1X1PA

Crystal structure of tk-rnase hii(1-197)-a(28-42)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGAGAIIGLAVGGVVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Structure of amyloid beta fragments in aqueous environments
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1x1pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1x1pA01
1S9GA 1HYVA 2X78A 2Z1JA 4KKOA 3WNHA 4DFPA 4PA1A 4HUGA 3AA3A 3H08A 3LAKA 1MU2A 4M3XA 3D45A 1ZBUA 2JLEA 3ALYA 4KPYA 4DTRA 3C95A 5JS2A 1C6VA 3VQCA 1J5OA 1UA0A 1HJRA 1RTDA 4I9QA 5FRMA 2KFNA 4AHRA 1S1TA 3AO5A 1S5JA 3LPUA 1J9AA 1RT6A 1J54A 3TANA 4DS5A 2XY6A 1KSPA 3S3NA 3ZSWA 2ZD1A 4Z4CA 2OPQA 5KTQA 4IG0A 4CEFA 4E1NA 1EXQA 2HNDA 5SZTA 4DTNA 4J2DA 4M3TA 4CJKA 2DFHA 4C8LA 1B92A 4ID1A 4ZHRA 1SV5A 1L3SA 2XY8A 1S6PA 4MQ3A 1U47A 2IC3A 4FM0A 4B9MA 2Z1GA 3ZSXA 1RTJA 3TAMA 1BISA 3VQ9A 1XWLA 3LALA 2W42A 3KD5E 4FK2A 3LP0A 3RR7A 1ZBHA 4QOZB 5CYQA 1RT2A 4FJKA 4LD0A 1KTQA 3EZ5A 3P83D 4FM1A 1QSSA 4B3OA 3NF9A 3NGIA 1NK6A 1FKOA 3CG7A 3V9ZA 4E7IA 3DM2A 1RDBA 1ZBFA 4DTXA 4F8RA 3AO2A 4KHYA 1IH7A 3OJUA 2RKIA 3VQEA 4ELUA 3NAEA 1NOYA 1BGXT 4AILC 4CK3A 3LWMA 3LDSA 4FJXA 2VWKA 1ASVA 4KHQA 3AA2A 4B8AB 3NCIA 3OYAA 1WSIA 2GV9A 2YHAA 4OVLA 3OYEA 3OYIA 3V6DA 5HP1A 1D9FA 2G8IA 4N5SA 2FBVA 3QLHA 4FJGA 4DU4A 4FLYA 2XHBA 4ZTFA 4AHCA 3PY8A 1TL3A 4BE2A 4CESA 1EP4A 2ATQA 4AHTA 1TKDA 2KW4A 2IOCA 3HYFA 3KK1A 3KLGA 4M42A 4CEOA 3SJJA 1VSEA 3V9UA 3QO9A 2D0BA 2HVHA 3ZSYA 1JLFA 3ZSRA 3QEVA 1NKBA 1Q9XA 3L3VA 4KI6A 4EP4A 4KHSA 2XY7A 3AVFA 3SUNA 3B6PA 4IKFA 1NJZA 3VQPA 3OYHA 3HSTB 3L2VA 1DLOA 3VQQA 2DFFA 4KTWA 1WNSA 4JS4A 1UWBA 3NDKA 5J2PA 1A5XA 3JSMA 3TAQA 4DSIA 4CF9A 1WSHA 3SPYA 3NH2A 3V4IA 1JLAA 1K6YA 3DLEA 3OYLA 1U45A 2WONA 3VQAA 1WAJA 4DQIA 1C0UA 4CE9A 3SQ1A 2FBTA 4UQGA 3IRXA 3G10A 1YT3A 4CF0A 4W5OA 1WSGA 5DMRA 4JRQA 3L2WA 4DSJA 3JYTA 4C8OA 2QXFA 3U3GA 1EETA 4FJJA 4FJHA 4LH4A 1RBUA 2DFEA 1HPZA 3U3YA 4KI4A 3SQ4A 1U48A 3AVCA 3C6UA 4CIGA 1S9EA 1CLQA 4KRFA 3KLHA 4KB0A 1S6QA 3ULDA 1HYZA 4MFBA 4O4GA 3V9XA 1XC9A 4F3OA 1BQMA 4CJVA 4OPJA 3QEXA 3TI0A 1TVRA 4F3TA 1JXBA 1CZBA 1WAFA 3HVTA 4M41A 3OYFA 4CJPA 2VG7A 3SQ0A 1UA1A 4NCAA 3O3GA 3S3MA 4DSLA 4M3ZA 3M8PA 3L2UA 4Q5VA 1W9HA 1JKHA 2OPRA 4CJUA 1VSDA 1Z26A 4CJ3A 3OYNA 4FM2A 4DS4A 4DMNA 4Y1DA 1RTHA 3LP2A 4CGJA 3K5MA 3L8BA 1KLMA 3MEGA 4CHYA 1VSFA 1L3UA 2DTUA 4FLVA 3L2QA 4E7KA 3CFPA 4BE1A 4H4OA 3KLIA 1BL3A 1TV6A 2IDOA 3AVBA 3QEIA 3PX6A 2P5OA 4DTOA 3SNNA 2D0CA 2NUBA 4CJWA 1T05A 2A1SA 4NYFA 3KIOA 2HNYA 3HPGA 4DTUA 4B9SA 2E6LA 4HCBA 3K57A 4CJTA 1UOCA 4CJLA 1IKWA 1VSMA 3QEPA 1RDDA 3AVHA 3M8QA 3NF8A 4KFBA 2PYJA 1HQUA 1RT3A 1C1AA 4FVMA 1C1BA 3KKRA 4FXDA 2YKMA 3OJSA 4CJFA 4FJMA 1G15A 2F8TA 2HW3A 1BIZA 4DQQA 4OGCA 3MAQA 2G8UA 3ZSVA 1JL2A 2PY5A 4B9NA 1U4BA 3AO4A 1LV5A 3SUOA 1CXQA 4DF8A 3AVNA 3CM6A 1RT7A 2BE2A 1RT5A 4FCYA 1KCFA 4FJIA 1YVUA 2G8WA 3IG1A 4I9LA 1JLCA 3TABA 3LZJA 1GOAA 4WE1A 3ZT1A 4DQRA 2OA8A 3VA0A 2HNZA 4DTSA 1S1UA 1QTMA 1VRUA 5HROA 4DTJA 3CYMA 3PX0A 2HB5A 3SUQA 3QERA 2IS3A 1BCMA 4DQPA 1U49A 4FK4A 3NHGA 2HHXA 4XIUA 2OPPA 3WNEA 4BDYA 2ZQBA 3AO1A 3K5OA 3OY9A 4BE0A 1R0AA 1SUQA 3LZIA 1A5WA 3VA3A 4FJNA 1TK8A 4RW8A 1IKYA 1RDAA 3CQ8A 4OKEA 4N41A 3OS2A 1IKVA 1ZBIA 1KFDA 3ZSOA 4CFAA 4CERA 3NF6A 3DLHA 2B5JA 4KHWA 4M3UA 1KVBA 3M8SA 4E89A 4B9LA 3EY1A 2XO7A 3BGRA 3OYMA 1QQCA 3ZT0A 4CEAA 1L3TA 1X1PA 3AVKA 1C1CA 3RMBA 2D5RA 3HPHA 3V1OA 3V9SA 4CJ4A 2HHUA 1F21A 3NFAA 3A2FA 3MXIA 1NOZA 4KHNA 4YNQA 4CEBA 1BQNA 3MECA 4ELVA 5HRRA 4JLHA 4FLTA 3VQ6A 1JXEA 1L3VA 1L5UA 4KTZA 3HPOA 3KK3A 4E7LA 2YNHA 2YNGA 3KD1E 1ITGA 3DMJA 3NBPA 1FKPA 4IG3A 4CJQA 1LAVA 4PQUA 3TAEA 3VQ5A 2JGUA 2HHVA 1SKRA 3K5LA 4C8KA 1RILA 1BHLA 4CGFA 1RDCA 2X6SA 1RBTA 1XHXA 1NK4A 1BI4B 4Z4HA 3NGZA 3QINA 3HK2A 4RW6A 4EZ6A 3SYZA 1LW0A 4W5QA 1X9MA 4FK0A 2YKNA 2Z1IA 1CZ9A 3I0RA 1QHTA 4CFBA 4LY7A 2QK9A 4FJ5A 2KFZA 2WOMA 2EHGA 1X9WA 3T3FA 3HVRA 3F9KA 4I2QA 4CEQA 4ICLA 3P1GA 1JL1A 3HT3A 1W0HA 3PV8A 4KV8A 3RRHA 4NCBA 4FJ9A 4F2SA 4O5BA 5FROA 4OKKA 5E41A 4CECA 4H4MA 3V81A 3LANA 4N47A 1XI1A 5I42A 5FDLA 4NYNA 3HM9A 1KRPA 1JLGA 1LWFA 3RMDA 2F8SA 3HO1A 5J1EA 4E3SA 2XY5A 3E01A 3RMAA 1NK7A 5KGWA 3QESA 4CF8A 1Q8IA 1O1WA 4KAZA 4QCLA 3KLEA 3D0PA 4BDZA 5HLFA 4AHSA 4CHPA 4RW9A 1SL2A 1RCHA 4CJSA 1TAUA 5J2QA 4DU3A 3NH1A 1ASWA 3QIOA 2YNFA 3ZT3A 1NJYA 4CHNA 2HHTA 4RG8A 1TKXA 3V1RA 4CGIA 4FLUA 4BDPA 2EX3A 3AVAA 4Z4GA 3AO3A 4FW2A 3CFOA 2KZMA 5CY4A 1RBVA 3AVMA 4DQSA 5J2NA 5CZ1A 3RMCA 4IFYA 2FBXA 1NKEA 2HHWA 1UAXA 1IG9A 3TARA 2OZMA 3SV4A 4CFDA 1IKXA 4F2RA 4ZTJA 2P1JA 3K2PA 2Y1IA 4RW7A 3ITHA 2BGGA 2QKKA 1TKZA 4C8NA 3ZSZA 5C42A 4FZYA 1QS4A 2F96A 3O4NA 4LSNA 4Z0UA 3KJVA 5HRSA 2HMIA 4CIEA 1SL0A 5FRNA 1TK5A 4B8CA 2B4JA 4CEEA 1A5VA 1VSIA 2E6MA 3RRGA 4JRPA 3AVJA 4IBNA 1GOBA 2YNIA 1RT4A 4W5RA 4RW4A 4OPKA 3DRPA 4HUEA 1REVA 3LWLA 3O3FA 1RBRA 3T1AA 1NJWA 1VSJA 4I2PA 4B08A 3BDPA 4CGGA 1KVCA 4NCGA 3IS9A 4HTUA 2ZE2A 4M3WA 1BCOA 3UIQA 2IAJA 2FC0A 1D8YA 1RT1A 1D5AA 2E4LA 4FLZA 4HCCA 4N56A 4DSKA 3QNNA 3DI6A 1YTUA 3MEEA 2PZSA 3RR8A 5I3UA 1KFSA 5KRSA 1GOCA 3HJFA 4TSXA 3SCXA 4FZXC 