1X1PA

Crystal structure of tk-rnase hii(1-197)-a(28-42)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGAGAIIGLAVGGVVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of amyloid beta fragments in aqueous environments
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1x1pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1x1pA01
4CK2A 4Z4HA 4DTPA 2BGGA 3KD1E 1CLQA 3B6OA 2LSNA 4M45A 2KQ2A 4E3SA 4B8AB 2X78A 4E7HA 2NUBA 1JXEA 4CIEA 3KJVA 1RTHA 3F73A 2Y1IA 1HYVA 1IKXA 2PZSA 4FW1A 4DU3A 4B3OA 3K2PA 3RMCA 3AVNA 4CF9A 1LAVA 2IOCA 4W5OA 4AHUA 3QETA 1TKDA 1HQEA 1S5JA 3K57A 1NKCA 3KLIA 4Q0BA 1RBTA 4I2QA 4KPYA 3D0PA 3HO1A 4KKOA 3OJSA 1BQMA 5HBMA 1Q8IA 3U6FA 3KTQA 3V81A 1ASVA 3OYLA 1RT2A 3DOLA 4IKFA 2F8SA 4CK1A 3V9UA 1JLBA 4UQGA 3ZT0A 4DFKA 1L3SA 3D45A 3CFOA 1EKEA 3H08A 3ITHA 4RW8A 4DF4A 4DF8A 1BL3A 4AHTA 2HHWA 4B9LA 4ELUA 5SWMA 3L8BA 1XI1A 3AV9A 3DYAA 1XC9A 5E41A 4CHYA 1QSLA 3SPYA 1LW0A 2EHGA 3VQ9A 1YVUA 5D3GA 3AO2A 3ZSVA 3IG1A 4Z0UA 4FJXA 2DFHA 3I0RA 3C94A 5CZ2A 4M3RA 4B9NA 1BCMA 4FW2A 4IFVA 3KIOA 1EP4A 1JLAA 1BI4B 4ELVA 4CHQA 4O55A 3OY9A 1U47A 4BDYA 4K8XA 2OPQA 4CEEA 4EP4A 3HP9A 3KK3A 4KB1A 2OPRA 4DTOA 1JL1A 1R0AA 4M3WA 1RT7A 1RDCA 4BE2A 4KTQA 2KFNA 4ID5A 4KHQA 2Q3SA 3K5MA 3QNNA 1DTQA 1HQUA 2PY5A 3NE6A 3K5LA 4KHYA 1RBUA 5FRNA 4KO0A 3TAFA 1HYZA 1RNHA 4N47A 4EP5A 3LPUA 2RN2A 3AVGA 4OKJA 2YHAA 4RW6A 3VQ8A 3ULDA 3TABA 3RRGA 1IKWA 4OLBA 2D5RA 4LY7A 2QK9A 4DQQA 1U49A 1VK0A 2B4JA 2EX3A 3WNHA 3V9XA 2DFFA 4Z4CA 1BGXT 3CG7A 4IBNA 1RT3A 4O0IA 4J2EA 1RDDA 3OVNA 4HUGA 4KHSA 1UA0A 1A5WA 4DTSA 1SKRA 3P83D 3VQBA 4ELTA 4I9QA 3NCIA 4I2PA 3I0SA 1C0UA 4NCBA 1NJWA 1S1VA 3JYTA 5DMRA 2OYQA 4B9TA 3RR8A 3TAMA 1VSDA 1U4BA 4IDKA 1IG9A 1NK5A 4TSXA 4C8MA 3LPTA 4FM0A 2KFZA 4CJLA 1GOBA 2ETJA 4G1QA 1TAQA 2P51A 1TK5A 3SI6A 3TAEA 1NK6A 3HJFA 1VSHA 2X6SA 4BWJA 4N56A 4Z4EA 4OGCA 4J2DA 1NJZA 4FJ9A 4H4MA 4NYFA 4CGDA 3V9SA 2HHQA 1Q9YA 5EU7A 2HHXA 4JS4A 5HP1A 1C1AA 4CFAA 3NGZA 1VSKA 3VA0A 1L3TA 4KHWA 2YKMA 3ALYA 1B9DA 3NFAA 1RBSA 5K14A 1VRTA 3U3GA 4FZXC 4FZZA 3ZSRA 4OGEA 3EZ5A 4RW4A 1JXBA 4KREA 4ZTJA 5DK5A 4M41A 4Q5VA 3MAQA 2RKIA 3PX6A 3V1OA 3OYCA 2Y1JA 2BE2A 1J9AA 4J2AA 3HP6A 3RTVA 1QSYA 3OYIA 1KFDA 2E6MA 5JS2A 1YT3A 4Y1DA 3OJUA 4HUEA 4FVMA 3SJJA 3OYJA 5I42A 4HTUA 4DQPA 2E6LA 4F8RA 1BHLA 4DTRA 1QS4A 4K8ZA 4B9VA 4DS5A 3AVBA 3VQCA 4Z4FA 3HT3A 1T7PA 1S1WA 3QESA 5J1EA 1VSJA 2YNHA 3C95A 3FFIA 2Z1JA 2HMIA 3AO5A 4E7IA 3MECA 1KLNA 2G8VA 4FJ5A 4FLZA 1S9EA 4NYNA 4AHRA 2GV9A 3CM5A 3NF6A 3VQPA 4CCHA 4F2RA 4CHPA 3L2QA 5HLFA 1NKEA 4CGGA 3OYMA 3ZT4A 1HNIA 3PX0A 1NKBA 3QEVA 1QSSA 3O4QA 4PWDA 4CFDA 2P1JA 1RDAA 1REVA 1JLEA 5KGWA 3DMJA 2FBTA 4CGJA 3L2WA 1ASUA 4FLVA 5HROA 2AJQA 3AVLA 1QE1A 3VQEA 4LH4A 3NAEA 3NF8A 3LWLA 3RR7A 3DLEA 4EZ6A 4NCGA 4E7KA 4AHVA 2YNGA 4DU4A 4PY5A 4E19A 4DQIA 1KTQA 2IC3A 1U04A 3CQ8A 1Y97A 1A5VA 4F4KA 3LAKA 4CJPA 1TKTA 3V9ZA 2P5GA 1KVAA 4YFUA 4EZ9A 3EYZA 1S1XA 1HRHA 2BANA 4AHCA 3SV4A 1GOAA 1DLOA 1RT6A 3F9KA 3AVJA 3HSTB 3O4NA 4CF2A 4CHNA 3KLGA 3LDSA 3LALA 3NGYA 3AA4A 4IG3A 1KCFA 1X9SA 4M3ZA 3HM9A 4N41A 3M8PA 4HUFA 1TV6A 4DTUA 4FJGA 4FJ7A 3OYBA 3HPGA 1JLFA 3ASMA 3OYHA 4FLTA 4CEOA 1GOCA 3HK2A 3V4IA 4CFCA 4LSNA 1SL2A 4DTNA 3LWMA 3VA3A 4CJWA 4CEAA 5HRSA 4CJUA 3DRRA 3NHGA 4FLYA 4E7JA 2IDOA 4CFBA 2YNFA 3O3GA 3TAGA 1X9MA 4OPKA 1X1PA 2HB5A 1QQCA 1YTAA 2YNIA 2IS3A 3L3VA 3S3NA 1S6QA 4DTJA 2ATQA 4OKKA 3OS2A 3RMDA 1NK8A 1LV5A 1LWFA 3I8DA 4QCLA 1HYSA 3OYNA 2KZZA 2F96A 3QERA 1WSFA 4MQ3A 2GUIA 2DY4A 4CF1A 5C25A 2R7YA 4GVMA 3K58A 4PQUA 4PUOA 3QEIA 1X9WA 4FJMA 3A2FA 4KI6A 1F21A 2OPPA 2YV0X 4DSLA 1RCHA 4BDPA 5KGXA 4DG1A 1BQNA 4HHTA 1FXXA 1SUQA 2JLEA 3NH2A 4E0DA 3VQ5A 3PY8A 3PO4A 3AO1A 3ZT3A 2ZD1A 3SQ2A 1YTUA 3DLGA 3KLFA 1UOCA 3RWUA 3MEDA 3ZSZA 4DLEA 3QNOA 4KAZA 4PA1A 3VN5A 4DSKA 2HHVA 1T03A 3VQQA 2JGUA 3NDKA 1XHZA 1NJXA 4CGHA 1C1CA 3AA2A 1WSHA 1D9FA 4AILC 1A5XA 2F8TA 1UAXA 2OPSA 1TKXA 4ICLA 1NJYA 4FJHA 3TAQA 5HRNA 4XIUA 3V1RA 1C0MA 3AVKA 3OS1A 1JLQA 2HHTA 1BISA 4C8NA 3S3OA 1TKZA 3PX4A 2O4GA 5KRSA 2FBXA 3LZIA 4CJEA 3O3FA 1W0HA 4M42A 3WNGA 3UIQA 3DI6A 3CFPA 1VSIA 4I9LA 4OKEA 4YNQA 4CEDA 1C6VA 2XY6A 1WAFA 4W5TA 3L2UA 1D9DA 3BDPA 4H4OA 3S9HA 4M3TA 3HPOA 1ZBFA 3QIOA 4LH5A 3OYEA 1HMVA 1L3VA 4HCBA 1RT1A 3QEWA 3NH0A 4W5RA 2D0AA 1ZBUA 4FLXA 3AVCA 3OYAA 1Z25A 2RPIA 4KTWA 3V6DA 3K5OA 5SZTA 4IFYA 3SV3A 2D0CA 3K59A 1WSEA 3P1GA 3G0ZA 5CZ1A 3VQ4A 3OYDA 2FC0A 2BDPA 1U48A 1QHTA 3KK1A 1IKYA 3L3UA 4CIGA 1IO2A 1S1UA 4DLGA 4OPJA 3HPHA 1K6YA 2W42A 4CJVA 1LAWA 3AO3A 3KKSA 3LAMA 1ZBLA 3QO9A 3IAYA 3QEPA 3P5JA 3HXMA 4KTZA 2KW4A 2OZMA 3ZT2A 4CERA 4BACA 2ITGA 3M8QA 3TWHA 4ID1A 1D5AA 2XY5A 3L2VA 3TARA 1ZYQA 2VG7A 4KI4A 1ITGA 5FDLA 3SYZA 4RW7A 1CXUA 4O5BA 4Y1CA 3BGRA 1UA1A 4OVLA 1ASWA 4DQSA 1NK4A 3SQ1A 1RT4A 5HRRA 5JS1A 4KRFA 1XWLA 4KHUA 2PYJA 3VQAA 2VWJA 1HJRA 5KRTA 5KTQA 4KFBA 3RMBA 3SUPA 3T19A 1KSPA 4DFPA 3NF9A 3AVFA 4RG8A 4B08A 3ZSYA 3ZSQA 3KLHA 1T05A 2VWKA 2Z1HA 4E1NA 4O44A 3OS0A 3T1AA 4KB0A 1EXQA 5FROA 3ZCMA 1FK9A 3IRXA 1L3UA 3AO4A 3DRSA 5CYMA 4DQRA 5HRPA 5CYQA 1VSFA 4AH9A 4DMNA 3CFRA 