1X1PA

Crystal structure of tk-rnase hii(1-197)-a(28-42)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGAGAIIGLAVGGVVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of amyloid beta fragments in aqueous environments
pubmed doi rcsb
molecule keywords Ribonuclease HII
molecule tags Hydrolase
source organism Thermococcus kodakarensis
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1x1pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1x1pA01
1ZBHA 3I0RA 4BE2A 1YVUA 3KLGA 1CXUA 3DMJA 1G15A 1JLCA 1UAXA 1VRUA 3KJVA 1RT2A 1C1BA 1VRTA 2VG5A 2X6SA 3CYMA 3LALA 3NH2A 4HUFA 4W5TA 3NBPA 4BACA 1L3VA 3D0PA 4KPYA 3HVTA 1DTTA 1TKZA 3SI6A 1GOAA 4CIGA 1T05A 1RBUA 4KI6A 4M3UA 3AVKA 4CFBA 3KLEA 2Z1IA 4B9LA 3C6TA 3PX6A 1JXBA 3VQ9A 4CJUA 4DTPA 3CM5A 1BI4B 2WOMA 3IS9A 4DSIA 3KIOA 3VQPA 4DQSA 3WNEA 1S6PA 5K14A 3VQEA 2OPRA 2F8TA 3ZSZA 2XO7A 4QAGA 4FW2A 4CK3A 4CJFA 4B9UA 4ELVA 2XRIA 5KI6A 1WAJA 1S1XA 1SKWA 4CEAA 4RG8A 4NCBA 3AO1A 3P1GA 2HHTA 3WNFA 1N5YA 3O4NA 2DFFA 4FYDA 3TAQA 4JRQA 4J2DA 2XY7A 5JS2A 4AH9A 1RCHA 1C0TA 3OYGA 3L2QA 4DLGA 4DFJA 2DY4A 3O3GA 2X74A 2KFNA 4FJ8A 3QIOA 1WSGA 4R5PA 4DSJA 5D3GA 2KFZA 1IKXA 3F9KA 1WNSA 2RN2A 4KHNA 5C24A 1NK5A 1VSIA 3LDSA 4FW1A 4BDZA 3OJSA 2Y1IA 1HRHA 2X78A 4I2PA 1LW2A 2EX3A 2A1SA 4JLHA 3VQQA 4B8CA 4HVJA 4Z4GA 5J2PA 1TK0A 1NOYA 4JS5A 1BQNA 3PO5A 4QOZB 2BE2A 1REVA 1T03A 3A2FA 4H4OA 1S9EA 4J2EA 4C8MA 4NCGA 4RW4A 3K5MA 4TSXA 1KLMA 2HHXA 3U3YA 1BQMA 4RW9A 2D0AA 3C94A 5HRNA 3LAKA 3HVRA 3L3UA 4CEBA 3CFPA 4NYNA 5KTQA 3LP3A 2FBTA 3K58A 3OS1A 5KRTA 1SL1A 1BHLA 2XY5A 4M45A 1KVCA 2OZSA 1HYSA 1LWEA 4JRPA 3TAMA 3NGYA 3ZSOA 1VSMA 2VWKA 1XHZA 1BISA 4KTQA 5FRNA 1GOCA 3QINA 4ID1A 4KAZA 4DF8A 1QQCA 1CZBA 1WSHA 1KVBA 4CFDA 3SUNA 3CQ8A 1XI1A 3AO4A 4FLUA 2EHGA 3RR7A 1QE1A 1L3SA 4CIEA 3VQBA 2IAJA 1QSSA 5FRMA 1B92A 1Z25A 2IGIA 4IBNA 4Z4HA 4E7JA 4FM1A 1U4BA 2BDPA 3NH1A 3K59A 4KTZA 4DQPA 3K5NA 3P83D 4O0JA 2OPSA 1BGXT 5J1EA 4DFPA 1NK4A 2OPQA 4HCCA 5C25A 4E1NA 3NH0A 3MEDA 4PWDA 1RDCA 1VSFA 2HB5A 4H4MA 5KGWA 4B08A 3SQ2A 2QKKA 4FZYA 4ZHRA 3TAEA 4FXDA 3VA3A 2Q3SA 4PQUA 4OLAA 2X6NA 4BE0A 2OA8A 1BIUA 3E01A 3DOLA 3ZT4A 3RMDA 1RT1A 4FLVA 2OYQA 4B8AB 3AVBA 1C0MA 1HNVA 1KTQA 3MEGA 4W5OA 2ZQBA 4O44A 4CHQA 3QESA 4GVMA 3L2VA 2HNZA 1HNIA 5I3UA 1BCMA 2P5OA 2E6MA 3CM6A 1WAFA 3MXMA 3HPHA 3S3MA 2OPPA 5FROA 4DTUA 4N5SA 4FLZA 3VQ6A 1J5OA 1QSYA 4CJEA 2G8VA 2PY5A 4KHUA 2ZD1A 1J54A 4CFCA 4M3YA 2B5JA 1WLJA 1ASUA 4G1QA 4DMNA 1ZBUA 3IRXA 4CJ3A 1LW0A 4CJRA 1CXQA 3C95A 3K5LA 2GUIA 2KW4A 3SNNA 1JL2A 1FK9A 1RDAA 1RTJA 3OYAA 4FCYA 2XY6A 3TANA 1VSLA 3KKSA 3TR8A 4FLYA 1IKYA 1RTIA 3V1RA 4FK2A 1C6VA 3RRGA 2DFHA 1S1TA 4LY7A 5CZ2A 3SV3A 3CG7A 3HL8A 3HYFA 1QSLA 1O1WA 4DQRA 4FLTA 4N41A 3SQ1A 3G10A 1NK6A 4AHRA 1U47A 3SUOA 4XIUA 2VWJA 3RTVA 3OYBA 4BDYA 3QEXA 2HHWA 4CIFA 3DLHA 1JKHA 2NUBA 4Z4EA 4Y1DA 4CGHA 4CHYA 1A5XA 1RNHA 5KGXA 1X1PA 3VQDA 4F3OA 4OJRA 4J2BA 1MU2A 3ZSRA 4DU1A 1JLGA 2RPIA 4CJ4A 1RT7A 3MEEA 4J2AA 1LWFA 3ZT3A 4FM2A 3AVLA 4CHZA 2FBVA 1LWCA 1TKTA 4CJKA 4YNQA 4CESA 4DSFA 2B6AA 4KKOA 5DMRA 1W0HA 2RF2A 4CF0A 1BI4A 4N47A 2XY8A 4OPKA 4FM0A 1RTDA 4BE1A 3V4IA 3AVMA 3HPGA 3SUQA 3JSMA 2YNIA 4EZ9A 2HVIA 4FJ7A 4IFVA 4KB1A 4DU4A 1FKOA 3AVFA 3TAGA 3DRRA 3U3GA 1DLOA 1UA0A 2F8SA 4ID5A 3NGIA 1ZBLA 1BL3A 1IO2A 3DI6A 1TAUA 2ITGA 1X9WA 4Q0BA 1VK0A 2P1JA 3KLIA 4Z4FA 2KQ2A 1VSKA 3HM9A 2E4LA 3QEVA 4N56A 1D5AA 1RILA 4Y1CA 2FC0A 3IG1A 1QHTA 3QEIA 4FJHA 1UOCA 2ZE2A 4M3ZA 2QK9A 4LH5A 4CK2A 4E7KA 3ZSYA 3ISNC 1TK5A 4FZXC 2AJQA 4CF1A 3V9SA 4E0DA 3AVCA 3CFRA 3DLKA 2D5RA 1FXXA 3VQ7A 4EP4A 5SZTA 3SZ2A 3JYTA 3KD1E 1UWBA 5CY4A 4DSKA 2OZMA 1N6QA 5CYQA 2G8WA 4C8LA 2FBYA 3ULDA 1WN7A 4B9VA 3PX0A 1X9MA 2PZSA 1VSDA 3QERA 3AVHA 4LH4A 3DLEA 3S3OA 3DLBA 4DWIA 5I42A 4LSNA 1NJZA 3V9XA 4QCLA 2IC3A 4CEOA 4CGIA 4E89A 3O3FA 2XHBA 4I7FA 4C8OA 1TL3A 4DTJA 1L3TA 2G8KA 2GV9A 4DFMA 4M3RA 1EETA 3ZT1A 1JLAA 3V9ZA 3OYCA 4K8ZA 2JLEA 1KFDA 3AVNA 1XWLA 4KHWA 3VQ8A 3HJFA 1W9HA 2FBXA 3OY9A 1B9FA 3KK2A 1HJRA 1HPZA 1RBRA 2E6LA 3OYJA 3LZIA 3TARA 1Q9YA 3NAEA 3TABA 3DRPA 4CEDA 4AHSA 4K8XA 5CZ1A 3RR8A 5CYMA 1JLFA 1B9DA 3AO2A 2O4IA 1J53A 3V1OA 4EZ6A 4HCBA 1JLBA 4HTUA 3LP0A 4ELUA 3KK3A 3SJJA 3CFOA 3ZT0A 2IDOA 4M41A 4IFYA 4CERA 1EX4A 1U45A 4KHSA 3DYAA 3HO1A 4KREA 4EP5A 1TAQA 3ASMA 1U04A 3O3HA 3AVIA 4CGGA 3T1AA 4CJPA 3VQ4A 3EY1A 3NE6A 4O55A 5E41A 1D8YA 4H8KA 4FJLA 4FZZA 3I8DA 2Y1JA 1HQUA 3RMBA 5J2NA 4FJGA 2YHBA 1LAWA 1SUQA 4CF8A 4O5BA 5C42A 4RW8A 2KTQA 3FFIA 4UQGA 1XHXA 4FJJA 3MXJA 5HLFA 3NF8A 3ZT2A 3NF6A 1S1WA 1RT4A 1XC9A 2VG7A 3OYHA 3TI0A 3QIPA 4B9NA 4WE1A 3H08A 3C6UA 3NFAA 2HHSA 1C1AA 1LAVA 4W5NA 1QS4A 4FVMA 4OLBA 3HXMA 1Q9XA 3OJUA 2Z1HA 2A1RA 4B9TA 4IG0A 1YT3A 2VG6A 2HW3A 3M8PA 4E3SA 3AA2A 1F21A 4YFUA 2G8IA 1NKEA 4DQQA 4AHUA 1NK7A 3V9WA 4KHYA 1ZBIA 1S1VA 3T19A 3VQAA 3IAYA 2P5GA 1LV5A 4M3TA 1S5JA 1D9FA 3M8QA 4O0IA 1TVRA 1IH7A 4CJSA 3OYLA 2G8HA 2HVHA 3SCXA 4L8RB 3B6PA 4CJTA 3ZSWA 1NJYA 3QEPA 3AA3A 4OGCA 4CGDA 1TGOA 2D0BA 3OYEA 4E7LA 4ZTFA 1NKCA 2IS3A 3P5JA 3KKRA 4M3XA 2R7YA 1HQEA 4FJNA 1I39A 1RBSA 4CECA 1NK0A 2Z1GA 1KSPA 