1X1PA

Crystal structure of tk-rnase hii(1-197)-a(28-42)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
b'MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGAGAIIGLAVGGVVIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Structure of amyloid beta fragments in aqueous environments
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1x1pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1x1pA01
5KRTA 3OYIA 3DM2A 4O5BA 2IS3A 4I9QA 2RKIA 4CFDA 2VWJA 1S5JA 1VSHA 4CGGA 3OS0A 3TAQA 3PO5A 4FXDA 2GUIA 4DFMA 3PX6A 1B92A 3AVGA 2Y1IA 3MXIA 4L8RB 4KREA 4EP4A 3MAQA 1IH7A 1KTQA 1O1WA 3B6PA 1IO2A 3C94A 3CG7A 1S1XA 3MECA 3ZSXA 3HSTB 1RDCA 1TKZA 2ATQA 3NFAA 4M45A 2W42A 3K5LA 1TGOA 4O0JA 4Z4IA 2HHWA 1CZ9A 1ZBFA 4J2EA 2ETJA 3L2VA 4N5SA 1S1UA 1L3SA 1B9FA 3NF9A 1L3VA 4DQIA 1SL0A 4FZXC 5KTQA 4FLWA 2QK9A 3AO2A 1UOCA 2IAJA 4FW2A 2VG6A 1RTHA 4N56A 3CFPA 2ZQBA 4RW8A 1I39A 1Z26A 1NK4A 3JYTA 2YNFA 4JS5A 5J2QA 4CJTA 4CEAA 4KHSA 3LAKA 4FM2A 3VQPA 1SL2A 3RWUA 3M8QA 1DTTA 3OYAA 4FM0A 4FJ7A 4M42A 1KFDA 1BI4B 4FCYA 2AJQA 3CFRA 1F21A 3LWMA 3SZ2A 4DQRA 2XY5A 3P5JA 4KHYA 1LWEA 3KJVA 1NJXA 4B9VA 2B4JA 2B6AA 1VSEA 3AA2A 3LPUA 4AHCA 1ASUA 5HRSA 4W5OA 1XWLA 1XHXA 3KLGA 3ZT4A 3H08A 2RF2A 2IGIA 3OYBA 3SQ0A 2BGGA 1QSYA 2X6NA 3OYNA 3DRPA 1TKXA 3CFOA 3JSMA 3OJUA 4FJJA 4CIEA 1NKEA 3L3VA 3TAMA 2G8HA 2HHXA 1Z25A 1RDBA 2HHUA 4CEQA 3DLEA 1IG9A 3HXMA 4K8XA 4B9SA 4CEDA 2IC3A 1KSPA 1ASVA 4F3OA 1C0TA 3O4NA 3SYZA 4PWDA 1NJWA 1C0UA 4M3TA 3DLBA 2QXFA 1CXQA 4FLYA 3AVCA 5CYMA 5SZTA 4LD0A 4DF4A 4UQGA 4CECA 3T3FA 4KAZA 4KI4A 5FDLA 3RRHA 3VQ9A 4CHQA 1S1WA 1QHTA 3KK3A 4E89A 1D9FA 4FLVA 1HPZA 3LAMA 3SV3A 4AH9A 1L3UA 3O3HA 4HUGA 1BCMA 3LZJA 2X78A 3M8RA 4DSJA 2OPSA 4M3ZA 3AA5X 1TK8A 3KKSA 3RMAA 2BDPA 1QSSA 4F8RA 3ZSYA 4DLEA 3M8SA 1JXEA 2OPQA 4KTZA 4BE2A 2XY7A 1RBRA 3MEGA 3OYMA 4CEZA 2YNIA 3SQ2A 4LH4A 1NK9A 1KFSA 4ELUA 4CJLA 3DYAA 2Z1JA 4W5QA 4EP5A 2P1JA 4DSEA 4F2SA 3V9UA 1ZBHA 4CF0A 2P5GA 3VQCA 3QEPA 4E7IA 3MEDA 2D0AA 4M3UA 4HCBA 5J1EA 3DOLA 4I7FA 3K5MA 1NOYA 4LY7A 4KHUA 2IDOA 2HB5A 3QEIA 3VQDA 1ZBUA 4H4MA 1SL1A 4DTSA 4Z4GA 4GMJB 3V9XA 1RTIA 3AA4A 4CEBA 4C8LA 3O3GA 4FJKA 3K5NA 4B8CA 4CJSA 3OYLA 3CQ8A 1LW2A 2Z1GA 4OPKA 5C42A 2RPIA 2QKKA 4FJGA 1RT2A 1TL3A 4G1QA 1XHZA 1KLMA 1WSEA 4JLHA 4B8AB 3EYZA 1TKDA 4FJ9A 1A5VA 3HP9A 4ICLA 3ZSQA 4E19A 4ELTA 4DS5A 2OPPA 3KLEA 4B9MA 4NCGA 1IKWA 1VSIA 1JLAA 1S9EA 4FM1A 1U45A 1YVUA 1WSIA 3ISNC 1IKXA 4QCLA 2YKNA 1VRTA 4C8OA 2HVHA 1CZBA 2X74A 3K2PA 4M3YA 1X9MA 4Z4FA 1WSFA 3LDSA 3QESA 1BQMA 4Y1DA 5C25A 4CEEA 2YHBA 3ZT1A 3KIOA 4RG8A 3K58A 1EKEA 4E3SA 3ZSZA 3ZT2A 3E01A 4BE0A 1NKBA 1NOZA 2YHAA 3U6FA 1QS4A 3QNNA 1BCOA 2WONA 4ZTFA 3HM9A 3WNHA 4F4KA 1C1AA 4NCAA 1WSGA 4GW6A 4DTRA 1YTAA 3SV4A 3SQ1A 1VSFA 3K5OA 1C6VA 1J53A 1A5XA 1SV5A 1UAXA 2Q3SA 4O55A 3VQBA 4BDPA 3VQ7A 3WNGA 1S6PA 1U48A 1MU2A 5HROA 3BDPA 2B5JA 4IFYA 3AO5A 3TANA 4DFPA 1RT4A 4BDZA 1BIZA 1HYVA 3P1GA 5HRNA 5HLFA 3HT3A 4CJ4A 3QEVA 3RR7A 1J54A 4CGDA 1HNVA 1RNHA 1ZBIA 3G10A 2JLEA 3L3UA 4IDKA 4B9TA 4FW1A 2GBZA 3L8BA 3OJSA 3KKRA 1S9GA 3NHGA 3EZ5A 4OLAA 1JLBA 1GOCA 3NGZA 3BGRA 4OKKA 2OYQA 1RT6A 1JLGA 4HUFA 1NK5A 4CJEA 3NH2A 1VSLA 3K59A 3TAFA 4FJ8A 1SUQA 3AV9A 4AHSA 4YFUA 4JS4A 4DSIA 3P83D 1NK6A 3DRSA 1SKSA 2DFFA 4KHNA 3V1QA 3HO1A 3QLHA 1D8YA 1ASWA 3DLGA 3AVAA 3NF6A 4I9LA 4ID1A 3LANA 4E7HA 1XI1A 4F2RA 3VQ5A 5I3UA 4OKEA 1NK8A 2E6MA 1KRPA 1RILA 4DSLA 4FJIA 3OVNA 3SQ4A 4BWJA 4KTWA 3B6OA 2HNZA 3IS9A 5CZ1A 3VQEA 3QIOA 4CK3A 2F8TA 1CLQA 3LP3A 4O4GA 1JXBA 4M3RA 3WNFA 4CEOA 3VA0A 4DQSA 4CJKA 1EP4A 3D45A 4E7LA 1U4BA 3ZT0A 4Z4EA 1WSHA 4Y1CA 3NCIA 5J2PA 3CYMA 1RTJA 3TI0A 4FJMA 2O4GA 1WSJA 5J2MA 4ZHRA 3V9WA 1X9SA 2KTQA 2KZZA 3OYKA 3CM6A 1BI4A 4RW4A 4FLXA 3SJJA 4DSKA 2OZMA 3I8DA 3NGIA 3SUQA 1K6YA 4CF1A 1L5UA 4HVJA 4ID5A 4KKOA 3DOKA 4MFBA 4CHYA 2ZE2A 2OZSA 4IKFA 3V1OA 2DTUA 1ITGA 4Q0BA 2RN2A 2FBTA 4CHOA 4LH5A 2DFEA 1GOAA 4KFBA 3HYFA 4OKJA 3LZIA 4B3OA 1Y97A 4N41A 4CF2A 3RR8A 2A1SA 3LP2A 5J2NA 1RDDA 3HP6A 4DTJA 4PY5A 1N5YA 2G8KA 4DU1A 4BACA 1WNSA 4OLBA 1BL3A 1LW0A 2XY8A 4CIGA 4FLZA 4W5RA 1IKYA 3AVHA 3SPZA 4IFVA 2G8VA 5KRSA 1X1PA 4DFJA 4M3XA 1I3AA 4EZ6A 2PYJA 1LAVA 3V9SA 3KD5E 4CHPA 2BANA 3DLRA 3QERA 4DSFA 1WAJA 2ITGA 3ZSRA 1BIUA 1RT7A 1S1TA 4B9LA 2E4LA 1RT3A 3AVIA 3K57A 3VQ4A 2HMIA 4ELVA 4H4OA 3VQAA 1RBTA 5KGWA 3NF8A 4N47A 3SUOA 3V6DA 3KTQA 1REVA 5HRPA 1HYSA 3KLIA 3AO3A 3AVMA 1KVCA 1GOBA 2FBYA 3VQ8A 1LWFA 3SUPA 3HPOA 1IKVA 4BE1A 1JL1A 3G0ZA 3S3NA 2FC0A 2YNHA 3SUNA 3OYCA 2BE2A 4HCCA 1TK5A 1X9WA 4KB0A 1S1VA 4Z0UA 4W5TA 1HYZA 4DTOA 3FFIA 2HNDA 4AHTA 1VK0A 1JLFA 3PUFA 3TAEA 4EZ9A 3T1AA 4Q5VA 1Q9YA 1QQCA 4O0IA 3NH1A 3LWLA 3ZT3A 2OA8A 4QOZB 1ZYQA 1T03A 1W0HA 3NE6A 3U3YA 4JRPA 2D0BA 4AHRA 3UIQA 2VWKA 3AVNA 3TAPA 1EXQA 3PX4A 1VSJA 3OYEA 4FZZA 1C1BA 2XO7A 4I2PA 3V4IA 4DTMA 1CXUA 4CGJA 4E7KA 2PYLA 2EHGA 4CCHA 2XRIA 2XHBA 4HTUA 1SKRA 2PY5A 3S9HA 4QAGA 3U3GA 3PV8A 4CFCA 1T05A 2G8FA 4CJ3A 3HL8A 4KI6A 4PQUA 4OJRA 4Z4HA 3IAYA 5HP1A 2OPRA 1RBSA 1UA0A 3TWHA 1YT3A 4N76A 4FJ5A 2VG7A 3L2QA 3ZSVA 1T7PA 2P5OA 1HRHA 3QETA 4H8KA 4DS4A 