1TL3A 2XO7A 2XRIA 2A1RA 2ZQBA 5J2NA 1NOYA 1JKHA 4H8KA 4CE9A 1LW2A 1UWBA 3C6UA 4CJFA 4FLUA 3QINA 1U45A 1BIUA 1C0TA 3AA3A 1N5YA 4DSIA 4DSJA 4CJKA 1EX4A 5C42A 3T3FA 1S9GA 3LANA 4CEFA 1KVCA 1WSIA 1KRPA 2O4IA 4DTXA 2OA8A 3LP2A 1S1TA 4CK3A 2G8WA 2G8HA 4MFBA 1JLGA 1VRUA 4M3YA 3WNEA 2RF2A 2X6NA 4BWMA 1BI4A 2G8KA 2QKKA 2YHBA 1WAJA 4F2SA 1KLMA 3SUOA 1RDBA 3C6TA 3MXIA 3AVAA 1NK9A 4M3XA 1Q9XA 4BDZA 1NOZA 4OLAA 3E01A 4FM2A 1TVRA 4FZYA 3DLHA 2X74A 3NBPA 1J54A 4NCAA 1IH7A 3NH1A 2OZSA 3M8RA 2G8UA 3CYMA 2HNDA 1QTMA 2DFEA 3ZSWA 4CHZA 3VQ6A 2YKNA 1NK7A 4B9UA 2QXFA 4KV8A 1C1BA 1SKWA 4C8KA 3THVA 3DM2A 4HVJA 1B92A 2G8IA 1JLCA 4DSEA 2IAJA 3MEGA 4CGFA 4CF8A 1N6QA 4FK2A 1B9FA 1FKPA 3ISNC 4N5SA 4LD0A 3SUQA 4O0JA 1CZBA 1WSGA 5CY4A 4CEBA 1J5OA 1HNVA 4FXDA 4Z4IA 3LP1A 3CM6A 3VQ7A 1D8YA 2P5OA 3SZ2A 3DOKA 4R5PA 2DTUA 1VSEA 1RT5A 1ZBHA 3U3YA 4CJ4A 3NGIA 4CJTA 4FM1A 3TAPA 2G8FA 4JRPA 4E1MA 3ZT1A 4DU1A 1L5UA 1J53A 4J2BA 3S3MA 1TL1A 4QAGA 4CIFA 4L8RB 4FYDA 4CJSA 1Z26A 4E89A 4C8OA 4ZTFA 1SV5A 4CJRA 4DTMA 2XY8A 3DLBA 1IKVA 2HHSA 4FJNA 1FKOA 3RMAA 2HVHA 1JL2A 4ZHRA 4DS4A 2KZMA 4CJQA 3RRHA 4B9MA 4WE1A 1VSLA 3HVRA 3SCXA 2PYLA 1KVBA 1T8EA 2I5JA 1S6PA 3G10A 3ZSOA 4GW6A 3HYFA 3OYGA 4JS5A 2QKBA 3ZSXA 3OYFA 1LWEA 3MXJA 3SNNA 4RW9A 3KK2A 3KKRA 4AHSA 2HNYA 1WNSA 4M3UA 4CJ5A 1TK8A 1XHXA 4FJJA 4KHNA 3O3HA 1BCOA 3L2RA 1G15A 4BE0A 3KD5E 3TI0A 4OJRA 4CGIA 1WLJA 3DLRA 4DSFA 1SL0A 3PO5A 4C8LA 4FJIA 1DTTA 2VG6A 3QEXA 4DFMA 4N76A 4I7FA 3VQDA 5T7BA 4O4GA 4CEQA 3SUNA 1TAUA 3NF7A 4CEZA 4IG0A 4FK4A 1SKSA 2WONA 3JSMA 4CESA 4FJ8A 1KFSA 1I39A 2WOMA 3EY1A 4CJ3A 4W5QA 1RBRA 2XY7A 2A1SA 1RTDA 4B9SA 1RBVA 4FJLA 5J2PA 1W9HA 3DRPA 2HHUA 4FLWA 3LP0A 4JLHA 1SL1A 2IGIA 1VSMA 3AVMA 1RTJA 1WSJA 3IS9A 3MEEA 1CZ9A 1RILA 3QIPA 2XHBA 4FCYA 2Z1IA 1MU2A 3HVTA 5C24A 4FJKA 5J2QA 4GMJB 3WNFA 2HNZA 2ZE2A 3TR8A 2B6AA 4DWIA 2GBZA 2VG5A 4B8CA 3K5NA 3QLHA 4JRQA 3V1QA 3V9WA 4F3OA 4W5NA 4FK0A 3AA5X 4HCCA 4BE1A 4F3TA 1HPZA 2HVIA 5KI6A 3KLEA 3LP3A 5I3UA 3HL8A 1CXQA 3M8SA 4E7LA 4CF0A 1WN7A 4QOZB 3TANA 3OYKA 3SQ4A 1I3AA 3MXMA 1TK0A 1ZBIA 5FRMA 1O1WA 3PV8A 1NK0A 2KTQA 5J2MA 2B5JA 2HW3A 1EETA 1TGOA 3AVHA 4LSLA 2D0BA 3LZJA 4CHOA 3SQ0A 4CECA 2FBYA 4Z4GA 4DFJA 2FBVA 3SPZA 3AVIA 3DLKA 1BIZA 3PUFA 2E4LA 2Z1GA 1LWCA 3B6PA 1RTIA
chains in the Genus database with same CATH superfamily
3TO7A 5HNHA 4DTPA 3L9FA 1VQON 1CLQA 4M45A 2LSNA 2PN6A 1B8IA 2KQ2A 3LSHA 1WH7A 3L0QA 5EG0A 2X78A 1XGNA 1JXEA 1RTHA 2Y1IA 1HYVA 1B1BA 1IKXA 3K70C 2PZSA 2COBA 1JXSA 3RSEA 3C6AA 1OVYA 4BVPA 4A6EA 3AVNA 3FXOA 2HDWA 3FX3A 4CF9A 4YOWA 3QQAA 2GXGA 2LREA 2VL8A 3BPXA 4EQQA 1S5JA 4B44A 4M9XA 5E1WA 3KLIA 1IF1A 1N32K 1WGXA 3LQRA 4AIHA 3MN6A 4I2QA 1FLIA 4G9ZA 4LIUA 5AQHA 5H1SQ 2WUSA 1O3TA 4E1JA 3U6FA 2E1CA 3OYLA 4H4KC 1RT2A 1X58A 3DOLA 1S9HA 5BRFA 4CK1A 3WE2A 3NRVA 3M6GA 1JLBA 2GEMA 2UUCK 1V3FA 2GWRA 1JKRC 3C2HA 3ZT0A 1ZN2A 2ZGYA 3D45A 3IAM2 1EKEA 3RZDJ 4DF4A 4RW8A 4YFKF 3ZQIA 1WVRA 4DV3K 2V1DA 3G1MA 1OCPA 2VODA 2QQBA 5AQKA 1SD4A 2DMNA 3F72A 3L8BA 5LRRA 2KRHA 2M2EA 4FX4A 2W7NA 3DYAA 2IA1A 3I33A 3LA7A 4UV9A 1FX7A 4CHYA 4A61A 5JMVA 3SPYA 1QSLA 1UJ8A 1LW0A 3VQ9A 1YVUA 2PI0A 3RKYA 3J7AP 1R4NB 1T98A 2GA1A 3AGRA 3C94A 4DOZA 5CZ2A 4B9NA 2XF6A 2JRTA 2ZNYA 4M74A 4FW2A 3QFPA 4IFVA 3WHBA 1EP4A 2OANA 3RVCA 4C3IJ 4O55A 4DBQA 1V4TA 1XCBA 2OPQA 4EP4A 3HHGA 2OPRA 2QM1A 1JL1A 3W0LA 3P4IA 4DTOA 1LFBA 2K40A 3KLNA 3CCRN 3LQQA 3VEZA 1BOBA 2E5ZA 3FXUA 3RTRA 4BE2A 1DKGD 5LEJA 1RT7A 3FKIJ 4IRGA 3L4QA 4FLZA 4KTQA 2KFNA 5M5WJ 3QNNA 1DTQA 3TARA 4DIQA 1OH7A 2F6CA 2EZHA 3I9V2 3TMOA 2PJRB 3AFHA 4L0YB 5FRNA 1HYZA 2PMZN 2HTJA 2YX7A 2QI2A 4N47A 3TAFA 2FXAA 3CCLN 3MMYB 1M1EB 4RW6A 5AQFA 1YJWN 3QAHA 3ZMUA 2QA4I 2GLOA 3D2FA 3KWIA 4CD3A 4LY7A 3ULDA 3RRGA 2FJ1A 2P4WA 2K4JA 4HA8A 4HAMA 4JOMA 4YEJA 4D1QA 3E5QA 2EX3A 3ATVA 3GO5A 5FKNA 3CG7A 4LFCK 3E7LA 2V9PA 2ZJ2A 3PIPF 3EZWA 2X1EA 4OU0A 5GAEJ 1SKRA 3P83D 1SS6A 4I9QA 2HDCA 5BR8K 4HNTA 4DR5K 2OJED 2O0YA 1C0UA 5JLFA 4RBOA 4NO7A 4FK0A 1YIJN 4QPOA 3E1SA 4B9TA 3RR8A 1BOAA 3VSKA 1VSDA 2O8KA 3F5TA 3FZLA 3M1CA 4C9YA 1T2KA 1IG9A 2PBIA 5F0FA 5AJ3K 2MC4A 3M1EA 2V6EA 1HNXK 3JTHA 1FJGK 2FBKA 3EKUA 4CEDA 2HWVA 1WJFA 3J7YP 3QBWA 3HG9A 2X6SA 4H5RA 4BR4A 5IPAA 4N56A 1ODDA 3DLLL 2RREA 1NJZA 4LLLA 4H4MA 5KCMA 2JSCA 3HRMA 1Q81O 3V9SA 2Z16A 3DQVC 2HHXA 2HHQA 2VC1A 4JS4A 3WU0A 2EWNA 3FF5A 4DR2K 5HP1A 1I50J 5D6FA 3U1KA 1HLVA 1YJNN 4OOIA 4HF0A 4XL9A 4P96A 3A5MC 3MN9A 1ITYA 4G1QA 1WHUA 1RBSA 1VRTA 3GTPJ 4G7ZF 3CZ6A 1SAXA 5MLCQ 3ISPA 3I64A 2E71A 4N4NB 2XGCA 4MGRA 1TWAJ 2CV1A 2E88A 4JKFA 4OGEA 3EZ5A 4RW4A 4GKJK 4KREA 2NNWA 4M41A 4MTDA 2QVOA 1MJBA 3K70D 5C4XJ 3DU5A 4MQVA 1J9AA 1ZARA 4Z6YA 1HJOA 4CI6A 2E6MA 2WC2A 2QEXI 5JS2A 5BR9A 5E84A 2MW8A 3OYJA 4EVIA 1RUNA 4HTUA 3HXLA 5C2DA 4LB6B 4JI1K 4H0EA 3M3ZA 5ED4A 1VQ4I 3VQCA 4KH4A 4WFNL 2Y0SA 1T7PA 1WI3A 1S1WA 2WBNA 5E3NA 1JUMA 3W3CA 3QESA 1SD6A 1VQKI 2UV1A 1HOMA 3LDNA 1VHXA 2VKEA 3C95A 4BG9A 2V9KA 3MECA 4FJ5A 3R61A 5EOYA 3BF3A 3IMXA 2LK2A 2J5OA 3HRSA 1IRFA 3OOUA 4CHPA 2M7AA 1GXQA 3KP2A 3GZ5A 3S41A 5C3EJ 3ZT4A 4NXNK 