;  5HE2 A;  2HE7 A;  1XOD A;  2Y8F A;  5DH9 B;  2COF A;  1J0W A;  2VRW B;  4HAX B;  4WJ7 A;  5D3Y A;  2ROV A;  2DN6 A;  1V5U A;  3V5W A;  5JLJ B;  2OQB A;  1MIX A;  1M7R A;  4A6F A;  3MDB C;  1MK9 B;  3PEG A;  2I1K A;  2DKP A;  4Z2M B;  2L2I A;  4WSF A;  3PVL A;  2MFQ A;  2J0J A;  3HK0 A;  4HDO A;  5J3Y A;  1W1G A;  1X1G A;  1K5D B;  1QQG A;  3ULB A;  1M7E A;  1WJM A;  1WJ1 A;  2E2X A;  3HQC A;  1DDW A;  4HAZ B;  2J0K A;  3T06 A;  4F7H A;  1V88 A;  2M14 A;  5CLQ B;  1EVH A;  3ODO A;  2P0H A;  2K2J A;  3TFM A;  2DKQ A;  5C16 A;  2DX1 A;  4EKU A;  1Q67 A;  2P0D A;  4H8S A;  1OQN A;  1H4R A;  2DHI A;  1WVH A;  1UEF A;  1FGZ A;  1I7A A;  2QKL A;  4MT7 A;  2RUK B;  1ISN A;  1I2H A;  5D27 A;  1FGY A;  3FSS A;  1BWN A;  3U8Z A;  1J19 A;  1ZVR A;  4A6K A;  2EC1 A;  4IAP A;  5JHH A;  5D3X A;  1NTV A;  2YVC A;  1PMS A;  2GCL A;  2QKM A;  2M38 A;  5KCV A;  3TO1 A;  3DXD A;  1RJ2 A;  1BAK A;  1MK7 B;  1V61 A;  1GC7 A;  4CHJ A;  2Z0O A;  1U2B A;  1MAI A;  5J3Q A;  2YT0 A;  3DXE A;  3D8D A;  2YF0 A;  3QWM A;  1X11 A;  5JHG A;  4WVF B;  2GCJ A;  2Y7B A;  1WG7 A;  2D9X A;  5KQ4 A;  3QBV B;  3N7C A;  2CAY A;  5L81 A;  5GOW B;  1W1D A;  1Y5O A;  4Y94 A;  1DRO A;  4DX9 0;  1LB1 A;  1PLS A;  3G9W A;  2D11 A;  2EJ8 A;  2AL6 A;  4A6F B;  2RGN B;  5HE3 A;  3WYF B;  1TXD A;  2OTX A;  4HAY B;  4KAX B;  1WI1 A;  1Y19 B;  3A8Q A;  4F7U P;  2DHK A;  4IFS A;  2DFK A;  3PVW A;  1U5D A;  4HB0 B;  1NTY A;  1UNP A;  4HAV B;  1NU2 A;  3AJ4 A;  5DHF B;  4CYE A;  4D0N B;  1X1F A;  2RSG A;  3FEH A;  2V76 A;  2W2W A;  4DXA B;  4GN1 A;  1U27 A;  2W2X C;  3AU5 A;  1UPQ A;  4YON A;  5C5B A;  2D9Z A;  3RCP A; 
#chains in the Genus database with same CATH topology
 2YS5 A;  3P6A A;  3LJU X;  2YRY A;  2DTC A;  4GOU A;  1EF1 A;  2DLW A;  4EMO A;  3FM8 C;  3CXB B;  2K2U A;  2KR0 A;  1KI1 B;  1U29 A;  2D10 A;  1U5E A;  2ZPY A;  3WA0 A;  4BBK A;  3FVC A;  5D3V A;  5D3W A;  1RRP B;  3SUZ A;  2HTH B;  1BTN A;  2DHJ A;  3GYO A;  4GPT B;  2H7D A;  4DIX A;  2YS3 A;  4CHM A;  1K5G B;  2UZS A;  1N3H A;  2D2Q A;  4YL8 A;  1H10 A;  5DI9 B;  3SNH A;  4GMV A;  3ULC A;  4Z2N A;  5LON B;  1PFJ A;  2R09 A;  2BCJ A;  2D9W