1I3AA 2O4GA 3SQ4A 4CHOA 1NJWA 2PYJA 3HK2A 3HPOA 4CK1A 2HHUA 1JLEA 4KO0A 2YKMA 3K5OA 4CEZA 4IG3A 4AHTA 3NDKA 4CGJA 4LSLA 3RRHA 1K6YA 1HYZA 4CGFA 3SV4A 3LANA 4PY5A 3DM2A 2RKIA 1ZYQA 3ITHA 1RBTA 1IKWA 3ALYA 4AHCA 4FJ5A 1L5UA 3DLGA 2HMIA 3T3FA 1Y97A 3ZSQA 3L2WA 4KI4A 4DQIA 4F2RA 1J9AA 1U48A 2KZMA 1JLQA 4ZTJA 3AV9A 4ELTA 3LAMA 5DK5A 1TKDA 4FLXA 3LP2A 4CE9A 3L2UA 2HNDA 3MECA 1NK8A 3K57A 1T8EA 3L8BA 4FJIA 3KK1A 2B4JA 1QTMA 3HSTB 1IKVA 2QXFA 4LD0A 3ZSXA 3OYNA 3AVAA 1Q8IA 2YNGA 1ZBFA 4Z0UA 4PA1A 3V1QA 3AVGA 3EZ5A 3TAPA 1RT3A 4CEEA 4CFAA 1TKXA 4CF9A 4OGEA 4KHQA 3OYMA 3DLRA 3U6FA 4IDKA 2BGGA 5HRRA 3OVNA 1S6QA 3BDPA 1EKEA 1SL2A 2ATQA 1S9GA 3RMCA 1TK8A 4CEQA 4BWJA 3PY8A 4C8KA 3KLFA 3OS0A 4GMJB 3AVJA 3NGZA 2HNYA 2WONA 3HP6A 2GBZA 5HROA 1KLNA 1JXEA 3K2PA 1T7PA 1BCOA 1TV6A 1A5VA 4CEFA 4CHPA 2YHAA 1EP4A 4HHTA 3DOKA 3MAQA 3PX4A 4F2SA 3ZCMA 4HUEA 4DS5A 4C8NA 4DTXA 4FJ9A 1X9SA 1ITGA 2LSNA 3PUFA 4DFKA 1SL0A 5JS1A 4KFBA 4FJMA 4Z4IA 1KCFA 2KZZA 3WNHA 3LZJA 4KTWA 3HT3A 4E19A 1SKRA 4DTOA 3LPUA 3AO3A 1Z26A 1R0AA 2F96A 4OKEA 4B9SA 3KD5E 3VN5A 1U49A 2IOCA 4I9LA 3V81A 3AA4A 4FK4A 2HHQA 1RTHA 1WSEA 4DG1A 3UIQA 5HBMA 4KB0A 4CJWA 4MFBA 1DTQA 3OS2A 1ASWA 4I9QA 4OKKA 4DLEA 3THVA 3OYKA 1SV5A 4DTNA 1VSJA 4AHVA 4E1MA 4HUGA 3WNGA 4M42A 1L3UA 4GW6A 3V9UA 3MXIA 1SKSA 4DF4A 4KRFA 5SWMA 5T7BA 3B6OA 4E7HA 2DFEA 3NF7A 5KRSA 4OPJA 4BDPA 4FK0A 4PUOA 3NCIA 1RBVA 1KFSA 4CJQA 5HRSA 4F4KA 4DTSA 3D45A 1VSHA 3F73A 3LWMA 4DS4A 3OYFA 3VA0A 1C0UA 1JL1A 1HYVA 4DSEA 4M3WA 1WSJA 5J2MA 2G8UA 4CJ5A 3PO4A 3QNOA 2QKBA 2DTUA 4FLWA 4CJLA 1NOZA 4E7IA 1YTUA 2BANA 3QEWA 2HHVA 2P51A 1RDDA 4RW7A 4DU3A 3SPYA 1VSEA 4OKJA 3OYIA 3QLHA 4AILC 1BIZA 1WSFA 4Q5VA 4CCHA 4DSLA 2YKNA 1RT6A 1ASVA 4Z4CA 1RDBA 1NJXA 2YV0X 3BGRA 4KV8A 5FDLA 1C1CA 4I2QA 5J2QA 3V6DA 3S3NA 4IKFA 3TAFA 3NHGA 3M8SA 4MQ3A 3PV8A 4BWMA 4RW6A 3RMAA 4B3OA 2W42A 1KRPA 3TWHA 1NK9A 3O4QA 1RT5A 3G0ZA 1CZ9A 5HRPA 3SYZA 3M8RA 3L2RA 3NF9A 2G8FA 3VQ5A 1NKBA 4ICLA 1FKPA 1GOBA 3SUPA 3QO9A 3SPZA 4F8RA 3S9HA 4B9MA 3KLHA 3LWLA 1EXQA 5HP1A 1WSIA 1CLQA 1TL1A 5EU7A 3DRSA 4O4GA 3OYDA 1HMVA 1IG9A 4JS4A 2PYLA 4W5QA 3KTQA 1UA1A 2Z1JA 3LPTA 1S1UA 2YNHA 1KVAA 3LP1A 2ETJA 1D9DA 3L3VA 3EYZA 4DTMA 3VQCA 1A5WA 2I5JA 3RWUA 4F3TA 2JGUA 4CJVA 2YNFA 4CF2A 4W5RA 4NCAA 4CHNA 2D0CA 4DTRA 3SQ0A 3QETA 4FJKA 3AO5A 4OVLA 3ZSVA 3I0SA 4NYFA 1YTAA 3HP9A 3AA5X 4FJXA 3QNNA 4N76A
chains in the Genus database with same CATH superfamily
3DMJA 3KJVA 2Y30A 3E9LA 3BG9A 1GOAA 3GBGA 2JVHA 3FX3A 4ZZLA 2XO7A 4ELVA 3RSEB 2VCPA 4RG8A 2A40A 4LFAK 1A6QA 3TAQA 3FXLA 3WHCA 1J7KA 2ZNZA 3M5RA 4NNJA 4OOIA 2GIVA 2L7ZA 2CQQA 2CUFA 2EX3A 1QVFM 1NMNA 4MGRA 3C18A 4C30A 3W3DA 1QHGA 3PO5A 2BY3A 2LF8A 1KLMA 5EY4A 5K5RA 4M45A 1KVCA 3ERMA 3G71I 4KTQA 3BG5A 3K4MA 4CFDA 1VQ6I 3ZRGA 3IRRA 5DEQA 5AIQA 3WGGA 1TWCJ 1HF0A 3QB0A 3TKYA 2KJCA 4H4MA 4DYCA 1MMNA 1QGPA 1IAWA 5J4YA 3DTIA 4FLVA 2L02A 4HG2A 3HOYJ 1POGA 1Z67A 3JRAA 1R9TJ 3HZ6A 3OL3A 3P38A 2X48A 4EM0B 2OPPA 2IAIA 4ZYGA 4G1QA 2IT0A 2F4MB 5M1FA 1VQ8I 1W7AA 2GUIA 3K5LA 3FZMA 1FK9A 1D1CA 4XNFA 4FE7A 4WXHA 3SFZA 5AQWA 1MMAA 1J5YA 2JA8J 2ID3A 3SQ1A 1MDMA 3RTVA 4CIFA 3HOWJ 1JKHA 3ABKH 1JI8A 3MZ8A 3MFKA 1MWMA 4FM2A 2NZTA 1ZYRF 2QYOA 4CESA 3H35A 2ZXJA 1KGSA 2YX4A 2R7QA 2XY8A 1RTDA 4A12A 4IFVA 1LFPA 1UA0A 5EZGA 3RKXA 2TDXA 4Z4FA 1VSKA 3L1PA 2FC0A 2ZE2A 3WUHA 1Z77A 2D5RA 5JI6A 2STTA 3L9FA 2PZSA 3ID6A 5C15A 3GTJJ 3OMYA 4PL8A 4DTJA 4M3RA 1EETA 5K1YA 2BOLA 3U1DA 5C3EJ 1HPZA 4LB6B 4CEDA 3DV8A 4GY2B 2O4IA 3V1OA 3UR3C 3CFOA 2CH0A 4A3JJ 1BM9A 1HNXK 2XUBA 4K25A 4XOPA 4D0PA 1D8YA 4H8KA 2Y1JA 1KAZA 1LAWA 3FFIA 4KICA 3CIPA 1XMAA 1G4DA 2XKPA 1RNLA 2MD0A 2K9MA 3OYHA 1S5LC 3QIPA 3W6KB 1C1AA 1X4PA 3VFZA 4X1EA 4MLOA 1XG1A 3GTPJ 2G8HA 3H1VX 2F48A 1GV5A 3AG4H 3WEEB 4FJNA 1XSXA 3QWLA 4B1VA 3HSEA 2VQHA 5AQYA 4AHTA 4CZGA 1R36A 2E1OA 1XMQK 1FJLA 3GFMA 2HQNA 2J5OA 1ZYQA 3QFUA 1QTMA 1FMVA 2ZMEC 2PFUA 4C2TA 3AVAA 1Q8IA 4ZDLA 4L9TA 3AVGA 4CEEA 4AVPA 1KQ9A 2XASA 4YIFA 1S29A 3I56I 2L01A 5AFUH 2VKVA 4CEQA 2XGCA 1NM1A 2DOAA 4XLPF 5F0HA 2LSNA 3R6MA 5JS1A 2ECBA 3LL3A 2PJPA 3LZJA 4LLGF 5LGTA 1FC3A 2P0WA 4B9SA 1KZHA 3V81A 4JKAA 3LSRA 2A68F 5JHUA 5EVZA 1MBHA 3BF3A 4E1MA 3E9PA 4RAZA 3A4CA 2ZXIA 4F4KA 3KZZA 4CJ5A 3ZMTA 3R8EA 3WXIA 2HHVA 2ASMA 5JICA 1YXQA 5E3LA 2DMPA 2NXNB 4RW6A 4DYQA 1NK9A 4UVAA 3O4QA 3M1CA 2ME0A 3WG9A 4ESBA 3SUPA 3A03A 3S9HA 3R0AA 2I7NA 4H4KC 3QDKA 2XPUA 1WJ5A 4BC3A 2K5CA 1TZLA 1D0YA 1IBLK 2AA4A 2R93J 3WEEA 1BA1A 4DTRA 3AFHA 5B5EC 1ZBHA 1RC9A 2M0CA 3ZP5A 5J3LA 2DMTA 3HVTA 4XLFA 5K5OA 5AQNA 4DTPA 2WOMA 2A07F 4DV5K 4GV6A 1E3MA 3GTGJ 3HB9A 3H9GA 2LTPA 1MKMA 3MWMA 4JHDA 2EV0A 3ML6A 3CJCA 5JR3A 1W0UA 2KFZA 4HNVA 2OJED 1H88C 4FW1A 1KQ0A 3VQQA 3F8BA 3LQRA 5IOYA 4LFBK 2BE2A 1JUMA 3MN9A 2NVUB 4XH5A 3LAKA 4BR2A 1I6HJ 1IN8A 1FBQA 2XDVA 2WAFA 5L3EA 3WQUA 3QINA 1CZBA 3AG3H 3FKIJ 4NLBA 2JQ7A 3HC7A 2EH3A 2CFOA 1QSSA 1B92A 4E7JA 2YX6A 4KTZA 3PUBA 5AQQA 4CCLA 1V55H 2OPSA 4JI7K 2L7MP 3SQ2A 2UUZA 1BW6A 4PQUA 1FT9A 1ZTRA 2OYQA 3RI4A 5K7FA 2LK2A 4O44A 1E3HA 2EB7A 2WB1A 3DPTA 2WWYA 3SXYA 3VQ6A 3CO6C 4FOEA 