1NGCA 3O6BB 2A61A 2WA0A 1K79A 1QPIA 1REVA 5KGWA 3K4LA 2DMUA 3L2WA 3JAMZ 3JTGA 2CGKA 4HSRA 3GBGA 1MNMC 1QE1A 3VQEA 2VPRA 3THXA 3NF8A 1N34K 4ZC3A 1TUUA 4U7DA 1FYLA 4NCGA 1OCCH 4E7KA 4XH1A 4PFPA 5EY4A 4DU4A 4PY5A 3LM2A 3ZCOA 3GVAA 5CYVA 1U04A 2HXOA 3FXQA 2IGNA 1JCFA 4CJPA 3S1NJ 2XAHA 4BU2A 1TKTA 4YFUA 4NC7A 2QQ8A 1NK2P 3PM1A 1LDJA 3G2BA 4FTHA 3ENOA 4AHCA 2F5CA 1DLOA 3F9KA 3GYHX 3AVJA 4A69C 3BT9A 3ECOA 3KLGA 3LALA 4LF5K 4I09A 3ERMA 3I59A 1K78B 5CE3A 2HOAA 1WSUA 2A69F 5IWAK 1X9SA 4KMFA 4N41A 4M3ZA 3GFJA 3OYBA 4XRFA 4EJOA 3OYHA 1Y39A 1EH6A 4FLTA 1DGRM 3DEEA 1D5VA 1GOCA 2I7NA 3F8FA 5L3BA 1ZTRA 2RV8A 2WADA 4I02A 4II3A 4OMZA 2V1UA 1GLEG 4IDHA 4DTNA 4LF9K 2KZGA 3MCZA 4CEAA 5HRSA 1I5ZA 2X51A 4CBWA 4CCLA 4E7JA 2HPIA 2V9VA 4OPKA 1X1PA 2HB5A 1QQCA 1Q1VA 1YTAA 2DK8A 3TSUA 5HDKA 1S6QA 2NRAC 4OKKA 2V51B 1K8KA 5J1YA 2MABA 3SFZA 5BQTA 3E3VA 2KMUA 5BPIA 2ZC2A 3D2EB 2D45A 1BR2A 3F6VA 2F96A 3QPLA 4HX4A 4I7HA 1HKGA 3C7JA 2ASMA 4MQ3A 5C15A 3B73A 4GVEA 4RB1A 2Y69H 4CF1A 5J1UA 1HW5A 2A68F 4HEA2 4CCMA 5BPDA 2LOOA 2R7YA 1Y8RB 3GMEA 2O8CB 3QEIA 2WY8Q 4ESFA 2LY9A 2Q1NA 3A2FA 1X9WA 3C2BA 3HTVA 2MBFA 2P9UB 4IX7A 1ZYRF 2Z2SB 4XLCA 1MNDA 5IT9Z 5KGXA 3LDLA 1FXXA 2JLEA 4E0DA 3HOXJ 1KQSM 3E5XA 3PY8A 4W1UA 1VFCA 3TO9A 2CV2A 2EFNA 2JUCA 2ZD1A 5KPTA 4HX7A 5GAGJ 3S17J 1YOVB 3O8HA 1NJXA 3KP7A 3OSGA 1A5JA 1MDUB 3CJ1A 1ZRCA 1DU0A 1V5EA 3FHZA 1UAXA 2OPSA 3M8EA 1TKXA 4ICLA 1NJYA 3KEOA 1TQMA 2J4RA 2KJBA 3RPQA 4F91B 1JTYA 2L54A 1UZCA 1QHGA 2NAZA 5M3FJ 2ZJQF 1D8JA 2P9SA 5GADP 2MD5A 3CP2A 3RYRA 3CD6I 1MSEC 1BISA 4KH5A 1WFXA 3QYBA 4Y4RA 5E3MA 2QEXN 4B3TK 3GTQJ 2FBXA 4BC2A 1HNZK 1NHAA 3WQUA 3O3FA 5AQUA 3VMFB 1W0HA 1RR8C 2F5VA 4ZYHA 3AG1H 2VE9A 2B9SA 2V52B 4OKEA 4U0WA 1C6VA 4JKAA 2DJNA 3O1BA 2DDBA 2WAQA 1GVDA 1W4MA 1YW9A 2PMZA 2HQNA 5DM6F 3BEXA 5LJVA 2ZXWH 4MIMA 3M7GA 3S9HA 3HB9A 4IXCA 2UU9K 3OYEA 3O80A 5EVZA 5JVGL 4FWSA 5FO5A 3AARA 3GZ6A 4HCBA 1EWQA 3QEWA 3LFUA 2DTRA 1JHHA 2YSRA 1U9OA 2L7ZA 4CA0A 1SANA 1Z25A 4Y15A 3CC7N 5SZTA 4TV7A 1FYMA 2ISZA 3K59A 4IO8A 4BY7J 3KP6A 1V4SA 3OYDA 1WSEA 4DYQA 2CGLA 4JK1X 3G0ZA 3OHRA 2E2HJ 1XGSA 3HRGA 4BL0B 1IKYA 4CIGA 4UVBA 2J5PA 1BOTO 4DLGA 5J4YA 1MGTA 2P9LB 4CJVA 2DMPA 2NNNA 2FA5A 1ATSA 2F7TA 4BR2A 1XS9A 4MFEA 3P5JA 2RGVA 2UYTA 3BPVA 2KTQA 3M8QA 3IRRA 2EV6A 3L2VA 3ENBA 4BHBA 1AU7A 3SYZA 2W85A 3H9GA 5HS9A 3WU1B 4Y1CA 1RI7A 1P92A 3BGRA 3HSRA 1UA1A 4DQSA 3J81O 3KYLA 3I8BA 1O7FA 4KRFA 5JS1A 4XM3A 3UKGA 1Y0UA 1ZH5A 1FP1D 1ZYQA 2BZTA 1HJRA 4KFBA 1NBWA 1H1VA 4DV2K 3TL4X 4BR9A 3SUPA 3MQ0A 3O9QA 2VGMA 4RG8A 2E60A 3H3VK 1ATRA 3ZSQA 4V19K 2EV0A 2VWKA 2Z1HA 4O44A 1YJ9N 2QK9A 2OUMA 1WCMJ 3X2QH 3QB0A 3BTJA 5ADXH 5FROA 4JD2B 4IL6C 3S93A 2DJIA 4O5FA 3ZCMA 4MO5A 4FX0A 3TEDA 3DRSA 5HRPA 5CYQA 1VSFA 4JHDB 4HF2A 3BDPA 2XO7A 3QPTA 4LF8K 2ZQBA 3C7NA 1O13A 4I99C 1JKHA 4KT5C 5AZJA 4H8KA 1NOYA 1V55H 4CE9A 5EGOB 4BAYA 1WRJA 4PJLA 4CJFA 3GBTA 3VQ4A 2DMQA 4DJAA 3QINA 2DQLA 5HLTA 1C0TA 3AA3A 4DSIA 3UR3C 3I3LA 3F0CA 3LANA 4CEFA 4DCHA 3CJNA 1VTNC 4F8RA 2O4IA 2YUSA 2OA8A 3QOEA 1IV0A 2P9NA 3CJBA 1JLGA 2H3GX 4H5TA 1VRUA 4L9JA 4M3YA 1IV6A 1I6XA 2RF2A 2Q0OA 2IS2A 4JKBA 1MBKA 2QSHX 1QVFM 1WH5A 2LSOA 4RA2A 5BREA 4CYDA 2IS6A 2R7SA 1WAJA 4F2SA 1ZG5A 1P6RA 1NLVA 1RDBA 3DXKB 3MXIA 5K5OA 4XLNF 1NK9A 3HGYA 4XSZF 4ASNA 3TTCA 1NOZA 5TISC 1Q9XA 2KKZA 1HKSA 4A3LJ 1EJ9A 4OLAA 1Y6IA 2V7FA 4Z2YA 4J01A 4RB2C 1TVRA 3QU3A 4NCAA 1J54A 4BKXA 4B48A 2R3SA 2X6XA 5FLXO 2OZSA 3OWTA 2G8UA 2BGCA 1R5HA 1S7OA 2FQ4A 2DFEA 2A07F 4BG8A 4U7BA 3WTSC 1EF4A 2V1NA 3G1LA 3VQ6A 4MDBA 2QXFA 5BS6A 1C1BA 3H1CA 3H6EA 1N5YA 3V7RA 4B4CA 4D9JA 2P9KA 2G8IA 1ON2A 5B3SH 2IAJA 2DXIA 4CF8A 3T0YA 3K4MA 1B9FA 1N6QA 1U6ZA 4UY8O 4N5SA 2X85A 1X3WB 2JUGA 4Q47A 3GTMJ 4O0JA 2HHTA 1WSGA 2Z99A 3J8AA 4CZJA 4Z4IA 1NGFA 2VLAA 1WPKA 1RR7A 1D8YA 2EZIA 1IDZA 3IKVA 4R5PA 4OO1J 5FPNA 3F3XA 4XQFA 1QQIA 4XLFA 4FM1A 3CCQI 5B5EC 5GADJ 2E1ZA 4UY8I 5KPRA 4BR5A 4L8RB 3UKUA 1Z6RA 2DFIA 4E89A 2CS3A 1X9JA 4KICA 4C8OA 4PL7A 2X4HA 4MEYF 1RDWX 4XORA 5L3FA 1K7AA 5EYRA 4A59A 1T39A 5HOOA 1OYIA 4CCKA 4DGWB 3PNTA 4NB4A 2HVHA 3SAGA 3RRHA 5IT9O 3F23A 2QUFA 3RYPA 2BHZA 2E2JJ 2E1OA 2M0MA 4Q48A 2XPWA 3E6CC 3SJMA 2I5JA 3G10A 3TTFA 1K83J 3UKRB 3ZSOA 4BRDA 4HV6A 3H3ZA 3MXJA 5BPMA 3KK2A 4XK4A 3KKRA 3VEOA 1WNSA 2QBYA 1Z3XA 1XHXA 2CG4A 1UELB 5FFXA 3OA9A 1BCOA 3QDKA 2HF3A 3CO7C 2DAOA 2BOLA 2F5EA 2KIMA 2RNJA 3H1VX 5JHFA 1JJ8C 4FJIA 2CQQA 3VERA 1DTTA 3OMYA 3QP6A 2E7WA 1GHCA 4A3JJ 2VBZA 1IJJA 3NF7A 2JQ7A 3NE6A 3DWLE 3MKYB 4FK4A 1SKSA 2R5YB 4C3JJ 3CCSN 4FJLA 5KPZA 1QNTA 4WQ4C 4HX8A 3PNVA 4R8HA 2D2WA 4JHDA 1W9HA 4F3QA 4ZYDA 1O3RA 4FOEA 3B6AA 3LP0A 4YOUA 1TP4A 1SL1A 1WSJA 4K2EA 2HBMA 4GYGA 1RILA 2LF8A 3QIPA 2XHBA 4BY1J 4BEHA 2DA6A 3KP5A 4GMJB 1OJLA 4DWIA 2VG5A 3BR1A 4DZJA 1BA1A 3BJ6A 5J3LA 2NNYA 1BO5O 3BTCA 3AL0B 4CZKA 5TKYA 5F0CA 1PP8F 1FPQA 3AY9A 4LFBK 1YF5L 4IHWA 4JX5A 5DTDA 2L0KA 3CCRI 1WJDA 2OAZA 3I4MJ 1LUJB 1IBLK 2Q0RA 2P8TA 1NH3A 4NQWA 3S32A 4RAGA 3HL8A 2KRCA 4L5EA 5LRSA 2FBIA 3DBLB 2HI3A 3S1MJ 4QOZB 1K6OA 1YQAA 3BY6A 3JSOA 5ILUA 4JNEA 2NVTJ 1NK3P 3SQ4A 1XGMA 