A;  1FOE A;  1U5G A;  2COA A;  1DDV A;  2IFS A;  2J0M A;  2P8V A;  2EMS A;  4KHO A;  4K2O A;  4DBB A;  3HSA A;  4P7I A;  1B55 A;  2LUL A;  3SO6 A;  3X23 A;  1OMW A;  3B77 A;  3CIK A;  5KQ1 A;  2DX5 A;  3AU4 A;  2VKI A;  2DA0 A;  1AWE A;  3VOQ A;  2ZKM X;  3HW2 B;  2EMT A;  2J59 M;  1Z87 A;  4DX8 A;  2D9Y A;  4GNK B;  2GJY A;  4QJ5 B;  4KHB A;  4QXA B;  3A58 A;  3U12 A;  4EJN A;  1LW3 A;  3KY9 A;  2DYQ A;  2K00 A;  3KSY A;  4NY0 A;  5HE1 A;  2PZ1 A;  1KZ7 A;  2GS0 A;  1ZYI A;  3D8E A;  5JP4 A;  1V89 A;  4NSW A;  2D9V A;  3ODW A;  3DCX A;  2FJL A;  2YT1 A;  1KZG A;  3D8F A;  3OAN A;  1ZC3 B;  2Z0P A;  4HB2 B;  2YSZ A;  3PP2 A;  5C6R A;  2RVB B;  1ZC4 B;  2YS1 A;  2Z0Q A;  3SYX A;  5DIF B;  2I5C A;  1W1H A;  4A5K A;  2LOX A;  2L1C A;  1V5P A;  1TQZ A;  1MKE A;  1U5F A;  1EAZ A;  2Y8G A;  2Z59 A;  2MDX A;  4MY6 A;  5DHA B;  1NI2 A;  3BJI A;  4IOY X;  4HDQ A;  4HAT B;  4HB4 B;  1XD4 A;  3P7Z A;  3ML4 A;  2D4Q A;  2I1J A;  1FAO A;  1FHX A;  4ZRI A;  3QIJ A;  1UNR A;  2W2X D;  3KRW A;  1FHW A;  2G35 A;  4B6H A;  2IYB A;  2ROZ B;  3MPX A;  3VIA A;  1TJ6 A;  2UZR A;  1GG3 A;  1WGQ A;  1QC6 A;  1SGH A;  3A98 B;  2AEH A;  2P0F A;  3UZT A;  1EGX A;  1P3R A;  2COC A;  2ELB A;  5C79 A;  3PZD A;  1UPR A;  1XX0 A;  2LYD A;  2LOZ A;  4K81 A;  1P5T A;  4HB3 B;  2NMB A;  4K2P A;  5J3T A;  2H7E A;  2Q13 A;  3OHM B;  4K17 A;  2CY4 A;  4TYZ A;  5IRS A;  4ZRK A;  3PSC A;  2ADZ A;  3O96 A;  2FJU B;  2CRF A;  2DYN A;  2MKR A;  4KHA A;  2JP2 A;  4GMX B;  5M4Y B;  2KCJ A;  2UVM A;  4L6E A;  4HHV A;  2LKO A;  3SV1 A;  1GC6 A;  3ZDT A;  2XQN M;  3IVF A;  2I5F A;  4KHB B;  4PNK A;  2COD A;  3TCA A;  5HE0 A;  1DDM A;  1WGU A;  3PG7 A;  4F7G A;  4ZRJ A;  4CSQ A;  4TKN A;  3F0W A;  1ZM0 A;  1MPH A;  1FB8 A;  3HIE A;  2GUM A;  2LG1 A;  5FI1 A;  5FI0 A;  4HSI A;  2X18 A;  4PQ0 A;  2RRF A;  3U7D A;  2KGX B;  1UNQ A;  1X86 A;  1E5W A;  3GYP A;  4GZU A;  2N0Y A;  3KZ1 A;  1XCG A;  3DXC A;  5CLL B;  1AQC A;  5C5B B;  2N23 A;  1DYN A;  4OSN A;  3TW1 A;  2RNR B;  4GXB A;  3TVV A;  4MK0 A;  3KRX A;  2R0D A;  1XKE A;  2Z13 A;  1XR0 B;  4C0A A;  3NSU A;  1BTK A;  2K49 A;  4HAW B;  5LOP B;  2K8E A;  