3OS0A 5D3GA 4M3YA 4PWDA 1HRHA 3ZCMA 1NK8A 4K8XA 1Z25A 4IDKA 3G0ZA 5K14A 3OYBA 2G8HA 1LWEA 3T19A 3SPZA 4R5PA 4CCHA 2KQ2A 4AHUA 3PX4A 4ID5A 3DOKA 1D9DA 2BDPA 4CJ5A 4J2EA 4CF1A 1QSLA 4K8ZA 3L3UA 4CHQA 3K58A 1KVAA 2Z1HA 2A1RA 5C24A 4FW1A 4DFJA 1NKCA 4Z4FA 2YHBA 1QSYA 4O44A 1BIUA 2GBZA 3IAYA 4FYDA 1SL1A 3O4QA 2G8KA 3LP1A 4AH9A 4Q0BA 1U04A 3PO5A 3DLKA 4CF2A 3S3OA 3TWHA 4HUFA 1ZBLA 3PUFA 1WN7A 3DLGA 4OKJA 5CZ2A 4DLGA 4OGEA 3P5JA 1RNHA 1RBSA 4M45A 2QKBA 2DY4A 4C8MA 4DSFA 3NGYA 2I5JA 1TAQA 3ZT4A 5C25A 3KK2A 3CM5A 4CGHA 3VN5A 1N5YA 1DTQA 2HHQA 4E1MA 3NE6A 1C0TA 5HRNA 4FLXA 3OYJA 2VWJA 4PUOA 4CEDA 2HHSA 2ETJA 3AVLA 1T03A 2BANA 4CHZA 4GMJB 3OYCA 4I7FA 4QAGA 1SKSA 3CFRA 2VG5A 3K5NA 5HBMA 3OVNA 1JLQA 1WSJA 5J2MA 3DRRA 3U6FA 3TAFA 3SUPA 1KLNA 3FFIA 1TK0A 1IO2A 1TGOA 3EYZA 4BACA 3SI6A 4DSEA 3QETA 2G8VA 4B9TA 4B9VA 3M8RA 3OYKA 4FZZA 4GW6A 3LP3A 5DK5A 4O0IA 1X9SA 3VQ8A 2XRIA 1NK9A 3VQBA 1JLEA 4Z4EA 4FLWA 1HQEA 4DTPA 1NK0A 4Z4IA 5KRTA 3MXMA 1VK0A 5SWMA 3LPTA 3DLRA 3VQDA 4OLAA 3MXJA 3DOLA 3SQ2A 3C94A 3AV9A 4DG1A 3V9WA 4PY5A 1B9FA 4E7HA 4G1QA 3NF7A 4CIFA 5KGXA 3QNOA 4EZ9A 1TKTA 2GUIA 4CGDA 2YV0X 3ASMA 1TL1A 1WSFA 4FJ7A 1I3AA 3AA5X 4KHUA 2O4GA 3ZSQA 4N76A 1C0MA 1N6QA 4EP5A 4DU1A 3TR8A 2OYQA 3SZ2A 2KTQA 1YTAA 1ASUA 2B6AA 2ITGA 4O55A 3MEDA 2KZZA 3SV3A 1EX4A 2LSNA 4DLEA 2Y1JA 3VQ7A 1J53A 3C6TA 4AHVA 2RPIA 2AJQA 2P51A 4O0JA 3TAPA 1HNVA 4KREA 2O4IA 4LSLA 5KI6A 1ZYQA 1WLJA 4CJEA 1HMVA 2RF2A 3S9HA 3HP9A 3WNFA 1S1VA 3DYAA 1RTIA 2OPSA 3NH0A 4DFMA 4BWJA 3ISNC 4CFCA 1T7PA 4L8RB 3QEWA 3DLBA 1Q9YA 3HP6A 3TAGA 1T8EA 1QE1A 4KB1A 2X74A 4DTMA 4J2AA 4W5NA 3RTVA 3I8DA 2P5GA 4ELTA 1HNIA 4HVJA 4CHOA 3I0SA 3PO4A 4LH5A 4DF4A 4CK1A 4J2BA 3HXMA 4YFUA 3ZT2A 1VSLA 3OYGA 3V1QA 4FJ8A 2FBYA 3L2RA 1Y97A 1VSHA 4E7JA 3LAMA 3OS1A 1JLBA 5T7BA 3WNGA 1WSEA 3F73A 1HYSA 1B9DA 3THVA 2Q3SA 4H8KA 4CK2A 3B6OA 5HRPA 2G8FA 1XHZA 4M3RA 3RWUA 1CXUA 1SKWA 4OJRA 3HL8A 2R7YA 1VSKA 4CJRA 4B9UA 1S1XA 4F4KA 4Y1CA 1LWCA 2HVIA 2IGIA 4CEZA 1FK9A 4KTQA 4BWMA 2RN2A 4DWIA 4DFKA 4E19A 5JS1A 3DRSA 2D0AA 3KTQA 1VRTA 4FJLA 3OYDA 5CYMA 2PYLA 1BI4A 2OZSA 3AVGA 1S1WA 1LAWA 4OLBA 1DTTA 3QIPA 1NK5A 4GVMA 3VQ4A 3O3HA 4W5TA 1I39A 1EKEA 1LW2A 3KLFA 1NJXA 4HHTA 4JS5A 1FXXA 3KKSA 4E0DA 2VG6A 4KO0A 2X6NA 3AA4A 5EU7A 3K59A 4IFVA 3AVIA
chains in the Genus database with same CATH superfamily
4PL8A 4KKOA 1R23A 4DFPA 3HOVJ 4IWVA 2VKDA 3FX3A 2H6CA 4BAYA 4DTRA 4BQOA 3TTDA 2XHKA 2ZXWH 3BT9A 2WB1N 3BTJA 1S1TA 1IDZA 1RT6A 4IG0A 3F9MA 1MMGA 3G25A 2O9LA 3IH2A 1Y8QB 4FK2A 3OBYA 1QSSA 4RB3C 1QQOA 3DM2A 2W7NA 1JUPA 1JCEA 2L3DA 3N97A 2ID3A 4FWKA 4KUMA 4FWSA 2DJNA 3AFHA 3MMYB 1WQ2A 3A5NC 4HA8A 5LHHA 4YIFA 1OJLA 5E3OA 4UVCA 2IA2A 3SJJA 3AG2H 2HVHA 4DGWB 3DLLL 4ANJA 3J7AO 1ETXA 3T5XA 1Q9XA 4A69C 1VQ5I 2RQQA 6PAXA 5B5EC 1TYQA 1WCMJ 1S3XA 2ZM6K 3CJQB 1K6YA 1B9MA 1WAJA 2H09A 4RLQA 4HSTA 1I5ZA 4FQGA 3ULDA 4CICA 5JHUA 4CJPA 4NCAA 1U2WA 2Y69H 2OPRA 4CJUA 4M9ZA 3MKZA 2GOXB 1VSFA 3L4IA 3RZOJ 3KYDB 2IS6A 1T05A 2I7NA 4AD9A 4BKXA 1UOCA 5K7FA 1XX5A 3AVHA 1RT3A 4X1EA 2WAEA 3G1LA 2W25A 3L0QA 1IN8A 4BQAA 4LF5K 4HX4A 4PGHA 1GOAA 4ENKA 1T08B 2ACJA 2KKZA 1TC3C 2AXTC 3FHNA 3AO1A 1R0AA 2ZFUA 4KT6A 2R7SA 1LCUA 3RSEB 2VQHA 3EE8A 4AQYK 1MBGA 3EY1A 1GV5A 3SFZA 5LFAA 3U9GA 4BC2A 4F52A 2QA4I 2HHVA 5LEKA 3QINA 1YITI 2RC4A 4EZ6A 3MD2A 4FISA 1YW8A 2WAFA 3GYHX 1O3RA 3Q7CA 2EHGA 3HVRA 2LBFB 1FYLA 1GLNA 3MN2A 2KISA 4CECA 3OV8A 1RI7A 1BWFO 1NH3A 5AQPA 5FDLA 1LVAA 1UAAA 1OCZH 1A5JA 1R7JA 2ZBKA 4GV6A 3O9RA 5KGWA 3T8TA 3QIOA 3V1RA 4FW2A 2RNJA 3J7YP 3C2BA 1QVUA 1X1CA 4HEA2 2MG4A 2ZXJA 2RV8A 4ZTJA 3KZZA 2Y1IA 2F4VK 1SEUA 5FRNA 4IHTA 5IP9J 4H4KC 4FT8A 2B4JA 1TWFJ 3JSOA 4JRPA 4W5RA 2IVNA 1TUUA 4U0WA 4CA0A 1GLCG 1Z3YA 2HQNA 4HTUA 2IAJA 1TL8A 4N56A 2CFOA 3F3XA 4TSXA 3BZCA 1NK8A 3OYBA 1Z7UA 4DQ2A 4CCHA 1D9DA 1QSLA 3F2KA 2V9VA 2A1RA 2GUPA 1YIOA 4M3FA 3M5RA 2BHYA 3BR0A 3FXRA 4XSXF 1IN5A 3QQAA 1BI2A 1VQLI 3A1YA 3U9ZA 2WY8Q 2CSOA 3BG3A 2IGKA 2X85A 3T1YK 3OYCA 3CFRA 3K1PA 1KLNA 4BACA 4B9TA 4DSEA 4FZZA 4O0IA 1D0XA 2YHWA 4RDUA 5AQKA 4Z4EA 5LGTA 2D0OA 4ETSA 3H1VX 1VK0A 1T3VA 3DOLA 2IGOA 3ONQA 3R9PA 4PY5A 3NF7A 2O03A 2HEOA 4LG3A 4N76A 4YOXA 1LB2A 3GF2A 3GOIA 1EX4A 5HL7L 3ATVA 4O0JA 4HX7A 4EM2A 5M5XJ 5D4RA 3BR5A 4DFMA 2DFIA 1T8EA 4S04A 1FNNA 1DGWY 2P5KA 3IMXA 2QQ8A 2X1CA 2JVHA 4XNFA 3ZMTA 1B9DA 2KIUA 1OQYA 4BC3A 4M73A 1CXUA 2PX9A 5K1YA 5C2DA 3CC4N 2HVIA 1S72I 4NXNK 4FJLA 2ZGYA 3CD6N 5HLGA 4BRGA 2E2HJ 4AIHA 1A04A 2X6NA 2KIFA 2P0WA 2JWKA 4HUGA 3AA3A 1MMAA 1ZHFA 3ENBA 3GE1A 1U9OA 2FMYA 5JS2A 4A61A 4AHRA 3DWLA 2IJLA 5LMNK 4AYBA 5C3EJ 2IPQX 5EZHA 1E3PA 3NMUA 2E5ZA 4MQ3A 3F8MA 3FXMA 4JKGA 2W42A 3TAMA 3KYLA 3KD5E 3WTUC 1KTQA 1ZLJA 3P4IA 1VQKN 5AZJA 2XKPA 2RKIA 3BG9A 3CJ7A 4DV6K 3I56I 2ZNZA 5C4XJ 3E6CC 4W97A 5AQVA 2GV9A 2FBVA 4OIRF 3W6KB 1H9TA 2ZGZA 1VSEA 4XRSG 1W4MA 4WCGA 4RGSA 3B6PA 1JJ8C 1YS7A 1PJRA 2DFFA 1N78A 4ESJA 3TAQA 2V6CA 4CF9A 3J7AP 2DLLA 2DQLA 3SMPA 3K1MA 4CW7B 5E1WA 3IRXA 3U3GA 2EV6A 4G7HF 4KI4A 1FMWA 1JCGA 4A59A 3PFYA 1MBJA 1UA1A 4P1WA 4DIQA 3MEGA 4HSRA 2EA4A 1TQPA 4A6DA 