1X1PA

Crystal structure of tk-rnase hii(1-197)-a(28-42)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGAGAIIGLAVGGVVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Structure of amyloid beta fragments in aqueous environments
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1x1pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1x1pA01
3OYLA 5FDLA 4QCLA 1BL3A 3KLHA 5J2PA 2D5RA 4FVMA 4B9LA 3LP2A 2P1JA 1ASUA 1KLMA 4ZTFA 2FC0A 4PQUA 3NH0A 3C95A 4DU4A 3CFOA 4HUEA 3SQ1A 4AHCA 1TK8A 4CEZA 3IRXA 3VA0A 4DSEA 3AVBA 3DMJA 4CEQA 3RR7A 3LDSA 1ASVA 1NK8A 1IKWA 4M3RA 3ISNC 1W9HA 4FW2A 4B3OA 4CE9A 3HVTA 2FBTA 4GMJB 4HUGA 4FLYA 4B9VA 2O4IA 5FROA 2ZQBA 4BE0A 1D9FA 2OZMA 1SV5A 5KRSA 2HHUA 3RMCA 1TGOA 4LSNA 1X9SA 1CZBA 4CHZA 3ULDA 4B9NA 3A2FA 3ZSRA 2RF2A 4CJLA 1L3TA 3ZSZA 3NF7A 1X9WA 3KK2A 4HHTA 3ZT3A 5KI6A 3OVNA 1FKOA 2WONA 4HCCA 3RRGA 4CCHA 4CIGA 4AHRA 3NGZA 1U4BA 3OYEA 4W5OA 2BANA 2E6LA 3TARA 3AA4A 3M8PA 4CEDA 4E3SA 4DFPA 3TAMA 1RT5A 3OYKA 3MEDA 5C24A 3TI0A 3D45A 4ELVA 3DRRA 2A1RA 3OYHA 1RT1A 3MEEA 3LZJA 3PUFA 1B92A 3OYIA 2AJQA 3AVKA 3O3FA 1L3SA 4NYFA 4CFAA 5HP1A 3AVIA 2ZD1A 4BE1A 1VSEA 1WSHA 4DU1A 3HXMA 4ELUA 2WOMA 3AA3A 3AVJA 2D0CA 1QTMA 4FM2A 4RW4A 1RT3A 4CHPA 3PX4A 2HNYA 3V9SA 4CJ4A 1QSYA 1TV6A 2HHTA 5HRPA 3RWUA 4RW8A 1VSMA 3KLFA 1Z25A 4CF0A 3NHGA 2DFFA 4C8LA 4FJMA 4FJ9A 4KFBA 1WSIA 3TAPA 1HQEA 4DS4A 5FRMA 1GOBA 4CJQA 2Z1JA 3F73A 3AO2A 2BE2A 3PO5A 4B9MA 1EX4A 1RTHA 2OPSA 4KV8A 4ZHRA 3AO3A 3QEIA 3ZSYA 1RILA 5DK5A 2NUBA 4HVJA 4CGIA 4F3OA 3OS1A 4ELTA 2HVHA 3G10A 4I9LA 1KSPA 4DSIA 4J2DA 1I39A 4I2QA 4CEEA 3AVCA 1KVBA 1J9AA 5JS2A 1NJXA 4BDPA 2QKBA 2JLEA 5HRRA 1K6YA 