1RT1A 4B9NA 3MXMA 3O3FA 3AVBA 1S6QA 4OGCA 4YNQA 4CJ5A 4KB1A 3PY8A 3C6UA 1XC9A 1RBUA 3M8PA 1BGXT 4E7JA 4IG3A 4C8KA 1WAFA 3THVA 3IG1A 4FK0A 3CM5A 1SKWA 1TV6A 3S3MA 5E41A 2DY4A 1EETA 2F8SA 1NKCA 1FKPA 3OS1A 4NCBA 5FRNA 1LWCA 3ASMA 2VG5A 1QTMA 2I5JA 3WNEA 3T19A 4FVMA 1VSKA 3ZSWA 4CERA 5T7BA 1KVAA 3PO4A 3NH0A 1J5OA 2Z1HA 4OPJA 5CYQA 3OYHA 3HPGA 5I42A 4XIUA 5D3GA 5CZ2A 1TKTA 4O44A 1FKOA 2DFHA 3LP0A 1DLOA 5FROA 4CJUA 2Y1JA 2FBVA 2G8WA 3RMCA 2HNYA 3SCXA 3AO1A 2A1RA 4CE9A 3QEXA 4E1NA 3D0PA 3TR8A 1TK0A 1QE1A 4KO0A 3EY1A 4AILC 3ITHA 3HPHA 1VSMA 1YTUA 4M3WA 3RRGA 4KPYA 1W9HA 1JLCA 5HBMA 3L2WA 3KLFA 5DMRA 5HRRA 4KTQA 1NK0A 1RDAA 1WLJA 2EX3A 4CF8A 3SNNA 3C6TA 4DQQA 4KRFA 4DTPA 3KK1A 4FJLA 4K8ZA 2D5RA 3LPTA 4NYFA 1TAUA 3HK2A 4CFBA 3ULDA 3V1RA 4CGHA 4PA1A 1BHLA 1FXXA 1LV5A 1JLEA 2HHQA 4JRQA 3OYJA 3MXJA 3NF7A 4M41A 3ZSOA 3DLHA 3MEEA 4AHVA 3SPYA 4FLUA 4DLGA 3DRRA 4FLTA 3HJFA 5KGXA 1KLNA 2HVIA 1Q8IA 1RTDA 4FK2A 3PX0A 3DI6A 4CGIA 2P51A 3DLKA 4FJHA 3AVJA 3ALYA 4CJWA 1U49A 4CJPA 2YNGA 1D9DA 1U04A 3LALA 4ZTJA 1BQNA 1EX4A 4CFAA 1TAQA 4DQPA 5FRMA 3AVFA 3S3OA 4E1MA 3QEWA 1RCHA 3I0SA 4CJFA 1KCFA 1JL2A 1ZBLA 1LAWA 4J2AA 3NAEA 4FJXA 4J2DA 3VN5A 5C24A 2YKMA 3AA3A 3LP1A 4I2QA 1TVRA 5KI6A 3OY9A 4LSLA 3TABA 4NYNA 4RW6A 4PUOA 2WOMA 4HHTA 4DG1A 2GV9A 1HJRA 3A2FA 3ZCMA 4DU4A 2E6LA 1D5AA 1UA1A 1J9AA 4LSNA 1QSLA 4OGEA 2IOCA 5SWMA 3C95A 1DTQA 4CHNA 1Q9XA 3V9ZA 4KV8A 2FBXA 3QNOA 3KLHA 3O4QA 4CK2A 4DTXA 4IBNA 4E0DA 4FYDA 2LSNA 4HUEA 1N6QA 4C8MA 4R5PA 4AHUA 1C0MA 4CGFA 1HQUA 3HVRA 4KHWA 3RMBA 2KFNA 4CEFA 1JKHA 4DMNA 4CJRA 4OVLA 2D0CA 4KHQA 3RMDA 4CESA 1VSDA 3QINA 5CY4A 3QIPA 2PZSA 4CJVA 2KQ2A 2G8UA 4BDYA 3HVTA 1G15A 1B9DA 3F73A 4CJQA 1TL1A 3L2UA 4DTUA 4DWIA 4J2BA 2ZD1A 1C1CA 3NGYA 4CHZA 4DFKA 1BISA 4BWMA 3OYDA 3AVKA 2G8IA 2KW4A 3KK2A 1FK9A 1HMVA 3NBPA 3AO4A 4CF9A 4Z4CA 4RW7A 1RT5A 1NJYA 3OS2A 3F9KA 3V81A 3L2RA 2XY6A 1KVBA 5EU7A 2HW3A 3TARA 5JS1A 1NJZA 1R0AA 1T8EA 1UWBA 4W5NA 3VQQA 4IG0A 4FK4A 2X6SA 2NUBA 3AVLA 4WE1A 4MQ3A 4CIFA 3I0RA 2JGUA 4DU3A 2R7YA 3OYFA 2HHTA 3DMJA 2QKBA 2HHSA 3SI6A 2F96A 3IRXA 2HHVA 4DF8A 4B08A 4DTNA 3KD1E 2YV0X 1JLQA 1U47A 4FZYA 5JS2A 4F3TA 4FJNA 4B9UA 3VQ6A 1A5WA 5DK5A 2KZMA 3VA3A 4RW9A 5K14A 4TSXA 2Z1IA 4C8NA 4CK1A 3OYGA 3NDKA 1RBVA 3TAGA 2KFZA 1NK7A 4GVMA 3RTVA 1L3TA 3QO9A 1WN7A 1HNIA 1HQEA 1VRUA 2O4IA
chains in the Genus database with same CATH superfamily
1RUNA 2IS3A 2RKIA 1S5JA 3BTCA 1RPWA 3AVGA 3HRSA 4KH4A 2L9VA 3HOTA 1MMDA 4UVBA 3L2VA 4IRHA 4BR0A 1SL0A 5KTQA 2QK9A 3AO2A 4FW2A 1NK4A 3A2KA 1I39A 4LGWA 3BG3A 2R7XA 4CZZA 4CH7A 4DQRA 2NVQJ 2K5CA 2AA4A 3LPUA 2QEXN 2BGGA 2EQRA 2L2OA 2H8WA 1R7JA 2CUFA 4XNFA 3ZQCA 2IVPA 2KJBA 4B9QA 1MMGA 1RDBA 4K8XA 2Z5UA 4M3TA 5DCMA 3ESWB 2Q0RA 4NLBA 1VQOI 4E89A 3SV3A 4AH9A 3H0GJ 1O7FA 1BCMA 4GCVA 1G99A 1AHDP 4RGSA 3M8SA 4DR6K 4IHSA 2OPQA 4BE2A 4IF4A 1V5GA 5CR4A 4CJLA 4DKWA 5CVRA 3I59A 4FVUA 1AOYA 5J1RA 2DU9A 5FPMA 3B02A 2P5GA 1J6ZA 2VJJA 4NO7A 3DOLA 4I7FA 4BXFA 1M1KO 3WHCA 3FX3A 3H3UA 4BQLA 2JVHA 1FIPA 2O7OA 1VQMN 2QKKA 4BC3A 3KZBA 2ZWHA 1ZGWA 1H0MA 4QCLA 2ZF5O 1VRTA 4G12A 3RSEB 2HKXA 4JX6A 4BROA 3ZT1A 1YW9A 3RTRA 3WHBA 4XH5A 2WAQN 4K43A 1S29A 5C10A 4D1QA 5DM6L 2L7FP 2YI1A 3E9LA 1RT4A 5E17F 3K6GA 1TWHJ 4D7NA 3S41A 2CW0F 4FASD 4CZEA 1VQ8N 2CUJA 4LJZF 1E4GT 3AV9A 1XGNA 2IBDA 2DTRA 2XF7A 3VQ5A 3I5UA 2XAUA 2YU9J 4RMNA 5ED4A 3EYIA 4L9NA 4BY9C 5EX5A 2JRTA 2HWVA 4I99C 4HBLA 1K8KB 2ZCWA 3IKTA 4YOYA 1W2BM 4ZHRA 2CH5A 2O5RA 2R5YB 5KHDA 3I8DA 3IWZA 3UKRB 1FBUA 4XRFA 1VQNI 3TO6A 5GAHP 2ICWG 3HP6A 1ITYA 2G8KA 4IO9F 2XY8A 2O9LA 4GY2B 2IJLA 1LOTB 4XLAA 2ITGA 4JKDA 4UHTA 2H8RA 1HCRA 4IVNA 4A0ZA 1KVCA 2KPMA 1B6AA 1GOBA 4H0XB 2R0QC 3ZETA 2JA8J 3VENA 1DKGD 1JJ6C 2QA4I 5IWAK 2WBMA 4AHTA 1K73O 2W7NA 3FXJA 3VOEA 1BIAA 4KIFA 1TP4A 3ZQIA 1XSXA 5C0YA 1IXSB 4PKIA 2WY7Q 1T05A 2CH0A 5JMVA 1SFXA 4A2AA 1YJWN 4HX4A 3MWMA 4CI6A 5AZJA 4F92B 3TU5A 5E3NA 1QRYA 1MDUB 3IG1A 1YIOA 3TP3A 2M30A 3D6RA 4XLPF 1S9HA 3ZSWA 4D5FA 3E3VA 1TKTA 4O44A 5GAEJ 2XDVA 2WWYA 2F5EA 5IP9J 2CUEA 1Z67A 4GYIA 5HLGA 1VF9A 3KK1A 4U88A 4L5IA 2H1KA 3LQQA 2E2NA 3THYB 3OYJA 2YHYA 4L9VA 3CO7C 1Q8IA 4OX9K 1SEUA 4FJHA 2F4MB 3ALYA 1U04A 2FXUA 4CD1A 5D4RA 4J2AA 2COBA 3GEZA 2BHYA 3VN5A 2YKMA 2V1XA 3QWLA 4A5MA 2LKXA 3KEYA 1UA1A 2E6LA 4JI1K 5FPEA 3WE2A 1LPQA 3I4PA 4IBNA 2K27A 2J5OA 3NWTA 5LLQA 2HQNA 4H4KC 3RMBA 4DNCA 3AG1H 4BDYA 1BW5A 2XIGA 3F73A 2ZSIB 2A69F 4DTUA 3F0CA 2ZD1A 3NGYA 3LDLA 3KK2A 4Y17A 2P9PB 2Y31A 3V81A 4B1VA 4A3MJ 2CV2A 2DFIA 1HW1A 4KISA 1TWGJ 3L9FA 4BYYA 2HHSA 3A5LC 5GP9A 2YV0X 1JLQA 2AQEA 3GXOA 3EEQA 2XSDC 1BW6A 4TSXA 3E6CC 3LDPA 1HQEA 3F8MA 3ZOBA 1N8RO 3TAQA 4FXDA 1X2MA 4AYBN 3PX6A 3QAHA 1IH7A 1KTQA 3DTEA 4QS9A 2HHWA 1VQON 1TT0A 3T8RA 4DQIA 3NF9A 3BR6A 2VG6A 3KZYA 4KNYA 4JHDB 3I54A 2Q8KA 3CFRA 4NDLA 5FPDA 3AA2A 2E2PA 4RWTA 3ULEA 3VGKA 1RGIA 3ZX3A 3MKWB 4XH4A 2XGCA 3EETA 5AQYA 4ILGB 1FZPB 4CEDA 3HM8A 1MBGA 1YX3A 2MSYA 1QPIA 5K1YA 3DLBA 3FF5A 1HSJA 4YEJA 5SZTA 4AU7A 3C1DA 4NHJA 2H6BA 3TOBA 1SVOA 4CHQA 3DEWA 2ZKZA 3K4CA 2WADA 4CCOA 4BRFA 3H3VK 1V5EA 2NVUB 4LH4A 