5EFX A;  2NZ8 B;  2YT2 A;  4XWX A;  3BIN A;  1OY2 A;  3ZVR A;  3F5R A;  3PVU A;  2KUP A;  4KVG B;  3ODX A;  4A6H A;  2CY5 A;  2MWN B;  1MI1 A;  1MIZ B;  1V5M A;  1P6S A;  1ZSQ A;  4HAU B;  1DBH A;  1SHC A;  3A8P A;  1FHO A;  2VSZ A;  1X05 A;  3M1I B;  5LG4 B;  2ELA A;  2RLO A;  1IRS A;  5HE2 A;  2HE7 A;  1XOD A;  2Y8F A;  5DH9 B;  4L1R A;  2COF A;  1J0W A;  2VRW B;  4HAX B;  3NWF A;  3NWD A;  4WJ7 A;  5D3Y A;  2ROV A;  2DN6 A;  1V5U A;  1T77 A;  3NW8 A;  3V5W A;  5JLJ B;  2OQB A;  1MIX A;  1M7R A;  4A6F A;  3MDB C;  1MK9 B;  3PEG A;  2I1K A;  2DKP A;  4Z2M B;  2L2I A;  4WSF A;  3PVL A;  2MFQ A;  2J0J A;  3HK0 A;  4HDO A;  5J3Y A;  1W1G A;  1X1G A;  1K5D B;  1QQG A;  3ULB A;  1M7E A;  1WJM A;  1WJ1 A;  2E2X A;  3HQC A;  5I2S A;  1DDW A;  4HAZ B;  2J0K A;  3T06 A;  4F7H A;  1V88 A;  2KUQ A;  2M14 A;  5CLQ B;  1EVH A;  3ODO A;  2KIG A;  2P0H A;  2K2J A;  3TFM A;  2DKQ A;  5C16 A;  2DX1 A;  4EKU A;  2KIE A;  1Q67 A;  2P0D A;  1OQN A;  4H8S A;  1H4R A;  2DHI A;  1WVH A;  1UEF A;  1FGZ A;  1I7A A;  2QKL A;  4MT7 A;  2RUK B;  1ISN A;  1I2H A;  5D27 A;  1FGY A;  3FSS A;  1BWN A;  3U8Z A;  1J19 A;  1ZVR A;  4A6K A;  2EC1 A;  4IAP A;  5JHH A;  5D3X A;  1NTV A;  2YVC A;  1PMS A;  2GCL A;  2QKM A;  4QJ3 B;  2M38 A;  5I2M A;  5KCV A;  3TO1 A;  3DXD A;  1RJ2 A;  1BAK A;  1MK7 B;  1V61 A;  1GC7 A;  4CHJ A;  2Z0O A;  1U2B A;  1MAI A;  5J3Q A;  2YT0 A;  3DXE A;  3D8D A;  2YF0 A;  3QWM A;  1X11 A;  5JHG A;  4WVF B;  2GCJ A;  2Y7B A;  1WG7 A;  2D9X A;  5KQ4 A;  3QBV B;  3N7C A;  2CAY A;  5L81 A;  5GOW B;  1W1D A;  1Y5O A;  4Y94 A;  1DRO A;  4DX9 0;  1LB1 A;  1PLS A;  4D6W A;  3G9W A;  2R2Y A;  2D11 A;  2EJ8 A;  2AL6 A;  4A6F B;  2RGN B;  5HE3 A;  3WYF B;  1TXD A;  2OTX A;  2Z14 A;  2NBV A;  4HAY B;  4KAX B;  1WI1 A;  1Y19 B;  3A8Q A;  4F7U P;  3NWA A;  2DHK A;  4IFS A;  2DFK A;  3PVW A;  1U5D A;  4HB0 B;  1NTY A;  1UNP A;  4HAV B;  1NU2 A;  3AJ4 A;  5DHF B;  4CYE A;  4D0N B;  1X1F A;  2RSG A;  3FEH A;  2V76 A;  2W2W A;  4DXA B;  4GN1 A;  1U27 A;  2W2X C;  4OT1 A;  3AU5 A;  1UPQ A;  4YON A;  5C5B A;  2D9Z A;  3RCP A;  4QJ4 B;  2Z4D A; 
#chains in the Genus database with same CATH homology