1HYSA 3VQ9A 1ZBUA 1SUQA 3QEXA 1IO2A 4DTXA 3K5NA 3O4QA 3HPGA 3OYAA 1X1PA 4E7HA 4O0JA 1EKEA 2PZSA 4DTNA 4FJIA 1RTDA 4KTWA 1JXEA 2DTUA 1UWBA 3AV9A 1JLAA 5KRTA 1S9GA 1QSSA 4RW9A 4FK4A 2Z1IA 3HL8A 1VK0A 4FZYA 1RBTA 2DFHA 3S9HA 1UOCA 4M3ZA 1TKZA 2JGUA 3I8DA 3T3FA 4KI6A 4FM0A 2P5GA 1RNHA 2VG7A 3AO1A 2ZE2A 5I42A 4B9UA 5HBMA 3T1AA 4DTMA 1GOCA 4N5SA 4EZ9A 4OKJA 3CFPA 2GUIA 3VQEA 3BGRA 4Y1CA 1JXBA 1BCMA 4Q5VA 4EP5A 4DLEA 3WNFA 2XY8A 4W5TA 3TANA 3S3NA 5KGXA 2F8TA 4E89A 1Q8IA 4FCYA 3PX6A 3V1QA 1TL1A 2G8IA 3VQDA 3FFIA 3TR8A 3PO4A 3QIPA 4M42A 1QQCA 1Y97A 5J1EA 1KRPA 4W5NA 1KVCA 1HPZA 5T7BA 3OYJA 4CK2A 1RT7A 1B9DA 4IBNA 3C6TA 1EP4A 2I5JA 3OYNA 3SCXA 5CZ2A 4CJFA 4FJXA 1BI4A 3V9WA 3CM5A 1S1TA 3SV4A 5CYMA 1D5AA 2IS3A 1IH7A 3DLGA 4OLBA 1KLNA 1S1VA 3SUPA 1WAFA 3V6DA 1C0UA 5D3GA 1JL2A 1S9EA 1UA1A 3L8BA 4C8KA 1J5OA 1RBSA 1YTAA 3VQ5A 3SI6A 3K5OA 1WNSA 4OGEA 4CGDA 1CXQA 4ICLA 1SKSA 2YHAA 3AA2A 4RG8A 4CHOA 3T19A 3LANA 4CJTA 1JLQA 2QKKA 3OYCA 4AHVA 4CJPA 1XHXA 3SQ4A 3K2PA 4DSLA 3WNEA 3DOKA 3L2WA 4CIFA 1UA0A 1SKWA 2YNFA 3PX0A 3IS9A 4DTRA 2X78A 4Z4FA 4CERA 4FJ5A 3ASMA 3OS0A 4CGHA 1LW2A 2G8HA 2HHSA 3NF9A 2HHWA 3VQ6A 2G8UA 1C1AA 4E7JA 4I9QA 4CFDA 4FLTA 4M3XA 2ETJA 2Z1GA 4EP4A 3ITHA 1HYZA 2F96A 2YHBA 1ASWA 3ZT1A 5FRNA 1C0TA 1RT6A 2YV0X 3KLEA 4BDYA 3B6OA 4BE2A 4F3TA 1IKYA 3L2VA 1YT3A 3TAQA 2YKNA 4F4KA 2XRIA 3LWMA 4MFBA 4CECA 1FXXA 4JS5A 3V4IA 4GVMA 3DLEA 3C94A 3KKRA 4QOZB 4AH9A 3CM6A 1YVUA 3SZ2A 3PY8A 1RDDA 5K14A 4O5BA 1QHTA 4TSXA 1B9FA 1BIUA 2ITGA 4OGCA 4B9SA 2FBVA 4CEFA 4DQQA 1C6VA 3SQ2A 4E7LA 2YNGA 4ZTJA 1Q9YA 1D9DA 4G1QA 1U49A 3WNGA 4AHUA 3SJJA 2BGGA 4I2PA 4HUFA 2IGIA 1LAWA 3WNHA 3L3UA 4AHTA 