2K4BA 2FD5A 3N97A 5J1EA 4LD5A 4JKGA 4YORA 4DOZA 4E7SA 2NOGA 1JHHA 1K4SA 1KLMA 5FKMA 3D5LA 4FWRA 4EQQA 1J75A 1CZBA 3JREA 2MD5A 3JRCA 4CEEA 2A42A 2CS3A 3LAPA 2UXBK 3JSOA 2YHAA 2WONA 2RE2A 2FA5A 4DTRA 3FXLA 1XGSA 3VQ7A 2PFUA 4ZJZA 2QYOA 4DFPA 3HT3A 2GA1A 1HNVA 5EG0B 1YITI 4HLXA 1VQNN 1N75A 1X3UA 4CJEA 5CLSA 3LAJA 3F9MA 1C0GA 2DK5A 4G6DA 2QQAA 1NK8A 3O6BB 3SQ4A 2X51A 3W6KB 2HOTA 2F8TA 4EIAA 3A01B 3NCIA 5GINA 2QWNA 2QA4N 2BY1A 3CPEA 4HVJA 5LHGA 3D2EA 3RKYA 2O8DB 1Z0XA 3V1OA 5F1XA 2MG4A 4CHOA 3MEXA 4XK4A 2HQ5A 3GFLA 4OKJA 1CF7A 2JQ7A 4BRAA 1A04A 4D0PA 2PJPA 3HOYJ 2K40A 3KP6A 5C3EJ 5HDKA 2E2IJ 4IEJA 3V9SA 1BOAA 2QCOA 4OO1J 4O8KA 2OQRA 1U9NA 1GLBG 2PFBA 2TCTA 3Q9VA 1BC8C 5EZHA 1BU6O 5F0CA 3SUNA 2WA0A 4HCCA 5JVTA 3LNQA 5LL6Z 4O0IA 2PJRB 1ZYQA 2ZJQL 2HYFA 1RUOA 3TAPA 2UZKA 4WXCA 3H9JA 2XHBA 2L9RA 3IUOA 3HL8A 3SAFA 1DP7P 2X9DA 1RKTA 4WWCA 3AARA 1ORKA 5AFUA 4I6MA 1RBUA 4K25A 5AQVA 1ZREA 1MBHA 4XEIA 4JAXA 4YOTA 3KHYA 3TO7A 2M3AA 1DLOA 3SCXA 1IDYA 4UV8A 4B1XB 3FIWA 4H5WA 3VEZA 1B9NA 2CGPA 5LMUK 3M8EA 1AKHB 4A69C 2QWLA 1HDDC 4N9IA 2FEZA 2G7HA 3AAQA 3T1BA 1RCHA 4CJFA 1QNTA 3AA3A 5KI6A 1TVRA 4LSLA 3H1VX 1HJRA 1LVKA 1YRNA 2ZXJA 3V9ZA 4KV8A 4CK2A 2Q2EA 3VPZA 5J40A 3BPXA 5LGNA 2HYJA 4AHUA 2KZZA 2QSGX 4CEFA 2PZSA 4IEEA 1B9DA 4XR6A 1NGDA 2G8IA 4GNIA 2JRMA 3TARA 1EQYA 3J80Z 2P9NA 2ASOA 1RKWA 4MQ3A 4C3HJ 3P9IA 1OYIA 3WEEA 5AQLA 3KX2A 4XICA 4Y33A 3OL3A 1SD6A 4FJNA 3FBNB 1FEXA 4RW9A 2Y75A 3RTVA 1Z91A 2FUG2 4K2EA 3H92A 1K6OA 3IMXA 1B92A 3CMEI 3MXIA 1LDKB 5IP6A 2O6GE 2E36A 1S1UA 1B9FA 1B8IB 5AIQA 5L3CA 1Z26A 5J4YA 3LAKA 2PBDA 2DMTA 2B6AA 5HRSA 3NWSA 1G3YA 1D8JA 2NRTA 1TKXA 3CJAA 3L3VA 2DA6A 1O3RA 1HDPA 1QVUA 1FMWA 2UXNA 2KRFA 4KAZA 1B1BA 4DBRA 5J47A 2GBYA 5TKWA 1XN7A 3O3HA 3HOSA 4M3ZA 3KKSA 4XKBA 4IFEA 3V7RA 4M9ZA 3CCEN 1OCOH 1W5SA 2FMYA 2NRWA 3G6EI 4LK0F 4XOPA 1D4XA 1HKCA 3MN9A 1YITN 4Z2YA 1BBYA 3FKIJ 4FJ9A 2E1CA 3MCAB 2OPPA 2M87A 3KLEA 3RZDJ 4DB3A 4UXNA 3JR9A 2L9NA 3KP4A 1X9MA 3U1DA 5A2QO 4FWOA 2XSJC 3IKMA 4ILJA 3KEOA 2A61A 3V7CA 3SQ1A 4OINF 2COMA 1P7IA 1R1VA 3BDPA 4BDZA 1D1AA 3A8YA 4CJ4A 3CHWA 3FE1A 3IAM2 4WCGA 1TUUA 1SUQA 3SMPA 3CC2I 5BPIA 4ID1A 2OJED 4DBQA 5AQMA 4RM3A 3BCBA 1XCBA 1OPCA 2ZFWA 2DAOA 4DQSA 2D45A 3TI0A 4A3LJ 1I5ZA 5AQIA 3DPTA 2LF8A 3IV5A 2A05A 2RN2A 3RR8A 5AQHA 2WB1A 4MFDA 1NHAA 5JVGF 3VMFB 3OOUA 4FLZA 4O5FA 1I3AA 5BR9A 1EO1A 3K1PA 3RQIA 4CHPA 5AONA 5M1NA 5KGWA 3NF8A 4CCKA 4JBAA 3U21A 2LREA 3NEUA 3GL1A 3HPOA 3G0ZA 5D8LB 2CYYA 2YNHA 4A0YA 3K7AJ 1TK5A 1HYZA 4U87A 2CGLA 3U3YA 2VBWA 1W97L 3OYEA 4JKBA 3QFUA 3GBTA 4I2PA 2YHWA 2FBKA 2OC6A 2AXTC 3U3GA 4WQ5A 2DO7A 3MVPA 1U78A 4UUSB 4ZDLA 3THVA 3IH2A 4DR5K 4K42A 2M0MA 4XRSA 1Y0NA 2GWKA 1QTMA 5T7BA 2AQFA 2Q0OA 3OYHA 2V4JC 2JWLA 3J7ZO 1YTUA 3QQAA 2FQ4A 3HOUJ 2A3SA 4Y3OA 2Z33A 2L5QA 4HNUA 2LLKA 3C6TA 4A12A 4JKEA 3ZN1A 3GYHX 3LL7A 2R7QA 3QFPA 4IOCF 1E3MA 2YHXA 3F8NA 1LFBA 4A5NA 1YI2I 3OIQA 2F4IA 4KMFA 2VODA 5FRMA 2OQGA 1ZBHA 4FJXA 3NAEA 2PMUA 1SQKA 1KGSA 2BTFA 1D0YA 4DU4A 4OIRF 1DTQA 3VFZA 5IY5H 1OLTA 4XSXF 3CJNA 3W2AA 1ZRFA 4MTDA 4NC6A 3QINA 2HPMA 3CMEN 4CZCA 1A35A 3CC4I 4FWPA 3FWEA 1TL1A 5I9EB 4X62K 5F2RA 4CICA 4GFBA 4K41A 3ZQQA 4IHYA 1I3QJ 2RQQA 3C7JA 1RIOH 1T8EA 4W5NA 1O3TA 4FK4A 2GUPA 4KN7X 1QHAA 2FSNA 1CZAN 5HLIA 2CV1A 3ZYYX 1BJAA 1FTTA 5JS2A 4XORA 3K70D 1APLC 1KYWA 3NDKA 2FSKA 2LOOA 1L3TA 2Q1NA 1JKOC 5KRTA 5M5WJ 4EP4A 1TWCJ 4CVNE 1ZBFA 1S5LC 1IN4A 1T6DA 2ECCA 1WJ5A 1NG6A 1BA5A 2JUGA 4BU2A 2O61A 3DPLC 3LSJA 2M8GX 3VQPA 1WKMA 2FU4A 3MKLA 2Z9OA 4ISFA 3M8QA 3UKGA 4FM0A 4PL7A 2P9SA 3JRGA 3ZMVA 1QGPA 3KLGA 1XHXA 4PUSA 2H3GX 3G6EN 3OJUA 1NKEA 1OCTC 3UKUB 2V7FA 3B6AA 2LY1A 4M63C 2ZJPL 3V7SA 2ZO4A 3BLYA 4PWDA 4HF1A 4UQGA 4Z94A 4HUGA 5HLHA 1TTYA 3F6VA 4OPAA 2VC0A 3MN5A 2TRTA 3QBWA 4CEZA 4DYRA 4WF2A 4B43A 4KIGA 2EZHA 4A3JJ 2OA4A 2I8DA 5EOYA 2GM4A 1T44A 4CJSA 3DCFA 4C2MJ 2Z1GA 2BHZA 4GVEA 3KYDB 2W24A 1WHUA 3BJOA 2R92J 1YVUA 1U8BA 5LRRA 2HDCA 1IKXA 1HJOA 3VGMA 3CC2N 2X74A 3K2PA 2LRDA 2VASA 3ZSZA 1WQ2A 5CQEA 2HQAA 3CCYA 3HM9A 4F4KA 2BBYA 2O8BA 4RB1A 1SV5A 1QBJA 3ASNH 3VQBA 2B5JA 2IS1A 2ZXHA 1HYVA 5CVJA 2QBYA 2YPRA 1LJ9A 3M9AA 3GCMA 1ETWA 4AHSA 4JS4A 3JTGA 3DKYA 4BJ6C 3OR2C 5L3EA 4KHNA 3V1QA 2CQKA 5BN8A 3DLGA 1RETA 3BF3A 2MLKA 2O8EB 2HF4A 1IN8A 3WTXC 1OFCX 4ZYGA 3B6OA 1FP1D 4NB5A 4B3AA 1ZBSA 1Y8QB 2HXOA 3HHHA 4LLGF 4WX9A 3GW2A 1OCZH 3NAUA 4FJMA 4DV4K 1FWZA 3RCOA 3VTHA 1P4XA 4CF1A 4MDBA 2CRGA 2DDAA 1MBEA 4C23A 1X4OA 1YW7A 3LP2A 5J2NA 2XRLA 1WNSA 3CMMA 4CIGA 2VE8A 2G8VA 2P9UA 5B66C 1WAJA 1WI3A 3O9TA 3M6GA 2HMIA 1FYKA 5HRPA 5AQTA 2JA5J 2QXLA 1LUJB 3CJ7A 1TBXA 4KB0A 4M6YA 2OANA 3BY5A 3EQLF 3G2BA 3G25A 4LG0B 3V4IA 5KPTA 4CXFA 2PYLA 2XRIA 3MX2A 2VGMA 1KAYA 3TWHA 1YT3A 1XNQK 2UUZA 5J1YA 4K0KK 3DEUA 4CCLA 1S6QA 3C7NA 1B4AA 3ZQGA 2BYVE 1IW7F 3UNGC 3P7NA 1JTXA 4FK0A 2N8GA 1YI2N 2DY4A 3EUHC 1NGJA 5C2FA 3VEXA 4LF9K 4FWSA 1Z77A 3ISPA 1JJ8C 2Z1HA 1H88C 2DFHA 2VT2A 3AO1A 3D0PA 5DCMB 4P55A 3KLFA 2F5CA 4C1NK 1RNLA 1O7LA 5ILVA 4IXCA 4DQQA 1N33K 2XPWA 1YO5C 3CC4N 1YOVB 4NYFA 1TAUA 2DDBA 5C44J 1QQIA 4FK2A 3I59B 2R7VA 