 2YS5 A;  3P6A A;  3LJU X;  2YRY A;  2DTC A;  1EF1 A;  2DLW A;  4EMO A;  3FM8 C;  3CXB B;  2K2U A;  1KI1 B;  1U29 A;  2D10 A;  1U5E A;  2ZPY A;  3WA0 A;  4BBK A;  5D3V A;  5D3W A;  1RRP B;  3SUZ A;  2HTH B;  1BTN A;  2DHJ A;  3GYO A;  4GPT B;  2H7D A;  4CHM A;  2YS3 A;  1K5G B;  2UZS A;  1N3H A;  2D2Q A;  4YL8 A;  1H10 A;  5DI9 B;  3SNH A;  4GMV A;  3ULC A;  4Z2N A;  5LON B;  1PFJ A;  2R09 A;  2BCJ A;  2D9W A;  1FOE A;  1U5G A;  2COA A;  1DDV A;  2IFS A;  2J0M A;  2P8V A;  2EMS A;  4KHO A;  4K2O A;  4DBB A;  4P7I A;  1B55 A;  2LUL A;  3SO6 A;  3X23 A;  1OMW A;  3CIK A;  5KQ1 A;  2DX5 A;  3AU4 A;  2VKI A;  2DA0 A;  1AWE A;  3VOQ A;  3HW2 B;  2EMT A;  2J59 M;  1Z87 A;  4DX8 A;  2D9Y A;  2GJY A;  4EJN A;  1LW3 A;  3KY9 A;  2DYQ A;  2K00 A;  3KSY A;  4NY0 A;  5HE1 A;  2PZ1 A;  1KZ7 A;  2GS0 A;  3D8E A;  5JP4 A;  1V89 A;  4NSW A;  2D9V A;  3ODW A;  2FJL A;  2YT1 A;  1KZG A;  3D8F A;  3OAN A;  1ZC3 B;  2Z0P A;  4HB2 B;  2YSZ A;  3PP2 A;  5C6R A;  2RVB B;  1ZC4 B;  2YS1 A;  2Z0Q A;  3SYX A;  5DIF B;  2I5C A;  1W1H A;  4A5K A;  2LOX A;  2L1C A;  1V5P A;  1TQZ A;  1MKE A;  1U5F A;  1EAZ A;  2Y8G A;  2MDX A;  4MY6 A;  5DHA B;  1NI2 A;  3BJI A;  4IOY X;  4HDQ A;  4HAT B;  4HB4 B;  1XD4 A;  3P7Z A;  3ML4 A;  2D4Q A;  2I1J A;  1FAO A;  1FHX A;  4ZRI A;  3QIJ A;  1UNR A;  2W2X D;  3KRW A;  1FHW A;  2G35 A;  4B6H A;  2IYB A;  2ROZ B;  3MPX A;  3VIA A;  1TJ6 A;  2UZR A;  1GG3 A;  1WGQ A;  1QC6 A;  1SGH A;  3A98 B;  2AEH A;  2P0F A;  3UZT A;  1EGX A;  1P3R A;  2COC A;  2ELB A;  5C79 A;  3PZD A;  1UPR A;  1XX0 A;  2LYD A;  2LOZ A;  4K81 A;  1P5T A;  4HB3 B;  2NMB A;  4K2P A;  5J3T A;  2H7E A;  2Q13 A;  4K17 A;  4TYZ A;  2CY4 A;  4ZRK A;  3PSC A;  2ADZ A;  3O96 A;  2CRF A;  2DYN A;  2MKR A;  4KHA A;  2JP2 A;  4GMX B;  2KCJ A;  2UVM A;  4L6E A;  4HHV A;  2LKO A;  3SV1 A;  1GC6 A;  3ZDT A;  2XQN M;  3IVF A;  2I5F A;  4KHB B;  4PNK A;  2COD A;  3TCA A;  5HE0 A;  1DDM A;  1WGU A;  3PG7 A;  4F7G A;  4ZRJ A;  4TKN A;  3F0W A;  1ZM0 A;  1MPH A;  1FB8 A;  2LG1 A;  5FI1 A;  5FI0 A;  2X18 A;  4PQ0 A;  3U7D A;  2KGX B;  1UNQ A;  1X86 A;  1E5W A;  3GYP A;  4GZU A;  2N0Y A;  3KZ1 