5C42A 1REVA 1TKDA 4KHYA 1RBRA 4JRQA 3AVHA 1WSEA 1VSKA 3P5JA 4E7IA 3RTVA 4JS4A 4JRPA 3NFAA 1T03A 3D0PA 1L5UA 4R5PA 2HW3A 1KTQA 4B8CA 1TKTA 2OPRA 2VG5A 1DTTA 3V9XA 1KCFA 2FBYA 3ZSXA 1DTQA 4W5QA 4CJ3A 1D8YA 1ITGA 3KIOA 2KFZA 3NH1A 4CJEA 4KHNA 3S3OA 1N5YA 3LAMA 1SL1A 3M8QA 1BQNA 1JLGA 2KQ2A 1NKEA 4DWIA 1JKHA 1WAJA 3I0SA 4RW6A 1LWCA 4YFUA 3OYBA 1TK0A 1WSJA 4PA1A 1KFDA 3V81A 4IFYA 1BQMA 1U45A 3M8RA 2QXFA 3QLHA 1NK7A 4J2EA 4CF1A 4K8ZA 3OYMA 2YKMA 4FLZA 4KHWA 4FLWA 1RBUA 3SUOA 1O1WA 1RT2A 3HJFA 3HPHA 4Q0BA 3ALYA 3ZSOA 2OA8A 2QK9A 3AVAA 2HHQA 3LPUA 3MXMA 2KFNA 3DLBA 4FLUA 1NJYA 3DLRA 1RT4A 1BI4B 1CLQA 2YNHA 4LH4A 1VSHA 3NE6A 3S3MA 1ZBFA 4N76A 3SUQA 1BHLA 2X6NA 4OLAA 3EY1A 1T05A 1RDBA 1A5VA 4ID1A 1S1XA 1JL1A 3K5LA 4CJRA 4KTZA 3M8SA 1CZ9A 4CEAA 4DSJA 4GW6A 4Z4EA 4M41A 5HRSA 2XY5A 1L3UA 3LWLA 1SL0A 1NKCA 3K58A 1BGXT 1WN7A 1TKXA 4O44A 5CZ1A 4CJVA 5SZTA 1BCOA 2GV9A 2E6MA 3KLIA 3UIQA 5CY4A 4CJWA 3ZT2A 3F9KA 4DFMA 4KHSA 2KW4A 1W0HA 4F2RA 1HMVA 3NCIA 3OJSA 5E41A 1VRTA 4CGJA 4CIEA 3KK1A 1ZYQA 4KAZA 4FJHA 1HNIA 4CJUA 4CJKA 1EETA 2B6AA 3JYTA 3HK2A 2HMIA 4CGFA 4M3UA 3OYDA 1VSLA 4DQRA 2IAJA 5JS1A 2F8SA 2B4JA 2FBXA 3RMDA 3RMAA 1TAUA 4NYNA 3LZIA 4KI4A 1S1WA 4IG0A 3CFRA 3AA5X 2XY6A 4KREA 2RKIA 4O0IA 3VN5A 3K5MA 3MEGA 3NBPA 3QIOA 4KTQA 4DTSA 4DF8A 4AHSA 3MXIA 1L3VA 4Z4HA 4J2AA 4F2SA 2HVIA 1J53A 4LSLA 4OPKA 3VQPA 1RBVA 1VSJA 3HYFA 1BISA 1S6QA 3L2UA 3EYZA 2E4LA 4FM1A 4CF9A 1U48A 2OZSA 2KTQA 5I3UA 1UAXA 3TAEA 5KGWA 4E7KA 3OYGA 3RR8A 4BWMA 3TAFA 5EU7A 2IDOA 4E19A 3LP3A 4CEBA 1XHZA 1J54A 3ZCMA 4PWDA 3DYAA 3ZT4A 3VA3A 3SNNA 3VQAA 3NAEA 3HT3A 3P83D 1LWFA 3SYZA 1LWEA 1C1CA 3AVNA 4LD0A 4AILC 3MXJA 5KTQA 