2ID6A 3PV8A 2ZXHA 1MMGA 5FJ8J 1VQ9I 4LLGF 2EA2A 2KLOA 1MD0A 1B72B 2GIZA 5J2MA 4XEIA 1FBQA 3BZ6A 5D4SA 2ZMEA 1R9TJ 3KHYA 4HSTA 4BRIA 3LZJA 3FLCO 3JAMO 4ESJA 4NXMK 2JTVA 4OAZA 4DFJA 1BJAA 3SPZA 1SMYF 3DLKA 4GY2B 1G3YA 2IS1A 1BIZA 3LDOA 1QZYA 4FPAA 4A5NA 2Q2EA 3LSMA 1ZBSA 5ICFA 1ACIA 1RTIA 3B6PA 4Z4HA 1YX3A 3L09A 2QCOA 1XMOK 2GWKA 3KD1E 2E20A 3ID8A 2K9LA 4BNCA 1TT5B 1G2HA 2TDXA 3IL2A 3F73A 3K5OA 3MKWB 5GAEP 2DK5A 1Z0XA 2IP2A 4DU3A 3FKJA 3VYRB 3BJOA 1J5EK 3O1WA 4GXOA 5HS7A 2R7DA 3COAC 1X3MA 2GXAA 2QENA 1HXDA 2IOCA 4W5OA 2OYQA 3QETA 2O8DA 4A0XA 2GQQA 1T95A 1K4TA 4Q0BA 2FF6A 2NRHA 1NNEA 3AAPA 5BPNA 4KPYA 3Q9SA 2VQGA 1OH8A 1QZZA 4WX9A 2PAVA 2OA4A 3KTQA 4UUTA 2R92J 4KHPK 1ASVA 3ECHA 3KX2A 4AVPA 4IKFA 4EHTA 2F8SA 4N9IA 4HV5A 4UUSB 3A01B 3BQZA 4XIDA 4A0YA 3LSPA 2WWYA 1W5TA 4BJTA 2R7FA 3KFWX 3T8RA 4X65K 4I2OA 4DFKA 3BLYA 2LR8A 3CFOA 2FEZA 3H08A 3GOIA 2LY2A 3KZZA 1BL3A 4OIPF 3K4BA 4AIJA 1WJAA 4AQYK 3H36A 1HKQA 3BCAA 3M8FA 4LK1F 2DT7B 5LMUK 1XI1A 3AV9A 3CDLA 2L3DA 1MZBA 1MKMA 5F08A 2STTA 5LFAA 2YU9J 3Q7CA 1SFOJ 2BXYA 4PCQA 4P1WA 4PZJA 2BUPA 3CP8A 5FKOA 3AO2A 1JJ6C 5FPDA 2R4GA 2DA2A 2XAUA 3R60A 1HSTA 3HC7A 2HEOA 2Y0MA 1ZLKA 3CIPA 3I0RA 3E6BA 1BCMA 2KIFA 4ELVA 2O8BA 3Q3SA 3JR9A 4CEEA 4AYBN 5K1YA 1BW5A 4IZZA 1X3UA 2CUZA 5EEHA 4P9FA 3LNQA 3HP9A 2EBIA 2M9HA 3WTXC 5AIPA 2RHKA 3D6RA 4NLBA 4YOTA 2NRRA 1RDCA 2JT1A 2LTPA 3BUZB 3UB5A 4CZLA 2WTUA 1NJIO 3H1QA 2XASA 5HL7L 1N36K 3M8JA 1BU6O 3K5MA 3K10A 2RNGA 4DW6A 1RETA 1ONVA 2HQRA 5LEKA 1UG2A 2B0LA 3H9JA 3F8NA 3GE1A 4W5NA 3K69A 1U3EM 4EP5A 1BM9A 4RWTA 2HHHK 1WQ2A 1LDDA 3O8MA 1X1BA 2Y0SN 2HBKA 3EEQA 2HKOA 2ZJQL 1IKWA 3OIOA 4KFCA 1KQ0A 4ELUA 4DQQA 3WNHA 2FRHA 2DFFA 4RLFA 4Z4CA 4G94A 1NGAA 4ILJA 2JWLA 4O0IA 4Y33A 4J2EA 1OCRH 2IGKA 2KT0A 2VE8A 2VQCA 4LFUA 5BNGA 1YE9A 1RDDA 1A5WA 2HZDA 1UA0A 5F0HA 2CUEA 3JRAA 4CXFA 3TKYA 1TNTA 2XSJC 3DBHB 1YW7A 1S1VA 1T6CA 3JYTA 1W0UA 4XONA 5JLHA 3TAMA 2W40A 4HF1A 4IDKA 5K5QA 5GAHP 5AQTA 4B3XA 2PBDA 2KFZA 1GOBA 3CTAA 4A6DA 1XD7A 3TAEA 1RKTA 1SVMA 1VQKN 2L5QA 4HBLA 4Z4EA 3QICA 4YORA 3ZP5A 4J2DA 5IY5H 4FWQA 3MCPA 4NYFA 4YG2F 4CGDA 4M71A 3F8BA 5D6EA 5F1JA 4KH6A 4JKHA 3V7CA 5EU7A 3H0DA 4HW0A 1YJ9I 3NH1A 3C0BA 1MA9B 4CFAA 1ZELA 4C2UA 2IPQX 3T8TA 1UAAA 1Y64A 3GTKJ 2VCPA 5GINA 1FOWA 5KAFC 2RDPA 3BG7A 4AM3A 1PYVA 4IO9L 1S22A 2LY1A 4XLAA 2DODA 1H0MA 3CQYA 3NFAA 5K14A 3MDQA 3ZSRA 4N9HA 5GIOA 2V4JC 3K9KA 1LQ1A 3ZX2A 3CPWM 1R6RA 1ZK8A 4BRLA 4DQ2A 3IAS2 5C0YA 3S1QJ 1I1SA 2O8DB 2P7CB 3W2VA 1MMDA 3CQXA 4KTZA 3JRGA 3V1OA 3ZETB 1MBJA 1ZBIA 2CFXA 4QPQA 1STZA 2XPVA 2GXBA 3BR6A 3UE5A 3HP6A 4MLOA 3RTVA 4HUEA 4J2AA 1SMTA 1YT3A 3I4PA 2ZGZA 4Y1DA 4FVMA 3ULEB 3SJJA 1DQUA 4C1NI 2QKMB 4JN4A 4K43A 1Q82O 2E6LA 4CCHA 4NBQA 3KP3A 5C10A 4DR1K 2BV6A 4H0XB 1YJNI 4B9VA 4K8ZA 1K61A 1BC8C 1USSA 3PJRA 3IWFA 3MWTA 3HT3A 3THXB 1ENHA 4XRSG 1RFQA 1Z7LA 4WFAL 1VSJA 1WJEA 1TWFJ 4GV6A 1IN8A 3ZN1A 2RQPA 5GPCA 1VQ9N 1J2XA 3J81Z 2ZB9A 2HR3A 1R22A 5GAGP 5IOYA 2MLGA 1ETQA 4YOYA 1Q9YA 4LF7K 1S9EA 1VQ7I 2Y31A 4YELA 4AHRA 2GV9A 3CM5A 3NF6A 4LK0F 1IG7A 5HLFA 1NKEA 1R59O 2CW0F 3PIOF 1DPUA 4CGGA 4XLEA 3U8XA 1NKBA 2QGUA 3ESWB 4H03B 4JEPA 4BS9A 4OAYA 3B8AX 3E9OA 4V2FA 4PWDA 2P1JA 3TGNA 3SMPA 3V42A 4UHTA 4FASD 3DMJA 4FLVA 2AJQA 3PO2J 5HROA 4GGGA 3AVLA 3NMUA 4XH5A 3EUHA 3GXOA 3TP3A 5CVIA 1KXPA 3LWLA 3RR7A 2EK5A 2EFWA 3DXMB 4IJNA 3ZMZA 3I58A 3JCUC 4MLHA 4AHVA 2O3FA 3ASNH 3CO6C 4Y17A 3QFUA 1KTQA 2IC3A 3AGKA 4E19A 3CQ8A 2P5KA 1JJ2M 5IT3A 1JGSA 1F9NA 1LE8A 1A5VA 3TSPA 5ADXA 2RQQA 2IJLA 3T5XA 4BHCA 1OLTA 4EZ9A 2BXZA 4M6VA 2ZO4A 4LOCA 3ZRGA 5DM7L 5KVRA 2JN6A 1NGGA 3SV4A 1H88C 1ZKGA 4IHVA 5AQNA 1TT0A 4OPHA 3LDSA 4EJTA 5M1PA 3NGYA 5JVGF 3KEQA 1KCFA 1U0JA 2P9SB 3IUOA 5DM6L 4B09A 3SBTA 1TV6A 1VQPN 1FOYA 3HPGA 5DYMA 4ENNA 4RGRA 2YR2A 3BQYA 5J6XA 3A2KA 3ASMA 3GLLA 2P9UA 2WTEA 1VQPI 1R49A 2Z5UA 4A3GJ 4KBOA 3LWMA 2EJRA 2G0EA 1G6NA 2ETHA 2Z33A 1ZRDA 5GPAA 4CJUA 5DEQA 4DYCA 3KK7A 4FLYA 3O3GA 3EY1A 3IH3A 2VQHA 4ZYEA 2UWMA 1JI8A 4F92B 2VB6A 1BWFO 1NM1A 1G8XA 2IS3A 3L3VA 1U2VA 3O9TA 3K1MA 3R9PA 3U9DA 4KISA 1OH5A 1NGEA 1U5TA 3CCVN 4L3QA 3R0JA 4BH9A 3CF5F 3HRUA 1FEXA 1OKJA 3SLCA 4JI7K 1WSFA 4XN3A 1N77A 1JT6A 1N75A 2GUIA 5JFRA 2CSOA 2KDZA 2IEKA 4FJMA 3KEYA 2WB1A 3LSRA 3W3DA 4KYWA 1T8IA 4DSLA 1RCHA 1FJLA 3VEXA 1ESVA 3CCMN 4P9UA 3VEYA 1MDMB 1HX1A 3JRHA 1ZGJA 3VQ5A 1L0OC 5IYCJ 3AO1A 3SQ2A 3DLGA 3KLFA 2GWJA 1HBXG 3ZSZA 1F4KA 2VBWA 4WCGA 3ABLH 1OQYA 4FISA 2QWLA 3LM9A 4PA1A 5AZIA 3VQQA 1T03A 1UHSA 1BG3A 4BRKA 1WSHA 4BBRJ 4AILC 2YCHA 5FLVA 2BY0A 1BC7C 1AA7A 4DQ8A 1A5XA 4M9ZA 1TQIA 3PO3J 3C7NB 4Z94A 3HM8A 2P9IA 3GL1A 4U0VA 1RUOA 1IW7F 4WXHA 1GLCG 5HRNA 4CHUA 4YOXA 2IA2A 1N8RO 4LIVA 2RKHA 3HTUA 1YO5C 4C8NA 1KU2A 1XMKA 2O4GA 5BN8A 4S0HB 2XPUA 4CJEA 1OISA 2VUMJ 3EUKL 4M42A 3LA3A 5AQIA 1VSIA 3WT0A 3J7YJ 2WFBA 3T1BA 2XY6A 3AKZA 2Y48A 4H4OA 3A02A 4UUVA 3QIOA 4CZGA 2QWQA 3O5BA 3H3OB 1HMVA 3THWA 4M73A 1E4GT 1YUWA 2XV4S 2EFQA 3GUDA 2EWSA 2D0AA 4ZZLA 2K7LA 1B8IB 2BVLA 2YJFA 4W5RA 3P31A 2RPIA 4KTWA 3BF1A 1IZ1A 2BVMA 5CZ1A 5EJCA 4CUGA 3CXCM 2BDPA 1K78A 3G71N 