3KVGA 4PK4A 4GVEA 2YJFA 3TR8A 4FLYA 1RTIA 3FWEA 3GFLA 3ZEUB 1S1TA 3OSFA 4H03B 1WI9A 4LC9B 1JKOC 2L0KA 1AOYA 2HOAA 4HV6A 1PUEE 4OJRA 1JLGA 2GOXB 2VGMA 1MD0A 3WU0A 2E2NA 4R1HA 4OPKA 1AA7A 2YS9A 2HOEA 1IDZA 4M72A 2KQ2A 3S2HJ 4S04A 1D5AA 3QEIA 2P9PB 2PMZA 4LH5A 3ISNC 3E6DA 4BHPA 3TTFA 2G8WA 1QHAA 1WH7A 3S3OA 4FWKA 2HZDA 2ZBKA 3KHYA 4CZKA 5FB2A 1USSA 2EIMH 5KK1A 3RR8A 1X4OA 4YY3K 1RPWA 2EV5A 3BR5A 2KFDA 2QGUA 4M41A 1U45A 2UZKA 1GXPA 2ZMEA 5FFZA 4FTHA 4CJPA 3LA3A 2XSDC 2W6LA 1Y1WJ 4FZZA 1P7JA 2JPCA 3VYUB 1HLUA 3O5BA 2HZTA 4UQGA 2LYCA 3HXMA 3MN2A 4IG0A 1NKEA 4UHTA 3E7LA 3IAYA 1TQPA 1S5JA 4BR4A 1O3SA 3OW2M 3ZX2A 1HKBA 1TGOA 4FL9A 3CJAA 3LM9A 2JSCA 2JZYA 1KU9A 3LSMA 3FXJA 4FO0A 1I39A 1KSPA 3VTIA 5GADP 3ZEUA 5ICEA 2XPWA 4ASNA 1STZA 2YKMA 4CBXA 2BHZA 3R61A 4DV2K 5LRSA 1RBTA 5A2QZ 2HMIA 4G6DA 4ELTA 1TKDA 4CE9A 3NAUA 4BKXA 2EA2A 1OCRH 2VKEA 3FLCO 5IYDJ 1KAXA 2Y48A 3U6FA 1OVYA 1S6QA 3MMYB 1S9GA 4HX8A 1I27A 1T7PA 1EP4A 3CDHA 2P9PA 1I50J 4KMUX 4AD9A 4A3GJ 4KFBA 2WY7Q 2QA4N 4YOTA 3SAHA 3I4MJ 4DG1A 3WG7H 3DBLB 3FKJA 2EPFA 4WK8F 1S3JA 2O61A 2V9PA 4A93J 5EYRA 2VE9A 2KPMA 5D4SA 1S3XA 1BBYA 4NB4A 1LCUA 3SEZA 3JTHA 3EEQA 1WSFA 2YKNA 2HF3A 3TDUC 3IMXA 2X6YA 3W2WA 3NHGA 3M8SA 4BWMA 3FBNB 2WB1N 5E26A 4YRVA 3SLCA 4NQWA 1FIAA 1HA8A 4KITB 3E6CC 1CLQA 3G2BA 4J01A 2JA2A 3OYDA 1KU3A 5M5WJ 2WV1A 4J19A 2D0CA 1M1EB 1K9MO 3KYCB 1SFXA 3QMLA 4M6XA 1L3LA 2NLXA 1JLCA 3JRBA 5LHHA 3DXKA 4CICA 2FRHA 3X2QH 3AVKA 3CQZJ 3PX6A 2VOPA 4CJUA 3M4OJ 4RAFA 4A6DA 4QAGA 3RCOA 3ENOA 3FFKB 5ADXA 1N5YA 3IAS2 2PMZN 2MABA 3TP3A 4MDAA 3P31A 4H0EA 3ZQGA 4KHNA 2W40A 3U9DA 1G3YA 3S8PA 4ZC3A 3BZ6A 4NCGA 4KH4A 3FHNA 1MSEC 2DQRA 4Z6YA 2R92J 3NGYA 3ZSOA 1BISA 5FRNA 2ZGYA 2ZJPL 2BH1A 1VQ4N 2RDPA 1K4SA 2ZGZA 5HLIA 5CVIA 3K70D 5LEJA 4HCCA 2Z2SB 2O7OA 5AQHA 2Q3SA 4MTDA 2LKPA 3FZHA 5TKWA 4UB6C 3WTTC 1C0MA 1HNVA 3MEGA 3IH3A 4W5OA 2Y9ZA 5EGOA 1BJAA 5BPDA 2A69F 5BR8K 3MXMA 2XAUA 1X58A 2KKZA 4M3YA 2NVTJ 2A5YB 5ILSA 1ASUA 3IRXA 4JAXA 4ZDOA 1JL2A 1RDAA 2KRCA 4FOIA 1IDYA 2MG4A 4WQ5C 3RRGA 1SFKA 1FTZA 1QSLA 1BW5A 2CYYA 3SUOA 2FUG2 2W1OA 3LFKA 3K7AJ 1ZKGA 3R6SA 3ULEA 2JA5J 2K3PA 1FP1D 4CJKA 3J80K 3D5RC 4KKOA 4LLNA 1ETOA 1G59A 3F8MA 4IEJA 3DEUA 2JA6J 2ITGA 1K8AO 1X3MA 1UOCA 2QK9A 4FZXC 3ZSYA 3AVCA 1VQKN 1Q7YO 1UWBA 4XK4A 3ZMDA 4IZ9A 2P9UB 3F8FA 3DLLL 2JRTA 2LD5A 4KN4X 3O3FA 3IKTA 1DEJA 4A0ZA 1WFXA 3C2HA 2H27A 3JSOA 1JLBA 1SAZA 4KHSA 3K1NA 4BRIA 2HEOA 5D6FA 3MN6A 3VQ4A 3LNQA 4IEEA 5E41A 4PUSA 2QWPA 5KHDA 1SUQA 2KTQA 3C65A 4J8FA 4FJJA 4CZFA 3MXJA 1BI0A 3TSQA 2VG7A 4A3EJ 5M1PA 3P9CA 4A3CJ 2IS1A 4NXMK 4WXDA 3VEWA 4HSRA 1ZQ3P 3M8PA 2O8DA 2AQEA 4G7HF 4M3TA 4OWRB 3EDPA 3LM2A 1JCGA 1TVRA 1T6CA 3B6PA 3TGNA 1WWXA 3OIQA 2VC1A 5D4RA 4UUVA 4CECA 5L3FA 3NDKA 3E9OA 5DCMB 1DDNA 3V7SA 1SFOJ 1UG2A 3LANA 2ZJQL 3DLGA 2FBKA 1ODDA 2AP1A 4FLXA 4BY9C 3K57A 3T1BA 1EA3A 3HSTB 1IKVA 1HDPA 4UUTA 3KP7A 2YNGA 4OX9K 3QICA 2X6OA 1SD4A 2RV8A 1Y39A 3LDLA 3S2DJ 5IT9O 1TV6A 2FF6A 3PX4A 3ZCMA 4FJ9A 3TSPA 2C6YA 2PEXA 4OMYA 4A3IJ 3BTLA 1D5YA 2P9UA 1PUFB 4BEHA 3Q3SA 5F08A 3ABLH 1UG0A 4MFBA 2DTZA 5BPMA 1QZ6A 3MXIA 1FOYA 2ESHA 3FM3A 2Y2ZA 4CZEA 3CC4N 5LY3A 4XOTA 2B63J 1JL1A 1WBDA 2ZNYA 4IZZA 3G3ZA 3QEWA 2P6TA 2IIRA 4AILC 1W7PB 4MTEA 4Q5VA 1W36D 4X0GA 4C3HJ 3N4MA 1R58A 3PV8A 1JCEA 1TTYA 3RMAA 1H9TA 2A6AA 3KK7A 3G0ZA 5BRDA 3MX2A 3RQIA 1GOBA 4CZLA 3SPZA 1TL1A 4O4GA 4BGBA 4AIDA 3LPTA 3O9TA 3KWGA 3TBIA 4DTMA 1T08B 3DWLE 3SQ0A 4OVLA 1ULYA 3CJRB 4M3FA 1J59A 2FMYA 2LY9A 1OFCX 1K79A 2E2HJ 3CYMA 3NBPA 4KPYA 3D0PA 1YW8A 3O1BA 4XLEA 2WBNA 3E0JB 1M90O 2BGCA 3WTYC 3WNEA 3FISA 3SJHA 4ENNA 1YS7A 3S32A 2XB0X 5KI6A 1B72B 2JSPA 3EPZA 3THWA 1O3RA 4J2DA 4DLGA 2PI0A 4PJNA 4N9IA 5EXWA 3QIOA 1KD1O 3F9KA 1WNSA 3PL8A 3A5NC 3K4JA 2W4SA 1NOYA 2QKMB 3QP6A 4WQ5A 5L3BA 1PUFA 3A2FA 4WF2A 4A2BA 2D1VA 3K5MA 4TSXA 3ATUA 4ISFA 2F5EA 1E4GT 2GA1A 4OAYA 4PL7A 3GUDA 4D7NA 2ZKZA 3F6VA 5LMUK 2FU4A 3C2BA 4IBNA 2VOOA 5ILVA 3EUHC 1TYQB 2WBMA 1NU0A 3MEDA 1PDNC 1FOKA 4FXDA 4OLAA 2OA8A 3ZT4A 5AQIA 4F91B 1KTQA 1PVEA 1TQMA 5DD8A 4CHQA 1HNIA 1X3ZB 2H94A 4MLHA 1Q1VA 5FROA 3K70C 1ONVA 4FWRA 3RIRA 2QA4I 3OYAA 1DKGD 3E6MA 2TRTA 3CCSN 1NK6A 4BROA 1VQ7N 4CGHA 1WVRA 1A5XA 1R1TA 5KGXA 5IWAK 1SS6A 3RYRA 3VQDA 4F3OA 1YIJN 1RT7A 3MEEA 4PKGA 3RPUD 3O1WA 2NRRA 5GIPA 2IGMA 2CGJA 4BRDA 3H3UA 3V4IA 3Q7CA 4GXOA 4FVUA 1B72A 2P1JA 1N25A 1ZGWA 1RILA 2E34A 2OTLN 1TK5A 1MMGA 4CF1A 4YIIA 3SZPA 1RKTA 4CUGA 2VODA 1H1VA 1NJZA 4RAYA 4P1WA 1NGEA 4CGIA 5DV5A 3CPWM 2G8KA 1X1AA 2RHKA 3HBLA 3J80O 1HUXA 2W84A 4KHPK 4NC8A 4K8XA 5CYMA 1R5ID 4XLNF 3ZT0A 5F0FA 3DYAA 4EP5A 2IGKA 3AVIA 1NGFA 2HKXA 3CC7N 3BQZA 1L0OC 4DR5K 4I6MB 3CESA 3CCUN 3P39A 1XC9A 3MAJA 5FLXZ 1LDDA 1LFUP 4B9TA 2HW3A 2KDZA 3VPZA 4B3SK 2FSJA 3I59B 4L8RB 1UCRA 4CGDA 4M3XA 2VB6A 2HVRA 4DR6K 3DXMB 1BG3A 5GIOA 4AM6A 2R7XA 4RGUA 4WQ4C 1VQ4I 3L4QA 4AHCA 4KI4A 2GXGA 3IWFA 3L2UA 3MECA 4LD0A 2M8GX 1Q1HA 4DGWB 4JYAK 2M1BA 4EVIA 5FD5A 1BI1A 5HROA 3GXOA 1JXEA 5IYBJ 4Y7NJ 3S16J 3VERA 3DTKA 4B3AA 1E3OC 3K9TA 3HOTA 3UB5A 4WCGA 1WZ2A 2DXIA 3C3WA 1KCFA 1XUPO 2Q0RA 1RDUA 3U4LA 1T95A 