4XIUA 1U04A 2EHGA 3O3HA 3THVA 1IG9A 3O4NA 1XWLA 3AO4A 4QAGA 4C8OA 3KD1E 4CJ5A 3DLHA 4YNQA 3PV8A 3IAYA 1MU2A 4CFCA 2HHXA 1CXUA 4FJNA 4IKFA 2G8KA 1JLCA 1A5WA 4O55A 3HM9A 2OPPA 3DI6A 4Z4GA 3LAKA 3IG1A 3OYFA 1NK9A 3I0RA 2GBZA 4H4MA 1T7PA 3CYMA 1RDCA 4OKKA 1R0AA 4LH5A 1DLOA 2Z1HA 2XHBA 3VQ8A 4FK2A 2EX3A 1C0MA 3VQCA 3RRHA 4H8KA 4DSKA 4M3TA 1JLEA 4DMNA 1NK6A 4CHYA 3P1GA 3NDKA 1EXQA 4DTPA 1TVRA 4FJ8A 2A1SA 4NCBA 4FXDA 3VQ4A 3QETA 1N6QA 4B9TA 2OYQA 3MECA 1G15A 4KB1A 1RTJA 1QE1A 4E1MA 4BACA 2HB5A 1S5JA 1VRUA 2B5JA 4O4GA 3QESA 3MAQA 3OJUA 4K8XA 3SPYA 1XC9A 4DS5A 4CHNA 2ATQA 2IOCA 4Y1DA 2BDPA 1HQUA 5C25A 4FJ7A 3TWHA 4DF4A 2RN2A 1KVAA 2W42A 1SKRA 4N41A 3U3GA 4KPYA 2Q3SA 3V9UA 1TK5A 3HP6A 1NKBA 1T8EA 1WSFA 3ZSQA 4RW7A 1LW0A 3ZT0A 1TAQA 4FJKA 1BIZA 3ZSVA 4FLXA 1X9MA 1HJRA 1YTUA 1NOZA 3NH2A 4DQIA 4M3YA 2Y1IA 2HHVA 1NJWA 2X6SA 2P5OA 4MQ3A 1RCHA 3NF8A 5DMRA 3HSTB 1I3AA 5HROA 2DFEA 4LY7A 4CEOA 3BDPA 4DQSA 3LP0A 2DY4A 3AO5A 4FLVA 4FJLA 3TAGA 5HLFA 1VSDA 4OKEA 3C6UA 4DFJA 1WSGA 3G0ZA 4NCAA 2G8FA 2D0BA 3NF6A 5J2MA 1A5XA 4H4OA 4FJGA 4FZXC 1SL2A 4CHQA 1VSFA 4CGGA 1F21A 1FK9A 1JLBA 2IC3A 3V1RA 3KK3A 3VQ7A 3QERA 5CYQA 4I7FA 4B8AB 4PY5A 1HNVA 3B6PA 1JLFA 1Z26A 2G8VA 4FYDA 4IFVA 4E0DA 3HPOA 1LV5A 1IKXA 4FZZA 4KRFA 3VQQA 2R7YA 4KO0A 2P51A 4DU3A 1QS4A 4Z4CA 1IKVA 3TABA 4M45A 2PY5A 3AVFA 2LSNA 4E1NA 4UQGA 3DRPA 2XY7A 2HNZA 3JSMA 3HP9A 5SWMA 1NK5A 3OS2A 3HVRA 1NJZA 3QNNA 4EZ6A 5HRNA 4WE1A 4CK3A 3V9ZA 4Z0UA 4F8RA 3LALA 3H08A 1TL3A 4Z4IA 3ZSWA 5J2NA 4KHQA 2OPQA 3SV3A 3DLKA 3KLGA 4ID5A 4KHUA 4M3WA 4DTJA 2D0AA 2X74A 3NGIA 4C8MA 2Y1JA 4OJRA 4DG1A 1ZBLA 4FW1A 1S1UA 4JLHA 3DRSA 1KFSA 2PYJA 2PYLA 4PUOA 