2O03A 5E1XA 1G99A 2E1MC 1WUAA 1E3OC 2W42A 3HBLA 1MBEA 3AO3A 2CUFA 2XAFA 3I59B 3HKZA 3JRIA 2YHWA 5BRDA 3QEPA 3ZXSA 4WXCA 2H1KA 1HKBA 3C18A 3HZ6A 1L3LA 1X4OA 2JSPA 5LGTA 3IV5A 2L02A 4CERA 1SAZA 3TWHA 4ID1A 2O9LA 1D5AA 3OL3A 4WWCA 2CJJA 2G7HA 2V7ZA 3BWGA 3VSLA 1ITGA 5FDLA 1FMVA 2BTFA 5E3LA 3HHHA 2B7EA 4RW7A 3VGLA 1IXCA 2BBYA 3QWLA 4NHJA 5LL6Z 1NK4A 3ULEA 1I27A 1XWLA 3ZN0A 4KHUA 3THYB 3VQAA 2PYJA 2VWJA 2DYSH 4G6TB 1X4PA 4WXDA 2CO5A 5K7FA 2R5ZB 3VTIA 2LVSA 1TQPA 2E2NA 4DV4K 2LNBA 3ZSYA 3KLHA 1SZ2A 3WGGA 4E1NA 1IUYA 4EIAA 4AIDA 5DCMB 2DQRA 4KB0A 3GF2A 1GUUA 1TTYA 3ZQFA 1D1BA 2A6AA 1BI3A 3RI4A 3JXUA 3AO4A 4PSXA 5CYMA 2HVQA 1OYYA 3L2CA 2Y9YA 4ISFA 3BR5A 5J2NA 1HF0A 3BP8A 2EPFA 4DV5K 1LW2A 1UWBA 1LVAA 1Z21A 1T08B 1S5LC 1YRNB 3C6UA 1D1AA 2XAJA 4ZDLA 3DKWA 2HKXA 1J5YA 4E4HA 3OV8A 4RM3A 1HKTA 1BIUA 3CUQA 4IVNA 2DU9A 3HZJA 1EX4A 1X2MA 2YHYA 1HSJA 2V79A 3FXMA 3H46O 1TW3A 3LL3A 1SFKA 1T33A 1HDDC 4DTXA 3N4MA 3RZOJ 3ZR8X 1R00A 5M1QA 1EH7A 3QPHA 4OINF 4GFBA 4IPAA 2P9KB 2ZSIB 2X6NA 1H8AC 2YNIA 4RS8A 3V7SA 4EM0B 1MJ9A 4KN7X 4U0YA 2YHBA 5H6RA 1KQ9A 3VB2A 1KLMA 2GTDA 3WGHA 4Q5SF 4ANJA 3C6TA 4NLCA 3CF5L 4M3XA 1TC3C 4BDZA 1R58A 3G4SI 2QBYB 3GZNB 4CD1A 1IN7A 1F43A 3KCCA 2VASA 1YI2I 2F9TA 3K4JA 3ENHA 4C30A 1UFMA 3DAWA 2DA3A 3V8JA 2RE2A 5LMNK 4R1HA 2X74A 3NBPA 4IOCF 1BI1A 2H94A 4CZCA 1AHDP 1GLJO 2HNDA 5A2QK 4EGZA 4Y0WA 4ENKA 4NC6A 3DLAA 4GKKK 2I8DA 3KWGA 4A3KJ 3K9TA 2VPLA 1NU0A 4B9UA 4KV8A 1IRGA 4LGWA 4D7NA 1YS7A 3THVA 2E1YA 4HVJA 2KP6A 4C1NK 1AOYA 1B92A 2HNHA 3SK3A 4DSEA 4XLHA 5HDNA 2Z3YA 2ZF5O 1FKPA 2ADUA 2XAGA 1BN5A 2VYPA 2Q1ZB 3SUQA 4I98B 2O8EB 1XN7A 2FD5A 5E8IA 3GTOJ 2DOEA 1CZBA 1HNVA 3NVMA 3P39A 1J5OA 3ZLJA 3MKZA 2AXTC 2D0OA 3LP1A 1GLFO 3IRQA 5JVTA 2PLYA 2P5OA 2ACJA 1W1WE 3SZ2A 1FC3A 2DTUA 2GOMA 4X0GA 4AIKA 1RT5A 1ZBHA 2IRFG 3DXJF 1VQ8I 3NGIA 2G8FA 2ZBKA 3EE8A 2FMLA 2Z9OA 1XTAA 3U21A 1L5UA 2K3FA 2KDOA 1TL1A 4QAGA 4CIFA 2MFZA 4CJSA 3VOEA 3BG6A 4S04A 3ZQLA 4B3RK 1B4AA 2OD5A 1SV5A 4JI5K 4BC4A 4YRVA 4DTMA 3ASOH 1KYZA 2WB1N 4PJNA 1X3NA 2X6OA 2WAEA 3OBYA 4IWVA 1R1UA 1YW8A 3O9RA 5AQOA 4DS4A 2OZ6A 1Y0NA 2W24A 2A6HF 1YTYA 1VSLA 4BXFA 3I5UA 3VF6A 5IYBJ 1S72I 4B9QA 2O8FA 5CKTA 2E19A 1R5GA 1W7AA 2FOKA 2LMDA 3OYFA 1LWEA 3SNNA 3NAUA 2EIJH 5IP6A 3HTSB 5EXWA 1HW2A 2HNYA 4AHSA 4M3UA 3CMEN 4KHNA 3CFRA 3L2RA 3LDQA 3KD5E 4CEQA 1JTXA 1SVOA 2VIXA 3QU6A 3TDZC 2VC0A 1WLJA 2E34A 1XC3A 2AXLA 2E2IJ 4C8LA 4Y13A 1FBUA 1J6ZA 3CCUN 2JK3A 3MMVA 4DFMA 3VDXA 2VXDA 2ZJPF 4I7FA 4DYRA 3VQDA 3GFIA 2VONA 3VGKA 3WXIA 1D0XA 5IP7J 4IG0A 4AM6A 5HLHA 2UXCK 4LJZF 2WONA 1E2XA 2K02A 3BG9A 4LMYA 3WEEA 4CESA 3KYDB 3E0JB 4JX4A 3V8KA 4MHGA 4ZDOA 3OOPA 2W6KA 1U5TB 4CJ3A 3DJCA 2XY7A 1RTDA 1IAWA 1HNWK 2HHUA 4PGGA 5H6QA 5CQEA 3IH4A 1U6GA 1V54H 1A6IA 4G12A 1RTJA 2DCEA 3ZOBA 3AVMA 3IS9A 3MEEA 5M1FA 3SAHA 1LCUA 2XF7A 4YOVA 3T69A 3KVGA 4D7MA 2LP0A 4ZJZA 3G71I 1SFEA 2QWWA 1FT9A 3WNFA 4DHYA 4A3EJ 2GBZA 4FWKA 2QTDA 2A40A 3ZQCA 5HLGA 1QGPA 3AA5X 1MMSA 2Q36A 4M3DA 3CUQB 3EETA 3S2DJ 4UVCA 2LBFA 1HPZA 3R6MA 5KI6A 2MA3A 1A04A 2P7VB 3KLEA 4MNUA 3VOVA 2VKHA 3D5RC 4J00A 4E7LA 5EEAA 1KONA 3OYKA 3TANA 3C2GA 1LJ9A 3K4NA 1I3AA 2KL4A 1F36A 3IKTA 3ZEUA 2JA5J 4KNYA 5FRMA 1GXPA 4BGBA 1TK0A 1NK0A 1M90O 2EFOA 2ZKZA 2FU4A 1NG9A 4IQ4A 1X19A 4F93B 2D0BA 2QF7A 2HS5A 1GT0C 2DPUA 3SQ0A 2FBYA 2FBVA 4HRIA 4PUSA 4BRNA 4DNCA 1BA5A 2E36A 3PUFA 2DBBA 2M87A 4I6MA 5LY3A 3IC7A 2E4LA 2O7OA 5FB2A 1SD5A 3IFRA 2HPMA 4IEEA 3SEZA 3HUGB 2CRGA 5FPEA 2BGGA 2Q2RA 2ELJA 4B3AA 1J0RA 2HOEA 1HQCA 3TQNA 3J7ZI 4E7HA 4A3FJ 1YX5A 2NUBA 3KJVA 1GLDG 2R93J 2HMPA 5C44J 3E66A 1KD1O 3DP7A 5LD2C 1YHQI 3O2PE 4U88A 5LHGA 2V6CA 1SFXA 3OIPA 2F4IA 4HLXA 2Z1DA 3VPRA 2IXSA 1T38A 1LAVA 1TKDA 1NKCA 3MAJA 5DCFA 5FFZA 3HOWJ 3K57A 1RBTA 5M3MJ 1XMXA 3HSCA 3EO3A 3HO1A 3ABUA 1VQ5N 2DPDA 2A05A 4F7ZA 4X6AJ 1RESA 3K1NA 1BQMA 1Q8IA 3T1YK 4RTFD 3V81A 3H9QA 1NG6A 1T56A 1ZAOA 2E5NA 2ELHA 3I56N 3SYTA 3ZMSA 2QW9A 1DGWY 3M4OJ 3F2KA 2JMWA 3PLAA 2JPCA 4L9TA 4WK8F 2JA6J 4YY3K 2OTJN 1QZEA 4XN0A 2L4MA 4DF8A 1XDUA 4DQPA 1KQ8A 1BJZA 3EL2A 2HHWA 1OCZH 2D5VA 2WY7Q 1W2BM 4B9LA 3ELKA 2ZCWA 5SWMA 1U9NA 5LBQA 4QTRA 2MH9A 5HODA 1XC9A 3E5UA 2QWMA 3H5NA 3G3ZA 5AQJA 2EHGA 1UB9A 3OR1C 3PNYA 4ABZA 3D2FB 1QA6A 2CH6A 1HR0K 1MDMA 4JI6K 5AQVA 3AG3H 4C2TA 4Z0UA 2X1DA 3MWPA 3ZSVA 2DFHA 3VEWA 4FJXA 2FNAA 4BQQA 5J47A 2QA4N 2WV1A 2CGJA 4FOIA 3U2RA 2CQNA 1ETYA 3B6CA 3VYUB 3OY9A 1BI4B 4H0YB 4CHQA 1U47A 3E6DA 2UXXA 2A41A 2KLAA 3KK3A 4K8XA 1P7JA 3GFLA 1QO0D 1P4WA 1LPQA 4ZH4F 4JD2A 3I54A 1PVEA 3FM3A 4M3WA 2LYCA 3NWTA 5GP9A 2TCTA 3HIFA 2IIRA 2W48A 2F5FA 2Q3SA 4ID5A 4IO9F 1HQUA 2EILH 2M34A 1HUXA 2EA4A 3ZETA 4EHUA 3K5LA 3SXYA 5BN9A 2KHMA 2R5YA 2JA7J 2H8RA 1DEJA 4KMUX 4CJ7A 5FKKA 4G8XA 3CQZJ 1IJWC 4A2UA 2EZLA 5FLXK 4LC9B 1ORKA 2ISYA 1QQNA 2RN2A 2YHAA 4DB3A 3OW2M 2H1LA 5B66C 3DEWA 5GTHC 1OVQA 1V5FA 2D0PA 2NRVA 3QNOA 2K4BA 1U49A 4B1WB 2B4JA 1W7PD 3ZQHA 4FT8A 2XIGA 3FIWA 3UNGC 1R0AA 2IT0A 1REPC 1RT3A 4EMSA 2ZM6K 3OVNA 2W00A 4KHSA 2GBYA 2FSJA 5HS8A 3MX5A 5A2QO 4HPQA 2HVRA 3ATUA 2GOXB 3BOQA 5AQSA 4I2PA 3VWBA 4L9VA 2R7TA 