4BE1A 1TV6A 3RSNA 4Z94A 5DEQA 5KAIC 4KIFA 1HJOA 5FPEA 1VSMA 1KQ8A 3RTRA 2QM1A 4K25A 1U6ZA 2KDOA 3ZSVA 2XF6A 1B9NA 1C0FA 1N36K 2FJ1A 1YVUA 1JLCA 1MA9B 3SUQA 2EIMH 3K9TA 2JTVA 4L0YB 4FK4A 5GTHC 5CVIA 4G94A 4FJNA 5IYBJ 4HDUA 4BEHB 1Q82O 2K3FA 3DBHB 5D5WB 2EFPA 2KL4A 4M3BA 1F21A 4NC6A 3DP7A 2J5PA 2FQ3A 4MFEA 3JAMO 3KK3A 3EZWA 2X4HA 3PM1A 3HOXJ 2HU9A 2HBJA 2M4KA 4XRFA 4HBLA 4DV1K 3QPTA 1MBHA 4H03B 2YKNA 3WGHA 4LY7A 3GW2A 3HT3A 3P9CA 3RRHA 4JI5K 5I42A 4NYNA 3HM9A 4QS7A 5J1EA 1VQ9I 3CXCM 4BDZA 5HLFA 3NH1A 2R92J 4BDPA 1BA1A 3FK7A 5J2NA 4XKWA 2QA4N 3D5SC 3ITHA 2BGGA 5TJJA 4S05A 3UB5A 4B8CA 2V26A 3S2DJ 4Y52J 4CZKA 3QOEA 1RKTA 3BZKA 1T56A 4A3GJ 4JKFA 1KU9A 5KHDA 4UHTA 4C1NI 4UNOA 1SVOA 4CUGA 3FK6A 2ZFWA 3H0GJ 5CHIA 3O4QA 4OO1J 4JX5A 2KHMA 2Y30A 1WOQA 3JRIA 2K40A 4OIQF 3ENHA 2VGNA 2VYPA 3AVLA 2M45A 3E9PA 3OVNA 5J2MA 1OH5A 5M1QA 1BJZA 4B9VA 4LMYA 3S2HJ 2ZC2A 2LDUA 4JP0A 1NK9A 1TWHJ 2B7EA 2HS5A 3R0JA 1I1SA 5GP9A 1VQ4I 4PKIA 2OF7A 1VQLN 2LG4A 1FP2A 2AJQA 3TAPA 1ON1A 3RKWA 3S9HA 2RVCA 3WNFA 3ZGKA 2P9LA 3HP6A 4CYCB 4ZC3A 3HTSB 4CHOA 3D1NI 1LE8B 3K1NA 3ID6A 2Q31A 3G4SI 1XHZA 4LIVA 3T7ZA 4X6AJ 1X3WB 1OCOH 4I0BA 3P9KA 2FRHA 1LAWA 3TL4X 2W4SA 1NGCA 3SXYA 1TNTA 4KT5C 2HOSA 4IFVA 4EJWA 2MC4A 3EN9A 5F04A 1ZBUA 3ALYA 4B48A 3VQCA 4JKHA 1HJRA 1XGSA 3ULEB 3WTXC 1RC9A 1BC7C 4J2DA 4R8HA 2NZTA 1K7AA 1S72N 4CZIA 1VQMI 1Q1VA 1JUMA 4E7IA 2R7FA 1BI1A 3L1PA 4NB4A 4CK3A 4X0GA 2D1KA 2H27A 3FZVA 3I3LA 1TL3A 1EP4A 4BRKA 1WB9A 3I54A 3M6GA 1OKRA 4B3SK 1BDGA 4AUXA 2DA1A 3EEQA 3QEVA 2DYRH 3WQTA 1SAZA 1T44A 3HSTB 4H5RA 5BPMA 3A01B 3ABTA 3JRFA 1BIAA 4G12A 1WSHA 2HVRA 5KVRA 3OBWA 4HPQA 4AIDA 4AM6A 1VI0A 4KH5A 3WXJA 4ZDPA 4H5WA 3AVCA 1U48A 5D5VB 2FF4A 1FOKA 4MFBA 2G7UA 3K4NA 3QICA 5CVUA 1VTNC 5FKLA 5DS9A 3O3GA 2A69F 3DXKA 3LP2A 1F5TA 2EFNA 1ZGWA 2AHQA 4C2UA 3LSIA 2K5CA 4KFBA 4B47A 5TKWA 3WTZA 3CP2A 1O3QA 5LD2C 1MGTA 2OC6A 1YX5A 1CXQA 1G3SA 2M87A 1LFPA 2G9WA 2RE2A 2O8FB 3FBIB 4KITB 3IG1A 4QPOA 1ZTRA 3KP4A 4M3DA 4KYWA 1UMQA 2V1NA 4XLPF 4MLEA 3NAUA 4XIUA 1VQ8I 2QTDA 1R1TA 5LRRA 1HDPA 3ZYYX 3KEOA 3D7EO 1V5GA 3B02A 1ZXOA 2QBYB 3QBXA 1LEAA 3TO9A 1D1AA 1HW2A 1ZC6A 4JK1X 4RWTA 4RB0A 3BC8A 2JWTA 4KIBA 2HDWA 2JGUA 1B72A 3Q0WA 3K4BA 2GLOA 4RS8A 4FPAA 2VE9A 2E1ZA 2Z1IA 4XONA 3I0RA 3CZ6A 4E7SA 4XORA 2WOMA 1NM1A 4U7DA 4I2QA 1XMOK 2CS3A 3LANA 3KP5A 2F8SA 3KEQA 3E01A 4BVOA 3RMAA 3WTWC 2STTA 4HNUA 1SAXA 1GVJA 1X1DA 4MTDA 3DF8A 3ECHA 1YG2A 1UCRA 3O9UA 3TW7A 3CJ9A 1YYVA 1VAZA 4A5MA 4DQSA 1AHDP 2NVUB 1YHQN 2HPMA 5JI6A 2E7WA 5EYRA 3VEOA 4G8XA 2BY2A 4KN7X 2NS0A 1QQIA 3AVJA 3EKSA 3H5RA 1SFUA 1VSJA 4GYGA 4LK1F 1RT1A 2ISZA 1JJ6C 1LDKB 3MEEA 1XMAA 4PZJA 4C3HJ 4L9VA 1MDMB 3R6MA 2LSOA 4IDKA 2VBYA 2XGDA 3FXLA 3AG4H 4LF4K 2JPBA 4CJ5A 4J2EA 5HDNA 1IXCA 3BJAA 2FX0A 1UG0A 2GBZA 2RHKA 1K61A 1BL0A 3F8NA 3DLKA 1MW7A 4OGEA 3P5JA 3HRTA 1RNHA 1BOAA 2CFXA 1U8RA 4E1MA 1NGDA 2HHSA 3T69A 3ZQCA 2PAVA 5AQQA 1LUJB 3RPQA 2E2OA 1JLEA 2L4AA 3DLRA 2A3ZA 3C94A 2JA6J 5E84A 2HF3A 4LB5A 4NNJA 4CIFA 5JLWA 1JUSA 5D8KB 4Y4RA 1WSFA 4KHUA 3HB9A 1IV8A 2FOKA 2O61A 3QP6A 3ZQIA 5TRDA 3C6TA 3BPXA 4J00A 1TWCJ 2NAZA 3C7JA 5FKNA 2P9PA 1XNQK 4CFCA 4JN4A 1ETQA 4DF4A 3VPZA 1UHSA 2BOLA 1HYSA 5HRPA 4B9UA 2R7QA 4CD3A 4B9QA 3MAJA 2JVGA 3IUCA 4XIDA 1VQ4N 2R7VA 5HS7A 4GVMA 4UVAA 2VG6A 5ILSA 2LD5A 2L0KA 1DT9A 4JYKA 2OTLN 4JKBA 2CQKA 2BY3A 2VJJA 5AR0A 4IQJA 2L7FP 3GLXA 1YLFA 4EFHA 3FKIJ 2F5DA 2BV6A 3KYCB 4DYRA 1Y8RB 4OAZA 1IDYA 2LF7A 4CEFA 3G4SN 1JHHA 3AL0C 1KQ0A 1S6PA 2ETHA 5IY5H 1D5YA 2K9QA 4DYCA 3IKMA 4V2GA 4YY3K 1X19A 4R1HA 3NGIA 3VOVA 5B1AH 3NAEA 3C2GA 2JUGA 4BYYA 4XH4A 2WC9A 3LDSA 5B1BH 4OIPF 2K86A 3C65A 1STZA 3NCIA 3FGUA 4BQNA 4BU2A 3AAFA 1U5TB 4BBSJ 2PFBA 2GAUA 4YFXF 2VONA 2X1EA 3ZSRA 3GXOA 4IQ4A 5BPNA 1MH3A 3KFWX 3J80Z 1KU3A 3NARA 5J4VA 1FSHA 3A03A 3KK7A 4HF2A 4I01A 2VODA 4Y7NJ 4JOMA 1GLJO 4C8OA 2DN0A 1Q86O 4U67L 3QBWA 1SD6A 4EHUA 1U6GA 1WVRA 1JXBA 2VG7A 1GLFO 4DSLA 3S3MA 4F55A 4CJ3A 1FLIA 3K5MA 3N05A 1ETVA 4FLVA 4E7KA 2P5OA 4OPHA 3HUGA 4YIRX 3O9TA 4CYDA 1K78B 3HTUA 1G15A 2NNNA 4FE4A 3SHFA 3LSJA 5AIPA 3JRCA 3VEXA 2WFBA 3IDHA 1J5YA 2DT6A 3G6EI 2ME0A 4YEJA 3T0YA 1YW9A 2R7RA 2ZQBA 1WHUA 3ABUA 3CCMI 4M6VA 1TW2A 2O3FA 4MQVA 4CERA 1E3OC 5J1UA 2DT5A 4CEAA 3HYIA 4Q47A 1NOZA 1HLUA 1AU7A 1YRNA 4HF1A 1L3VA 2F5VA 3KD1E 2WY7Q 3H35A 2WBNA 3DKYA 1RILA 1PP7U 4EATA 1ZR2A 2IS1A 4D5CA 1JJ2M 1QHTA 1W97L 2QK9A 2QWRA 1KAXA 5ELZA 2E20A 3S1RJ 2HOEA 3S93A 4KN4X 3JTHA 3QAHA 3FM3A 5EJCA 1VQ8N 2DMNA 2V51B 3KX2A 4QCLA 2HOTA 3BEXA 3SFIA 1V55H 2L54A 3OIQA 2Y75A 2BXZA 2DO7A 5E3NA 2GELA 1V4RA 3CFOA 3AVMA 4FVUA 1TQMA 2E2QA 3H5NA 5GAHP 4I99C 2XUBA 4P5OA 1GHCA 1MJAA 4L5EA 4IHVA 4LB6B 3HZ6A 4IRGA 2O8DA 5IOYA 3P9IA 3SLCA 3LA3A 1OR7A 1D8YA 5ILVA 2DA4A 3PIPF 4CZGA 4RAYA 2W85A 3TSUA 2XV4S 4IL6C 3G0ZA 3EYIA 1EV7A 2G8HA 2K9NA 3PSIA 3KLNA 1IBKK 1MNDA 1N77A 2ZF5O 4YDUA 1D8KA 5M1OA 4IZ9A 4OKJA 3MWPA 1SQKA 3I4NJ 4H0XB 4AVPA 3Q3SA 3VN5A 2H6BA 4DV3K 1HSJA 4ISGA 1K9MO 2WADA 2ETJA 2BANA 1EWQA 1MNMC 4O5VA 4KISA 2UXBK 4C9YA 2VT3A 4BY7J 3DPUA 1HQEA 1MBFA 2LR8A 2XASA 3V9WA 4V19K 