3QEWA 3KKSA 4CJSA 3E01A 3LPTA 4DFKA 1NK0A 5J2QA 4HTUA 3QNOA 2HNDA 1HYVA 4HCBA 3K59A 3DOLA 3OY9A 2O4GA 4IDKA 3CQ8A 1U47A 1ZBHA 4J2BA 1WLJA 3DM2A 4OVLA 2YNIA 4DTUA 4KKOA 2KZZA 4IG3A 3L3VA 3L2QA 1ZBIA 1HRHA 3EZ5A 4CF2A 4C8NA 2XO7A 4DSFA 1XI1A 1QSLA 2KZMA 1GOAA 2RPIA 4BWJA 3QEPA 3RMBA 4L8RB 3HO1A 3QINA 3KJVA 3AVLA 3L2RA 3KTQA 3VQBA 3O3GA 3AVMA 4CF8A 3SPZA 4N56A 2VG6A 3U3YA 3KD5E 4FJJA 4NCGA 3SQ0A 3SUNA 3NGYA 3U6FA 1RTIA 4DLGA 4FK0A 4CK1A 3LP1A 3V1OA 4KB0A 3CG7A 1NK4A 1VSIA 4N47A 4CESA 4OPJA 2VWJA 2G8WA 4BDZA 1RDAA 4B08A 1C1BA 1NOYA 3AVGA 3QO9A 1LAVA 1FKPA 4CFBA 3K57A 4W5RA 4DTOA 3QEVA 4DQPA 2VWKA 1Q9XA 1S6PA
chains in the Genus database with same CATH superfamily
4RCHA 4L9TA 3K1PA 1WI9A 3EUAA 1TK8A 4U7BA 1BU6O 4CEZA 3AVBA 4B3RK 4EVIA 2OTJI 4FE4A 1K8KB 4WQ4A 3RYPA 3ZEUA 1TGOA 4OAZA 4Y15A 3E6BA 4CHZA 1Z7LA 4CUGA 1L3TA 1TWFJ 1ATRA 3HOTA 4M71A 2F5VA 2M7AA 4HHTA 4BRAA 3VEOA 1OKJA 2E6LA 5C24A 3OYIA 3AVKA 3TTDA 3HM8A 5FPDA 3KYDB 3F8MA 4BROA 3WHBA 3CDLA 4NXNK 2DO7A 5LBQA 3A8YA 1HC8A 3CCMI 2XSJC 1Z6RA 1RKTA 4H5VA 3D2FA 3C7JA 1IW7F 3F73A 1OH6A 3H5AA 5J1RA 1S72N 1SAXA 2JLEA 2OV7A 1IO2A 2OU2A 2IGOA 4CZIA 3A0IX 4PHTX 4NHJA 1STZA 1K61A 3BLYA 3H3NO 3TDZC 3J7AP 1TKZA 2LP0A 5ICEA 2YR2A 4DTMA 1QRYA 4BQLA 3U21A 1E3MA 1WH5A 4Y1CA 1ZLJA 4EP5A 3DF8A 1VQMN 3THYB 4NLCA 1HPZA 3DAWA 1B9DA 4EJOA 1D5AA 2E1MC 2O7OA 3THXA 1S1VA 2KHOA 3BF3A 4I01A 4PKHA 4CGDA 3ZMSA 1CXQA 1SKSA 3LANA 1IXRC 2XROA 1KU2A 2OD5A 4CERA 4FJ5A 4PSWA 3CCLI 5E26A 5BMZA 2O8FB 4BGDA 3S32A 4XM3A 1HYZA 2P5VA 3QODA 3G1OA 2P8TA 2QGUA 4J19A 1RDDA 4M73A 4HF1A 2ITGA 2NRVA 2QM3A 4E7LA 5L3CA 1MD0A 1D9DA 3SJJA 4BGAA 3OV8A 1DUXC 1T03A 3GTKJ 