3A1YA 1D3YA 3FMSA 5FLXK 4NYNA 2R7UA 4HHTA 3RYPA 3T7ZA 1D5YA 1Q9XA 3O4QA 3SYTA 1OCPA 5IYBJ 1NK2P 3BF1A 3HTVA 1HQUA 2KFNA 4OVLA 3S93A 3CF5L 4Q5SF 2DA4A 3E9PA 1E0EA 1T98A 1WJBA 4DWIA 3ZEUA 1MJAA 2VB6A 5FFXA 3J7AP 1DEJA 3DF8A 2H27A 5E18F 5AQJA 3V4GA 1OCCH 3OYGA 4CK1A 3KWGA 3QO9A 4XKWA 1HNIA 3BDDA 2JVGA 3T69A 2GUIA 4GV9A 3KETA 3MN6A 2RC4A 4YDUC 2EFWA 1S7AA 4H03B 1L3VA 5JLHA 1RTHA 2LYCA 1J2XA 3FZKA 3FZVA 3DEEA 2O03A 2ID3A 2YU3A 3SZ2A 2EWSA 1K78B 1VSEA 2X85A 3H08A 1BA0A 3M8JA 3UR3C 1X19A 3LFUA 4M3FA 2LKSA 3W2WA 3CCVI 2KT0A 4FLYA 4LK1F 3CJCA 3VEOA 2NRRA 3DBRB 2I10A 2CW8A 2M0CA 2GXGA 1SZ2A 2V51B 1NMNA 2RV8A 4BVOA 4GV3A 2VKVA 4W1UA 2VBYA 3AA5X 1TK8A 4F8RA 3ZSYA 4V2GA 1JXEA 3SZTA 1W36D 1Z1DA 1JGGA 1STZA 4P96A 5EF6A 5TISC 3ZR8X 2GQQA 4LF6K 5TRDA 4I01A 3VQDA 4GMJB 1RTIA 3ATVA 1NH3A 3PO3J 3WT0A 1HXDA 1K4TA 2UUBK 3OV8A 2ITMA 1YIJI 4ELTA 2KIQA 2VJIA 1YE9A 1JHFA 4NCGA 5AZJB 2DI3A 2H6CA 2EV0A 3EKUA 1UAAA 5L3BA 2O8FA 1E3HA 2ZC2A 2HOSA 3OSFA 2FE3A 1YJNI 2BVLA 4LF5K 1C1AA 4WQ4C 5JHUA 2ZJRL 4O55A 1J53A 1A5XA 1BWFO 2BZTA 2BY2A 3TANA 1YW8A 1NM1A 1U5TA 1HA8A 1P9QC 1U6ZA 3P38A 4CYCA 5M1FA 2R7RA 5EEHA 1S9GA 1XDUA 3NGZA 4YHHK 5E1XA 1VQ5I 1TQIA 1NK6A 3HO1A 2ESNA 1D8YA 3NF6A 4I9LA 2E1ZA 3PQJA 1J5YA 3VQEA 4CK3A 2IXSA 1U4BA 4Y1CA 1KU3A 1ETVA 1X9SA 3CM6A 4M9XA 3SFIA 1EJ9A 3SUQA 4CD3A 2DTUA 1USSA 4WFBL 3HYFA 5DM6F 1N34K 1RDDA 1IKYA 3AVHA 2DN0A 1X1PA 5DD4A 4XLHA 1GHCA 1LAVA 3LSIA 3KD5E 1SD4A 5LBQA 1DGWY 1Y6IA 4H5RA 2L3DA 1FBSA 4N47A 1HYSA 3BP8A 4G8XA 4UY8O 5JLXA 2DJNA 2HNDA 3JRHA 1VK0A 5FD5A 3PUFA 4EZ9A 3H3ZA 4KA4A 3JW4A 2EILH 2QSHX 3HKZA 2VWKA 3GWZA 2NRXA 2FSJA 2XAGA 4CCHA 1SKRA 2A6HF 2CSOA 2V6EA 1GLNA 4JYAK 1I94K 2FF4A 5ELZA 2O3FA 4KITB 2OF7A 5HOOA 3TPQA 1MZBA 4RTFD 3QETA 4MFEA 3AVBA 4CJ5A 3CLQA 3PY8A 4JX5A 3BCAA 2JWKA 1WAFA 4G6TB 3ULEB 1SKWA 1ENHA 3S3MA 3FM3A 1O3QA 3S2HJ 3Q7CA 3OW2M 2KISA 2LH9A 3C18A 2O8XA 5B3SH 4B3SK 1BUPA 1E4FT 1VQLI 5D3GA 2G8WA 1DQUA 5GADJ 1TK0A 5BPMA 1QE1A 4PSXA 1QVFM 5HBMA 2DT6A 5M3FJ 4KRFA 2G9WA 4N4OB 2R7WA 5KK1A 4B1ZA 2HHQA 4PA1A 4X64K 2E60A 2CQXA 2LBFA 3S1NJ 4QS8A 4CGIA 4CJPA 3LALA 4JKGB 3QU6A 3G1OA 2CUZA 3OY9A 3CCSI 1D5AA 1J9AA 1MW7A 1CGPA 3QNOA 3MD2A 4BR9A 3QP5A 5F08A 3RQ4A 2CGKA 2QGUA 1WJDA 5CY4A 3O1BA 3FLCO 1BL0A 5GIOA 1G15A 5FKOA 3C65A 5ICGA 5AFUH 4IX7A 1DGRM 4EGYA 1R00A 3HJEA 2CU7A 1H1VA 2Z3YA 4F3QA 1U47A 1A5WA 3DXKA 3SFZA 2KRHA 2V1NA 1I6HJ 3VEPA 3CCVN 4PK4A 3H45C 3C94A 3HOVJ 3M07A 1TKZA 4Z4IA 1G4DA 2IVMA 5F0XA 3DKXA 3EPZA 1UOCA 3W0LA 3HDDA 1DP3A 4KHSA 3OWTA 1KFDA 1F21A 4NBQA 2Q31A 3D2EB 1ASUA 3BG6A 2JA6J 1XC3A 1KXPA 1CF7B 4XN3A 1Y8RB 3Q0VA 3LSKA 4R8HA 4Q4ZF 1IG8A 5M1PA 3C2GA 4H0VB 3A4CA 1YIJN 4CBUA 1SMYF 1TW3A 1YF5L 1S1WA 1QHTA 3H35A 5IPAA 3GTOJ 2OPSA 1BC7C 5E20A 1QSSA 1R59O 3L2CA 4KTZA 2UYTA 3NMUA 1R71A 4IJNA 3ENOA 1YJNN 1TNTA 3M3YJ 3A5OC 3OA9A 3BJ6A 3N4QA 4LB5A 1F36A 3KFWX 3V9XA 3AA4A 2E2HJ 1TYQA 3VF6A 3CPWM 3HSRA 4DUYK 1BI2A 4ABZA 5BPNA 4DUZK 2QQ9A 4DS5A 1VQ5N 1IGNA 4I6MB 3C6AA 1WSFA 3BEXA 4LC9B 3WNHA 3DU5A 4JKHA 3G71N 4OIQF 1C6VA 1DPRA 2HZTA 3BR5A 3PSFA 3AG2H 3THWA 2V6CA 1BIZA 3CQXA 2VOOA 3K9JA 2HQRA 1GOCA 3JRDA 1NU0A 3AY9A 1J0RA 1S7EA 3LANA 3I55I 3WG7H 2JN6A 1XGMA 4A2BA 2M7AA 4H0TB 3OVNA 3CJQB 1GLDG 2OBPA 2KRCA 4Y4RA 4YFNF 3MCPA 2RNGA 1WSHA 1JXSA 1G6NA 5F64A 2O4GA 3B8AX 3HTSB 2HTSA 1YRNB 3SJJA 1BI4A 1IBLK 2Q2EB 2OZMA 2GA2A 4XN0A 2P9KA 2OZSA 3RJPA 4MFBA 5JI6A 4XLCA 4R79A 3LA3A 3JRBA 3RVCA 4RB3C 4N41A 3LDQA 2MC4A 2K9MA 2FSWA 4LIVA 3ZSRA 3R6MA 4H4OA 3LDNA 2HBMA 1IRZA 4Y0WA 1WI9A 3AO3A 3P31A 3WEEB 2CQNA 1LEAA 2L7MP 2EIKH 1S1VA 1UMQA 4JK8A 1ZN2A 3VDXA 1VQLN 3ZT3A 5KQDA 2D0BA 1OKRA 4AHRA 1XSVA 1VQKI 2DPNA 1VQ9I 4JKCA 4HTUA 3WXKA 3PV8A 4RAGA 2G8FA 3A5MC 4B1UB 5ILSA 2BVMA 2VG7A 2UV1A 2HFHA 5B1AH 1W0TA 4M74A 1BR4A 3ZCOA 3F8BA 2FF6A 3VEWA 5J8FA 4PJNA 4CZGA 2JMWA 3CUQC 1MKMA 2I5JA 2DA7A 1P7JA 4PSWA 3PO4A 3ABMH 4XIUA 2P8TA 3CCSN 1FMVA 3PM1A 1MBFA 4LOCA 4E1NA 3ZXSA 1MH3A 4JK1X 2E7WA 1NK0A 1LE8A 3SNNA 3FBIB 4I0AA 2ZJQF 1NMDA 3C2HA 3MKZA 5FLVA 4PGHA 1KLNA 2ZJ2A 3QBXA 3CO6C 1NLVA 3FFKB 2E88A 2VQCA 4XM3A 2QKLB 2ELJA 4A3CJ 4RW6A 3SMSA 3A2FA 3ZCMA 1KYZA 3OTOK 4CYDA 5JLWA 3FGUA 4C8MA 4I09A 4EHTA 2AO9A 5AIPA 2OV7A 5BPDA 1R6RA 1EH7A 4CCNA 1V4RA 2NS7A 5IT9O 1HR0K 3F9KA 1WH7A 4P5OA 3VETA 1UWBA 2NXNB 4UUVA 3CUQB 4EEFG 1T6CA 5K5RA 2ISZA 3F22A 2EFOA 1Q18A 3FDYA 3E5XA 3BY6A 4WK8F 3B73A 3RSNA 4DFMA 2KHMA 2V7ZA 3DKWA 3B6PA 5KCMA 2VUMJ 5A2QZ 2MGQA 2HBKA 1RDCA 1R36A 2PMZA 3PJRA 4FLWA 3JYTA 5J2QA 4JS5A 4KT6A 4IXAA 4S0HB 1OH6A 3CCUI 1J59A 1T0FC 1X1AA 1YUWA 2RVCA 4U0YA 1OCRH 5E1WA 3V8KA 2Y0SA 3HXLA 3O9RA 2FBIA 4BKXA 2R3SA 1NGIA 2A40A 3RRHA 2ZNZA 1Z3YA 3GG4A 2LP0A 1K7AA 3DXJF 3M8RA 4EM0B 3U8XA 2BDPA 2LDUA 1XQSC 3EUAA 1NK9A 1V5FA 1UFMA 3FHNA 2HS5A 3R8EA 2Q1ZB 4QS7A 5B5EC 1AU7A 1WPKA 5JR3A 4XKVA 1VZ0A 4B8CA 2X6OA 2FMLA 1LW2A 2RPIA 1RT2A 1H89C 5M1KA 1IC8A 1IKWA 1J9IA 4EJOA 1WSIA 5K7ZA 3O4WA 2MABA 2EJRA 3I55N 4M3YA 3QESA 1FY7A 5E3LA 3CQZJ 5DDGA 1NKBA 2FBHA 1QS4A 1BCOA 4DZJA 3OIPA 1S6PA 2HNHA 3PNTA 4IHWA 3AO5A 5HRNA 3TDZC 3RR7A 3K0LA 2OTJI 3ERMA 3MMVA 3KKRA 