4IHTA 1OR7A 5AIQA 5FLMJ 3BCBA 2UUAK 3FZVA 5DMRA 4AWXB 1ILYA 2YX4A 4WFBL 3ABTA 1U4BA 1VI0A 2X1CA 1NK5A 3CERA 4TSXA 2W4SA 2PMHA 4RAFA 2P5LC 5LGUA 4C8MA 4FWMA 4CJLA 1PDNC 2M3AA 2MC3A 3HOZJ 2ETJA 2VJ4A 3HOSA 4XNFA 1WWXA 3Q0VA 4IRHA 5D8LB 2P51A 3SI6A 3CJ7A 3AL0C 1VSHA 2NRZA 4FJ9A 3WTZA 1RDUA 3BZKA 3DV8A 5DCMA 4I0BA 4BQAA 1UMQA 2ELKA 2L7KA 2D1VA 1W7PA 1VSKA 3L4IA 4LLNA 4K42A 3VA0A 2COMA 4MO4A 1L3TA 3ZMTA 2YKMA 4KHWA 4RGSA 2A5XA 3U3GA 4GV3A 2L9SA 2HU9A 3BTIA 3A0IX 1W7PB 3W6KB 5E26A 4O5VA 1S3JA 2W25A 4AYBA 5AQRA 4M3FA 1GLLO 4HNVA 1PUEE 4U67L 1YIJI 1O3SA 1CF7B 3EE9A 2VQEK 1HLUA 3M1FA 1VQ8N 4ZTJA 4Q5VA 2MD0A 1VQLN 1R1TA 3OYCA 3LAPA 5E8GA 2BE2A 2Y1JA 4CZHA 2L7FP 3WXJA 1QSYA 4JKCA 3D5SC 3OYIA 3OJUA 2ITMA 3VODA 5CVJA 3SDGA 4ITVA 1CF7A 2PJPA 3D2EA 1BHLA 4DTRA 2HF4A 1QS4A 2JVHA 1W0TA 3CC2I 1WKMA 3AVBA 3WXLA 2OZUA 4Z4FA 3F6OA 3KZYA 5EZHA 4L9NA 1PUFA 2LLKA 3U9GA 1P4XA 5AR0A 2R7OA 2CV0A 5KK1A 4JAXA 3WXMB 4B1XB 1FY7A 5HLIA 4OIQF 4ILHA 2ID3A 2HBLA 3WTYC 2Z1JA 3BZCA 3FFIA 4A2BA 1QQOA 2G8VA 3A03A 4CCJA 1KLNA 1YRNA 3W6VA 3DXKA 3HOVJ 3EQLF 4NDLA 4KJZA 1ZRFA 4HWIA 3SDBA 4NYNA 2H09A 2E1MB 1OPCA 2DT5A 4L5IA 3L2QA 1JCGA 2JZYA 1OKRA 1FSHA 1YI2N 3ROUA 4BC5A 1TWGJ 3V9UA 3PX0A 2CQ7A 1WJBA 5J40A 4O8KA 3O4QA 1TYQB 4CFDA 4CH7A 1RDAA 2QWNA 1A31A 2W57A 2M30A 3FXRA 5FKLA 2OTLN 2FSWA 3V8LA 5LHHA 3LMMA 3JSPA 4CGZA 3U4LA 3KYCB 3GDQA 4X1EA 4BQNA 3DLEA 3G6EN 1V4RA 1SQKA 3TTDA 1S7EA 4CZZA 3CCEI 1P2FA 3H35A 5DD4A 4DQIA 2X6YA 2Q8KA 1HPMA 2KQRA 3SZPA 1CGPA 1DT9A 1Y97A 3I71A 4F4KA 3NWSA 2QLZA 2XROA 2M45A 3O08A 4RCHA 3V9ZA 4WQ4A 3EYZA 1S1XA 2FE3A 1IXSB 1ZREA 2VOPA 3R3LA 5AQMA 4EV0A 1HRHA 1XPXA 2BANA 5GIPA 3O4NA 1QPMA 4CF2A 3HSTB 2GM4A 4AD9A 2CH0A 2QYOA 3EYYA 5ILSA 4A3IJ 4CHNA 3DPUA 4G6QA 3AA4A 3SZGA 3JRCA 4QS7A 3BTLA 3HM9A 3FMQA 2HZTA 4HUFA 4DTUA 1XSVA 3SZTA 1JUSA 3LSKA 2IA0A 4XICA 1JLFA 3CMYA 3WUHA 3CCJI 1NWKA 4CEOA 1XNRK 3BDDA 3V4IA 4CFCA 4LSNA 5M1KA 1LKXA 2HDDA 3FDYA 1BL0A 4CJWA 4JI8K 2K27A 4JBAA 2VJIA 2PMUA 4GRIA 3CJRB 4HNUA 3GTGJ 3K2AA 2BY2A 3DRRA 3NHGA 3TAGA 3HM5A 3MFKA 1X9MA 3B02A 4II2A 3W6JB 4F55A 2HYGD 3EYIA 3QMLA 3RMDA 1NK8A 4QCLA 1LWFA 3I8DA 1HYSA 4AUXA 1BR4A 2ECBA 4G9YA 4FWRA 4CBUA 5IP9J 4PJ0C 3GX4X 4DR6K 2OQGA 2IW5A 4YIFA 4B43A 3O8GA 3CPEA 2PJRA 4PGHA 4IEJA 4EJUA 1IN4A 1Y8QB 3FM5A 1TYQA 4GVMA 2WAQN 3ZMVA 4O3MA 5C25A 3K58A 4PUOA 3OR2C 1QU3A 4CZIA 3GTJJ 3MVPA 3ZQQA 1F21A 2OPPA 2YV0X 3K9JA 3ZX3A 2DTZA 4BDPA 2BW3B 1NGHA 4J8FA 4DG1A 1YLFA 4KIFA 5EF6A 4HHTA 2R7ZJ 1EV7A 2LDUA 4I76A 1SUQA 4EGYA 3T7ZA 1Q7YO 4C3HJ 3PO4A 3VYTB 5JI6A 3LFKA 3R4KA 2D1KA 1UHWA 1YTUA 1S29A 4YDUC 3RWUA 3JREA 1UOCA 4CZEA 4DLEA 2XF5A 1A36A 2E35A 4XRSA 4DSKA 3QBXA 2M8EA 2JGUA 3NDKA 3DTEA 3FBIB 1C1CA 5EZGA 4D5FA 4ISEA 5L3CA 3O9SA 1U2WA 5AQGA 1D9FA 2FOWA 3CC4I 5D8KB 4H0TB 4FJHA 1VQNI 1XB4A 3H3NO 3TAQA 1KU9A 1KU7A 3BROA 3V1RA 1C0MA 4LG0B 3OS1A 3PUBA 1JLQA 5EDNA 4GYIA 2F2EA 3WTUC 3WG9A 3PSIA 4MTEA 1JKQC 4P55A 1DDNA 1TKZA 4RLQA 4A5AA 4BRCA 3LZIA 3GWZA 2PG4A 3H5AA 5AQLA 4HDUA 4I01A 1K4SA 3WNGA 2NVQJ 3DI6A 2P0WA 3CFPA 4YNQA 3UIQA 4MEXF 1XMAA 3G1OA 2AQFA 2EIKH 2EV5A 2LBFB 1ZR4A 1Z6TA 1WAFA 3R1XA 4WQ5C 4W5TA 5IOZA 3HPOA 3FK6A 1MNEA 2R7UA 3WGIA 4J19A 4YDUA 2HMIA 2YPRA 2C6YA 4FWNA 2M0CA 3L00A 4YIRX 1L3VA 3JS6A 4YFNF 4XOTA 2R7VA 4PKHA 3NH0A 2VJJA 1ZBUA 4FLXA 3AVCA 4Y3OA 4IFYA 3H45C 3CJQB 3P1GA 4JKDA 2BHYA 2DPNA 5LGNA 4IRIA 1MMAA 5ICCA 1LFUP 3KK1A 1U48A 2HYFA 2XB5A 4M72A 4P5OA 4XKWA 3W2AA 1MWKA 2FSKA 4B1UB 4BRGA 5KQDA 2CGPA 2VT3A 3F8CA 3KKSA 3LAMA 4OPAA 2V1XA 3FXKA 1FTZA 3QO9A 1XG1A 2QQ9A 3HXMA 3FXJA 2FUG2 4I6MB 1GLAG 1E4FT 4XKCA 3CCVI 2AHQA 4BACA 2KPMA 5L3EA 1RRJA 2XGEA 1EQYA 2ITGA 3ZT2A 4EJWA 3NVKA 1U5TC 1R4MB 1CXUA 2WAFA 4O5BA 1X1DA 2N8GA 3GW2A 3FFKB 2HTSA 5HRRA 1XQSC 3FE1A 2WV0A 3LSTA 5CVUA 4N0BA 5KTQA 1OMIA 3CLOA 3RMBA 3I55N 3MEXA 1KSPA 5FD6A 1X1CA 1XX5A 1HW1A 1EH8A 1J75A 5F1XA 2EINH 4B08A 2QZ8A 3C3WA 2Y2ZA 2QM3A 3SFIA 5DDGA 1T05A 2JJ7A 1NG7A 1P7IA 2OQRA 2Y75A 4OWRB 5FD5A 4XKBA 1I6HJ 2I10A 1DGKN 2AQEA 1EXQA 1YJWI 1X3ZB 3HL2A 3IRXA 2M7BA 1W36C 5ELZA 3Q0WA 4DQRA 2FMYA 1NMNA 4DMNA 1T0FC 5M1OA 5JICA 2A5YB 2LKXA 2UUZA 3I4NJ 1TLHB 3MX2A 2A1RA 2W6LA 1I94K 1GDTA 2VBYA 5GTIC 2L2OA 3TDUC 2E7XA 1MSFC 4GDFA 1P90A 3J80K 1TZLA 2EIMH 2R7XA 1FNNA 5C42A 2BY3A 1E3PA 1X2NA 1WSIA 3BR2A 4UQGA 1A35A 2DO7A 1Z67A 1OR7C 4PK4A 4CCNA 2AO9A 3TP0A 1DUXC 1WOQA 3S16J 2QWPA 3WNEA 4FHTA 4RGXA 1XMQK 3VENA 1BI4A 2HBJA 5CR4A 4RGUA 1PP7U 2LC2A 3FMSA 2OPTA 1FTTA 2JWTA 2WBMA 3NARA 3CD6N 3AVAA 4A5MA 4BJ6C 3BC8A 3EUAA 2IBDA 3E01A 4FM2A 2HOTA 2YU3A 1VQMI 3L7WA 4FZYA 3IH2A 4PL8A 1PUFB 3DLHA 2VXZA 1G4DA 1QHAA 5F04A 3ZPLA 2XRLA 2EFPA 1RPWA 3TO6A 1Z1DA 1DPRA 1RNLA 1FWZA 4IHSA 4XH4A 3J80O 3M8RA 3ZSWA 4EATA 2BEOA 3KPHA 1D0YA 4YHHK 3E9PA 1SKWA 3CDIA 1TNSA 4M63C 1JUPA 4BQOA 5A2QZ 1CZAN 2I7PA 1JLCA 4FK2A 2ECCA 1ETOA 2NRWA 2V7YA 3CMEI 4XR6A 4W97A 4LD0A 5C2FA 1FIPA 4DUZK 4I0AA 1J09A 3MCAB 5JLXA 5CY4A 3ZMDA 3VYSB 2R7WA 2NVUB 4EM2A 3RKWA 1U2VB 1KYWA 3CM6A 3VQ7A 1HDPA 4O8UA 1R36A 4HZFA 5EEGA 4I6ZA 2HVSA 1YVNA 4A57A 2DW4A 1VSEA 4UV8A 2P9LA 3U3YA 