3QNOA 1SD4A 4RM3A 3QDKA 1ATSA 5BRDA 3TTCA 1NTCA 5CKTA 2B6AA 3MEDA 2RREA 3SV3A 3OL4A 2LSNA 3C1DA 1O3TA 2VXDA 2RPIA 1QZEA 2JA7J 1X9JA 4KREA 4AM3A 1U78A 3R8EA 3NH0A 4QSHA 4L8RB 2L9VA 3DLBA 3HZJA 5DUIA 4KB1A 2X74A 3HSEA 5C0YA 2P5GA 3HXLA 5JVGF 4QPQA 4U0YA 1ZKGA 4A3DJ 4H0YB 2O8BA 5AQUA 4MEYF 1A35A 4G9YA 2BW3A 2VI6A 3EKUA 3VESA 2Q1ZB 3KP7A 4JHDB 2EJRA 2DJIA 1BI4A 3SQNA 4BY9C 3MCPA 4YOWA 5C12A 1NK5A 2XB0X 1DTTA 1BBYA 2EFQA 1MMDA 4JEPA 3VTHA 4HHTA 2EZLA 2GZWA 3TU5A 4A5NA 1WJ5A 3AVIA 2X78A 3LAKA 4HV5A 1IXRC 3ASOH 3H3OB 2JLEA 4KPYA 1C6VA 4CCKA 3AO5A 1X4OA 2QWNA 3I59A 4RBOA 2VQLA 3FZFA 4CBUA 2YCHA 3NVKA 5KTQA 3THXA 4E1NA 3ZQQA 4B9MA 2IC3A 2P8TA 2VC1A 2R7OA 3AY9A 2KMUA 2LVSA 1XCVA 4BRIA 4M6XA 4HF0A 4KHQA 3S32A 2F4MB 4MGRA 2V1XA 2G8IA 2DPUA 4BE2A 4AHTA 2Q0RA 2EILH 2BE5F 1KZHA 2J5OA 1FJGK 5KAFC 3L2VA 3NDKA 1ZH5A 5F1JA 3HTVA 3BP8A 1JLAA 4GGGA 5BPIA 1MJBA 4OINF 4JRQA 1UB9A 4CJVA 3VYUB 3QOPA 3M8PA 4EM1A 1JKHA 5DD8A 2DMTA 1RTHA 2E2JJ 3ERED 1Y56A 1ETWA 4DTOA 2HKOA 2D0CA 2N8GA 3M1CA 3BR3A 1JL2A 2COBA 3I5UA 4WXCA 1Z0XA 2F4IA 4FJIA 2QF7A 2X6OA 3VA0A 1D8JA 3AKZA 1SMYF 2DK5A 2E2NA 2E34A 5J40A 3THWA 2HB5A 3QWLA 1QHHD 1R36A 3LA7A 2H1LA 2HHXA 3K2AA 2OPPA 5KPZA 5JVHL 1I6XA 3ZXSA 4HLYA 3PLAA 3DLHA 1V4SA 3QFPA 2CH5A 5HOOA 2IIRA 2XO7A 2OJED 2EV0A 5J3LA 3RMBA 3V9SA 2ZJPF 3A2FA 4HRIA 3UKUA 5BPLA 2M0MA 2GWRA 5HNFA 4FLTA 3WGGA 4KTZA 3B6CA 4FWNA 3LWFA 4CJQA 1RBTA 3ZMZA 3O9SA 2LRDA 4M71A 3OW2M 1OYIA 4NCBA 5E41A 1YX3A 3FM5A 1ETYA 4F92B 3HDDA 3RMDA 2QXLA 2QI2A 1SAUA 4JYAK 1RR7A 3EYYA 2UZKA 1ZG5A 4LLGF 4RG8A 1TKXA 3VF2A 4FLUA 2EX3A 3AVAA 1R49A 2OTJI 2HTJA 3RMCA 2MYSA 3SV4A 1IKXA 3K2PA 2I7PA 3ZSZA 4C8NA 4BQLA 5ERIA 4B4CA 2W48A 2R5YB 4BUPA 3CUQB 5KK1A 4ZYAA 3WU0A 2YPRA 3RRGA 4GV9A 1DGRM 1G3TA 3ULQB 4B08A 1KVCA 1XSXA 2X9DA 1FT9A 3MWMA 1MZBA 1TQIA 3ZQHA 2V7ZA 5BR9A 4XKVA 3RR8A 2XAJA 3SCXA 3ZP5A 2P9NA 3WXIA 4DW6A 3T19A 4UV9A 5JHFA 2KRFA 3ECOA 4C2TA 4JQFA 4I02A 2VXZA 3CF5F 3S3OA 4DR6K 2MABA 2VQFK 3ZETA 4IO9F 1TAQA 1YAGA 3GO5A 3OYJA 1XD7A 4QIWN 3WE2A 4QAGA 4ISFA 3RKXA 5E1XA 1R1UA 1WSJA 3TAFA 3VFZA 5DD4A 2M2EA 2Y0SA 4CZEA 5GADJ 5KRTA 3JAMK 2WBMA 5F1RA 1Y6IA 1YI2I 3LDLA 4I6MA 4NQWA 4CZCA 4G1QA 1XMQK 5GAGJ 1TKTA 2YV0X 3VERA 3MMVA 3ASMA 2IW5A 4X62K 2OYQA 2CGLA 3D0SA 4DLEA 2Y1JA 2K9SA 1W7PA 2LYCA 3CDLA 2O4IA 4LSLA 1HMVA 3S1QJ 3HP9A 3DEWA 2CW0F 2BHZA 5AQLA 1JKOC 4A2BA 1NBWA 4LH5A 3HG9A 4UUSA 3ZT2A 3K0LA 2FBYA 5ICGA 2DDAA 4H8KA 1RFQA 1VFCA 1B6AA 4MIMA 5E17F 1IBMK 4NDLA 3U1KA 1YF5L 4W5TA 1I39A 2P9UB 4GKJK 2Q2EB 3VYSB 1T95A 4M3WA 2DQRA 4IJAA 1M90O 4EV0A 2K9LA 2L7ZA 4G6TB 4Y3OA 4F9OA 3W6JB 4DHYA 2BZTA 2HSTA 1G3YA 5HS8A 4IZZA 1QO0D 1EXQA 2HNDA 1W5TA 1EH6A 2ZJ2A 2DFHA 1G4DA 3F21A 4GV3A 4AIKA 3GTGJ 4EM0B 1ZBHA 3TSQA 1PYVA 1KQ9A 1MMNA 2OAZA 3R4KA 1C0GA 4EMSA 3BY6A 2F9WA 2VWKA 2XAUA 3CQZJ 3WTYC 4CBWA 2PBIA 2AQFA 4DU4A 2DMPA 2IS4A 5E3LA 1GLEG 4JK7A 3G2BA 1ZREA 2DPNA 4XICA 3VMFB 4FSVA 3HKZA 1XNRK 2XY7A 1W2BM 4UY8I 3W6VA 4KTWA 5GADP 4IPAA 5H1SQ 1PDNC 1OPCA 4K41A 5GAGP 3L2WA 1PUFA 4FJJA 1RBUA 3U3YA 2MD0A 4YG2F 1S9EA 3HM5A 1CLQA 4OPJA 3SBTA 2A6AA 3VODA 4M3ZA 1K8KA 1JTYA 2ITMA 1BO5O 3LDOA 5FKOA 4AIJA 3S15J 3K0SA 4FWMA 4IOAL 3SNNA 5M3FJ 1IN4A 1IKWA 4LD5A 5AQSA 1IRZA 2FD5A 1MSFC 4BRMA 2F8TA 4H5NA 2PY5A 5DM6L 4B9NA 5M5WJ 2CQ7A 4DQRA 3DXMA 4JKAA 4JBAA 2VBWA 3CERA 4XR6A 2QWOA 1ETKA 3OY9A 2ZSIB 5EGOB 1IKYA 3NWTA 5HVQC 3ZSOA 4CCLA 3AVKA 3OIPA 2UXCK 3CLOA 3I4MJ 3LSGA 1G6NA 1PVEA 2WB1A 4A0XA 1S5LC 1K73O 1R59O 2X6SA 3V7CA 2WA0A 4IO8A 4GFBA 4I7HA 1X9WA 2P9KA 3ZRGA 4CEQA 4WQ5A 1HF0A 1OMIA 5D4SA 3WTSC 4LLLA 2E1NA 5KQ8A 4PKGA 4LF7K 3HO1A 2XY5A 3SDBA 4RW9A 1SL2A 1TAUA 1NJYA 2L7MP 4ZH4F 4XN0A 2YX7A 1RBVA 2KQRA 3PL8A 1UAXA 3TARA 3RJPA 4FZYA 4CCNA 1Q7YO 3ABKH 1YS6A 5C4JJ 5E79C 4BR7A 2GOMA 4CEEA 3D5LA 1SFEA 4BG8A 3GG4A 2DOEA 3UIQA 2YR2A 3MEXA 4RTFD 1P6RA 3B73A 2HMPA 3V4GA 1Q18A 4FZXC 4BRQA 4K8XA 2Y9ZA 2W40A 5AQOA 4ID5A 4O5FA 1LE8A 1AKHA 2X6YA 3L3UA 3CF2A 2XF7A 1TYQB 2YHBA 2OZUA 4J19A 1IGNA 2EWSA 2QKBA 4FWLA 4UB6C 3MKWB 4HNTA 2P9IA 3F5TA 1FW6A 2O8CA 1QGPA 1S9HA 2L9RA 2IP2A 1HKCA 4BHCA 3LPTA 3CCUI 2CU7A 3FBNB 5K7HA 3P38A 4FJ7A 2O4GA 1C0MA 1H9GA 1YTAA 1GLDG 2NVQJ 5DYMA 1J53A 4N4OB 1NGJA 4PJLA 2OU2A 1O7LA 1QNTA 2KLOA 3ISNC 2A07F 2LY9A 1MSEC 4DV5K 1Z05A 4HVJA 4PK4A 1HNWK 2HVSA 1VSHA 3LAMA 2ASOA 3HL8A 4A2UA 4CJRA 4F4KA 3K9JA 3MWTA 3KWGA 3PIOF 2ZJQL 3OYDA 3ZR8X 3LQQA 2YJEA 3O3HA 1USSA 4RAZA 4JI8K 2CGJA 1XC3A 3AA4A 4YOVA 2E1OA 2M7AA 3RZDJ 5M1PA 2QENA 4FE7A 1QU3A 5SZTA 2F5CA 3DEEA 3HM8A 2QWMA 4C8LA 4BGDA 3O8HA 5CYQA 2EA2A 3JAMZ 3P83D 1BW5A 3NF9A 5FFZA 1RDBA 3OJUA 4YHHK 5JMVA 1WJAA 3OL3A 4LF6K 5J8FA 5A2QO 3TKYA 4A12A 1ASVA 2V9KA 4MO4A 4OVLA 3TTFA 3VSLA 2M1BA 2XHBA 4ZTFA 2OCCH 2IBDA 5HNHA 4DCHA 2BXYA 3KLGA 4CXFA 1NMNA 4M7YA 5HLIA 3HOUJ 1HA8A 1KAYA 4NLBA 5GTIC 1YIJN 4JI6K 2UUCK 2ZMEA 3KP3A 2KFDA 4JI3K 2QXFA 2JN6A 2CGKA 3BZ6A 3K7AJ 2ZNYA 1XTAA 3VYTB 2ZJRF 4A3IJ 3LSMA 3TW6A 2JA8J 3HVTA 3SZGA 4Q5VA 5DCMA 4X66K 4ZYDA 4B1RA 2LH9A 2L5QA 3QEIA 1D0ZA 4NYFA 4DTUA 4OOIA 3NF8A 3KKRA 4OIOF 1R9TJ 3PO3J 2QQBA 3A02A 3K4KA 2GXBA 