5K7HA 1JLBA 4C2UA 4YIIA 4DYCA 3HSCA 3AVAA 1NWKA 3QB0A 5F1RA 2E6MA 4OIPF 4EM1A 2QQ8A 1Z7UA 2XPVA 2V1UA 4B3XA 1K83J 4FE7A 4RB0A 4CEOA 3K4MA 3GF2A 5LRSA 2M45A 2XKPA 1XUPO 1ZYRF 5AQOA 2R93J 1HBXG 3DJCA 3FHZA 2FBTA 1ULYA 4YOWA 4KFBA 5FKLA 4FO0A 1VQKN 5HNHA 4RDUA 1VQ9N 5E26A 3H6EA 1N5YA 2IA2A 3J7YJ 1LW0A 4WYBA 2KJCA 2QWMA 1WSUA 2PYJA 2GLOA 1PDNC 1FSHA 3G1LA 1LNWA 3ZLJA 4ANJA 3CESA 3KLIA 4YELA 2FBYA 2NS8A 1E2XA 3VQ8A 1MMNA 2FOKA 2FC0A 3WXIA 4MEXF 2ZB9A 2V9KA 5ICCA 2LG4A 3TEDA 4U7BA 3T1AA 4Q5VA 1Q9YA 3NH1A 1U0JA 3LWLA 2JZYA 2P81A 1ZQ3P 3L7WA 2R7TA 3AVNA 5GAGJ 1JJ2M 3J80K 2XO7A 4BC2A 1P92A 4ZYHA 4NC8A 4QAGA 3IKVA 3D2FA 5GAEP 3KVGA 1VQ7I 4AM3A 3K0SA 3L2QA 3Q5FA 3RKQA 1IG7A 3MXMA 2B0LA 1JTYA 2BXYA 3LA2A 5LGTA 1MD0A 1YTYA 2Q2RA 1P90A 1R5HA 3OBYA 3A03A 4EJTA 3WNEA 2M1BA 4CERA 3GE1A 2QUFA 2FBVA 3I8BA 3SQNA 4HX8A 1T39A 3HPHA 4BGAA 4M3WA 3KPHA 1G3WA 2QWOA 5DMRA 2NS0A 2EX3A 2FQ3A 3J7AO 4ZYDA 2W1OA 5AZIB 2EV5A 1QQOA 1X1BA 1JLEA 1EA3A 3MXJA 4M41A 3CF2A 1U6GA 3IC7A 1GLEG 2VQHA 2YNGA 3QEWA 1IXCA 5AQWA 4J2DA 3VSLA 2E5LK 4PUOA 3H1CA 2HF3A 2LNBA 3IP4B 4J8FA 3TW6A 5LFAA 3KLHA 4DTXA 1N36K 3I64A 1N6QA 2XF6A 4R5PA 1NGHA 1B72A 2R5ZB 1TLHB 5HNFA 4BR4A 2V7YA 5H20A 4BRKA 5FFZA 2NNYA 5EYRA 1I50J 1BISA 2F5VA 2W25A 1ZRCA 3FXMA 2A07F 2O8BB 2FF3B 1NJZA 3SEQA 3D5SC 4BRHA 4J01A 5EEAA 2R7YA 3CCUN 2HHTA 2A68F 2ZBKA 4B08A 4FWQA 4JI6K 3RPUD 3AL0B 3KD1E 2KZMA 4NC7A 3NRVA 2V79A 2X1DA 4DQ8A 3DM2A 4CFDA 4KREA 2WBNA 3M1CA 3HBTA 1JUSA 3GTKJ 2QI2A 1TGOA 2ETJA 4IHVA 1HNXK 4FZXC 2VQGA 4IDHA 3T0YA 4PJLA 1G59A 5C4XJ 4JN4A 1LFUP 2STWA 4YFKF 5BQTA 4MTEA 2B4JA 3WTUC 1VTNC 3JAMO 3SQ0A 2RF2A 2IGIA 1UELB 1XMAA 3QP6A 1QSYA 1BR1A 2NNNA 4A59A 3QYFA 3K2ZA 1P8ZA 5AQXA 2IC3A 1FP2A 2P9UB 4BQNA 3AKZA 3O3KA 5M5YJ 1CXQA 5CYMA 1RC9A 2XRNA 4CECA 3T3FA 1FSEA 5FDLA 2F7TA 4BGDA 4FLVA 3LAMA 1WJAA 3LZJA 2NLXA 2UXDK 1USTA 4BEHB 1Y39A 3HRUA 4DR7K 4LFBK 3MEDA 5M3MJ 4IHTA 2P5KA 4CEBA 4FJKA 3QOEA 2OTJN 3CQ8A 1DGKN 4M71A 3RIRA 1IN5A 4JLHA 2JUCA 1LDJA 1XTAA 4FM1A 3C7NB 3RZOJ 4BXXJ 3HKZN 2ZJPF 3CERA 3KIOA 3K58A 3FKJA 3HC7A 4AVZA 4AVPA 4S04A 2HSTA 3FXQA 2ASPA 2IIRA 3HUGA 4L3QA 4NCAA 1FLIA 3WXLA 2CQ7A 3SV4A 2Y2ZA 2VQLA 2XAFA 4G7ZF 1MSFC 2V52B 3IFRA 3QEVA 2CV0A 4IDKA 4LFAK 4DJAA 3IRRA 2YS9A 1W7PB 1VSLA 3P83D 1ZGJA 1J5EK 2HVQA 3WGHA 3I3LA 2CFOA 4OKEA 4RGXA 4Y7NJ 4JP0A 4M9SA 4O4GA 2CMPA 5E1ZB 2F6CA 1HW2A 2I7PA 3CYMA 4MLHA 3MN2A 1ESVA 3O8HA 2CQQA 4ID5A 4CHYA 1OISA 2XB5A 2VCPA 1ZHFA 1RZ4A 1MIJA 1Y97A 3ENBA 4OLBA 1QHHD 3ZEUB 1VQ7N 1O13A 1WGXA 3S15J 4D7MA 1ZXOA 3QERA 3SHFA 1RT3A 2ASMA 1DU6A 1XS9A 4ZDPA 4YOVA 2XHKA 2XKOA 4EHUA 1TNSA 1JLFA 1WFXA 1ZELA 2P4WA 2OU2A 5ILUA 4NXNK 4QWQA 3F23A 1C1BA 4IWVA 1RRJA 4DTMA 4YFXF 1U2VA 5K5QA 2KL4A 4LF7K 3GTGJ 3MCZA 3EE9A 4O8UA 1IN6A 4UV9A 2K3PA 1C0FA 2M2EA 5H6QA 3S1RJ 3DTKA 2A5WA 1JI8A 1RT1A 3B6CA 3C6UA 1BGXT 2DA1A 2L4AA 3OSGA 1NKCA 2VIXA 4RGRA 2E20A 1WJCA 3BZKA 2Y1JA 4L0ZB 1IV8A 3R1XA 2A1RA 1AWCA 3EE8A 1WH5A 1JLCA 4XLFA 3DV8A 4UB8C 1ZTRA 1UG2A 1B8IA 2FNPA 4KMUX 2D5RA 3MEEA 4FLUA 4EFHA 1SAXA 2A6EF 3U9ZA 1BQNA 2XAHA 4I98B 4YG2F 4FWKA 3FZHA 4CHNA 3WG9A 1S8NA 2VI6A 4OWRB 4DV1K 2DOEA 4A0XA 1BJZA 4RA2A 3HG9A 2F4VK 1X4PA 1HQCA 2O8FB 2YX7A 3LWFA 2MW8A 1C1CA 3OIOA 4C3JJ 3VYUB 3Q0UA 3ZX2A 5B8HA 4RAFA 1U5TB 2KP6A 5F0FA 3IRXA 1N78A 2VKDA 4DF8A 4CYCB 5EGOA 4FL9A 1R23A 3KP3A 2BY3A 5DK5A 3U9GA 5L3DA 4S05A 5LD2C 1HW5A 3CCEI 4GV6A 4A2UA 4ZYAA 2EH3A 1S1XA 3ZSXA 2XGDA 1J09A 3ABLH 5TGTA 4J2EA 4H0OA 2YNFA 4FM2A 2D0PA 4B1RA 4M42A 4DR3K 5EVZA 1N32K 3VSKA 2ETHA 3LWMA 3TTFA 2UWMA 4BHCA 3MDQA 4RGUA 2X6NA 3G1MA 2JA2A 4G9YA 1WZ2A 3JSMA 1JCFA 1W7AA 3TAMA 4BBSJ 2V9VA 5C4JJ 3DLEA 3HXMA 1YHQI 2L01A 4M3DA 2JSPA 3H3NO 2YR2A 1KQ0A 4BR5A 5AQKA 5CYVA 3ZRGA 4KI4A 3QU3A 4DSJA 3A0BC 2QQBA 5CVIA 3I33A 2D4WA 1RBRA 3WU2C 3MEGA 3PUBA 3EO3A 3Q0WA 3W3CA 2WV1A 2IA1A 3QEPA 4HLYA 2M4KA 2E34A 1QPMA 3K5MA 1Y64A 3I56I 3QEIA 3O9QA 1SL1A 4H4MA 1E3OC 5CJ9A 3VB2A 3RKWA 2KIMA 2ZXWH 2KDZA 4D5CA 2HYGD 1TL3A 4G1QA 1A31A 3R3LA 2VQEK 1FOYA 1TC3C 3EYZA 4PCQA 3HP9A 2QSFX 3QPHA 4CGZA 3BPVA 3ATUA 2XGEA 4JI2K 4BJTA 2LF7A 4C1NI 2KDOA 4MO5A 4PKHA 3BTIA 5HODA 4HSRA 1YTAA 1VNDA 1UAXA 1K61A 3SZGA 4JYKA 2ELKA 4NQWB 2P6TA 3G10A 3WTWC 4BVPA 2QWPA 1SKSA 3ZQHA 5CVVA 3CJ1A 5F27A 3AAPA 2LBFB 3I4NJ 3FMQA 1IAWA 3PL8A 2HNZA 4RS8A 3THXA 1T6SA 2L4MA 2EFNA 4CA0A 5GPCA 2HBLA 3EZWA 2EFQA 3P9CA 4LLLA 2GX9A 3V9WA 2KTQA 3OYKA 3NGIA 3FXUA 1WOQA 3BOQA 1POGA 2W4SA 4LH5A 4LFUA 4OOIA 5FKKA 2ZJRF 1IV6A 1H9GA 1P4AA 4ZC3A 4CZFA 5K5OA 3F8FA 1JUMA 2HGCA 4I6ZA 4YIFA 2GXAA 4IOAL 4JI0K 3VQ4A 2E2JJ 4IJAA 1RBTA 3V6DA 2C6YA 1QA6A 4JK9A 3MMYB 4HSTA 4BE1A 4HV6A 4OAYA 3DXKB 2Y9ZA 3M7GA 2ME6A 1SC7A 1T8IA 1NBWA 4QOZB 2B9SA 3NE6A 4ISGA 1PJRA 2K9QA 4BRDA 4DCHA 2XAQA 2DOAA 2D1KA 5FPNA 1IF1A 3VEVA 1RBSA 4KH5A 3K4NA 2MD0A 3ZSVA 4XL9A 2MA3A 4B3RK 1XC5A 4KB1A 3LQRA 3M8PA 4IQJA 5J6XA 2L7ZA 3TMOA 4BC4A 5FRNA 3SJMA 2VG5A 5ADXA 4I76A 4FVMA 1VSKA 2VWBA 4LITA 4MO4A 5I42A 2YSRA 1QVTA 1GLLO 1DPUA 1IJWC 2NRAC 3K1MA 4J00A 3D0SA 1RDAA 4CF8A 4AIKA 4BQAA 2VLAA 3WGIA 1BHLA 4AM6A 1WB9A 5FJ8J 5KGXA 3L00A 