2E7XA 4I9LA 4BYYA 2YCHA 2A3ZA 6PAXA 1NWKA 4RLFA 3IUOA 1QZ5A 1P6RA 3T8RA 1YUWA 1O3TA 3AG1H 4S05A 1MGTA 1LB2A 4XONA 4FQGA 1WSJA 5J2MA 1ATSA 3LSIA 4ENKA 1IG7A 4V19K 3BWGA 1GLFO 4B1ZA 4RW7A 4I6MA 4PJLA 5FLVA 4A3BJ 2BTFA 4CCHA 1RUNA 3JAMZ 5J6XA 3QRFF 3GZ5A 3ZOBA 4PFOA 1VQKI 2FX0A 4A3FJ 3CTAA 3RSNA 2R3SA 4BRKA 2OU2A 1T6DA 2L5QA 5BMZA 1W36C 1JJ8C 2VPRA 1NK3P 4YFUA 2BXZA 2CV2A 4PJMA 2XF5A 3KLGA 1CXUA 5J8FA 4WXCA 4YOYA 4W5TA 3V42A 4JYKA 5AQGA 3C6TA 4JD2A 4CH7A 2D45A 4FT8A 2WC2A 2OPRA 1WJCA 3ZSZA 2HDWA 3QPSA 1SKWA 2PG4A 2HHTA 5J40A 4QLCU 2O8XA 3ELKA 4JRQA 4XSXF 4NBQA 1C0TA 2CQXA 2BVLA 2ZFWA 1A5JA 5J2PA 4JS5A 4XN0A 1SVMA 1T03A 4H4OA 2W41A 1K78B 3PO2J 5HRNA 4JI4K 4KN7X 2LOOA 5KTQA 1IN6A 4HA8A 5KRTA 5HS8A 1E0EA 2QSFX 3Q5FA 2VWKA 1NMDA 1N36K 4LG3A 3H3VK 4UXNA 3H9JA 3M8JA 2IAJA 3R9PA 3DXJF 4HDUA 2OANA 1U4BA 3ZCOA 4OINF 2A5XA 2VL8A 1K8KB 3TAEA 5KCMA 2P81A 3K4BA 4BS9A 4BC4A 3BTJA 3ESWB 5B1AH 1ZG5A 1N32K 4EGYA 2XF7A 1ZBUA 2IGOA 3C95A 1NLVA 2DFHA 3FK6A 4DV6K 2QW9A 3F72A 4MIMA 1JUPA 1LDJA 2Z16A 1MJBA 4G6QA 2W24A 2QWQA 3CC4I 4C2UA 3OBYA 3SBTA 5D5XB 2DJIA 1TKTA 1K7AA 2RF2A 1LEAA 3HPGA 2GBYA 5C44J 3DRRA 5M1NA 1TUUA 1IO2A 2KLAA 3AAFA 2K9LA 3KLIA 1FEXA 4XRFA 1TWAJ 4MEYF 3WE2A 2OZMA 5H6QA 3S1QJ 5JLHA 1QO0D 3V8LA 2F6CA 3PIOF 3CXCM 1MBKA 3HUGA 1K78A 4G94A 1WB9A 1W9HA 2FBXA 1Q9YA 3REOA 3IKVA 2NOJB 4KMFA 4WQ4A 2K9QA 3F8NA 3AO2A 2X6WA 3AG2H 3H3NO 1TT5B 5JLXA 2L54A 4HQEA 4A3KJ 4CERA 4MLEA 3HO1A 4B47A 1DGKN 2HVQA 2CUEA 2KRFA 2CG4A 3QBXA 4NHJA 2E5NA 1IV0A 2O8CB 1K8KA 3BG6A 3H08A 3GEZA 1QZEA 2DODA 2UXNA 3BR1A 1CZAN 2HGCA 5ICFA 1IW7F 3HSFA 4M3EA 2FNAA 2R4GA 2KZVA 3QEPA 2KJBA 2IS3A 1GLBG 3LDNA 3HGGA 3O8MA 2MH9A 4M6YA 4II3A 1GLJO 3WTUC 2V7ZA 2FD5A 1LE8B 3QYFA 3D5LA 1UHWA 1NGHA 3EKSA 5F1JA 3HXLA 3LFUA 3CERA 2HXOA 5AJ3K 1QVGM 2HS5A 2HBLA 3BDPA 1WRJA 3OS0A 1BIAA 1DP7P 5HODA 2ASOA 4B43A 3NARA 1FP2A 1R22A 2LKXA 3DLLF 3F21A 2F96A 2DA5A 4A62A 1YAGA 3A02A 1WBBA 4DTNA 3CCSI 2QSHX 4YFXF 1VHXA 2W25A 5SWMA 2DFEA 2OC6A 1V54H 1VQ7I 4M3BA 1BIBA 1VSHA 3V7CA 1YIJI 4JI3K 1T8IA 1IG8A 3MWTA 1HKSA 1B8IB 2CV0A 1T6SA 1HQCA 2LP0A 3TPQA 5J2QA 2EIJH 2O8CA 4IJNA 1MNMC 4MQ3A 3ONQA 3B6CA 1KRPA 4HDVA 2OTLI 3THXB 1HKCA 1C0WA 3VMFB 2LSOA 3I64A 2AQFA 2F9TA 1HMVA 3WTZA 3PQJA 2EBIA 2P9SB 4ZYDA 1C0GA 2OBPA 4D5CA 2BBYA 3ZSVA 3S1MJ 1V4TA 1NK0A 5M5YJ 1JKQC 3EUKL 3D0SA 1VRTA 1LE8A 2FLOA 3CM5A 3CC7I 2JT1A 3VQEA 5GPAA 3CCUI 1VI0A 2D1KA 3I53A 1S1XA 4BJ6C 3AO1A 4L18B 4DUYK 1RCHA 2GWKA 2YI1A 5D3GA 4CVNE 3GLLA 3LDQA 4XRMA 1YLFA 4MFDA 2Y1IA 4I2PA 4JLHA 4A5AA 5DM6L 2D0OA 3QPHA 2IRFG 2Y0MA 1QZYA 1GT0C 5JLWA 2HPMA 1S9EA 3BEXA 4J2EA 2HHXA 3FXRA 4GYIA 1KU2A 3L3UA 2FBTA 3D6RA 2I10A 2LRDA 4JRPA 1VSMA 3OSGA 4YFNF 1KVBA 4BRAA 1BI3A 4V19S 5AQSA 2Y0SA 2R5YB 3MK6A 4Z4HA 4Z2YA 2ELHA 4FZYA 1B8IA 2QKKA 3JSPA 3JR9A 3M1FA 2X6NA 3P4IA 2CGPA 4O6JA 1IC8A 4IO8A 3VF4A 4F3QA 3RPUA 1GLLO 3LSHA 5I3UA 2H09A 2DQLA 2B9SA 4ITVA 2UXXA 5JVGL 2PY5A 2G8VA 5ADXH 2QWMA 2B5JA 5HLGA 1GV2A 4CW7B 4CJ3A 4CJRA 2V1NA 1P92A 2OD5A 4AC0A 1MBGA 2FA5A 3G1LA 2CSOA 2PFBA 2ASPA 3MEXA 4YOVA 2W00A 4U7DA 2NYXA 4IHYA 4XIUA 4OPAA 2WAQN 1QHHD 3OOUA 4G8XA 1Q18A 1N75A 4HNTA 3RPQA 3UNGC 4J2AA 2RVCA 3SUQA 3JSMA 3IV5A 1DLOA 3R60A 4PJ0C 3KEQA 2K9NA 3HOZJ 3LA2A 1G6NA 2Z99A 4HRIA 3CFRA 3O08A 4FE4A 5CY4A 4DSKA 4EM2A 2CH6A 1VSDA 4LH4A 3RJPA 1K73O 4XRSG 4IL6C 1TLHB 3VTHA 3K0SA 2MBFA 3SYTA 4DFMA 3OYCA 5FD6A 4BVPA 1RBRA 4B1RA 3OYJA 2MA3A 5EOYA 2QEXN 2CH5A 1YVNA 3D5SC 3CCMI 1U04A 1HSJA 2VUMJ 2R5YA 2KT0A 2QQBA 4BNCA 3PQKA 1FBSA 3NRVA 4M71A 1ZN2A 2XROA 2R0QC 4JKGA 4JI8K 1HDDC 4FVMA 2ICWG 1JKRC 3ZGKA 2O3FA 5CVRA 1DU6A 4E3SA 4GFBA 3HBTA 1G8XA 3TTCA 3OYLA 3M8QA 4O0IA 2O03A 3IWZA 1OH8A 2RAEA 1JJ6C 2NRWA 3ENBA 2KKOA 2I7PA 4IHTA 4HF0A 1GVJA 4PZJA 3ZSQA 1ZH5A 2V7YA 4ILHA 2G0EA 2FJ1A 4M9ZA 3AV9A 3H1CA 1T8EA 1F9NA 3MCPA 4E7ZA 3OYNA 4Z0UA 3V1QA 4K0KK 2KZGA 1YQAA 1IRZA 3FXQA 3VYRB 3J7ZI 1IN7A 2HNYA 3W6VA 3KPHA 1S72N 5L3DA 2PBIA 4DS5A 3THYA 4GKJK 2ACJA 4C3IJ 5FJ8J 3VEXA 4ILGB 5DYMA 5IOZA 5E1WA 3EZWA 1NBWA 4G12A 4X65K 3MKWB 1ASWA 4N41A 1SV5A 3H92A 3RDIA 3TEDA 4RDUA 4M42A 2M4GA 4PGGA 3ZYYX 5T7BA 3LSTA 2GTDA 4HF2A 2Y0SN 3TL4X 1LKXA 3QU3A 4OU0A 2CW8A 1YS6A 1ESVA 1NJIO 2V4JC 1HNWK 2GXBA 1HCRA 4LF6K 1W1WE 1RT6A 4HW0A 1NJXA 3S3NA 1Q82O 4DQ2A 2QSGX 2W42A 3TWHA 3CD6I 3AGKA 2OQGA 5HRPA 1I5ZA 3FGUA 1V4SA 1LNWA 2DPUA 3QO9A 1T38A 4F8RA 5JLFA 5I9EB 1OLTA 2PYLA 3HJFA 2KL4A 4W5QA 4AIKA 2Z1JA 3T1YK 1P4AA 3EYZA 2V79A 4FX4A 1W0TA 3WTXC 3A2KA 2Q36A 2QUFA 3FXOA 2DA1A 1C1BA 2BY2A 1ETYA 4BJ5C 3SFIA 3VQ9A 2VQLA 4IHVA 5FPMA 2DOEA 5B66C 3NQOA 3M1EA 4XKBA 1PP7U 4KDPA 2DFFA 2XY7A 3OYGA 3L2QA 4NLCA 2KFNA 1Q81O 2EFNA 4DSJA 4JQFA 2CS3A 4JBAA 1Z6RA 1OISA 3D1NI 1TK0A 3ISPA 1P8ZA 1XDUA 4RW4A 1YX3A 4M3GA 3WXMB 3HVRA 4C9YA 1D8JA 3SDGA 2ISYA 4HBLA 3EKUA 1A31A 2X6XA 1YRNB 4HTLA 4CYDA 5KNLA 4N9HA 4PCQA 4FPBA 3I4PA 3BPVA 3K5NA 2NOGA 4Y13A 5KGWA 3W0LA 4DV4K 1BIUA 1RT1A 2O8EB 3CCLN 3AVBA 3H36A 2PMHA 2FQ4A 5TISC 3CI5A 2P5OA 1SANA 3M07A 3I5UA 1XSDA 3KE2A 5AQMA 2ZD1A 1UZCA 2QQAA 5GAEJ 1LW0A 3DAWA 2MC3A 4BXUA 5CZ2A 3CG7A 3HL8A 1IZ1A 2B7EA 