3SBGA 3CJBA 1U4BA 4IEIA 3W3DA 1X1BA 1LNWA 5E20A 3LOCA 4A62A 3MN6A 4I9LA 4A3BJ 3PNTA 5FLXK 3A0IX 5M1NA 3ISPA 1ZGJA 2JSCA 4BDYA 1FYKA 1RDAA 1ORKA 1IKVA 3IWFA 3VGMA 3M07A 1L3TA 1C1CA 3TSPA 2D5RA 3F8BA 1UHWA 1LJ9A 2VL8A 3ZMVA 3RDIA 2WTEA 3QODA 2KRCA 4CGFA 4ENMA 2DPDA 2GWJA 4KBOA 3CC4I 1QHGA 5C2FA 1CZAN 4OMZA 4H0PA 2VB6A 1JL1A 3CD6I 4JD2A 1SFXA 1Z6RA 3D2FA 4BROA 4Q4ZF 3D2EA 1OH6A 4FWRA 3D0PA 5LL6Z 4GYIA 4CJSA 4CDGA 3VOEA 3AO3A 1Q1HA 3FLCO 1OH7A 3F6VA 4JKGB 2MH9A 1SD5A 1T98A 4N9IA 5CVJA 5B66C 2F96A 1T2KA 3O4NA 2HMIA 2A5WA 3I33A 5AZJB 1D5VA 4KNYA 2YNIA 3KZBA 5ICCA 2O0YA 3DV8A 2W6LA 2VGMA 2FC0A 2KJCA 2XPUA 2W6KA 1OVYA 4IOCF 3J81O 1RUNA 3H92A 4A3MJ 1SANA 4O44A 3ELKA 2I10A 1Q9YA 3PUFA 5CZ2A 3DWLE 3ZT4A 4NO7A 5HRNA 3SYTA 4CHZA 4GMJB 4PGGA 4EJVA 4XH1A 2B63J 1IN6A 5FD6A 3OHRA 3IP4B 2DTRA 5AFUA 1JT6A 4F93B 2FE3A 1WI3A 1APLC 5FLVA 3HSFA 1F1ZA 5C15A 5D8LB 3DBLB 4DOZA 4DU1A 3SZ2A 2EPFA 5CVRA 3E5QA 4WWCA 5EEAA 2L9SA 2P51A 4BXFA 3HOWJ 3JRBA 2NS7A 3DU6A 3ZX2A 1O57A 1ONVA 5EG0A 3H3ZA 3HL2A 3OYGA 1T38A 2Y9YA 3OS1A 3AG3H 1JGGA 2DA6A 1RZ4A 4JI7K 3CCUN 1SKWA 1LWCA 3V8JA 3E6DA 1P8ZA 4CEZA 2PYLA 3QIPA 1UJ8A 4IHWA 3G1OA 2D5VA 3WG9A 5EU7A 4JI1K 3ASNH 3KEYA 3WGIA 3WODF 1J5OA 1F36A 3DPTA 1UA0A 4HLXA 4I9QA 1VQPI 2PJPA 4WX9A 1T33A 3TANA 3DCFA 1Z6TA 2LFBA 3OIOA 4K42A 4M9XA 1YJNI 4DTNA 1D1CA 4CJKA 3E6BA 4LC9B 3T8RA 1ATRA 3FXKA 3EETA 1BU6O 1RT2A 4OX9K 1U8BA 2E36A 5FFXA 2RDPA 2EINH 5FPMA 3VF4A 2IRFG 4A3KJ 3MDQA 3KZYA 4II2A 2HQ5A 2DW4A 2E1YA 5EF6A 3L6QA 4XLNF 1BI3A 4BR0A 3A5MC 3TDUC 4D1QA 2WUSA 1J7KA 2BYVE 4CEOA 2A40A 4U88A 1JLFA 1IW7F 3CDIA 1OR7C 3U2RA 4BJ6C 3OYHA 4YFKF 3VEVA 2PJRA 1WNSA 4WYBA 3QYFA 3JRHA 4MEXF 3TOBA 4DQIA 2EWNA 3BJOA 3BR6A 1BN5A 4OMYA 3JYTA 1QA6A 5EOYA 5IYDJ 4YDUC 3FISA 1D1BA 4KRFA 4EVIA 3L2CA 1WAFA 4M41A 1Q81O 3P39A 2NXNB 3ZX0A 3VWBA 3BR1A 3GLLA 3DU5A 1S22A 3JRAA 4CJFA 1IV0A 3CMYA 2GEMA 3DLLF 1RT5A 4DBRA 2W84A 2EZKA 4M7XA 2OANA 1VF9A 4D0PA 3KZIC 2OA8A 2OA4A 3K4MA 1S1UA 5HROA 1U3EM 2VQGA 3THYA 2IAIA 3CCSI 3P7NA 2R4GA 4H5TA 2P9LB 1G59A 1N32K 4BH9A 3JRGA 3ZEUA 1TTYA 3JR9A 3TDZC 4BRAA 1I1GA 5C44J 1R4NB 3ZOBA 3LNQA 5LEJA 4BR5A 5J8CA 3HPOA 5CLSA 1XCBA 3WXLA 2DA7A 4C8KA 1Z21A 4P55A 1DGKN 3W2WA 1HKGA 4YORA 1DDNA 2WAQA 4CFBA 1SFOJ 1VQOI 1CF7A 3F9KA 3GBTA 2K3PA 2E8AA 4MHGA 1X2NA 4O5BA 1Z3XA 5D5XB 1R5GA 3PUBA 2R3SA 4KMFA 1ZAOA 3C18A 4N47A 1XC5A 2KZVA 1DEJA 1YJWI 5JLFA 1RUOA 3R60A 3FWEA 4AHSA 3P31A 4XLFA 2A41A 2HHHK 3T1BA 3G71N 2XDVA 2W57A 2KZMA 2VIXA 3J8AA 4WF2A 2HBLA 2NVYJ 3K10A 3D6RA 4LSNA 4B1XB 2V52B 5BMZA 2K27A 3SAFA 3ZQGA 5E8GA 1IN7A 2LLKA 3MKLA 3IS9A 2XAFA 1BCOA 2NS8A 1N33K 1D5AA 5FLXZ 2YS9A 5FJ8J 3VENA 4HZFA 1KAZA 1KFSA 5KRSA 4BXUA 1HRHA 3CIPA 2JJ7A 2XAGA 4IVNA 2JRMA 4P9UA 2HI3A 2G8KA 2F5FA 5TGTA 4Q0BA 1ODDA 1JXSA 3S14J 5FLMJ 2JPCA 5JLXA 4C8MA 1Z7LA 3CM5A 4LFBK 4BC5A 3VEYA 1JGSA 2VWJA 2QUFA 1JI8A 4PHTX 4GW6A 3VQBA 4FLWA 4DTPA 4PJJA 3DXKB 2GA2A 4H0OA 4DG1A 2F9TA 1AOYA 3I8BA 4CZLA 3MQ0A 2HNHA 2O5RA 2KZZA 4BRPA 2Z3YA 3DYAA 3E9OA 3CQYA 1QE1A 3I8DA 1W36C 2C6YA 1Y97A 1HW1A 1NJIO 4HQEA 2QW9A 1M1EB 4EEFG 1X4PA 5BNGA 1VSKA 5BPDA 4F91B 1V54H 3ATUA 4PDKA 4YELA 4I0AA 2VPRA 1S7EA 2ZB9A 2JZYA 2LKPA 1JTXA 4EIAA 3WQUA 2G7HA 1B72B 3C95A 1WH5A 4BHBA 5FRMA 4UXNA 1J9AA 5ILUA 4DS5A 3W2VA 1R71A 3S3NA 4EAHD 4O3MA 1T0FA 2QLZA 4I6ZA 1E3MA 1ON2A 1RDWX 2Z1GA 4TV7A 4B1WB 4EJTA 3EZ5A 1GV2A 5FKKA 1NK6A 3IHUA 4F8RA 4DTXA 4KHYA 1ETOA 2KIQA 1QZ5A 2GBYA 1BG3A 3ENOA 1SFKA 1YTYA 1FPQA 3OYAA 1D9FA 1FBUA 3OYEA 2V9PA 5HP1A 3QLHA 4RGXA 4FLYA 4AHCA 4WF9L 1RPWA 2KW4A 1REPC 3HYFA 1VQPN 4HDVA 4B3AA 1QRYA 4WXDA 5AIQA 5C10A 3VDXA 2P6SA 1YJNN 4LG0A 4XLEA 4IEEA 1YHQI 5CE3A 3SUNA 5B8HA 4IOXA 3VQPA 2O8EB 4DR5K 3H3UA 1LVKA 4JS4A 1A5XA 2R5ZA 4BC4A 1X3UA 4ZJZA 4CE9A 1L3LA 2VE8A 4LFAK 3G10A 1YT3A 2HF4A 4NUBA 3LDPA 3AGKA 4E1JA 2F6CA 3K70C 4JV5K 3IAS2 2COMA 4F3OA 3OYFA 1L0OC 5KCMA 3DFGA 4Y1DA 2DOAA 3L8BA 3L2QA 1IV6A 2OBPA 4H5VA 2CYYA 3TOAA 3PX6A 4CJWA 2GA1A 4HCBA 4B09A 1Z9CA 1X3NA 2YJFA 1RDDA 2VCPA 1HQUA 2PYJA 1BIZA 4DQQA 1MNEA 5FPNA 1P7IA 1KCFA 3OR1C 2XGCA 4B3TK 4DR2K 1QTMA 1LQ1A 1ZGAA 3QERA 1BCMA 2EBIA 1LFBA 3QB0A 2P9PB 1GVDA 3GTQJ 2MW8A 4B43A 1ULYA 2TDXA 2BTFA 4WFBL 4YOTA 4D7NA 5J1YA 3S8PA 3BGRA 2AO9A 4Q5SF 3MFKA 3NFAA 4XLHA 3J7ZI 4E7LA 4KH6A 3ZN0A 2R7XA 1LAVA 3A0HC 3BG7A 1JKQC 4UVBA 2Z5UA 3SYZA 5KNLA 1AWCA 5BRFA 1HKSA 3CO7C 3T3FA 1WFXA 3P1GA 2JUCA 2FSNA 4BRHA 3CCSN 3G1MA 3A0BC 1KYWA 2P81A 5D6FA 2ISYA 2H1KA 3IL2A 3E1YA 1FY7A 2E1MC 2OTLI 3E9LA 4CHNA 4KIGA 3TEDA 2O8XA 3VEWA 1R6RA 1FTTA 4DR3K 1TKZA 4Z0UA 5DM7L 3R0AA 2A5XA 4JAXA 1VQON 3OR2C 4IBNA 4RW4A 3GEZA 3DRPA 2CQXA 1IUFA 5IT9O 2OUMA 2L2OA 3L9FA 1YJWN 3EDPA 3GTJJ 4RGRA 3PX4A 2VWBA 3MZHA 4F7ZA 2PMZN 4CHQA 2HBMA 2ELHA 1BR2A 1T6DA 1U9NA 4GKKK 2KT0A 1WSUA 4CF2A 1PUEE 3TWHA 1WN7A 4DSFA 2WAQN 3QP5A 1R1VA 4I2OA 3KK2A 4RB1A 2KHOA 3WU1B 5IOZA 2VKEA 5EEHA 2YUSA 1IO2A 1TGOA 2NNWA 2P9SA 2FSJA 4K43A 1RRJA 1J9IA 3VQDA 2XIGA 4LITA 3LM9A 2KIMA 1YW7A 3BDDA 1HKBA 2GUIA 1I3AA 3AA5X 3LSHA 1Z1DA 4KA4A 1XG1A 1N6QA 2M9HA 2Y2ZA 4XOPA 3IKVA 4AHVA 1QPMA 1S3JA 