2BE5F 4B47A 1RDWX 1T56A 2PLYA 1MDMB 2DYRH 1TYQB 2WOMA 3K9TA 1R58A 2IW5A 1OMIA 2YJFA 4LSNA 4XH1A 4MNUA 4CZKA 5BN9A 5IYDJ 4PJ0C 2FBXA 3T1YK 3N05A 4HQMA 2LSNA 4QSHA 1X3ZB 4DW6A 4DR1K 1ZRDA 5DS9A 3EUKL 3PNYA 1H9TA 3AO4A 1EWRA 1A6IA 3AVLA 1W0UA 3THWB 2QKBA 1OJLA 3ML6A 1QHGA 3F2KA 1JKRC 1YHQN 3J7ZI 4O5BA 4Y13A 1VSHA 3U1KA 2X0LA 2V1DA 2P5LC 4KH6A 4IEIA 2WAFA 4M3GA 3V42A 1OVQA 4C3IJ 1QO0D 4O5VA 1LFPA 4RLQA 4L9TA 3CCMI 3CFPA 1MWMA 3WE3A 1SL2A 1BN5A 4FJ7A 2DJIA 1BI4B 1W5CC 1YVNA 1R9TJ 4Q48A 2P9KB 5IOYA 5AQPA 4ESBA 3I56N 4FJJA 3LSTA 3PSIA 4CEQA 1X2NA 4CDGA 3KP2A 1GXPA 2Q97A 1ASVA 3BC8A 2O8EA 1NJWA 5ERIA 3ZX0A 4JK7A 3TSQA 2GWRA 3G73A 3KK3A 2GELA 1T3VA 4I2OA 3BWGA 3CDLA 1SMTA 1NGAA 3GBGA 2OTLI 3CP2A 3GLXA 3SQ2A 1KFSA 3J81O 4EV0A 2Z1JA 2W6LA 4A3BJ 2P1JA 2BXZA 3WU0A 2P9LB 4CF0A 3VQCA 3LM9A 4B44A 2F9TA 4HCBA 4KHUA 4UNOA 3HZJA 2HB5A 3SDGA 4DTSA 4Z4GA 1MBKA 2A5YB 3K5NA 4FJGA 4AF1A 3GTLJ 4E6KG 3C3WA 2DMNA 1A5VA 4ICLA 3H3OB 3C2BA 4C8OA 2GIVA 1D8KA 2M5WA 2CH6A 2YHBA 1Q86O 3FXOA 1W1WE 2L7KA 1DU0A 4BE0A 2DYSH 3U6FA 4JD2A 1IXRC 4LG0A 4BQQA 4CZIA 2Q3SA 3VODA 3U9DA 3FM5A 1WUAA 1QVGM 1B9MA 2V26A 1RNHA 2FOWA 1LE8B 3NHGA 2ZMEC 4OLAA 5BRHA 3PIPF 4KFCA 1NGBA 5AQUA 3UB5A 4HUFA 1K8AO 4BG8A 4PZJA 2MC3A 1X1CA 3CDHA 3BR3A 4U67L 3QLHA 4BRIA 3GLLA 5HDNA 3SAGA 3GTQJ 1X3NA 2WY8Q 4BWJA 5EZGA 2PN6A 1CLQA 3VA0A 2ACJA 4N0BA 1BI3A 4TV7A 4BQZA 3GZNB 2LY9A 1L5UA 1NG7A 4KN4X 1KU2A 2DFEA 1X58A 4MEYF 2VN2A 4A3EJ 3LZIA 3LFKA 2E5NA 3HL2A 4CF2A 1IBMK 2A1SA 1K9MO 2X4HA 4F93B 4ON0A 4W5RA 2WC2A 3IHUA 4M3XA 1GVDA 4BHPA 4DSFA 3K57A 1S6LA 3KZZA 4A3GJ 4BRGA 1ERDA 2MYSA 1R1TA 4BR7A 3HHGA 1HX1A 3WQTA 3EKSA 3J8AA 4DV2K 3TAEA 3P39A 3M4OJ 1S22A 1EXQA 2ZMEB 2QM3A 3MZ8A 4ISEA 2ZGZA 4DR4K 2YJEA 5M1OA 2XC7A 5MLCQ 2X1CA 5DM7L 3WQUA 3IAYA 5E3MA 4G6QA 3EUHA 1LQ1A 5AJ3K 5KQ8A 5IT9Z 3M1FA 2GIZA 1ODDA 1ZAOA 4OGCA 3FXRA 5IP7J 2W82A 3O1WA 1OH7A 4C8KA 4QIWN 1EETA 2W85A 4NCBA 2O0YA 2IGKA 1X9JA 1MMAA 4OMYA 4AUXA 1Q1VA 4CJUA 3SXYA 4CE9A 4AILC 3WTZA 4KPYA 5IT3A 4DV3K 2A6TA 4K8ZA 4BJ5C 1ZG5A 4BRMA 2JJ7A 3ULDA 3ZSOA 4AHVA 2HEOA 1QZEA 1V4SA 1K78A 2B7EA 2HVIA 4FSVA 5CE3A 2VQFK 3KCCA 1LVAA 5D5WB 4CFAA 2H1LA 4DQPA 1HUXA 2Q36A 4YRVA 4UB6C 3TABA 2X48A 1BA1A 2G7UA 2JTVA 4PGGA 3RYRA 3ZP5A 4R1HA 2JPBA 1JT0A 1EV7A 2QKMB 2HKOA 4DMNA 3JRIA 5L3FA 4ITVA 3NARA 1HC8A 1D0ZA 3J7AY 4V19K 4ESFA 5H6RA 4PJJA 3CCMN 3KYLA 3HGGA 1FNNA 2F5FA 2JGUA 2R7FA 3I71A 1LDDA 2P6SA 4FT8A 1L3LA 4F3TA 4YDUA 3TO9A 2VGNA 2D2WA 3BT9A 3OYIA 5JLFA 2VKEA 4HG2A 3HB9A 1IDZA 4F9OA 1Z05A 3CJTB 1ZK8A 2EZLA 4O0JA 5CKTA 5FO5A 3WU1B 3MK6A 1SANA 1XMXA 2KIUA 4QPQA 2NRVA 2OTLN 4CEAA 2P9IA 6PAXA 5BR8K 4IPAA 4F52A 2AJQA 2XY5A 1FBQA 2GXBA 1D5VA 2NRHA 3JSPA 1XWLA 2K9NA 1O4XA 4CIEA 1FOKA 3V8JA 5HS7A 1OYWA 1PUFA 1ATSA 1KSPA 1R1UA 2FLOA 3DLLL 3ROUA 3GDQA 3K4JA 3M5RA 3L1PA 3VQ9A 1D9FA 1HPZA 2RKHA 1L3UA 3BR0A 4DHYA 3AG4H 5AQQA 2FNAA 3JRFA 3QYEA 4HX7A 4KUMA 3WUHA 3F72A 3OYMA 3HM5A 4GRIA 2YX6A 1BI1A 2EA4A 2E71A 3V9UA 4AQYK 4FWNA 3VYRB 2ZM6K 3LSHA 1G2HA 2TDXA 5D5UB 4M6VA 4OPKA 3D2FB 3M1EA 4B8AB 1LEBA 2XASA 2V9PA 1QU3A 3K4LA 2OCCH 4WQ4A 3VGLA 5HDGA 3OOPA 5C25A 1HKTA 4E3SA 4AIDA 4YOXA 3O9SA 3R9PA 2MH9A 4CCMA 3QNNA 2MFZA 3ZN0A 4FX4A 3ASOH 1Y1WJ 1VSFA 5GIPA 3TTCA 2D1HA 4C2TA 2WV0A 5TKYA 1I27A 2VXDA 3E5QA 1UB9A 1N77A 2Z99A 2X1EA 1NK5A 3K59A 1IRGA 4DSIA 1XI1A 4AM7A 2AHQA 4DSLA 2W41A 4CZMA 4QLCU 3JXUA 2Y69H 2A41A 3QIOA 1SFOJ 3C0BA 1RR7A 1XNRK 1RTJA 3QOPA 4MGRA 5ICFA 1JKQC 1XMOK 3E97A 1YG2A 4FLXA 4LMYA 2H09A 1M1EB 5FGMA 3DOKA 3A02A 3RPQA 1B72B 2XGXA 2MLGA 1X1DA 2DK8A 2HI3A 4GKKK 4WXHA 2O8CA 1LB2A 4L9JA 5AQZA 1SFUA 3GZ5A 1S1TA 4B9LA 2E4LA 3VQAA 3H5RA 2B63J 3DQVC 3IDHA 2NAZA 4EM2A 5GAHJ 3FMRA 3RKXA 2E8AA 3OYCA 5JICA 1X9WA 4RB2C 4KBOA 1ZKGA 2P7CB 5EDNA 1W0HA 3DWLE 3UIQA 4ESJA 1MNMC 3RI4A 2EHGA 3MZYA 1GXQA 3S9HA 4B1WB 1D1CA 5GADP 1U3EM 2P5OA 4DS4A 4B8XA 4MQVA 2LSOA 4YNQA 3KK7A 2F48A 5E41A 2JWTA 1OH8A 1FKPA 3MWTA 5A2QK 1LWCA 3S2WA 1NGGA 4GKJK 2ZSHB 3LP0A 1RR8C 3QEXA 3JCUC 3ZMSA 1W9HA 2QWQA 3Q7BA 5HRRA 1LCUA 2VBXA 4DTPA 3LOCA 3DU6A 4DR2K 1IV0A 1ZH5A 3D7EO 3HK2A 1F1ZA 4CGHA 1LV5A 5GTHC 2BEOA 4P1WA 3CMAI 5LY3A 1RTDA 4JI4K 3AVJA 1W4MA 3TP0A 3JAMZ 5KAIC 3HRMA 3AVFA 3TKYA 4DV6K 3DAWA 2BY0A 4UY8I 2GV9A 1AA7A 3CCLI 3ZETB 5SWMA 2L0KA 2BV6A 3BROA 3O80A 2DT5A 3ECHA 4KHQA 3RMDA 1ZGAA 2F2EA 3ECOA 1L0OC 3R0JA 5EJCA 1WBBA 4PHTX 4PFOA 2XV4S 1KONA 2Y9YA 1OQYA 4FETA 3J81K 3BUZB 4CF9A 3HUGB 2DW4A 1KVBA 5E84A 2HW3A 5JS1A 4D9JA 3EN9A 1PP7U 4WE1A 3I0RA 3CCQI 3SI6A 1VQ4I 2HHVA 2A5XA 2HVSA 2IRFG 5K7FA 2LR8A 3VQ6A 3OL4A 4Z6YA 1GDTA 4ENJA 4CW7B 3VA3A 1TWFJ 1HSTA 2KFZA 1W5TA 3PLAA 2PBIA 4GVMA 1Z7LA 4PKGA 5KPRA 4YIRX 3F21A 4DV7K 4CGGA 4A6DA 2L02A 3MWPA 4M45A 3WXJA 2IA0A 4EAHD 4RW8A 1IN7A 3W6JB 4A61A 4MDAA 3P5JA 3F6OA 1LWEA 3ID8A 2MH2A 4LLNA 1YQAA 3MQ0A 1V4TA 3W6VA 3O4NA 1ZLJA 5J4VA 3QMLA 3HTUA 2WC9A 1M90O 3FZFA 3G71I 2L54A 2GEMA 4EJVA 2KZGA 2NVTJ 4ZZLA 2IGNA 4I7HA 2PAVA 4DLEA 4XLEA 2DCEA 2M4GA 2OZUA 3T8TA 3DYAA 4F2SA 1A6QA 4WFAL 3GFJA 4C9YA 3HZ6A 5BMZA 1NOYA 3ABKH 4LY7A 1ZBUA 3TSUA 1U2VB 3O3GA 4CZLA 5KVRA 3GVAA 