1IRZA 4CJTA 3HOUJ 3MZ8A 2VQFK 3CLQA 4RB0A 3WXKA 3MN5A 1J53A 3UKUB 2O8XA 4FYDA 2P81A 5D5UB 4OIRF 1G3WA 5AONA 1Z26A 4M3GA 4ZTFA 2CWEA 3CJ9A 2FBHA 1MBFA 2F4MB 1H89C 2FLOA 2XY8A 3HBTA 4CJRA 4LFAK 1Y56A 3HUGA 1IKVA 3FMRA 1U8RA 4X62K 2VOOA 4FJNA 1GVJA 1YIOA 2ASOA 3WEEB 4JP0A 2KZMA 5M5XJ 5AZIB 4WE1A 4UXNA 1KZHA 3HVRA 3SCXA 3SMSA 2PYLA 1LVKA 1KVBA 4AM7A 3SJHA 1T8EA 1S6PA 3AAQA 4GW6A 3ONQA 3HEFA 3OYGA 2F4OB 3JAMK 3HYFA 2QKBA 4RW9A 3U9ZA 1EA3A 3A4CA 4S05A 4QS9A 4LG3A 2X48A 3CDHA 3MK6A 4H5NA 4CJ5A 3CCJN 2KFDA 2LD5A 2CW8A 2BW3A 1YG2A 4BE0A 5D4RA 1YAGA 5F64A 2QWOA 4QSHA 3TSQA 3ABMH 3CUQC 3VGMA 5DUKA 4V2GA 2E2QA 5B8HA 1L3UA 3I55I 1SL0A 3PO5A 4LG0A 1JCEA 2VG6A 3QEXA 1BBYA 9ANTA 2O8CA 4HG2A 2L9RA 4O4GA 3RKQA 3V6DA 4FL9A 1BIAA 2ME0A 2QKLB 3A01A 3QRFF 4CEZA 1GV2A 3DCFA 4EM1A 3JSMA 1I39A 2Q97A 2WOMA 4W5QA 1IG8A 4HTLA 3JRDA 1QVTA 2P6TA 4HQMA 4NB5A 5J2PA 5AQXA 3D0SA 1J7KA 5TGTA 2DMTA 4IOXA 4FLWA 4JLHA 2FQ3A 2IVNA 2PQ8A 1VSMA 2IGIA 3ID6A 3LSJA 3F9MA 1BIBA 1CZ9A 3N05A 4BRPA 4FCYA 2FF3B 2Z1IA 1NTCA 2A6TA 3EUHC 3HVTA 2OTLI 1XC5A 4RB3C 4FJKA 1Q18A 4OX9K 3HI0A 3RPUD 2ZE2A 3TR8A 1FIAA 3IKMA 1D1CA 1VF9A 4RAYA 2Q2EB 5F6FA 3M5RA 5AQZA 3V1QA 3VF2A 4DV6K 4F3OA 3LDPA 2K86A 3DBRB 4M3BA 4HCCA 1NGJA 2H6BA 3KZIC 1B59A 2BYVE 4MLEA 2E1NA 3TOAA 1WZ2A 3LP3A 4JK9A 1CXQA 3CCYA 3M8SA 4WYBA 4CF0A 3BY5A 3CCMI 2IGMA 1W5SA 2M4KA 4CCOA 4BRAA 1TGOA 3AVHA 1B72A 1NMDA 4HQEA 4PJMA 2EH3A 2LKSA 1PJRA 4Z4GA 4LD5A 4YFXF 4CYCB 3OTOK 3CC2N 1TUYA 2ZJPL 4IFEA 1USTA 3H5RA 4UVAA 5CLSA 1RZ4A 2H27A 2X6WA 1N25A 5AFUH 2NRXA 4JV5K 2IS4A 4CK2A 3HDDA 1LFPA 1LEBA 2XDVA 2CYYA 1C0FA 3B6OA 3IWZA 1IXRC 4ZDPA 2LFBA 3OL4A 3TW6A 2XB0X 1AWCA 4E3SA 3FR0A 2K85A 3CJCA 4B8AB 4CIEA 4JKGB 4KI4A 2P9PB 3DEUA 4K41A 3GEZA 3M9AA 2LF7A 1D8KA 3DPTA 1AKHB 1KAXA 2NZTA 4FW1A 4B3OA 3FBNB 4RMNA 2NS0A 3LSIA 1TBXA 4L5JA 4BGDA 3K2PA 3RMCA 2ZXJA 2XKOA 2MGQA 3S1RJ 2B63J 3DF8A 1BDGA 2DA5A 3ZYYX 4AHUA 1Y1VJ 1HQEA 4XLPF 1IDYA 4JYKA 3D0PA 3A1YA 1U78A 3T1HK 4FWPA 3MWMA 4KKOA 5HBMA 1JKOC 4OIOF 4BROA 3FISA 4A5BA 5AFUA 3OJSA 5C12A 2RAEA 1IV8A 1Z9CA 2ME6A 2H6CA 1YXQA 4A62A 2HGCA 3BG5A 2A6EF 1R1VA 4IXAA 1IC8A 2LKPA 3K2ZA 4PKGA 1K8AO 1EO1A 4KN4X 4CSWA 3ITHA 2NS8A 5JR3A 1ZXOA 5EG0B 4B1YB 1ULYA 2WC9A 2M4GA 1BI0A 3N97A 4AHTA 5BPLA 4PKIA 1NGIA 1RIOH 3LAJA 3MKLA 2AS5F 4LITA 3RSEB 3CCQN 2D1HA 1VQ6I 3EN9A 3CMAI 2L9VA 4CICA 3KE2A 5IT9K 5AQPA 5KNLA 2CUJA 5E41A 4ZYGA 2XGXA 4B1ZA 2A3ZA 1I3QJ 3K4CA 3THYA 3DTKA 2F48A 1BUPA 5D3GA 4BVOA 1WB9A 3CF2A 1MBGA 2L4AA 4KUMA 4UB8C 1ETVA 3QYFA 3IG1A 1OH6A 3ERED 5M1NA 4M3RA 3QYEA 4ZZDA 3Q0UA 2DA4A 1BI2A 1T6SA 2DI3A 1HKCA 3KIOA 3G73A 2FXUA 1JLAA 4FE7A 2XHKA 1FOKA 4BUPA 2YJEA 1J59A 3ULQB 2UXBK 4KB1A 2ZSHB 3JRBA 1XDSA 1MH3A 4IOCL 2DOFA 3EKSA 3RCOA 2L7MP 4R79A 4KHQA 3J7ZO 1TL8A 3E9LA 5AQWA 2PY5A 1Z05A 2LH9A 4KHYA 2VKDA 5BOXA 1RBUA 5E3OA 4KO0A 2JVGA 4E6KG 2ZWHA 3L1PA 4C2MJ 3VFZA 2TRTA 1E0EA 1RNHA 2IVPA 4C23A 3LPUA 5JVHL 2NS7A 2DT6A 4OKJA 3AVGA 3VQ8A 4PSWA 1WJ5A 3TABA 3DLLF 4OLBA 2D5RA 1IGNA 3WTWC 2HSTA 1VK0A 3V9XA 5ICEA 2CH5A 2K9NA 2XC7A 1BGXT 4IBNA 1KGSA 5D5XB 4HUGA 3WTTC 3SQNA 3G6EI 3CCSI 1Q86O 4DTSA 4ELTA 3VQBA 2NXNB 1Z91A 3J80Z 5TRDA 3NCIA 4M7XA 1YITN 3I0SA 4EAHD 1J9IA 4NCBA 1NJWA 4BY9C 3MD2A 2G7UA 3DU6A 3GCMA 3K6GA 1IBKK 2KKOA 2RVCA 4ETSA 4ILGB 4H0OA 2OBPA 3FZKA 2R7QA 3LPTA 1KAYA 3VETA 3PIPL 4FM0A 2OTJI 1ZGWA 3SHFA 1TAQA 1TK5A 3FK7A 1IBMK 1NK6A 3RJPA 2QSGX 5F27A 1LOTB 4BWJA 2Q0UA 1FW6A 2VN2A 4OGCA 4CO8A 4JI3K 2O61A 3ZGKA 4NNJA 4WF9L 4Q4ZF 4D0PA 5E20A 1H9TA 1BA0A 3GFMA 1C1AA 5B1AH 2VWBA 5K7ZA 1B6AA 3HOTA 4K25A 1WBDA 2K9SA 1VQ4N 4NUBA 4GV9A 1GV5A 3FZFA 4F9OA 5D5VB 3ALYA 3ABKH 1KA8A 1B9DA 2JPBA 4ENMA 5KQ8A 4FZXC 4WCEL 4FZZA 2BH1A 1P8ZA 5M5YJ 2YHXA 4AF1A 1DP7P 3O6WA 4IJAA 2GUPA 4BQZA 5F0XA 2K9MA 4IF4A 2BE5F 1JXBA 5DK5A 5DD8A 5AZJB 3MAQA 1I1GA 2RKIA 3PX6A 5BMZA 2CFOA 1SEUA 5AQYA 3C1DA 3VEPA 5LHIA 1O57A 3VESA 1N33K 1KFDA 4M9SA 1O7LA 2R0QC 3CESA 4GCVA 2FSNA 5C4JJ 5I42A 5HDGA 5DUIA 3IUCA 1XNQK 2GA2A 1HA8A 3D1NI 1VAZA 1B9MA 4DS5A 4XOPA 2MH2A 1N78A 2P9NB 2Q31A 4DKWA 1VQNN 1ATNA 1P9QC 5J1EA 2E2PA 3A5NC 4H0PA 1MIJA 3JRFA 2XUBA 1ERDA 2YNHA 3F22A 4MDAA 1TWCJ 2F9WA 4FWLA 2PFUA 1QRYA 4AC0A 1GLBG 3AO5A 2X9DA 2HQAA 2XRNA 4E7IA 3CJAA 3IHUA 3K0LA 1Z77A 3VQPA 4F2RA 3KLOA 4MFDA 4Y7NJ 2IVOA 3REOA 3OYMA 2UUBK 1MBHA 1HNIA 2L01A 2M8GX 4WQ5A 3TPQA 4N4OB 3V4GA 2DLLA 1S8NA 2XKPA 5IYDJ 3QEVA 1QSSA 2HQ5A 2R7RA 3KZBA 4CGJA 1C0WA 4Y52J 1JLEA 2FBTA 3NQOA 5ERIA 3CMMA 5CJ9A 3OSFA 1ASUA 2VKVA 3WU2C 2OV7A 3PQKA 5E1ZB 4A12A 4A2AA 4LH4A 3NAEA 3LOCA 3GTLJ 4EZ6A 2NVYJ 4KITB 4AU7A 1IUFA 3VF4A 5EX5A 2YNGA 2ASPA 3M07A 3VPZA 2ICWG 5AQQA 1FYKA 1SVLA 1ZLJA 4XSXF 3S15J 2NRTA 3LAKA 5FPMA 2KIUA 2P5GA 1KVAA 2NLXA 4UNOA 1QHHD 4E70A 3BG3A 5CHIA 4MQ9F 3DTIA 5HVQC 4BXXJ 1GOAA 1RT6A 1NGDA 5BRHA 3DKYA 4KA4A 1YFHA 4IG3A 2A42A 1ZR2A 4CW7B 3NEUA 4DR4K 2QXLA 3ML6A 2CQKA 3M8PA 4HLYA 4FJGA 3RQ4A 4FJ7A 3HSEA 3C65A 3FWEA 4X66K 3QODA 4EEFG 2P9PA 4KT6A 3HK2A 1BR1A 3WTVC 1SL2A 3AAFA 4V19S 3A0HC 3VA3A 5TJJA 4QWQA 4BXUA 1W36D 2O6GE 3ZEUB 1M1KO 2LRDA 1G3SA 3IDHA 2XSDC 