1S1VA 3QEWA 4HW0A 3IC7A 2NVXJ 3RTVA 3I0SA 3CCVN 3CJRB 1FBSA 2E1CA 3CCRN 1RIOH 3CDHA 3GUDA 4ESFA 4PCQA 3K4JA 2G8FA 3RWUA 4PKHA 1QZ6A 3JCUC 1B8IA 2QEXI 4RM2A 4QS9A 2STWA 4OLBA 3HSCA 3CCQI 4GRIA 1YRNB 1RKWA 2P7CB 3KPHA 1N8RO 1IG7A 5F0CA 2D1HA 3K59A 2FBIA 2Z1JA 5BREA 2FA5A 2KJBA 4K2EA 3TQNA 2XPVA 3G73A 4CGZA 1Z77A 2DA2A 1KSPA 4WQ5C 1TNSA 2V7YA 4M3TA 4ID1A 2PLYA 3JS6A 4AC0A 2KP6A 4JI0K 4NXMK 4FJKA 4JI4K 3BQZA 1FKOA 5EVZA 3PQKA 3UNGC 3K4LA 1XQSC 3MKYB 2AS5F 2F2EA 2LMDA 2X6WA 5CJ9A 4ENJA 4ITVA 2PN6A 1TWGJ 1BR1A 3LL7A 3WEEA 1KYZA 1NGFA 1IG8A 1BA0A 5F1XA 3OSFA 2BBYA 2O8DB 3ZSYA 3GFLA 2HDDA 1NKBA 3L3VA 2ICWG 3DEUA 2CUJA 3BF1A 3SPYA 3RQIA 2X6XA 3OYLA 1U45A 3N4QA 4HNVA 1E4GT 2R7UA 4FJHA 4FO0A 4L3QA 5J4YA 1IF1A 2WV1A 3C6UA 4CIGA 2MFZA 1TVRA 4F3TA 4WK8F 1CZBA 2XF5A 3OYNA 4F3QA 5AQXA 4DS4A 2A6HF 2CGPA 1OFCX 4ZZLA 1L3UA 4XLAA 1IXSB 5DUKA 2E6LA 4I09A 5F08A 5J1RA 3OJSA 2E5LK 3ZMUA 2HW3A 3ZX3A 4V19S 4OGCA 4ILJA 5IP6A 3SUOA 1DP3A 3GFJA 2EZIA 4DV4K 1SC7A 3Q9SA 2LKXA 3VGKA 3M8JA 5E3MA 4DTSA 3EUHA 2XB5A 1IUYA 1XB4A 3CYMA 1OH8A 3WG7H 3R61A 4BE0A 3Q7BA 3K5OA 3GBGA 2BY0A 1TK8A 1B4AA 2HYFA 2YHXA 4M3UA 2XKOA 4C30A 4A6EA 2JRTA 2O8BB 3OSGA 3V1OA 4CJ4A 3MECA 5A2QK 5AZIA 4V2FA 2BW3B 3SAHA 1MKMA 1FOWA 2HQRA 1NK4A 1BI4B 2A42A 3TMOA 4FOIA 4W5QA 3J7YJ 2DDBA 3VPRA 3Q0UA 4EJUA 1NGEA 1E2XA 3E66A 1E17A 4KV8A 5FROA 1LDJA 1F4KA 2FF3B 1HW5A 4C1NK 3LFKA 4CF8A 1W7AA 4ISEA 3I59B 3GTMJ 5BR8K 5J2QA 2FXAA 3THXB 4EQQA 3A4CA 2HTSA 4Z4GA 5CY4A 3C7NA 3IWZA 5E1ZB 2P1JA 2FOWA 2V4JC 1Y0NA 3CCYA 4L18B 3RKQA 5CR4A 3RI4A 2E60A 1K8AO 1XGMA 1YTUA 2PZSA 1R22A 1TT0A 2GQQA 4PJNA 2NRAC 5K14A 3L09A 1O7FA 1LWEA 2YU3A 2KQ2A 4AHUA 1ERDA 1O4XA 5L3BA 1NNEA 5C24A 4DFJA 4Z4FA 4UY8O 3IAYA 4L9TA 5FPDA 1RGIA 5FLXO 5I9EB 3FDYA 3FZHA 3HHHA 5C25A 2ZMEC 2JA5J 3SMSA 1C0TA 2DBBA 4R79A 2VG5A 3FXQA 2UUZA 2QSFX 3CJTB 3GMEA 4MNUA 1I3QJ 3GTKJ 4WQ4A 2PMUA 2QWWA 3SQ2A 3AV9A 1NMDA 4RCHA 1W36D 3ZSQA 3UR3C 4BY1J 1X3ZB 4IEJA 5BRHA 3ZLJA 4FWQA 1ZYQA 2RF2A 3FXOA 4ON0A 2WTUA 3TAGA 4YIIA 3W0LA 3K69A 4KH4A 4YFUA 3THWB 3ROUA 4AU7A 3COAC 5LJWA 3THVA 4G7ZF 4GDFA 2BEOA 2Q1NA 4WFAL 2P5LC 4BWMA 2HYJA 2CUFA 2D0AA 3KTQA 5M5YJ 3J7AY 3WHBA 2FF6A 3UKUB 3MK6A 1T8IA 1FXXA 2LC2A 2MSYA 3RIRA 3WNHA 2VQCA 1S8NA 4O8UA 2EZHA 4DBQA 1RTDA 3J81K 2FSKA 1J54A 5D5UB 2XY6A 2IXSA 1U0JA 2DYSH 3CO6C 3SEQA 2H8WA 5AFUH 1WJBA 2QEXN 4FM0A 3NEUA 1N25A 5GIOA 1HXDA 3CCQN 2D2WA 1IH7A 5AQTA 1BGXT 2QKMB 3DTEA 5LGUA 3H9QA 1EH8A 4XBFA 1NG6A 3VTIA 3LA2A 4FJGA 5IP7J 5E8IA 4CESA 3WUHA 2D0BA 3H46O 2V1DA 2XROA 4CZJA 4KI6A 4BHPA 3S41A 1R5HA 2PBDA 1T6SA 3K70D 3O5BA 4DR1K 5J2PA 2P9NB 2JQ7A 1Z67A 1XDSA 2IVPA 4JKDA 4U87A 1VZ0A 1VQNI 2FBTA 4OU0A 3UKRA 4D9JA 1EETA 1TLHB 2DFEA 1SVLA 4O4GA 3VF6A 1V4TA 5H6RA 1I6HJ 3SQ0A 3ZETB 1VSDA 1C0WA 1KLMA 2WC2A 5EZGA 3CFPA 1FZPB 2DMQA 1BL3A 1KU7A 1YUWA 1RR8C 1WZ2A 1KQSM 1W7PD 4CJTA 3MX2A 4XQFA 1XN7A 2DCEA 1ZR4A 1DP7P 2P4WA 1BA5A 3CJ1A 3M4OJ 2HXIA 4I6MB 4NQWB 3HI0A 3QU3A 1EH7A 2AA4A 2ASPA 5H20A 3KHYA 4BGBA 3KVGA 4NBQA 1W7PB 3WXKA 3WNEA 1ATNA 4IF4A 3IH3A 1UG2A 2DK8A 2B5JA 2CH0A 3TP0A 1OYYA 3CLQA 3A2KA 4XLCA 4UUSB 1U5TC 3GWZA 2B0LA 4YNQA 4MQ9F 4G6DA 1FX7A 4A0YA 2MLGA 2YNHA 2YNGA 3AG1H 4GY2B 1ITGA 4ESBA 4KHPK 3DQVC 5AQRA 1SKRA 4IHYA 1BHLA 1P9QC 2ELKA 3Q9VA 2M5WA 1UHMA 2HFHA 9ANTA 2TCTA 4QTRA 3GZNB 4FOEA 4IHSA 4XH5A 4BRLA 3VETA 2E1MB 1KU2A 2V6EA 3ZT3A 2DTZA 1KA8A 5HLTA 3NWSA 1FSEA 5CZ1A 2EV5A 3BTIA 1IG9A 2L01A 3NQOA 4IJNA 2QKKA 3OMYA 1VQ5N 2KRHA 5C42A 1TZLA 2PQ8A 5LHGA 1XPXA 2MBFA 4E70A 2XRLA 2D45A 1YXQA 1RT4A 3VYRB 1NJWA 3RVCA 4O8KA 5TISC 3M3YJ 4HCCA 2LP0A 4DSKA 1HOMA 3QPHA 1BUPA 1ZRDA 3SPZA 4AM7A 4MLOA 1SVMA 2BDPA 3E1SA 2OZ6A 3C0BA 5J6XA 3V7SA 4M63C 3BCBA 1MH4A 5DTDA 5A2QZ 2XC7A 1P90A 4EJOA 1H1VA 1R00A 2WWYA 2I5JA 4C3JJ 1HNZK 4CGHA 2G0EA 1PUFB 2NRWA 5HBMA 3U6FA 1JLQA 3SUPA 2NNYA 1KGSA 1GXQA 3M8RA 1X2MA 3KLOA 2XVCA 1DU0A 1K8KB 1NK0A 3MXMA 5SWMA 4MTEA 4EGZA 1NGIA 3ESWB 3MXJA 2M8EA 5KGXA 1MJ9A 4EZ9A 4JK8A 1ZG3A 4CSWA 4O55A 1QBJA 4NB5A 4LF9K 2W00A 4I76A 1J6ZA 4GXOA 3PO2J 4Y13A 3OA9A 3H3VK 1IJJA 1HR0K 3K6GA 5GAEJ 3RSEA 3BOQA 4LOCA 3DXMB 3V1QA 1HCRA 3DTIA 1YJ9I 5AQIA 4CK2A 1YITN 3I4PA 3ZQFA 1XUPO 1HSTA 3EPZA 2LKSA 1K83J 4DFKA 1F43A 2FSWA 1WJFA 2ASMA 5KPRA 3KLFA 5FD5A 5F0FA 4E0DA 2LBFA 4KO0A 3CMEI 1S9GA 3PNVA 4LLNA 3H08A 5LY3A 1UFMA 2NRRA 4B8XA 4M3GA 2Q36A 2KFNA 3C6HA 4OWRB 1IC8A 4PFOA 2LNBA 1FJLA 2P9KB 3DLAA 1B92A 4N4NB 2XY8A 1U47A 3OOPA 2UXNA 3O6BB 1ZYRF 4DKWA 3CCJI 4QOZB 2CO5A 4B3OA 1HQCA 1J0RA 3PJRA 1F9NA 4BBRJ 4DZJA 1W0TA 3GCMA 3JXUA 3BPVA 1FC3A 4BJ5C 2QQAA 4X64K 2YSRA 3MN5A 2NOGA 3C6AA 2HWVA 4CD1A 4KHSA 3A8YA 5HS9A 3BROA 3VQQA 3JSMA 4JK9A 1QVGM 2VOOA 5LGNA 3AGRA 4UQGA 4HX8A 2Y31A 1AKHB 3J80K 3A5OC 3MCAB 3JREA 2CQNA 1FWZA 2Q8KA 4A3CJ 1S6QA 3I71A 3CC2I 3V9XA 3TI0A 4CZHA 1IRXA 4KDPA 1W9HA 1WJDA 4HWIA 2NRZA 3K2ZA 4BXXJ 5GAEP 1FIPA 2V1UA 3J81Z 2IDOA 2P9IB 3E0JB 5GIPA 1EJ9A 3LDQA 2O8CB 4B9SA 1I50J 2EIJH 3KP6A 1IRGA 3K57A 3QEPA 4NC8A 5FB2A 2DOFA 2BVLA 1POGA 4FXDA 2YKMA 1IJWC 1SMTA 4FJMA 2R7ZJ 2Q97A 4DJAA 1VQNN 4OAYA 4Y0WA 3IUOA 3N4PA 