3K4CA 3ZR8X 1BJZA 2H1LA 1WUAA 4Z4EA 4OIPF 5HNFA 2COMA 3A0BC 3ZT3A 4CBUA 1JGSA 2VONA 5BRFA 5IP9J 3I55N 4G6TB 5L3CA 2GLOA 1GHCA 1XS9A 4I98B 4M74A 3ERED 2A41A 4ZYHA 4BRMA 4LF4K 3E66A 4PFPA 4JKHA 2R7SA 2KIUA 1XMXA 2RQPA 2A6EF 4E0DA 3VQ7A 1OH7A 4LG0A 3SEQA 1Y56A 1MW7A 3ULDA 3PX0A 3EQLF 3DLBA 4CEOA 4X64K 3HOUJ 2DA4A 1KFDA 3ECHA 4R79A 4AUXA 5AQOA 4HTUA 3SQNA 1IJJA 2V9VA 3RYPA 3CMMA 3ZMVA 3ASMA 3CCVN 2PMUA 2IVPA 3D7EO 1YG2A 1HQUA 4BRNA 5C42A 1QPIA 3ZT2A 4IHSA 2DLLA 1LAVA 1R4NB 2VGNA 2O8EA 2OCCH 3SDBA 2CUZA 3WXKA 3HOXJ 1D1AA 5C4JJ 2EWNA 1Z05A 5CYVA 5M5XJ 2QTDA 1WQ2A 1AKHA 3VGKA 4IOAL 1KQ8A 1NG7A 2BHYA 3HEFA 4N4NB 1RBSA 5J47A 4O8UA 3SQ4A 1NJWA 1JLEA 1O7FA 3ENHA 4IG3A 1GLCG 3RRHA 4XRSA 4RA2A 5TRDA 1K6YA 2OZUA 1EWQA 3C7JA 1MDMB 3R1XA 4PY5A 3GFJA 3T3FA 4C3JJ 3HTSB 1J9AA 2CO5A 4IXCA 1UB9A 3L8BA 5LHIA 3MN5A 4F92B 4CFAA 4XR6A 1HPMA 4CF9A 4Y0WA 4KHQA 4WF9L 5BS6A 1S22A 4B44A 1D0XA 3K2PA 2VLAA 2O8BA 2YHAA 3LWFA 3VEZA 3DOKA 1SAUA 4DTXA 1YX5A 2E1ZA 4E70A 1ITGA 2O8FB 3Q9VA 4BR7A 3WTSC 4DYRA 4LF5K 1Z26A 4QS9A 2LMDA 4FWNA 2P9IA 3K10A 1I94K 2F4OB 1PJRA 2DN0A 4A5MA 3D45A 3GOIA 3JS6A 3OYFA 4EATA 4RM2A 1HYVA 4M3WA 1XSVA 3DBHB 5KVRA 4FLWA 4DU3A 3L00A 2QI2A 2QM1A 5LBQA 2HKOA 3TO9A 4I6ZA 4IQJA 3FM5A 2MYSA 4DSLA 2FXAA 4KFCA 4I76A 1WPKA 1CZ9A 3BTCA 1ZRFA 4WFAL 2VI6A 4JS4A 1EO1A 2F2EA 4CGZA 2I5JA 2JGUA 4W5RA 1IRGA 1YTAA 2QEXI 4U0VA 3I0RA 4EAHD 4DNCA 2HYGD 1L3VA 4KH6A 4JV5K 2E7WA 3KLEA 3CZ6A 4BH9A 4B9LA 3DF8A 2V6EA 2XAHA 3H0DA 3RQ4A 1WKMA 1BI4B 3CCYA 4DQ8A 1XTAA 4N0BA 2F8TA 1Z3XA 4FW2A 3M6GA 2DA2A 2XRIA 4BU2A 2IVNA 5D6EA 4OIOF 1U0JA 1H89C 2DY4A 4TV7A 1G2HA 3CHWA 4DFJA 3O3GA 3ZMUA 1U3EM 2KP6A 4LF9K 4H5NA 1QA6A 1VSIA 3H9QA 3CJ7A 1SVOA 4BRQA 2O8FA 2L2OA 1PYVA 2HQ5A 4ESJA 1CF7A 1MBJA 3CFPA 4WWCA 3LP3A 4M9XA 1XCVA 2X1CA 2UU9K 4DF8A 2XKOA 5D5VB 3VGLA 3CQ8A 1ZG1A 1L3SA 3VQBA 1P2FA 2IA1A 3C7NA 2O5RA 1QQOA 3NH1A 5C12A 2A5WA 1G3WA 1T98A 4FWMA 4GKKK 4BC2A 4BC5A 2VQGA 5C2DA 1U8RA 1O7LA 4WCEL 3WE3A 1S72I 2E6MA 4IRHA 3S3MA 1OCOH 3LA7A 2V26A 2ADUA 4IQ4A 3TANA 1VQ9N 1C6VA 2K4BA 3HYFA 1HXDA 3G10A 3UKRA 4BQLA 4AHRA 1U47A 3S17J 2PN6A 3A5LC 2VWJA 4KISA 3K2AA 3BJOA 1R4MB 1SD5A 4NB5A 2J5PA 1J6ZA 2R7VA 2RPIA 2LY1A 3CP2A 2WV0A 2GZWA 4CHZA 2V52B 1ETWA 1BI4A 1SAXA 2H1KA 4FSVA 3H6EA 2HVIA 4YHHK 1FKOA 3NGIA 5JMVA 3DI6A 4Q0BA 1MBFA 1FTTA 4N56A 3CLOA 1BWFO 4JHDB 3FDYA 4DCHA 4M3ZA 4E7KA 3IL2A 5MLCQ 3FF5A 2P5LC 3S1NJ 2FBYA 1WN7A 3QERA 1YJNN 4U7BA 2MLKA 1MA9B 4DV1K 1JT6A 2XHBA 1KC8O 1HC8A 1MDUB 4JKDA 3OY9A 2UUCK 1I6XA 1O4XA 4A6EA 2WC9A 1K83J 4FWLA 3K0LA 2E1CA 2WA0A 3T1AA 3BOQA 3EY1A 2MSYA 3HOSA 4FJLA 3GTMJ 3KEYA 1QPMA 1QZZA 1LUJB 2J4RA 1XHXA 1S1WA 2DO7A 4XLCA 3TI0A 4OIRF 4B4CA 4W5NA 2HPIA 2VG6A 1WCMJ 1NK7A 3NVKA 3VDXA 2LH9A 3CJ1A 1YYVA 4JK1X 5M1OA 2Y9YA 5FKKA 1LQ1A 1ITYA 1IH7A 2HQAA 2YJEA 1R23A 3DKWA 3DQVC 5DDGA 1HQEA 1XGNA 2D5VA 2EWSA 4IRIA 1ERDA 3GL1A 1ORKA 1IKWA 4PKHA 4FJ5A 1Y97A 1MH3A 3NVMA 1V5GA 2A6TA 2HNDA 1NK8A 1NGBA 5HS9A 5DM7L 3TAPA 4IDKA 3OVNA 3N05A 3HGYA 3CCLI 3F9MA 4H0PA 4ESFA 3NGZA 2GBZA 1A5VA 4CEFA 2RREA 4A57A 2XVCA 1GVDA 2P9NB 4MO5A 2IPQX 3WU1B 4BQZA 3ZMSA 2HBKA 2F5FA 2ESNA 4A59A 2E5ZA 2UWMA 5KPTA 3HT3A 1U49A 2UXBK 4EV0A 2JUCA 2BEOA 2FOWA 1Z3YA 1D3YA 1W5TA 2V9KA 1RETA 5JVTA 3NF7A 4Q5SF 5FPEA 1YW7A 3NCIA 4CJQA 3HRMA 3EE9A 1IN5A 1C0UA 2ZMEB 4ENMA 2QKBA 3SK3A 4CJLA 1YTUA 4JN4A 3OR1C 3VSLA 1VQNN 2CMPA 2E35A 3J80Z 4CSWA 1X1BA 3TAFA 2E19A 3DU5A 4IHXA 1TC3C 4JKEA 3DBRB 1NKBA 2RGVA 3DKYA 3GMEA 2M5WA 4XORA 1VNDA 3CCRN 4AM7A 5E3NA 4JP0A 4PHTX 1IG9A 4ON0A 4F52A 4PJJA 4H5TA 1VQ5N 2ETJA 2L9VA 1A5WA 2HR3A 3QETA 4BQOA 1D0ZA 4KYWA 2WY8Q 2ISZA 3V7RA 3CQYA 4JX6A 1RT2A 3NH2A 2EZLA 1FSHA 1KYWA 2PJRA 1ENHA 4KBOA 3CCVI 5CHIA 2H8WA 3KIOA 1IGNA 3BF1A 2JPBA 5L3GA 3KYLA 5IYCJ 1XX5A 3COAC 3U9ZA 2E1NA 3CCQN 2X51A 4R5PA 4O3MA 1FLIA 3Q0WA 3EYYA 2P9NA 2VN2A 1RKWA 3GYHX 1AU7A 4C8MA 4KIFA 4M73A 4MNUA 2XY5A 2NRXA 2JWTA 1RFQA 3SUNA 1Y6IA 1IXCA 3CJ9A 4W97A 1V5FA 4OMZA 4YIRX 4A5NA 1HLVA 4BAYA 4AVZA 2IGIA 3P83D 4DFPA 4PWDA 1P4WA 2K86A 3PSFA 1Y1VJ 2CUJA 1WHUA 2ELJA 1KONA 3E01A 3RMDA 4B8AB 5LFAA 2OZ6A 2I8DA 1NGDA 1BCMA 4NQWB 4CFCA 4DMNA 2IVOA 3VEOA 1HKTA 3E5QA 1IKYA 3V1RA 1DP3A 3H46O 2ZXWH 5IT9K 4NDLA 3T5XA 4BDYA 2HHWA 2NUBA 1RNHA 5FPDA 2I5UA 5J1YA 3DXKB 4DU1A 3AVLA 5BOXA 2FBVA 1MWKA 2M9HA 3DTEA 1EH8A 1BN5A 2EQRA 3E6BA 1WJBA 4FJ7A 2EFWA 3TAGA 4XN3A 2P5KA 4ZDPA 4Y15A 5F0XA 1HW1A 2ZM6K 4FJHA 5GAGJ 3SZGA 1BUPA 5ILUA 2AJQA 2EV6A 1LFBA 3J8AA 4CHUA 4F93B 4O5FA 2N8GA 1TW3A 2GV9A 4L0YB 5FLXO 3IDHA 1JTYA 3ASNH 5CLSA 5CZ1A 4I0BA 1BA5A 2X0LA 1JXSA 1EX4A 2JWKA 3JREA 4BRCA 2EFQA 4GCVA 3H3ZA 2IEKA 2O9LA 3MDQA 4QSHA 4AWXB 2Y75A 3RKQA 4EFHA 3D2FA 4K41A 2HHSA 2Z1DA 2ZO4A 1NH3A 2Z1HA 5EGOB 4DZPA 1CQTA 2P5GA 3WT0A 1YFHA 3JRIA 4LD5A 1U5TC 4HNUA 4BG9A 3ZQCA 3KX2A 1Z7UA 1ZARA 1JUSA 4EGZA 3HK2A 5CVVA 3HPOA 2HHUA 4UY8I 2H6CA 4KO0A 4LSLA 1HW2A 1ZK8A 3JRFA 2IJLA 5GAEP 1P4XA 3M8FA 2MH2A 3ULEB 4E7SA 4PA1A 3EZ5A 1RT3A 4HEA2 1O57A 2A61A 1EKEA 2ATQA 5CJ9A 3VEYA 3HL2A 2PX9A 2WONA 1BL0A 3MAQA 4F2SA 1A36A 1XQSC 3CLQA 5HDKA 3PUFA 5E18F 3K4KA 5EF6A 