2XROA 1WSEA 2IPQX 5F6FA 2QF7A 2Y30A 1VSIA 3K70C 3H5AA 2HDDA 1HOMA 2I5UA 3BR1A 3I0TA 3VYSB 3K4KA 3LDSA 3NVKA 1O57A 3E01A 1KA8A 2VPRA 2ZXIA 4BUPA 1ZG1A 2EIMH 2KQRA 1SS6A 4IO8A 5BOXA 2DPDA 4IFYA 1Q7YO 1DDNA 4BY1J 1RDUA 3P1GA 3CI5A 1ZBIA 2BUPA 1E3PA 1FTZA 3PIOL 4IRGA 4J19A 4OKKA 2OYQA 1GV2A 5E3OA 1GV5A 3LDOA 3GUDA 3CETA 3KP7A 3S8PA 2HU9A 1B59A 1OYYA 5FLXO 5J3LA 5AQGA 2BW3A 3VESA 2HBJA 2HVRA 3DLAA 3LP3A 4CBXA 3BR2A 3D45A 4E7LA 1Q81O 3REOA 2PI0A 1P6RA 2FRHA 1EH6A 4RW4A 4M72A 2D5VA 2WUSA 1FC3A 2DLLA 3T5XA 2ZE2A 1KQSM 1ITGA 1VHXA 3E5UA 2NRZA 2DA5A 3AAFA 2LD5A 2IEKA 3COAC 2HHHK 2IP2A 4BACA 4OU0A 1BL3A 3SPZA 1GT0C 4KIBA 2AS5F 3N4PA 1KD1O 1EF4A 3AVIA 5E8GA 2VXZA 4M7YA 1GLAG 4IQ4A 2DA2A 5JVHL 1FYMA 1LWFA 3U2RA 1IKVA 5EGOB 9ANTA 2BE2A 4EJWA 4W5TA 3C6HA 4ETSA 1PYVA 1X3WB 3SEZA 4JRPA 5EXWA 2LKPA 3PX4A 3NQOA 3PQKA 4NLCA 1CXUA 4E7KA 2WTEA 4QPOA 4BRNA 1Z6TA 3W2VA 3CUQA 2ID6A 5L3GA 1FIAA 3CMAN 4PJMA 4YOUA 4E7JA 4RAYA 2Z2SB 2FX0A 2F8SA 4L5JA 2CW7A 3OS1A 4HF0A 2DXIA 3W3DA 4DV0K 3NH0A 4NB4A 3K4BA 2VPLA 5DUKA 5CYQA 3CCLN 3RMCA 4HNTA 3TR8A 3CC7I 2X6WA 3RRGA 2ZGYA 4FJLA 3LPTA 5BRFA 2D0OA 3V1RA 3NF7A 3SPYA 2IVOA 2UXXA 3L09A 3L0QA 3QPSA 2P51A 3DLKA 3ZQLA 5C2DA 1U49A 3BZ6A 1S72I 1REPC 5DCFA 3DWLA 1OH5A 2DQRA 2CFXA 4UVCA 5DTDA 5DUIA 3CCQN 4GGGA 1VQ4N 3E9OA 4A6EA 1QSLA 3GO5A 1X3MA 2WB1N 2YUSA 4M3BA 1JKHA 1J7KA 3OHRA 3DXMA 1WCMJ 5C15A 3QIPA 2KQ2A 3RPUA 1XX5A 4B1YB 4CJQA 3K9KA 4DFKA 2DMQA 4BWMA 5F0HA 1EWQA 4RW7A 2VOPA 4IZ9A 4G9ZA 2E1MC 2HMPA 2JPCA 3AG3H 4CIFA 5ADXH 3EL2A 4QTRA 2XPUA 4ASNA 2IGOA 4FZYA 4B9UA 5D5XB 4C8NA 1NK7A 3TTDA 1YLFA 2HOEA 5AR0A 2ELHA 2QWWA 4O6JA 2ATQA 3K5LA 1T0FA 2EK5A 3WTTC 3THXB 1QZ5A 4A3DJ 4PDKA 3RWUA 4KHYA 4H0PA 4HTLA 4HDVA 2RGVA 3O8GA 3CFOA 1T38A 2HHXA 2G8HA 2CO5A 2KLOA 4BH9A 4B9SA 3ZQ7A 4MLOA 1C0TA 1YAGA 2QZ8A 4LG3A 1S7OA 4L0YB 2BOLA 1WVRA 1H8AC 3BQYA 2XAJA 4B09A 1BR2A 3KWIA 4JI3K 2E1MB 2CJJA 4DV5K 3MKYB 2VJ4A 4W5QA 4DSEA 3O6WA 4M6XA 4XMYA 2IDOA 2P9NB 1HF0A 4JI5K 1ETQA 2IVNA 1TQPA 2CWEA 2NZTA 1ON2A 4BS9A 5BNGA 3CCRI 1NG9A 4E70A 4B4CA 2JSCA 2K02A 1BQMA 1OR7A 1NOZA 5M5XJ 5LEKA 4GW6A 2ADUA 4BDPA 4DYQA 3QPTA 4IO9L 4KHPK 4B9TA 4X66K 2RREA 2GBZA 3L8BA 1TWAJ 1HKSA 1RT6A 4NNJA 2A6AA 4MO7A 3PO2J 1P2FA 3U4LA 4XRSG 3O5BA 4OIOF 2DQLA 1HLVA 1XPXA 4KTWA 4Q47A 3O08A 1ON1A 3J7YP 4WF9L 4CJKA 1XMKA 3ZT0A 4Z4EA 4O3MA 4M7XA 4A93J 3R61A 5M1QA 3H36A 4DSKA 2NOJB 1K6YA 5AZIA 1MJBA 4IKFA 4B3MK 4Q0BA 1W36C 4KDPA 2G0EA 4B3OA 3SAHA 2DBBA 4IFVA 1D0XA 5LHIA 4EZ6A 5GAGP 1RT7A 4ELVA 4BREA 1I1SA 4M3EA 1FYLA 4BRPA 2K3FA 1REVA 3GMEA 3AVMA 3KLOA 1N25A 1SD7A 1JL1A 2CG4A 2Y0MA 4LIUA 3FFIA 4A62A 3E6BA 2ZNYA 2VJ5A 2R5ZA 2EIJH 1TQMA 2EINH 5KAFC 3CC7N 4CFCA 2O8KA 5HP1A 2OUMA 4NUBA 1T7PA 1HRHA 3TOAA 3CLOA 4WQ5C 4IG3A 1WRJA 3RSEA 4II2A 4RLFA 4I0BA 1S72N 2E7XA 4MHGA 4IOAF 1J5OA 5CZ2A 2R7DA 2HNYA 3EY1A 3ITHA 1S3XA 1VSMA 1MMSA 1R4MB 2J4RA 2EV6A 4HA8A 2OD5A 4HF2A 2UUAK 2KIFA 1RFQA 2E1YA 3E6MA 1YS6A 3GTMJ 4C30A 2VYPA 1MNDA 2E5ZA 1FXXA 4CCJA 1WJEA 3DRRA 3MFKA 4BRQA 4FLTA 3EDPA 4XIDA 3CJRB 2WAEA 3PX0A 3DI6A 1BIBA 1CQTA 1D9DA 4ZTJA 2OPTA 3S3OA 3I0SA 4AIJA 1YYVA 4I2QA 1K8KA 4LF4K 3SJHA 4IRIA 4EATA 1SFKA 2IOCA 4XLNF 2R5YA 3TGNA 4E0DA 4X1EA 4FYDA 3UKRA 4HUEA 3MX5A 4FX0A 1PP8F 4CESA 2NVXJ 3IH3A 3HVTA 4YY3K 5CHIA 1IUFA 2GWJA 1U2WA 3L2UA 4BEHA 2IGMA 2GOXB 2KW4A 1GUUA 1R5ID 4B48A 4JD2B 3J81Z 1Z21A 3OS2A 3E6DA 2PX9A 1R0AA 3ELKA 4E4HA 4H5VA 4JOMA 2GTDA 3OYFA 1QZZA 3DMJA 1JGSA 3H0DA 3S2DJ 1WJFA 2KFDA 5K14A 3TAGA 4KICA 3ULQB 3S17J 3KLNA 1IJJA 3ZPLA 2E35A 2O4IA 4WXDA 1JCGA 3MAQA 1E17A 1O1WA 4V19S 1YS7A 3NFAA 1CZ9A 2JK3A 4IHXA 2EZKA 1L3SA 1BM9A 4P9UA 1XDSA 4CJTA 4FCYA 4FISA 1FT9A 2EWNA 3OYBA 2W40A 3DRPA 1W7PA 4CZHA 4L5EA 4XKCA 1DUXC 5JHFA 3S14J 1IG9A 2MBFA 3A0HC 4F3OA 4AIHA 4X6AJ 1C0UA 4KYWA 4BR2A 4CO8A 3IWFA 3CD6I 3T1HK 3CCRN 3RMAA 3THYA 1ZARA 3VWBA 2XY7A 2YNIA 1PVEA 1UCRA 1FPQA 2OAZA 4E7IA 5DD8A 4BXUA 1F5TA 4CHUA 4UUTA 3ABTA 2Z16A 2EPFA 4C8LA 4AC0A 3AGRA 3OYLA 3P9KA 1V3FA 3SBTA 5C42A 3I53A 2YX4A 1BG3A 3M3ZA 1FJLA 1VQPI 2KHOA 1TKDA 5HS9A 3H9GA 3G4SI 1PUEE 4B9MA 2E19A 1ZR4A 3ISNC 5F04A 2HVHA 2UUCK 1G3SA 3DP7A 4ILHA 1G8XA 2EBIA 1EKEA 1KAXA 4OMZA 4ZTFA 2P9PA 4HAMA 2RAEA 3K5OA 3WNGA 4JI8K 5LMNK 5HROA 5HLFA 2E1OA 1ATNA 4KJZA 2P9SB 4FW1A 3GX4X 2PQ8A 1BOTO 1SVLA 1JLGA 4HQEA 1OVYA 3NH2A 2P0WA 4G94A 4FJ8A 5LJWA 3ONQA 1ASWA 3ZGKA 4F2RA 3GTPJ 3AL0C 2FJ1A 3WTVC 4AWXB 4BAYA 3S1QJ 1KQ9A 3IS9A 3N4MA 1SAZA 3WNFA 2K4JA 5IYCJ 1EH8A 2JA7J 3L4IA 5J2PA 4JHDA 3LL3A 2EA2A 2M34A 4JEPA 3ID6A 2M9HA 4E7ZA 3K10A 4DFJA 3R4KA 3DBLB 3DLRA 2K9SA 3TDUC 4A3IJ 3KP5A 1NGFA 3KZIC 3A0IX 3KEQA 1QZ6A 1C0WA 1S3JA 1VFCA 1MSEC 4GXOA 5AQFA 4W97A 2DMPA 5CVUA 4U7DA 4HOBA 4BRCA 1G3TA 4MIMA 3DFGA 1QQCA 2KKZA 1ATRA 2OA8A 1VSJA 2WTUA 4HNVA 2WAQA 4CJ3A 2QTDA 4OJRA 2W00A 2QBYB 2OPRA 1UA0A 4N76A 4FJ5A 4A3KJ 2P9IB 3UE5A 2CGJA 4LFCK 4B9NA 2NYXA 1BOBA 2P7VB 1TV6A 2LTPA 5EY4A 4F91B 5FD6A 1U8RA 3CXCM 2GAUA 4FHTA 2AXLA 2DMUA 4RM2A 2IT0A 3WGGA 1KVAA 1PUFB 3WODF 1HPMA 1TW2A 3LA7A 4KO0A 3WXMB 2QWRA 2HTJA 1NJIO 3AFHA 1FOXA 5EG0A 3WTSC 2DODA 2M7BA 