3CM6A 3FKJA 3GVAA 2BY1A 2CQQA 4QS8A 4AVZA 1MDUB 4CVNE 5JFRA 3FIWA 2BUPA 1P7JA 1U2VB 4XKBA 1PP8F 3LZIA 2J4RA 3VA3A 3OS2A 2HZTA 4KHWA 4E89A 4RMNA 4A3JJ 5AJ3K 3BQYA 2IVMA 3MXIA 4Y33A 2DA3A 3PFIA 3GZ5A 2L02A 4PQUA 3CESA 1RDCA 4Z4HA 4B1UB 1X9MA 3HOSA 4FJ5A 3SDGA 4KJZA 4CZMA 3S17J 3R1XA 3PV8A 4FJ9A 1W1WE 4OKKA 1NGHA 4H4MA 2E2PA 3I56N 1KRPA 3LAJA 4L9JA 3R3LA 1HC8A 1T0FC 4DU3A 3BTLA 2YNFA 2P5VA 2GWKA 3HJEA 4AYBN 4IFYA 1Y1VJ 1NKEA 4XK4A 2E2IJ 3QMLA 1ZBSA 4X65K 2A05A 1ACIA 3KJVA 5HRSA 1TK5A 4ZYGA 3MN9A 4FL9A 4H0TB 4P96A 2I5UA 5JVTA 4HUEA 1HBXG 4OPKA 5AQZA 2DA5A 4CGGA 1DU6A 1UZCA 4ZYHA 3WHCA 1QZZA 5F6FA 4BS9A 3LQRA 4M3YA 4PWDA 3ZCMA 4JX6A 4JKCA 4R5PA 4G6QA 3BJ6A 4FWPA 1KC8O 4CO8A 1Y39A 3FR0A 2IGNA 1NKCA 4Y15A 1IAWA 1BI0A 5LJVA 1XS9A 1SL1A 4FYDA 3LP1A 2A3SA 4CI6A 3AL0B 1J5EK 2RQPA 2ESHA 2ZMEB 1X1AA 1V3FA 4FLXA 2CMPA 3TO6A 3B6AA 1YIJI 1VHXA 1TK0A 2G8VA 3JSPA 3LSKA 1OCTC 2CUEA 4Z4IA 2NLXA 4OLAA 5DCMB 1BC8C 3VEZA 4E7HA 2JWLA 1EQYA 3I9V2 3E5XA 2VKVA 1TL1A 3MX5A 1WPKA 3C2HA 3PQJA 2ITGA 1WRJA 4A3FJ 2M0CA 1QPIA 2HQAA 4IXAA 1RTIA 4BEHA 2VT2A 2ZCWA 3JRDA 2F7TA 1WSEA 3LFUA 4M3RA 3CUQC 1ZLKA 4O6JA 4KTQA 3L7WA 3DRSA 5CYMA 2FQ4A 2OQRA 3BY5A 3VQ4A 5LRSA 2O8EA 3HRUA 1HNXK 4WCEL 3KKSA 1VQ9N 3H1CA 3Q5FA 2MA3A 1HYVA 5IT9K 1MU2A 1SZ2A 2QWLA 2UXXA 4XRMA 1S5JA 2FLOA 1QZYA 1YJ9N 3ZSWA 3DPLC 4YOUA 4C3IJ 2FNPA 4JD2B 2ZO4A 3S2WA 3D2FB 1MBKA 3LSPA 3D2EB 4EHTA 2O8KA 2QWQA 5LBQA 2K7LA 3AO2A 2A61A 2V7FA 1BOBA 1SD7A 3GX4X 4B3XA 1IRFA 2E88A 3CMEN 2VBXA 3O3KA 4KMUX 4N5SA 2FXUA 5BN8A 4CH7A 1DKGD 5M3MJ 1Y0UA 2Z1DA 1WJCA 1VQ7I 3KK1A 3M1FA 4M42A 4GVEA 5LLQA 1WI9A 3FXJA 2O6GE 3QO9A 1XGNA 4FASD 1X3MA 3AVFA 2XSDC 2R93J 4A3EJ 2VASA 3CPEA 1X58A 1OKJA 3CCJN 3I53A 3E97A 3CHWA 1DPRA 3O2PE 3GTLJ 2VJIA 1ZK8A 1MIJA 2DU9A 1B1BA 2WONA 3VQAA 2CW8A 4CF0A 5K5OA 4C23A 3BUZB 1HPZA 4GNIA 2D0PA 3KLHA 1HYZA 5D6EA 3A5LC 2HKXA 3L2UA 4FM2A 4IHXA 2DTUA 2X1DA 4B1VA 3KLIA 2XAHA 4XRSA 2NUBA 3E7LA 2A1SA 2K02A 2ZKZA 5BN9A 2R7TA 2CV1A 3MZ8A 1NLVA 2AXLA 4FVMA 3F0CA 2P7VB 4BL0B 2G8UA 4OPAA 3AO4A 2CG4A 2BE2A 4CYCA 2E5NA 3LZJA 1NGAA 2HNZA 4DV2K 3CC2N 2EQRA 2OPTA 2VC0A 4DQPA 3O80A 1SUQA 2AP1A 1QQNA 4RW8A 3TPQA 1OCPA 5F0HA 1ZBIA 1KFDA 4MO7A 1D0YA 3OYMA 5EG0B 1X1PA 2A6TA 2HPIA 1T39A 3BG6A 3IRQA 3S1NJ 3HRMA 1QQMA 2A68F 4JLHA 3SJHA 3PIPL 3DMJA 3LDNA 4PJMA 1NGGA 3BR2A 3TP3A 4IOAF 3NGZA 5MLCQ 3RPUD 1LW0A 2W1OA 3OOUA 3ULEA 3FMRA 1VQMN 5GAHJ 1W0HA 2FNAA 1A6IA 2E7XA 4F2SA 5DM6F 3V81A 1FOYA 2CV0A 1LWFA 2QSHX 4D7MA 2DI3A 2YI1A 4CHPA 4LJZF 2HHTA 3HBTA 1N75A 4PSXA 2UXDK 4LGWA 3U8XA 3E5UA 1RNLA 3CMMA 2FBXA 2OZMA 3H45C 5ADXA 4F2RA 1TUYA 3F22A 1G3WA 1KD1O 1YE9A 1SL0A 1A6QA 2LY2A 3F72A 1REVA 4I2PA 1R58A 4UUVA 3EQLF 2E35A 1WBBA 3WE3A 2PI0A 3HGGA 1WKMA 1FOXA 3A01A 5D3GA 3FZKA 2OQGA 1USTA 5HDKA 5M1KA 2EB7A 1VQ6I 2M3AA 5JVGL 2I8DA 1A31A 4Z2YA 2A6EF 2PJRB 3WTVC 1U04A 3QFUA 4HUFA 4DLGA 3O8MA 3HOZJ 3NGYA 5JR3A 2YU9J 1AA7A 2ZWHA 1T03A 2YHYA 3D5RC 1NG9A 4DUYK 3EUAA 1D3YA 3DKWA 3H3NO 3QETA 3ABLH 2XAQA 3X2QH 3WT0A 1IZ1A 3CCLI 5IPAA 4M9SA 2EH3A 1G99A 2IA0A 1K79A 4DNCA 3GFMA 2DAOA 2O8FA 1GLAG 4EP5A 2KTQA 3CC7I 2HYGD 3VQ7A 1QVFM 5IT3A 4M6YA 5K5RA 4YFNF 2PEXA 1JKPC 1HNIA 3EUHC 4CZZA 3PO4A 4J2BA 5L3FA 3VEPA 3L2RA 2QBYA 4E7JA 3THYB 1S29A 4IDHA 2FU4A 5K7ZA 4XKCA 3T1HK 1OLTA 4E19A 2LK2A 1FEXA 3ZEUB 3I55I 3KP2A 3SJMA 4XSZF 1LW2A 3F23A 3KE2A 3DTKA 1ILYA 3J7ZO 3HEFA 2ESNA 2ME6A 5JICA 4DV0K 2P6TA 3D45A 2MC3A 2MD5A 3SK3A 1CF7B 4Z4CA 1TWAJ 2OPQA 4JX4A 1V5FA 2GTDA 3ZSXA 1RTJA 1BISA 3LALA 2CRGA 2L7KA 3RCOA 1W5SA 4RLFA 2NRHA 4AILC 3LWMA 3OWTA 3CJNA 4B8AB 3ZCOA 1WSIA 3OYIA 5CQEA 2BGCA 2ZJQF 1H8AC 2ATQA 2B9SA 1MDMA 3G71I 4UB8C 3ERMA 5EY4A 1P4XA 3K9KA 5F2RA 2H94A 3HIFA 4EP4A 4HAMA 4AWXB 4IKFA 1YQAA 2UWMA 2NRTA 5M1FA 3NH2A 3V4IA 3DLEA 2GXGA 1C0UA 4CHUA 4A5BA 4W5OA 4ILHA 1N34K 4KB0A 2W24A 1BQMA 2ZJPL 1GT0C 1GUUA 1VQ7N 5IT9Z 5FO5A 3WU2C 2JK3A 4DMNA 4CHYA 4BRCA 4GCVA 4M74A 3HGYA 3KIOA 2HNYA 3HPGA 5AONA 3I0TA 4MDBA 3EL2A 1HPMA 3N4MA 1J2XA 3ML6A 4WQ4C 4HQMA 2QQ9A 3F8FA 1OYWA 1WBDA 2Q2RA 1LV5A 4FCYA 2QWPA 4PJ0C 1P92A 4S0HB 2VJ4A 3ZT1A 1JE8A 3IFRA 3VSKA 4B3MK 4BVPA 1H0MA 2IS3A 4ZYEA 2K85A 1H89C 3KCCA 1MWMA 3RYRA 3HC7A 4N41A 4CFAA 4XOTA 2GXAA 5LMUK 4XL9A 4JKEA 5AQWA 1KVBA 2VUMJ 4B9LA 2Z2SB 3ZT0A 2QM3A 2Y48A 4KHNA 2IEKA 4CEBA 3CPWM 4B3RK 3F8CA 1FYMA 1L5UA 2UUBK 2UV1A 2LREA 2CWEA 3TO7A 3U4LA 4HV6A 5LHIA 3O8GA 1FKPA 1OISA 1O13A 3TAEA 3VQ5A 1QVTA 2IA1A 1D4XA 2K4BA 2K9MA 1CZ9A 3HSRA 2MH2A 2KFZA 3CUOA 3MVPA 2KLAA 4J01A 3Q0VA 3CF5L 1E4FT 3G3ZA 4E3SA 2FUG2 1XDUA 3IAM2 1NK7A 4KAZA 1Q8IA 4MDAA 4IO9L 2QCOA 2RGVA 2R7WA 2PG4A 5AQGA 3HOYJ 3CETA 3CCEI 2HHWA 1U5TA 2D4WA 4RW7A 3IV5A 5EEGA 4IFEA 4CIEA 4DR4K 3ZN1A 1NU0A 1A5VA 3LM2A 4IRIA 2Z16A 3BTCA 2X48A 2ZE2A 4FLZA 3DI6A 5CYVA 2DMUA 3OS0A 1SS6A 3MN7A 3U21A 1O3SA 5CPRB 2XGXA 3HRSA 3DOKA 4LG0B 3DJCA 3PSFA 4K8ZA 5DCFA 1KONA 1KVAA 2Z1HA 1W0UA 1NHAA 2CJJA 3RPUA 5L3EA 4AH9A 2FBKA 2R5ZB 3DLGA 4FJXA 4ZDOA 1RBSA 5F64A 2QSGX 1DTQA 3NE6A 4RAFA 4FPBA 2ZXHA 3K5NA 3E6MA 3W3CA 3DRRA 4BR9A 2ZSHB 3EYZA 3SI6A 5DK5A 3VQ8A 4HTLA 4NLCA 