4FJMA 4DUZK 2KZZA 5JFRA 2STWA 1VQ9I 3MX5A 1FYMA 1RTHA 1WSEA 3UIQA 4MO7A 3BTIA 1ETKA 3OYKA 4AHVA 3CETA 3IH2A 2E1YA 4IHWA 1J9IA 1WH5A 3W6JB 1U6ZA 3VOEA 4DS4A 3ABUA 5KAIC 2UYTA 3BUZB 2HHHK 1TT0A 2BANA 2HBJA 2EILH 4D7MA 4C1NI 5E17F 1MSFC 2YV0X 2PQ8A 4EM1A 1XC5A 3QPTA 2LREA 1RT5A 5BREA 5H2FC 2P9LA 3SYZA 2O8DB 4B9MA 3PLAA 3LWLA 1YJNI 1E4FT 4D1QA 1QBJA 1J09A 3KP2A 4IOAF 2XAGA 4YFKF 2YNFA 3MMVA 4FISA 3QNNA 5FFXA 4BE2A 1YVUA 4DBQA 2NNWA 1YOVB 3LALA 4HUFA 4BVOA 1R1VA 1FYLA 4DSIA 2BW3B 4IRGA 3VQPA 3A5OC 1VAZA 2H3GX 5CKTA 4L0ZB 4B9UA 3FMQA 1VTNC 3J7AO 1U5TB 1D8KA 5CQGA 5C24A 3KP4A 3LSPA 3ASOH 1H8AC 4CO8A 1REVA 3MZHA 3QBWA 4L9VA 4BEHB 5FKNA 2KQRA 4JX5A 2X9DA 3K58A 5M3MJ 3KZIC 2A42A 4GO1A 1HYSA 5B8HA 4M7YA 2GEMA 5FGMA 4KAZA 2NRAC 3JRCA 3I58A 1Y0NA 2GUPA 1IUYA 1ZRCA 2VJ5A 1R49A 3E1SA 3D2EB 3NH0A 3CCEN 1FWZA 4B08A 1VFCA 4YELA 4HSTA 3DOLA 3WTWC 4BRLA 1B4AA 4ENJA 1YE9A 2HMPA 1KU7A 1WAFA 4DTUA 4XEIA 4HX4A 4JOMA 5LL6Z 1ON1A 3PM1A 2JA7J 4NUBA 3PFYA 4HYEA 2R7RA 4H5WA 3OYBA 3QYEA 4CHYA 2CW7A 2DMQA 1DT9A 2IP2A 3C1DA 4DV0K 4BREA 4YEJA 2BW3A 1R7JA 3HM5A 2VJ4A 3L7WA 2OCEA 1VQNI 3K4NA 3J7ZO 3G1MA 4ID5A 3DJCA 4G7OF 2E4LA 3THWB 4BR5A 1LVKA 1QHTA 4ISGA 2HYFA 4EIAA 2FSWA 1F43A 4Y4RA 5SZTA 5AQLA 4UV9A 1U5TA 5CYQA 3CCRI 4RGRA 3H5AA 3GFIA 3KFWX 4IOCL 2NRZA 2IC3A 2ZFUA 3BY5A 5E8IA 4I7FA 1TL3A 1VQ5I 3EYIA 2JMWA 3K1PA 2NRTA 3VQ8A 2NAZA 1IUFA 4JI1K 1HJRA 2E6LA 3NAEA 4L5EA 4M3DA 4AHSA 3IP4B 4G7ZF 1EH7A 1TAQA 2LFBA 2KIMA 1X3NA 2GELA 3E1YA 3LSJA 3L6QA 4AU7A 1TL8A 5J2NA 1SD7A 3PFIA 3D2EA 4U88A 4CF8A 1MBEA 1XMOK 4CZJA 2CQKA 1YT3A 4CD1A 3CCQI 1F21A 4AHUA 3IH4A 1HJOA 4KHYA 1S1VA 3VQAA 1LV5A 4BRFA 3P9KA 1TAUA 2XB5A 2XF6A 4OGCA 3P5JA 4U87A 1I3AA 2O4GA 3FR0A 4CHOA 2PYJA 2VJJA 4CK1A 4IWVA 3K5OA 4JNEA 2VWBA 2M8EA 5HNHA 3ALYA 3HRTA 1K4TA 1SMYF 4FJIA 2X85A 2P7VB 5E20A 3ZSXA 2CFXA 5BR9A 3RSEA 1S7OA 2QQ9A 4IX7A 1F1ZA 5HRRA 1UELB 5AQJA 3PY8A 3TW6A 1KLNA 2DA3A 4L9JA 2A6HF 4H0OA 2V7FA 2IW5A 2NVYJ 3HG9A 2XHKA 3S15J 2DT5A 4EEFG 1X9SA 2L4AA 3BR6A 4DFKA 1OKJA 4U0YA 3I8BA 1UMQA 1SKRA 3BJAA 4A61A 2BE5F 1R0AA 4FK4A 2QF7A 2QCOA 5HBMA 4N4OB 1R00A 9ANTA 2DA6A 1ON2A 4KRFA 3IRQA 3B6OA 4E7HA 4RWTA 3DEWA 2V1UA 1F5TA 4O5VA 2O8KA 2E1MC 4DR3K 5CE3A 4RB1A 1GDTA 1NOZA 2OV7A 1RDDA 3TO7A 2VXZA 2HTJA 1Q86O 3C6AA 5BNGA 2ZC2A 4HLXA 4HV5A 3L2RA 1B9NA 3VQ5A 3G4SN 1EH6A 4RB0A 1GUUA 5F2RA 3KLHA 4QS8A 3DRSA 3GTLJ 3HTUA 2YNHA 1KVAA 4CJVA 5K7HA 4FJKA 2ZSHB 2CGLA 4NYFA 1IBMK 4KTWA 4K2EA 1LEBA 2GX9A 1HSTA 1G3TA 1ETXA 2X6SA 2HSTA 3K6GA 3CQXA 3SI6A 4KI6A 1RBUA 4CFBA 4DQSA 1NTCA 1GXQA 5K14A 1TWGJ 2LKSA 5DM7F 4CK3A 3AAPA 3KEOA 3P1GA 3WNFA 2AO9A 4Y52J 2HWVA 1JJ2M 4V2FA 1QU3A 2A1SA 4HVJA 1BOBA 4QOZB 2D0PA 1MNDA 3K9KA 1YTYA 3O8HA 1BOTO 2D0AA 3ZQLA 1R6RA 1LWEA 4CZIA 1GOCA 3L0QA 3CMYA 5EEAA 4PSWA 3AO4A 1QE1A 3DLAA 4FWOA 3FZVA 1FJGK 4IDHA 2LG4A 5D5WB 2BYVE 1BGXT 4KT6A 5C25A 1HKQA 3GG4A 1N77A 1RDCA 1VSFA 2HB5A 3VA3A 3H5RA 1UFMA 3J81K 1QQNA 2W48A 3L2VA 4GVMA 2RNJA 1ZR4A 3B8AX 1OCTC 4FLZA 1QSYA 4KHUA 2QVOA 5LGNA 4LB5A 4LITA 3SNNA 2DK8A 1RR8C 3HRGA 1KA8A 2F5DA 3CF2A 3HJEA 1O1WA 3EUAA 4EJWA 1XB4A 2GXAA 2HVSA 4FWPA 4PSXA 3VYTB 1LVAA 2E1MB 3U2RA 4MDBA 3KZBA 4QPOA 1MU2A 1BO5O 5F6FA 3CJTB 4JD2B 2FSKA 3PO3J 4N47A 1B59A 3VYSB 2B0LA 3KCCA 4BRHA 3J7YJ 3AVFA 1YF5L 2LLKA 1BL3A 4UNOA 5AQXA 5M3FJ 4CK2A 3SZ2A 3DFGA 1ZXOA 5K5QA 1NGGA 4LSNA 3VWBA 4E89A 4C8OA 3A5MC 2K3FA 5LLQA 4S0HB 2Z9OA 2WTEA 3W2AA 3PNTA 3HM8A 3OL4A 4DBRA 3J7AP 2OQRA 4RMNA 4AQYK 4KREA 3DCFA 4CGGA 3UKGA 3I8DA 4JKCA 3RMBA 4B3TK 3O9RA 2QWOA 1CGPA 1FMWA 2WFBA 3HDDA 3VOVA 1B6AA 1U2VB 3BLYA 1UAAA 2Q0OA 3AA2A 4YG2F 3T19A 2L9NA 2F5CA 2AXTC 2HI3A 3SCXA 1APLC 4DR2K 5BPNA 4I0AA 3OYEA 4MEXF 3Q7BA 1KYZA 3T8TA 3PNVA 2XGEA 1W7PD 1VQPN 3ZETB 3L2WA 1U48A 1ETVA 3KK1A 4OO1J 2CJJA 1ZREA 2UUBK 1AWCA 3CCEI 4BG8A 1ZR2A 2M45A 2YHYA 2BGGA 3OIOA 4F7ZA 3AVJA 3WGIA 2NVQJ 5E3OA 3MZYA 4YOWA 1VF9A 4CHPA 2L3DA 1BR4A 5E79C 3BZCA 4J00A 4DTOA 3KD5E 4LMYA 3AA4A 4KB0A 3HUGB 3OS2A 5GAGP 4OPHA 3FK7A 4HUGA 4AIJA 2DPDA 4FK0A 3GZ6A 4EJVA 3BZKA 3VA0A 5E3MA 2GA2A 3OHRA 2E2JJ 2VQEK 4ILJA 4BBSJ 2P51A 2Q2RA 1ASVA 3BGRA 2Z5UA 3O9UA 1XMKA 1NGAA 3ZMZA 1WOQA 2BXYA 1U2VA 2NNYA 1I1GA 4UVCA 2K85A 2EFPA 3ABMH 5AQFA 2NRVA 2R7TA 2KHOA 2DTRA 2IA0A 3LL7A 3L3VA 3CJQB 4CHNA 5BN8A 2A05A 4H5VA 2G9WA 2E60A 2DA7A 4N76A 2QXLA 1FNNA 3SAFA 1T2KA 1UHMA 3ZETA 4M63C 1Z9CA 3AARA 3A1YA 1TP4A 1WSUA 3F5TA 2UXCK 3BT9A 2ZCWA 4GDFA 4FWQA 2ECCA 5KAFC 2OA4A 5CQEA 3ATVA 2WUSA 1ZGAA 3MKYB 1OCPA 2P5VA 4M7XA 2BVMA 3ZQ7A 3LDSA 3OJSA 2MD5A 1Z21A 2PBDA 4Z4GA 4DZJA 2QWLA 2X1DA 4RAGA 2X4HA 3B02A 4BRPA 2ZF5O 5H6RA 5DCFA 1DPRA 3C94A 3WTVC 3OS1A 3ABTA 2OZSA 4GV3A 3O9SA 1XHZA 4JI5K 2ME6A 4BUPA 4BY1J 2EHGA 3ZLJA 1O13A 3FZFA 3FXMA 5LHGA 2ZJPF 4DQPA 2P8TA 2DYRH 5BRHA 5J1EA 2WTUA 1WJDA 1P7IA 2M2EA 2M30A 3GE1A 2FBHA 3M9AA 4CCOA 3PIPL 3SZTA 1OVQA 3EN9A 4DB3A 3CMEN 3SAGA 2V1DA 1I1SA 2FQ3A 1J5OA 1MNEA 4CJEA 3U21A 1SC7A 3TMOA 3QFPA 5AQTA 1VSLA 2F5VA 3T1HK 1MJ9A 3GLXA 4QTRA 2ZJRL 4A3DJ 4L5IA 4GRIA 2XV4S 1SD6A 1TBXA 1O3QA 4BGAA 3J81O 4Y17A 4CJ4A 2FMLA 4DR7K 3CP8A 5BQTA 3JRDA 4EJUA 