4UB6C 2IDOA 4CFBA 2YNFA 1VQOI 1FZPB 4L0ZB 5E79C 4M6XA 2OCCH 3S3NA 3TOBA 4FE4A 3J7AY 4DTJA 2KRFA 3OS2A 2VBXA 2ATQA 3U1DA 5JHUA 4CYCA 1LV5A 4E7SA 1K8KB 2QSFX 3OYNA 5LJWA 2XGDA 4WF2A 2KZZA 5DS9A 5J4VA 1CQTA 4BBSJ 4OMYA 1DP3A 3QERA 1D5YA 4DR7K 3M3YJ 2OC6A 2KJCA 2KZVA 2DY4A 3K4KA 4QLCU 3WQTA 3G4SN 4PQUA 2W84A 2ZJRF 3IP4B 3PSFA 2VI6A 3I56I 4CZFA 1TW2A 4KI6A 4JKGA 1EWRA 1ZGAA 2ZNZA 4FVUA 3CUOA 2VGNA 1DU6A 1BQNA 4BR0A 1UCRA 3FGUA 3D5LA 4A3DJ 3NH2A 3ZT3A 2CQXA 2A5WA 4AVZA 3FZHA 1B9NA 2GIVA 3MEDA 4KAZA 1O4XA 2HHVA 3OBWA 3VN5A 3ZX0A 2CU7A 5I9EB 1XHZA 3CCLI 4FQGA 2ZMEC 4RDUA 4CGHA 5FGMA 5KHDA 3AA2A 2NOJB 2Y30A 2VQLA 4NC8A 3BR3A 2P5VA 4M6YA 4M3EA 1W97L 2GX9A 1GLNA 2F8TA 3TU5A 1ZQ3P 3HYIA 1F1ZA 1VQMN 2OF7A 3LL7A 2P9IB 4XIUA 3AVKA 1K9MO 3CCEN 1YS6A 2ESHA 3OIQA 2W82A 3CHWA 3S3OA 1G59A 4ISGA 3ZQGA 3PX4A 4NQWB 2DN0A 4BYYA 1LE8B 5KRSA 2D4WA 1KAZA 4CJKA 1YYVA 2JWKA 3GG4A 4JI4K 2YS9A 4XRMA 3KETA 2GELA 3DFGA 4H5WA 4I9LA 4QIWN 4BRMA 1RKWA 2ESNA 2P6SA 4HYEA 5CQGA 3L2UA 4IHXA 3PIOL 1D9DA 4M3TA 4BREA 1ZBFA 3EDPA 2HFHA 4LH5A 3CC4N 2H8WA 3DKXA 4XMYA 2FX0A 5FKMA 4BEHB 2CMPA 2CW7A 2E2OA 1RT1A 1O3QA 4BJ5C 3N4PA 3VTHA 3P9KA 4GNIA 1SC7A 2DA1A 3OYAA 1LDKB 1WI9A 2EZKA 2HYJA 1ZHFA 1OFCX 1X1AA 2PEXA 2ZFWA 5E18F 2A3SA 4A93J 2D0CA 3SV3A 4CZMA 2FC0A 1S72N 1VQ7N 4JYAK 4B1VA 1ON1A 3J7AO 4ZYAA 1QHTA 1FMWA 1RC9A 1IO2A 2DOAA 1S1UA 3L3UA 4H5VA 4M7YA 4OPJA 3HPHA 1R7JA 1K6YA 3FXLA 2IVMA 4JI2K 1LAWA 4B8XA 1ZBLA 1R23A 3IAYA 3THWB 5H20A 2KW4A 4N76A 2OZMA 3TAPA 3MZHA 2UXNA 3VEVA 2XY5A 3CETA 1OCOH 2VG7A 2VJ5A 2ZMEB 3GLXA 4BHPA 3E6MA 3MN2A 4BQLA 4OVLA 1ASWA 4BGAA 1YITI 3SQ1A 3I53A 1RT4A 5FLXZ 2F4VK 5K7HA 1R5ID 1Y1WJ 4FPBA 1KC8O 1D0ZA 5KRTA 3RSNA 2YI1A 2XVCA 4IQJA 3T19A 2MLKA 4DV7K 5CVVA 3NF9A 4BRFA 3AVFA 2XAQA 4DFPA 1FSEA 3S8PA 2V26A 3K7AJ 2QQAA 3A5LC 5ICGA 1HCRA 3I0TA 3OS0A 1ETKA 3HOYJ 3T1AA 6PAXA 2GZWA 1JGGA 4B3MK 3A8YA 1FK9A 2M5WA 1KU3A 1VNDA 4AH9A 1MW7A 3RKXA 2K5CA 1U8BA 2JA8J 1TL3A 2XRIA 4QS8A 1MH4A 1MJAA 3W2WA 4HOBA 2DA7A 5TKWA 1D3YA 5CVRA 2UXDK 3CC7I 2MYSA 1IRXA 4B1RA 3C6HA 1LEAA 4FLUA 4A3CJ 2VT2A 2MSYA 1U45A 2K3PA 3HKZN 4JX6A 4B3SK 3T3FA 1QZ6A 3ZQ7A 1S9GA 3F8MA 1KVCA 1IN5A 4E7ZA 2R5ZA 1QQMA 3N4QA 1KRPA 2NOGA 1S1TA 3LP2A 4BRQA 3LWFA 4CK3A 4MFBA 2G8WA 2G8HA 1S3XA 1JE8A 2ZJRL 4BWMA 1Z3YA 4FWOA 2MG4A 2G8KA 3E97A 2QKKA 2LG4A 2F5DA 1VQ6N 3SUOA 3K0SA 1W5CC 5B1BH 4EJVA 1C0GA 3RDIA 4DBRA 2KHOA 2AP1A 1H9GA 3D7EO 5CPRB 5E17F 3E1YA 4BR7A 3H3UA 4XBFA 2GAUA 4DZPA 4G7HF 3P38A 1POGA 5D5WB 1QBJA 1IH7A 4DV1K 1JKPC 3CYMA 3Q5FA 1QTMA 1UHMA 1XGOA 5DM7F 4FSVA 2O5RA 4CHZA 4IOAF 1XUPO 5J8FA 2YKNA 1NK7A 4C8KA 2O8BB 2NVXJ 1BW6A 3FZMA 3O9UA 4BC3A 3DM2A 3Q9VA 2PX9A 4O6JA 2OU2A 3RPUA 3MEGA 4CGFA 3AG4H 4PHTX 4DUYK 3RIRA 1F5TA 1XCVA 1JT0A 4KIGA 4KIBA 3S14J 3ISNC 4FETA 3DXMA 3A5OC 5J1RA 4CEBA 2O8FB 4FXDA 4ESBA 4MO7A 2O8EA 4IZ9A 4YIIA 5ILVA 4JKEA 4CDGA 3CI5A 4HDVA 1MMNA 4LB5A 4JK8A 3CJTB 1QVGM 1S7AA 3SAFA 1SD7A 1OYWA 3DOKA 2EQRA 2JA2A 4CJ4A 3AG2H 3WG7H 1NGBA 4JRPA 2X0LA 3S2HJ 4E1MA 3ZT1A 2RN7A 3HRTA 4OJRA 4DU1A 4J2BA 5K5RA 3O3KA 3S3MA 4JI0K 4PDKA 2UZKA 4L18B 1TWHJ 3NGZA 2G9WA 3BR0A 1FBSA 1SFUA 3TBIA 2DYRH 2QWRA 4B47A 3DLBA 2HHSA 1FKOA 2ZFUA 3R0AA 4U87A 3RMAA 2Y9ZA 3LA2A 1LB2A 1JL2A 2IAIA 5JLWA 4ZHRA 3FHNA 1JHFA 3MN7A 1VQ5I 4CJQA 4B9MA 1RGIA 1XSXA 4UUSA 3P9CA 3K1PA 5H2FC 5EGOA 4JS5A 3ZSXA 4GO1A 1D4XA 4A3BJ 1V5GA 4F52A 3A0BC 3SEQA 2YX6A 1WJCA 1TK8A 4FJJA 3QOPA 3Q7BA 3HJFA 2STWA 1UG0A 4G7OF 2AA4A 3O3HA 3TW7A 4IHYA 1VQLI 1G15A 1WBBA 5F1RA 3TI0A 1E3MA 3WODF 4CGIA 3O4WA 3DLRA 1YHQN 2E8AA 2HXIA 4DSFA 3EPZA 3PFIA 2FF4A 4FO0A 1IN6A 4G6DA 1P4AA 1G3TA 1E17A 5F2RA 3L6QA 1HC8A 5T7BA 4DV0K 3G25A 3SUNA 1AKHA 4IOAL 2BY1A 1TAUA 4H0VB 3P9IA 2PFBA 3JW4A 2DDAA 2KISA 2M1BA 2K9QA 4D5CA 1KFSA 4FJ8A 4K0KK 1T0FA 1RBRA 2A1SA 4B9SA 2RC4A 1QZ5A 2ZXIA 3R6SA 5LLQA 1RBVA 3PL8A 1T44A 5L3GA 3DRPA 4LF6K 3WE3A 5L3DA 3H92A 5DV5A 4X64K 2IGOA 2W1OA 1SAUA 4IEIA 3J81K 3PQJA 4BRHA 4DSJA 3KP4A 1T3VA 2NYXA 1MU2A 5C24A 5J2QA 2HNZA 4EFHA 2B6AA 3CCUI 4ENJA 3HJEA 3QPSA 4B8CA 4CVNE 1FOXA 3QLHA 3K5NA 4JRQA 3V9WA 2JRMA 3LSGA 4PJJA 5J8CA 1XSDA 4A3MJ 3H0GJ 1ZC6A 3SBGA 1E3HA 4BE1A 1Z7UA 4ON0A 1FP2A 5GAHJ 4F3TA 1T6DA 1ETWA 4LF4K 1LNWA 1S6LA 2HVIA 1QVUA 1ZG1A 4RM2A 5I3UA 3BJAA 1APLC 2HOSA 2EB7A 2OCEA 4JQFA 3F21A 1R71A 4KDPA 3P7NA 1MWMA 3PFYA 1WN7A 3RQIA 3S2WA 1ZG3A 3R8EA 4CBXA 3MXMA 1L3SA 4PFOA 2L9NA 4RAZA 1O1WA 3DPLC 2B5JA 2HW3A 1ETXA 4XKVA 3WHCA 1EETA 4LSLA 4CHOA 3CMAN 3HSFA 5HNFA 1OCTC 3HGGA 3MZYA 3UKRA 4CECA 1K73O 4JK7A 5KAIC 3AVIA 1A6QA 1VZ0A 2W41A 4DR3K 3DWLA 2Z1GA 2KIQA 1Q1HA 3QP5A 1LWCA 2E5LK 2I5UA 4A0ZA 4BDYA 2FNPA
chains in the Genus database with same CATH topology
4CK2A 4Z4HA 4DTPA 2BGGA 3KD1E 1CLQA 3B6OA 2LSNA 4M45A 2KQ2A 4E3SA 4B8AB 2X78A 4E7HA 2NUBA 1JXEA 4CIEA 3KJVA 1RTHA 3F73A 2Y1IA 1HYVA 1IKXA 2PZSA 4FW1A 4DU3A 4B3OA 3K2PA 3RMCA 3AVNA 4CF9A 1LAVA 2IOCA 4W5OA 4AHUA 3QETA 1TKDA 1HQEA 1S5JA 3K57A 1NKCA 3KLIA 4Q0BA 1RBTA 4I2QA 4KPYA 3D0PA 3HO1A 4KKOA 3OJSA 1BQMA 5HBMA 1Q8IA 3U6FA 3KTQA 3V81A 1ASVA 3OYLA 1RT2A 3DOLA 4IKFA 2F8SA