4LB6B 4GO1A 4BG9A 2STTA 3QDKA 5GPAA 4JV5K 1YFHA 4N9HA 3HJFA 1Y1VJ 4CJWA 5DM7F 4IZZA 4E1MA 1ZBLA 2KZVA 2W57A 3IH4A 1RI7A 3FISA 3A01A 2NNWA 4DG1A 2DTZA 2D1VA 3C95A 3BQZA 2O8DA 3HI0A 4KHWA 4CJRA 3QRFF 1XD7A 2QLZA 2G8UA 4H5NA 2QVOA 4J2BA 4CHZA 3AVKA 1FK9A 1HMVA 3PFYA 3NBPA 4JKAA 1NJYA 3L2RA 2XY6A 4IG0A 3CCJI 1UHMA 5CPRB 2F96A 2F9WA 3ZMZA 3GTJJ 5H2FC 2R7ZJ 4Y15A 1RBVA 3WTYC 1VRUA 2IAIA 2PJRA 2VWJA 3PO5A 1NGEA 3F3XA 3PNVA 2R7SA 2Y1IA 3CP8A 3E66A 5B1BH 3CG7A 3HGYA 2JT1A 2W42A 4A57A 3CD6N 4N56A 4DQ2A 3E1YA 4ENNA 1ETOA 4NQWA 1DTTA 3K2AA 1NTCA 1HLUA 3KJVA 1NJXA 1D1BA 3E0JB 1VQ6I 4HWIA 3ZT4A 1I1GA 3OYNA 1UHSA 1FX7A 5BREA 3R6SA 4WCEL 1UHWA 2RQPA 2I7NA 2O8CB 2XVCA 3SYZA 1TL8A 5LEJA 1VQPN 2QXFA 4LD0A 3G4SN 3IRQA 1GVJA 3H1QA 1IZ1A 1AKHA 2X78A 5E8IA 4A3FJ 1TT5B 2HZDA 3OR1C 4FE4A 2UU9K 3S32A 3TBIA 3K1NA 3MN7A 4EP5A 4HZFA 3J80O 4BBRJ 2D0AA 3RDIA 5FKNA 3Q3SA 1ETYA 1FJGK 2LFBA 2R4GA 4BNCA 1JUPA 2F5DA 3ZSQA 4HRIA 2BH1A 1JLAA 3L4QA 3FZLA 1U45A 4FOIA 5J1UA 4Z4FA 1F4KA 4NXMK 1T33A 1V54H 3DPUA 4RG8A 3SLCA 2K86A 5D6FA 3DLLF 2PMHA 5BRDA 1ZG3A 4PFPA 4CUGA 4JI7K 2OCEA 1NK3P 1GLFO 4AYBA 5IT9K 2H94A 3QPLA 5JVGL 4XSZF 4XONA 2L9SA 2JLEA 3MAJA 3L3UA 2PEXA 3CQYA 1ZC6A 2K9LA 3OJSA 4V2FA 3BGRA 2K7LA 4YFUA 5AQSA 1U5TC 2DFFA 4E7HA 5HS8A 5DEQA 1KRPA 1RILA 2IS6A 4FWMA 4JNEA 3CJBA 5JFRA 3BTLA 1T2KA 2E1NA 2W6KA 3HOXJ 4GYGA 3QYBA 2DA3A 5KPZA 4HEA2 1HKBA 3ERED 3A5NC 3X2QH 5J2MA 5AQRA 1WWXA 2GZWA 3ZQFA 4KKOA 5F1JA 2HR3A 1YX5A 3KE2A 3HSEA 2QW9A 1IUYA 1ACIA 2LC2A 2HPIA 1R5GA 4PY5A 2WFBA 1SFEA 1ETKA 3PIPL 5J8CA 2LVSA 5KRSA 5IOZA 2ESHA 4B3TK 1BIUA 4RAZA 1MDMA 5DV5A 3K69A 3SUOA 3KTQA 2RHKA 2HDWA 4X0GA 3BJAA 2E2QA 3VEYA 2K85A 4WFNL 2M8EA 4Z0UA 3H9QA 3OBWA 3LSPA 3CMYA 1T03A 1HNZK 1XCVA 4Y52J 4XRMA 3VYTB 4IOCL 4FZZA 2RNJA 3CIPA 1KAZA 3LSGA 2PY5A 2IS4A 5GTIC 3FXKA 4KI6A 4PQUA 4Z4HA 5HLTA 3BZCA 4BY7J 4IL6C 1ONVA 2ME0A 3IAS2 3O3FA 2RDPA 1XC9A 4FPBA 4JQFA 3NVMA 4XBFA 4BC5A 3CM5A 2VKHA 3FK7A 4U0WA 1ZLKA 1QQNA 3FZMA 3VOVA 4P9FA 1XGOA 2VONA 1OKJA 1KQ8A 1BO5O 1MNEA 3HPGA 5H1SQ 5TJJA 5FROA 1NGCA 3H5NA 3DTIA 3CF5F 1SVMA 3L2WA 1Z6RA 4KTQA 1WLJA 1XMQK 1SAUA 4A5BA 4CFBA 1VAZA 3LM2A 5FB2A 4JRQA 4DLGA 3SDBA 2A3ZA 3S1MJ 2OZ6A 1Y0UA 2VT3A 2NVYJ 1KCFA 1JL2A 1LAWA 3CCJN 2DPUA 5EEGA 1NNEA 5C24A 3LP1A 2EFPA 3E1SA 1W7PD 2W84A 3ZMDA 5LHHA 1Q1HA 2DT7B 1P4WA 3LSMA 1C0MA 4CGFA 1JCEA 5D5VB 1VSDA 3GFIA 3Q9SA 3TW7A 4H5TA 4DZPA 2ZFUA 4G7HF 5D8KB 4IOXA 2P9LA 1ETXA 3KYCB 4Z4CA 1RT5A 4MLEA 4MQ9F 5EU7A 5E79C 5LGUA 4DGWB 1Z9CA 4DIQA 4DU3A 3HEFA 1JKPC 2GOMA 4F55A 4X65K 3OMYA 2X6YA 1VQ6N 1V55H 2QM1A 4G7OF 3ENHA 3HSFA 4I9QA 3OS0A 2PG4A 4L8RB 1FOWA 3CTAA 3SK3A 1KC8O 1YJ9I 1IO2A 3MECA 3HBLA 3HSTB 2BW3B 4N5SA 2Y48A 4N4NB 3JTHA 3D1NI 2IAJA 2ZQBA 4FPAA 1GLJO 3OYAA 4UUSA 5KNLA 3SZPA 4B9VA 4W5OA 4AHCA 3GZ6A 3TQNA 5DYMA 1Z25A 2HHUA 2QENA 1K79A 4ZH4F 1QQMA 2X6XA 2UXCK 3AVCA 4DF4A 4U0VA 3M8FA 3CJ9A 4HV5A 4ENKA 5FLXZ 3AGKA 5BPLA 2YCHA 4EJUA 2R7OA 3D5RC 5CQGA 3V8LA 1YXQA 1GLCG 1Q82O 3F5TA 4ELUA 3HRGA 1XG1A 4EVIA 2QEXI 3JRAA 1TUYA 4M3UA 3HOZJ 3G3ZA 2FXAA 3BG7A 3CZ6A 1BDGA 4ZYEA 3E7LA 1MJ9A 3DBHB 3L6QA 1MBJA 3VERA 4OPHA 3I4MJ 4FTHA 1XHZA 2LMDA 1BI0A 1R49A 4BRLA 1JE8A 3S16J 4E19A 1HKQA 4FQGA 4ZZDA 1S9EA 5HL7L 5FLMJ 4BGBA 3BG5A 2YKNA 1DT9A 4Y1DA 2XUBA 1FW6A 3ZT2A 1ILYA 4M73A 1VI0A 1WSGA 2ZMEA 3QICA 1JT6A 1U48A 1MU2A 3HRTA 2VL8A 1J54A 4CGDA 1VQMI 1F43A 2F4OB 3EZ5A 1O3SA 2AP1A 3MZHA 3TAFA 3DRSA 5ICEA 3O8MA 1KU9A 2PMZN 3IL2A 4RCHA 4BQOA 1U9OA 5I3UA 4CSWA 1LKXA 3GFMA 3QODA 2Q0UA 4FJIA 1KU7A 2XB0X 2VC1A 3HIFA 5CZ1A 3CUOA 3SBGA 3LMMA 1JXBA 4M3RA 2ECBA 4H0YB 1EP4A 2VE9A 3IUCA 1WSJA 2Y0SN 4JKFA 3O2PE 3I58A 3FK6A 3I9V2 2BGCA 1GOAA 2VBZA 3DXMB 3JAMK 2LK2A 3VPRA 1VQ8I 4XOTA 4E1JA 3UKUA 4EGZA 4DTJA 3JS6A 4DU1A 4GDFA 1T95A 3R60A 3EYYA 2KLAA 3ZMUA 5LJVA 3PIOF 2BANA 1SD5A 4A5AA 3ABUA 3O9UA 3HYIA 1A5JA 2RN7A 1MGTA 3SUPA 5HVQC 3S3NA 1MH4A 3H46O 2KKOA 1HNWK 1MWKA 4DTOA 4II3A 4JX4A 3VTIA 3F8CA 4BL0B 1F9NA 4XQFA 4AD9A 4HW0A 3ZMTA 4ZDOA 4CGJA 1WBDA 5C12A 1ZR2A 1R22A 1UG0A 4H8KA 1OR7C 4EMSA 4I02A 4CJ7A 3TSPA 1MA9B 4OAZA 3ASMA 3BG9A 3T19A 3PFIA 3HOWJ 4OPJA 5AQNA 5D6EA 1FKOA 2DOFA 1R4NB 3VF4A 1IRFA 3GOIA 4UVAA 4LF8K 4HPQA 1QZYA 1UZCA 4H0EA 3VF2A 1IBKK 1IRXA 1YJWI 3DLHA 3BTJA 4CBWA 1I6XA 2Z1DA 4RBOA 4BHBA 1TZLA 3P4IA 2KMUA 1EX4A 1TAQA 2E2OA 2XF5A 2LY2A 1Z3XA 4OGEA 1HKGA 2P5VA 2J5PA 1RESA 3HVRA 2D0CA 1UJ8A 4CJVA 4L18B 1A36A 1YJ9N 3R0AA 2IS2A 2W48A 2HOAA 4HYEA 4CZJA 3OYDA 2EB7A 2ISYA 2HXIA 1KZHA 3TL4X 5BS6A 4FOEA 3VQQA 2X6SA 5D4SA 2NUBA 3FR0A 4F7ZA 4FWLA 1XSDA 1T08B 3CDIA 4DTNA 4KT5C 3LSRA 1XB4A 2EZIA 2Z1IA 4HDUA 4PL8A 4ENMA 1WN7A 1Y56A
chains in the Genus database with same CATH topology
5KRTA 3OYIA 3DM2A 4O5BA 2IS3A 4I9QA 2RKIA 4CFDA 2VWJA 1S5JA 1VSHA 4CGGA 3OS0A 3TAQA 3PO5A 4FXDA 2GUIA 4DFMA 3PX6A 1B92A 3AVGA 2Y1IA 3MXIA 4L8RB 4KREA 4EP4A 3MAQA 1IH7A 1KTQA 1O1WA 3B6PA 1IO2A 3C94A 3CG7A 1S1XA 3MECA 3ZSXA 3HSTB 1RDCA 1TKZA 2ATQA 3NFAA 4M45A 2W42A 3K5LA 1TGOA 4O0JA 4Z4IA 2HHWA 1CZ9A 1ZBFA 4J2EA 2ETJA 3L2VA 4N5SA 1S1UA 1L3SA 1B9FA 3NF9A 1L3VA 4DQIA 1SL0A