2D2WA 1HX1A 4FM0A 3AVMA 2LDUA 3O8GA 3HRUA 3UE5A 4Y1CA 1JTXA 3GX4X 4DW6A 1YO5C 5KPRA 2GWRA 3RTRA 2IVMA 3PIOL 3G4SI 1SQKA 4C1NK 4B9VA 3AVHA 4DWIA 5I42A 4EMSA 3R3LA 4HAMA 3KLNA 1L3TA 3ZX3A 2DFIA 1XD7A 1IV8A 4KHWA 3LSGA 5IT3A 3LAPA 4PGHA 3VETA 4IO9L 3IKMA 2GM4A 2RQQA 1B9DA 2R7WA 4B1WB 4OIQF 2Q97A 4MQ9F 3SJJA 1U2WA 2R7ZJ 2EJRA 1TWHJ 3AL0C 5GAHJ 3ZQFA 2WAEA 1U9NA 3ZN1A 4JI6K 4JK9A 1ZLJA 3OJUA 2EZKA 2X1EA 2VIXA 1D9FA 2XRLA 3E5UA 3VEPA 1NJYA 5F1XA 4CCMA 3E3VA 4X66K 5GTHC 2AHQA 1HYZA 4CGFA 4IPAA 3SV4A 1NGIA 2KISA 2H6BA 1L5UA 3I9V2 2CW0F 2YHXA 3F22A 2JK3A 2KZMA 1YI2N 5AQPA 5AQVA 3A0HC 1FZPB 4ISEA 2B4JA 2QXFA 2ZJQF 3EO3A 3QQAA 3W2VA 1J75A 3JCUC 1Y0UA 1TK8A 3F8CA 3F23A 3WODF 2MW8A 4IFEA 4YOUA 4E1JA 5DTDA 3BC8A 2ZSIB 4AIHA 4RM3A 3GTKJ 3VSKA 1BU6O 3AY9A 1A35A 1S6LA 2V6CA 2JVGA 2VBWA 4HOBA 4IOCF 5HLTA 4OAZA 4CDGA 5CVUA 2ELKA 3B6AA 3G73A 1SKSA 4B3RK 4PUOA 3QODA 4DTSA 1SFEA 1FIPA 2QM3A 2QENA 4DSEA 3HHGA 3QNOA 3CF5L 3NEUA 1SEUA 1VSEA 4OKJA 1BIZA 4DJAA 4QIWN 1C1CA 1OQYA 1BDGA 5HVQC 1D5VA 3O9QA 4JKGB 5E84A 1OH6A 3FXKA 2NS0A 5LJWA 3O6BB 4P5OA 4RB3C 1AHDP 5EJCA 5HP1A 4RGSA 4NC6A 3MCAB 5K7ZA 2IGNA 1D9DA 5AIPA 5J8CA 3H5NA 3QYBA 3BDDA 2DJNA 3AO5A 3AA5X 4FJXA 3CCJN 3DP7A 1S7AA 2VG5A 1IBKK 1R71A 3AL0B 1DTTA 2VBZA 2P9KB 4CIGA 1T05A 4M3UA 1JHHA 3S2WA 2H8RA 3U1KA 4JI0K 3ZQHA 3C0BA 3GWZA 2HNHA 3EETA 2L7KA 3DEEA 4H0TB 2MFZA 3I33A 4CEAA 2IS4A 4NC7A 5JS2A 2QWWA 3BP8A 3GO5A 3ZQQA 3HRSA 1IKXA 3MKLA 5DD4A 3THYB 1RZ4A 1QQMA 2M0MA 4LK0F 2HDDA 2KHMA 1BQNA 1ATNA 4BR9A 1S7EA 4QWQA 3W3CA 2BZTA 3SHFA 2NS7A 3K9JA 4A2AA 5CPRB 2DOFA 2TCTA 1VQPI 5A2QK 5BPIA 4CI6A 3F2KA 2RN7A 1J5EK 2HOTA 1XI1A 4FLUA 3CJBA 1D1BA 1Z25A 1JGGA 2BDPA 3GBTA 2VBXA 4Q47A 3JW4A 4XL9A 4E1NA 4XMYA 2W82A 3T69A 3EL2A 3QU6A 5GINA 1EF4A 1DGRM 3L2CA 2EFOA 2KMUA 3I0TA 4ABZA 1M1KO 2ITMA 2VPLA 1XGOA 2HXIA 1CXQA 2KW4A 3MD2A 5IPAA 3HI0A 3KKSA 5HDNA 5JVHL 1VQMN 4JEPA 2IBDA 1ZC6A 3BCBA 1YJWN 3IC7A 4UY8O 5DCMA 5LJVA 1H0MA 1SFUA 4A5BA 5HL7L 3FMSA 4IJAA 3RKYA 2O6GE 4Y1DA 5AZIB 1X1PA 2P9KA 4LGWA 2V51B 4DHYA 1LJ9A 2Q8KA 1YW9A 4YDUC 1ZBLA 1X1DA 2EZIA 4BXFA 4FETA 1VK0A 1YHQN 3HM9A 3BPXA 3F3XA 4JX4A 3CJNA 2F4VK 4DV7K 3DLKA 1FXXA 3KD1E 4BR0A 2PAVA 1T56A 3QOEA 1X9MA 4RB2C 4LF7K 2UUAK 1RGIA 1OMIA 5DUKA 1JLAA 3BG7A 4B9QA 2DT7B 4MQVA 3E5XA 1NGCA 1JLFA 2KRHA 4HCBA 1Y64A 1DQUA 2EA4A 5F1RA 3CO7C 4IFYA 4DR1K 1Z6TA 3L09A 1FSEA 3S41A 2FEZA 3NWTA 4EQQA 2M7BA 3R4KA 1W7PA 4NXNK 1JKPC 1X9JA 4A69C 4ZYAA 3RZDJ 4WE1A 1GLDG 3K4LA 2RNGA 3FE1A 3OTOK 4BJTA 1Z1DA 1NG9A 3S93A 1GLNA 3V9WA 4II2A 3CPEA 1U9OA 3QAHA 2OPTA 5IP6A 2YU9J 2QLZA 3ID8A 3ZSWA 3AA3A 4ZTFA 2D0BA 1IF1A 2R7YA 4EHUA 4X62K 3C6HA 5CVJA 2ZXHA 3K2ZA 4CEZA 3TO6A 3IHUA 1P90A 3T7ZA 4BY7J 5JHFA 2FF3B 5HOOA 3LDPA 3S1RJ 4DQIA 5AZIA 3LAMA 5DK5A 4JK8A 1REPC 3LP2A 5LMNK 1FW6A 2EZHA 4P96A 1PP8F 3GF2A 5FLMJ 5ED4A 1ZGJA 1SL2A 2YSRA 4BWJA 3KLFA 4GMJB 2DYSH 1ACIA 5FO5A 1J2XA 1W5SA 2DU9A 3CMEI 4HUEA 1USTA 1SL0A 4LG0B 4MFEA 5TGTA 5EG0B 2GIZA 4Z4IA 3WNHA 3M3ZA 2L7FP 3J7YP 3F0CA 2IOCA 1MJAA 3HOVJ 2GQQA 4ETSA 3M3YJ 1L3UA 3ECOA 4CCJA 4KJZA 3V9UA 3CC2N 5KRSA 2M7AA 1K61A 1RBVA 4B8XA 1F36A 2FF4A 2K40A 4U0WA 1TYQA 2DTUA 4E7IA 3V8KA 5D8LB 3SPYA 3WXLA 1OR7C 4Z4CA 3GTOJ 1RDBA 4KV8A 4IKFA 1HR0K 4FX0A 2IA2A 2Q1NA 1E17A 3LOCA 1WJEA 4ICLA 3O2PE 1Y8QB 1WSIA 3GW2A 3LP1A 1BA0A 1AKHB 2JTVA 1TUYA 4PKIA 2KDOA 4F3TA 2QKLB 2DT6A 3I0SA 2RE2A 1VRUA 2BY1A 4HPQA 1VQON 2Z1IA 1JXBA 3ZXSA 3C2GA 2NRHA 1OYIA 2K4JA 3FIWA 2E36A 3KZYA 5C4XJ 1X2NA 2HFHA 2LR8A 2LBFB 1TNSA 4WX9A 4AH9A 3OA9A 2KLOA 5M1KA 2X74A 4GNIA 4FJ8A 2O8BB 4HQMA 2W6KA 1H9GA 3GDQA 5C0YA 3NWSA 2M34A 2RC4A 3TQNA 2YU3A 3LQQA 3I54A 5EG0A 3KLOA 3O6WA 5F04A 4DR4K 4RW9A 4CEBA 4BQAA 4NYNA 2DDBA 5TJJA 1BHLA 3FHZA 2P9IB 3OR2C 4LLLA 2FXUA 1VZ0A 3TTDA 3WHBA 2YHWA 3OBWA 3RR7A 2VXDA 5FRMA 1YI2I 4CA0A 3M7GA 3K59A 2K02A 4O0JA 4YDUA 1ZRDA 1KQSM 1NK4A 1I3QJ 2QQ8A 2Q0UA 4L9NA 1XC3A 4ZHRA 3O80A 2DK5A 2NVXJ 5LD2C 2HNZA 5EZHA 4QPQA 3S14J 2JRMA 3CM6A 1T33A 2CGKA 5A2QO 3ROUA 1OCZH 3I59A 4EJTA 2DDAA 4H5RA 1DU0A 1RTJA 2XY6A 1ZG3A 3DXMA 3CUQC 4Q48A 4DQRA 3CCMN 3VB2A 5AZJB 1SVLA 3QEXA 2DMNA 2E8AA 5AQUA 3EUHA 2OF7A 4E6KG 3OWTA 2KIFA 4K43A 4YNQA 4DSFA 4XLAA 2B6AA 1W0HA 3T0YA 2Q31A 4EZ9A 4M9SA 1BR2A 3IUCA 1X9WA 1NNEA 2QWRA 1JHFA 4V2GA 2LBFA 2G7UA 5BPLA 3V9SA 3QP5A 4PDKA 4EP4A 4BRGA 2VT3A 3RZOJ 1W5CC 3HSRA 3DLEA 3GVAA 1DGWY 4QCLA 3V9XA 3VF6A 3ZT1A 2VASA 2JLEA 1CF7B 1W2BM 3KK2A 2HF4A 2G8UA 1DPUA 4FHTA 3CCJI 4XLHA 3LP0A 4LK1F 4ELUA 3KK3A 2AS5F 2IDOA 2P6SA 3DKXA 1KAYA 3P7NA 2VC0A 5AFUA 3MN7A 3OOPA 3VEVA 3NE6A 5HDGA 3C7NB 2HDCA 1D4XA 4O5BA 4RW8A 1E3PA 4FPAA 1RT4A 5TKYA 4ZH4F 3C6UA 3PIPF 5E1XA 3NFAA 3TOBA 4OLBA 2VT2A 1X2MA 3H45C 2A1RA 4BGDA 4B1XB 3I4NJ 2G8IA 4A2UA 5FPNA 4DQQA 4B1YB 2YX7A 2HVHA 1FYKA 4KIGA 2VQCA 4X6AJ 4E7LA 1NKCA 3KKRA 4HZFA 2YPRA 5J4VA 3BROA 1FOWA 1YJ9N 5H20A 3FZKA 2MLGA 5AZJA 3UKRB 2Q2EB 4E4HA 2GAUA 2ZJRF 3WQTA 3ITHA 1U6GA 4F2RA 1JLQA 4C23A 1N8RO 3CMAN 1OR7A 3HYIA 4HX7A 3CDIA 3OYMA 4XH1A 1XDSA 3VF2A 4IVNA 3RMCA 2BY0A 3GCMA 4GGGA 1G3SA 2CQNA 1T3VA 3CD6N 1ATRA 3HP6A 1BCOA 1EWRA 2KIQA 