1K78A 3QPLA 2OCEA 2ECBA 4G7OF 3G6EN 4N9HA 4Z6YA 3MZYA 4L9NA 3LAPA 4CGDA 5HODA 1VQ6N 2ADUA 2M4GA 3CCMN 3TR8A 1FTZA 4MLHA 2CV2A 1ZARA 5DV5A 1WWXA 2RAEA 1XSVA 2M34A 1YO5C 5KI6A 1WLJA 5TKYA 1ZRCA 3FFKB 4GO1A 1J09A 3GFIA 4BWJA 3ZMSA 1T7PA 5L3GA 3M7GA 3H1QA 2Z33A 4ELTA 1HLVA 2EFWA 1J59A 3BCAA 1MD0A 3H6EA 3V8LA 4FJ8A 2H3GX 2VQEK 3EE9A 2HGCA 3CCLN 2FMLA 4OJRA 1MMSA 2R7YA 4P9FA 4XM3A 2ECCA 4EGYA 1ZELA 4L5JA 2IT0A 2RN2A 3S1MJ 4A2AA 2X51A 3CC7N 3FXUA 1HX1A 2Q0UA 2GX9A 4JS5A 4DYQA 4LFCK 2ELJA 1B59A 3O6WA 4PA1A 4M3XA 5IYCJ 3O1WA 2RNGA 3LPUA 1BOTO 2ZD1A 4PL7A 4PUSA 5IWAK 1TBXA 5K5QA 4ZHRA 3O08A 4UUTA 1SV5A 1BW6A 2X0LA 4NC7A 2CUZA 3LSRA 3RR7A 3L4QA 1EA3A 3I55N 2UU9K 3VGLA 2R7DA 5DDGA 4KICA 5FGMA 1P4AA 4B1ZA 1P2FA 1QHAA 2VPLA 3V6DA 3ZPLA 3TBIA 3VB2A 4LFUA 2PMZA 1TKDA 3C3WA 2IGMA 5EDNA 2AQEA 4FHTA 1R5ID 1LPQA 4PSWA 3CMAI 1TP4A 4E4HA 2QGUA 2HDCA 2CH6A 4DQ8A 1NJZA 3EO3A 4ENNA 5F27A 1ITYA 3QU6A 1UWBA 4W1UA 4BRFA 5CQGA 2LY1A 3BF3A 3QYEA 3SQ1A 1FMVA 1WSGA 3SAGA 5EXWA 4BGAA 4A0ZA 1XC9A 3DKXA 1Z26A 1RETA 4CGJA 1Y1WJ 5J47A 1S7AA 4H4OA 2EFOA 2FEZA 1LFUP 2GM4A 2NRVA 5FKMA 2LF8A 3M9AA 4BJTA 3H9JA 4MFDA 1LEBA 2P9SB 4CJLA 3QRFF 1Z91A 1BM9A 1C1AA 3UE5A 1C1BA 1NWKA 1JHFA 2OV7A 4MO5A 2DT7B 3MAQA 4AF1A 1HKTA 5AQFA 1MBEA 1RT7A 3CJCA 4LF8K 5CVVA 3FZLA 2G8WA 3E3VA 4KFCA 4WE1A 2QKLB 1VRUA 1OCCH 4A93J 4DTJA 3PX0A 2E19A 1DPUA 4L5IA 5BQTA 1U49A 4UV8A 1BJAA 2L4MA 5JLHA 1WUAA 1A5WA 4DR7K 1JCFA 3CQ8A 3O1BA 3NF6A 4CJ7A 4B1YB 2NYXA 3M8SA 2V79A 4JHDA 2Y0MA 4ILGB 3NRVA 5AQJA 3HPHA 4DUZK 2HHUA 1CGPA 2NRXA 4ELVA 2YX6A 5HRRA 1MWKA 2ID6A 1B8IB 3CCVI 3NBPA 1FBQA 3CCRI 1XSDA 1XHXA 3HK2A 4RW6A 4DV7K 2FBHA 1WH7A 4ICLA 3KWIA 2XPWA 2GIVA 2XRNA 3JTGA 1XGOA 5EX5A 3ZQ7A 3IKTA 1JLGA 4HYEA 2JSPA 1ENHA 1O1WA 3QYBA 3O4WA 3J80O 2HVQA 5GINA 1JKRC 4CGIA 3UKGA 5HDGA 4IXCA 3GZ6A 3CTAA 5KPTA 4DZPA 1NGBA 3V8KA 4CCMA 1I27A 1QS4A 3GL1A 5HLHA 4K0KK 1VSIA 3ABMH 3LWLA 1RBRA 3T1AA 3FMSA 5H2FC 4DB3A 4XEIA 3IH4A 3HHGA 3QNNA 4YRVA 3WEEB 4JI2K 1GOCA 4ASNA 1DQUA 2IS2A 1LDDA 2RN7A 1Z25A 2Z99A 2VBZA 1HDDC 4YOYA 4ABZA 4U0VA 3U1DA 1G8XA 4CF1A 3GTOJ 2KKOA 3CCEN 1BIUA 3BLYA 3PY8A 1ZBLA 1XMXA 2DY4A 3H36A 3SZTA 1N5YA 1K6OA 4CEDA 1GLBG 2VKHA 4I7FA 3PIOL 3AARA 1S6LA 2NVTJ 3OYKA 1X9SA 3REOA 5ICEA 5L3CA 2HOAA 1TT5B 2EK5A 2KPMA 1BIBA 3DAWA 1E3HA 3MCZA 2JT1A 1HNVA 4ZZDA 2PFUA 5ED4A 4I98B 4BRNA 3EUKL 1GDTA 3SEZA 2XGEA 4CK1A 1G2HA 2GIZA 3HXMA 1VSLA 2EIKH 3V42A 2UUAK 3WNGA 4M72A 3B6OA 1LOTB 3CP8A 2M7BA 1S1XA 3FZMA 2IGIA 3FE1A 4DWIA 1VRTA 4U7BA 4WXHA 4RB2C 3AVGA 1S1WA 2CW7A 1VNDA 5AQNA 1NJXA 4FX0A 5AZIB 1GLLO 3RQ4A 2LTPA 4RA2A 4LK0F 2DODA 1K4SA 2OTJN 1BR4A 4BQZA 3I64A 3CJAA 4NHJA 1RDUA 1YOVB 2JA2A 1J75A 1ZRFA 5AQMA 1L3SA 3LMMA 5E18F 1GXPA 3VQ9A 1XWLA 3LP0A 3QPSA 2ZJRL 1NK2P 4LD0A 2O7OA 4FM1A 2F5EA 4BRDA 3R6SA 3V9ZA 3CG7A 4WFNL 2R5YA 1ZBFA 3CUQA 4FX4A 3VQEA 2QVOA 2W41A 4ELUA 2OD5A 3AAPA 1NOYA 1H88C 1E0EA 3GDQA 1FIAA 3C7NB 3AA2A 2YHAA 3WXMB 2JMWA 2HZDA 3HBLA 2L9NA 2IOCA 1CQTA 2VLAA 5L3DA 2Z9OA 3V9UA 4HOBA 4RAGA 4L0ZB 4G9ZA 4FWOA 1U2VA 1DLOA 4DSIA 2ZXIA 3F6OA 5DMRA 2VJ5A 4DSJA 2RKHA 3H9GA 3DBRB 4LH4A 3SQ4A 1WJEA 1I94K 2TRTA 1YI2N 3QEXA 2R0QC 4H0EA 3L00A 4II3A 1EF4A 3ID8A 3LSTA 3CMAN 4M3EA 4BNCA 3M8EA 3U9DA 1DUXC 1K4TA 3AVBA 1V5EA 3CI5A 3HOTA 3M8QA 4CBXA 3IRRA 1HUXA 4BR2A 4DF8A 1RESA 3AVNA 2Y0SN 3B8AX 1OCRH 3TABA 2QZ8A 1P4WA 3SZPA 4IRHA 4Y17A 3NHGA 2DXIA 1FP1D 2D1VA 2Q0OA 1YFHA 4OKEA 1Y64A 1EO1A 4Q48A 1EWRA 3WTTC 1UELB 3LL3A 1QQCA 1T6CA 3TGNA 4A5AA 2P9UA 4BREA 2HBKA 4FETA 4C2MJ 3JW4A 1BQNA 2Q2EA 3BG5A 3VQ6A 1JXEA 1LKXA 4IG3A 3K5LA 4E6KG 4IOCL 4FK0A 3FF5A 2F48A 2E71A 3ZQLA 5AQHA 1M1KO 3HUGB 3RYPA 1XI1A 1R4MB 2BVMA 1YVNA 4XMYA 4HG2A 3QESA 4LIUA 1ZQ3P 3KLEA 1ZG1A 1RCHA 1ASWA 3O9QA 3H5AA 2UYTA 4A57A 2W82A 5H6QA 2HXOA 2VN2A 2MGQA 4JNEA 5BOXA 3HRGA 3RKYA 4CFDA 2KZGA 1XMKA 4D5FA 2M30A 2E6MA 1GOBA 3O3FA 1KXPA 3BDPA 4NCGA 5E26A 4CCOA 5AQYA 2HR3A 2E4LA 4B44A 2F4OB 3S16J 2K4JA 4FTHA 5I3UA 3HJFA 4A3LJ 2KDZA 5BS6A 4E7ZA 1ESVA 2NOJB 5GPAA 3NVMA 3V7RA 3DXJF 3K58A 4BQQA 2BH1A 4FW1A 3CQXA 1S7OA 1QSYA 2QYOA 3M3ZA 3PO5A 3HKZN 4CCJA 4M45A 1NK3P 1W5CC 2HHQA 4PUOA 3UKRB 4QLCU 5KQDA 1SKSA 3I58A 3FFIA 2WV0A 2M8GX 4N0BA 3LP3A 2XRIA 4H0VB 4RGUA 5DM7F 3K4CA 1TW3A 1B9FA 2XSJC 1WGXA 3FHZA 1OVQA 1HKQA 1ASUA 4PFPA 5ADXH 4CJEA 3W2AA 2MLKA 3M8FA 5EGOA 4BG9A 4QWQA 2OPSA 5ICFA 4CZFA 1NG7A 4IX7A 4DTMA 4J2AA 3H0DA 4W5NA 3GTPJ 5B3SH 3KETA 1ZN2A 5GPCA 2PMHA 4ZDLA 1JLBA 5T7BA 3F73A 2Q3SA 2A5YB 3PNYA 2VOPA 3OTOK 4J8FA 2LOOA 4Y1CA 1JT0A 1FK9A 1IBLK 5JS1A 1A36A 3M1EA 2OZSA 3BWGA 3AAQA 3ZMDA 1VQKI 5F0XA 1EKEA 3FMQA 2IVOA 2YX4A 4BR4A 2H8RA 4XN3A
chains in the Genus database with same CATH topology
1S9GA 1HYVA 2X78A 2Z1JA 4KKOA 3WNHA 4DFPA 4PA1A 4HUGA 3AA3A 3H08A 3LAKA 1MU2A 4M3XA 3D45A 1ZBUA 2JLEA 3ALYA 4KPYA 4DTRA 3C95A 5JS2A 1C6VA 3VQCA 1J5OA 1UA0A 1HJRA 1RTDA 4I9QA 5FRMA 2KFNA 4AHRA 1S1TA 3AO5A 1S5JA 3LPUA 1J9AA 1RT6A 1J54A 3TANA 4DS5A 2XY6A 1KSPA 3S3NA 3ZSWA 2ZD1A 4Z4CA 2OPQA 5KTQA 4IG0A 4CEFA 4E1NA 1EXQA 2HNDA 5SZTA 4DTNA 4J2DA 4M3TA 4CJKA 2DFHA 4C8LA 1B92A