A;  1XCG A;  3DXC A;  5CLL B;  1AQC A;  5C5B B;  2N23 A;  1DYN A;  3TW1 A;  2RNR B;  4GXB A;  3TVV A;  4MK0 A;  3KRX A;  2R0D A;  1XKE A;  1XR0 B;  4C0A A;  3NSU A;  1BTK A;  4HAW B;  5LOP B;  5EFX A;  2NZ8 B;  4XWX A;  3BIN A;  1OY2 A;  3ZVR A;  3F5R A;  3PVU A;  2KUP A;  4KVG B;  3ODX A;  4A6H A;  2CY5 A;  2MWN B;  1MIZ B;  1V5M A;  4HAU B;  1P6S A;  1ZSQ A;  1DBH A;  1SHC A;  3A8P A;  1FHO A;  2VSZ A;  1X05 A;  3M1I B;  2ELA A;  2RLO A;  1IRS A;  5HE2 A;  2HE7 A;  1XOD A;  2Y8F A;  5DH9 B;  2COF A;  1J0W A;  2VRW B;  4HAX B;  4WJ7 A;  5D3Y A;  2ROV A;  2DN6 A;  1V5U A;  3V5W A;  5JLJ B;  2OQB A;  1MIX A;  1M7R A;  4A6F A;  3MDB C;  1MK9 B;  3PEG A;  2I1K A;  2DKP A;  4Z2M B;  2L2I A;  4WSF A;  3PVL A;  2MFQ A;  2J0J A;  3HK0 A;  4HDO A;  5J3Y A;  1W1G A;  1X1G A;  1K5D B;  1QQG A;  3ULB A;  1M7E A;  1WJM A;  1WJ1 A;  2E2X A;  3HQC A;  1DDW A;  4HAZ B;  2J0K A;  3T06 A;  4F7H A;  1V88 A;  2M14 A;  5CLQ B;  1EVH A;  3ODO A;  2P0H A;  2K2J A;  3TFM A;  2DKQ A;  5C16 A;  2DX1 A;  4EKU A;  1Q67 A;  2P0D A;  4H8S A;  1OQN A;  1H4R A;  2DHI A;  1WVH A;  1UEF A;  1FGZ A;  1I7A A;  2QKL A;  4MT7 A;  2RUK B;  1ISN A;  1I2H A;  5D27 A;  1FGY A;  3FSS A;  1BWN A;  3U8Z A;  1J19 A;  1ZVR A;  4A6K A;  2EC1 A;  4IAP A;  5JHH A;  5D3X A;  1NTV A;  2YVC A;  1PMS A;  2GCL A;  2QKM A;  2M38 A;  5KCV A;  3TO1 A;  3DXD A;  1RJ2 A;  1BAK A;  1MK7 B;  1V61 A;  1GC7 A;  4CHJ A;  2Z0O A;  1U2B A;  1MAI A;  5J3Q A;  2YT0 A;  3DXE A;  3D8D A;  2YF0 A;  3QWM A;  1X11 A;  5JHG A;  4WVF B;  2GCJ A;  2Y7B A;  1WG7 A;  2D9X A;  5KQ4 A;  3QBV B;  3N7C A;  2CAY A;  5L81 A;  5GOW B;  1W1D A;  1Y5O A;  4Y94 A;  1DRO A;  4DX9 0;  1LB1 A;  1PLS A;  3G9W A;  2D11 A;  2EJ8 A;  2AL6 A;  4A6F B;  2RGN B;  5HE3 A;  3WYF B;  1TXD A;  2OTX A;  4HAY B;  4KAX B;  1WI1 A;  1Y19 B;  3A8Q A;  4F7U P;  2DHK A;  4IFS A;  2DFK A;  3PVW A;  1U5D A;  4HB0 B;  1NTY A;  1UNP A;  4HAV B;  1NU2 A;  3AJ4 A;  5DHF B;  4CYE A;  4D0N B;  1X1F A;  2RSG A;  3FEH A;  2V76 A;  2W2W A;  4DXA B;  4GN1 A;  1U27 A;  2W2X C;  3AU5 A;  1UPQ A;  4YON A;  5C5B A;  2D9Z A;  3RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...