2JN6A 1V5EA 3HKZA 1LDKB 4H0XB 2OTJN 3LPUA 3CUQB 4B1UB 1ZELA 4F55A 5IY5H 1VQMI 2E20A 2HHQA 2XGXA 4CJWA 1YJWI 5C10A 3WNGA 1DUXC 4I02A 4IO9F 4BXXJ 2R5ZB 3SJMA 4OPJA 4XQFA 5IT9Z 4I09A 1IJWC 4KIBA 1WJFA 2K7LA 3OYIA 4L5JA 4Y33A 1T39A 4CXFA 3BJ6A 1YHQI 2LF7A 2HTSA 2G8FA 1NGJA 4CCKA 2L4MA 4EJOA 5GAHP 4AF1A 3HIFA 4CZCA 3H3OB 5ICGA 1S1UA 4WFBL 1XCBA 2E2PA 4BHBA 4CF2A 1VQLN 3U8XA 5GTIC 3A8YA 2WAQA 1N33K 3VENA 1W97L 1P9QC 5EEHA 5DUIA 2Q2EA 5ELZA 2FNPA 3VODA 1NHAA 3IS9A 5EEGA 1YITN 4M6VA 2G7HA 2E5LK 4CJFA 5FLXK 3O3KA 4NCBA 2EINH 1LOTB 2XIGA 2Q1ZB 2DW4A 1NK5A 1HRHA 2X78A 4B8CA 1ZHFA 4A0YA 4IXAA 1S9HA 4KA4A 1T44A 3U3YA 5IP7J 3CUQA 5DM6F 3LDOA 1EJ9A 1SL1A 3WU2C 3VPRA 1TNTA 2QZ8A 2M3AA 4JKBA 2P7CB 1OYWA 2R5ZA 1QNTA 3V8JA 4NO7A 5LRRA 2F4IA 1MZBA 4HWIA 5DS9A 2OAZA 5AQKA 2OPQA 2EK5A 3MVPA 3ZQIA 3KYDB 1GLAG 2CQ7A 1ILYA 3CF5F 3K69A 2HYJA 2MGQA 1RUOA 1RIOH 4F9OA 1MMDA 1C0FA 2VQFK 2E2OA 1QRYA 1B9MA 3QESA 4P9FA 4UUSB 3G6EN 3SMSA 3DPUA 2HU9A 3HPHA 4N5SA 1TW2A 1J54A 1WLJA 3N4QA 4JI2K 1U78A 4FCYA 5JVGF 1FOXA 4LY7A 2W57A 3SV3A 1G99A 4FLTA 1R5HA 5HLHA 5AQZA 3HZJA 3CC2I 3FZLA 3DLHA 1BI2A 4WFNL 1N78A 5J1RA 3R0JA 3U9GA 3ZSRA 2PJRB 3ULQB 3ZN0A 3DU6A 3GTQJ 5DMRA 3PSIA 1R59O 3JAMK 2ETHA 4D9JA 5J1UA 1IXRC 2E2QA 4RS8A 2VYPA 4KB1A 4DU4A 2QWNA 1XGMA 1A6IA 3QEVA 1SMTA 3IG1A 2BV6A 2JJ7A 2XAFA 4DOZA 4KT5C 3HKZN 3JYTA 2LY2A 1N6QA 4C8LA 3IFRA 4Y3OA 2P4WA 4K42A 4WYBA 3V9ZA 4K8ZA 1XWLA 3MQ0A 1B9FA 2F7TA 3DWLA 3HSCA 3TABA 1HNZK 3QOPA 3DRPA 1LPQA 2DMUA 2GOMA 2VBYA 1RRJA 4XIDA 4EZ6A 2M87A 3VESA 1VQOI 3A01B 5BN9A 3O3HA 3UKUB 4BBRJ 3JXUA 1IXSB 1Z7LA 5AR0A 3TSUA 5AONA 3E97A 3NF6A 3I55I 4KUMA 4JKFA 3LMMA 1QS4A 3THXA 4KH5A 5F0CA 4UUSA 1ZBIA 5F64A 2CRGA 1NK2P 1BC8C 3JRGA 1NG6A 5EX5A 1R5GA 4XM3A 2P9SA 2D1HA 2HOSA 1JCFA 3AAQA 3LAJA 3PNYA 1WJAA 3G71N 4CZHA 4YORA 3AGRA 1FY7A 2DPNA 1WI3A 1QQIA 2JWLA 3HTVA 2R7UA 1VQ6N 3H0GJ 4A3MJ 4ZTJA 4LF8K 4W1UA 3F6OA 1TQIA 3P9IA 1ZBFA 4OGEA 1MMSA 3DLRA 2F9WA 2XPVA 1XN7A 1X19A 4C8KA 4XKCA 2Z3YA 3KETA 1KXPA 4XH4A 4HHTA 4LIUA 3WXJA 4A0XA 1V3FA 4CZMA 1VQ8N 4E19A 1FPQA 1N34K 3AO3A 3OV8A 5H1SQ 2LNBA 3VN5A 3SMPA 3KWIA 1R1UA 1DTQA 4OKKA 4DLEA 2L9SA 4JK7A 5HS7A 2NNNA 4DF4A 2ZB9A 3PJRA 3QPLA 3TW7A 2YR2A 4DKWA 2ZWHA 2ZJ2A 4B09A 2AXLA 3A01A 1TWFJ 4B3XA 4I01A 3UKUA 1T0FC 4G9YA 1ZBSA 3ZPLA 3QLHA 1UHSA 5CR4A 5FKLA 1X3UA 5LEKA 2VJIA 4I2QA 3D2FB 3V6DA 3BQYA 4B3OA 2XRNA 3I3LA 4G9ZA 4I7HA 4P55A 3A0IX 1MIJA 1IV6A 1OKRA 3KP5A 4IF4A 1EXQA 2BUPA 3TU5A 4H0VB 3NMUA 3KTQA 3Q9SA 3MKZA 1BOAA 1EV7A 3RVCA 2Z33A 3HP9A 4XICA 1W4MA 3I71A 1JT0A 1G15A 1XPXA 1UAXA 4MO4A 2FSNA 1JE8A 3TOAA 4BACA 4XKWA 1TKZA 1F4KA 1A04A 4MHGA 5E8GA 4P9UA 4LOCA 2CU7A 1UJ8A 1S6PA 4RBOA 2CV1A 4XBFA 4C2MJ 1WAJA 5LGUA 3SBGA 2O0YA 4XKVA 3O4NA 4FYDA 2NS8A 4CYCB 1WSGA 1GLEG 3G1OA 2PLYA 2IXSA 4KNYA 3CDLA 4BL0B 2RN2A 4BDZA 1B1BA 3KP3A 1LW2A 3BY6A 2XGDA 3AKZA 5GPCA 1BQMA 2XC7A 4I2OA 1YJ9I 4FWSA 3TAMA 1BR1A 4ID1A 1HKGA 2OUMA 2K27A 1QQCA 2MC4A 3IAM2 1WSHA 2E88A 1EQYA 2L9RA 3RKWA 2E71A 4CIEA 3BCAA 2HQRA 5F27A 1OH5A 2CWEA 4UV8A 4FM1A 3CMAI 4A3LJ 3I56N 4I99C 2V1XA 4BE0A 5GADJ 3VGMA 1OCCH 3B73A 2JUGA 2ZQBA 4IOXA 2E2IJ 3DPLC 3K1MA 3JRHA 4BDPA 1X1CA 2K9SA 2P9LB 3N97A 1RDWX 2W7NA 4FASD 1E2XA 2OTJI 2R7OA 4AYBA 3H1QA 4FK2A 3BG3A 4O8KA 3FBIB 1U8BA 3J7AY 2FE3A 1BC7C 4J2BA 1LWFA 1LWCA 4CF0A 4BQQA 4BE1A 2YNIA 1OJLA 3U3GA 2F8SA 3TDZC 1V4RA 4CJ7A 5D8KB 2QBYB 3L4IA 4CYCA 3MCZA 3LSKA 1Z91A 3N4PA 2M4KA 5FKMA 5KQ8A 2IS6A 1XNRK 3CUOA 3M8EA 1S8NA 4R8HA 4GV9A 3AVNA 1VQLI 1XNQK 2A3SA 3LZIA 3TARA 3JAMO 5GP9A 2COBA 4AM3A 2UV1A 4CZZA 1IRFA 1J53A 4RCHA 4DV3K 4EHTA 2FOKA 4CD3A 4O55A 4U67L 3Q0VA 2W85A 1SZ2A 3ZX0A 4FJGA 2HBMA 2YHBA 3HHHA 4ZYEA 1YITI 1ZAOA 5FKOA 5HLFA 2WADA 4BQNA 3NF8A 4RLQA 5M1QA 2DAOA 1RR7A 4D5FA 4XSZF 2Y31A 1FBUA 2Y69H 1Q9XA 4ZJZA 3BR2A 1Y8RB 3KP6A 3TP0A 4UB8C 4B48A 3MWPA 4CJSA 2LC2A 2EIKH 4CJTA 3Q0UA 4LFUA 1X3WB 2XSJC 4RGXA 4B3MK 4Q4ZF 2Z1GA 4QS7A 1FX7A 3G25A 1OPCA 4CGJA 1XGSA 2R7DA 4BHCA 3OIPA 4HF1A 1K6OA 4LIVA 4CCNA 3DM2A 2RKIA 1MH4A 1T0FA 5EDNA 4IEIA 2DI3A 2LVSA 2UXDK 2VKDA 1HOMA 4RTFD 4B9NA 1Z0XA 1TKXA 5B1BH 3O4WA 2XAQA 4LFCK 5B3SH 2IS2A 4H0YB 2YUSA 2R7FA 5ERIA 1HBXG 4LJZF 2QBYA 3G6EI 4C8NA 3J81Z 1WGXA 1YIOA 5D5UB 5E1ZB 1ZLKA 1RI7A 2D4WA 4ANJA 3BR3A 4CBWA 4OKEA 1QVTA 2VKHA 4UVBA 4YOXA 4I9QA 2DCEA 3THVA 3FMRA 1VSJA 1YRNA 4GW6A 1IN4A 1KFSA 5HRSA 5AQRA 3F73A 3LWMA 2VE8A 4Z94A 4HLYA 3PO4A 2FBIA 1OYYA 3FXUA 2DBBA 3JTGA 5KQDA 3BR0A 5C2FA 1RESA 5FDLA 1ETQA 2XAJA 3GZNB 2GWJA 3V4GA 4DIQA 3M8RA 3NF9A 3EE8A 2ID6A 1FKPA 4L3QA 5KPZA 1IRXA 5ICCA 1J0RA 3WGHA 5EU7A 1HW5A 1UA1A 4GYGA 4AYBN 4ZZDA 1QVUA 3VQCA 3RWUA 4NCAA 2RKHA
chains in the Genus database with same CATH topology
1ZBHA 3I0RA 4BE2A 1YVUA 3KLGA 1CXUA 3DMJA 1G15A 1JLCA 1UAXA 1VRUA 3KJVA 1RT2A 1C1BA 1VRTA 2VG5A 2X6SA 3CYMA 3LALA 3NH2A 4HUFA 4W5TA 3NBPA 4BACA 1L3VA 3D0PA 4KPYA 3HVTA 1DTTA 1TKZA 3SI6A 1GOAA 4CIGA 1T05A 1RBUA 4KI6A 4M3UA 3AVKA 4CFBA 3KLEA 2Z1IA 4B9LA 3C6TA 3PX6A 1JXBA 3VQ9A 4CJUA 4DTPA 3CM5A 1BI4B 2WOMA 3IS9A 4DSIA 3KIOA 3VQPA 4DQSA 3WNEA 1S6PA 5K14A 3VQEA 2OPRA 2F8TA