2VG5A 5EGOB 1ITGA 4M7XA 3NH1A 1GLLO 4XONA 3AVAA 4WCGA 1W36D 1CLQA 4BXFA 5DCMB 5AZJA 1RDBA 1HKTA 2VODA 4H0XB 3M1FA 1N25A 3VYUB 1VQNI 4ZYEA 4KICA 5CR4A 2EZHA 4M3GA 4KMUX 3QBWA 1AWCA 4CIEA 3HZ6A 3OYDA 1YFHA 3WXKA 2QQ8A 2HOTA 2K9LA 4OPHA 4DF8A 3MWTA 1NG9A 5J6XA 3VYSB 5KGWA 2Y69H 3JSPA 3KYCB 2YJEA 1U3EM 3ZCMA 3JRBA 3HUGB 2MSYA 5ED4A 5D3GA 3SYZA 3G71N 1OQYA 3F21A 3D5RC 3B6AA 2L7FP 3LAKA 2E1NA 2A41A 3TL4X 2EX3A 5ICFA 2Q1ZB 4DSKA 1FT9A 4B09A 4AIKA 4JD2B 3WTUC 4FHTA 4A3KJ 3FBNB 4U87A 2V1DA 2RQQA 4CO8A 3T1BA 4RW7A 3BR2A 4BYYA 5JLFA 3TQNA 1FZPB 5HLHA 3BPVA 5K1YA 1J7KA 4KYWA 4MQ3A 1X3ZB 2KDOA 3I58A 4MDBA 3CJCA 3GZ5A 4B1UB 2M1BA 3V1RA 1JGSA 2XKOA 3VGKA 4ZC3A 4MO5A 3HOUJ 2G8VA 3K4MA 3C1DA 1ZGJA 5B8HA 2XRNA 5J2NA 2O9LA 2HQ5A 2K5CA 3VEZA 2ELKA 4OJRA 4PUOA 3ZQCA 3LSHA 2ZGZA 3OL3A 3B8AX 2FMLA 4JKEA 2YNIA 3A03A 4PUSA 3HBTA 1G2HA 5H2FC 4CF8A 3DPLC 3H35A 3GG4A 3HRSA 4CK1A 4JKBA 2AQEA 3R61A 3CG7A 1C1BA 3RVCA 3QEVA 4JKDA 2E7WA 2COMA 2XGDA 2YUSA 1P4WA 5LD2C 1NGJA 1BG3A 4ZTFA 4PL7A 4PQUA 1T3VA 3D7EO 4AHCA 5CVUA 3VF6A 3LDSA 5AQYA 5M5XJ 4H03B 2FF4A 4EHUA 4O5VA 4ETSA 4CI6A 3ATUA 1X9WA 3GVAA 4B47A 4A5MA 2IP2A 5GTIC 2NZTA 3OYKA 3F8BA 3LZJA 5C44J 4L0YB 1WSHA 2RNJA 4BH9A 1X1DA 2OTJN 2RKHA 1T08B 2V6CA 4RW8A 4II3A 9ANTA 2YJFA 2BTFA 4DBRA 4RTFD 1HR0K 3KE2A 3CUQA 2NUBA 1Q1VA 1U2VA 3QMLA 3ATVA 2FNAA 3IV5A 3OYAA 2KL4A 1X1PA 5BS6A 3AFHA 3DKWA 1CF7B 1ZQ3P 4RA2A 5J8FA 1W7PB 1ZG1A 3ZYYX 3A5NC 3VQEA 2KKZA 3DLAA 3H9GA 2M8EA 4JI1K 1IGNA 1D5YA 3VQDA 1KU7A 2E19A 3RSNA 2QSHX 1RT7A 5CZ2A 3FK6A 4DR1K 1AKHB 3W2VA 3K2ZA 1D5VA 2D0OA 2MYSA 2Z1DA 3MZHA 2DPDA 4A93J 4AIDA 4A3IJ 2ZFWA 3T19A 1XN7A 4WWCA 3ASOH 2F9WA 3L2WA 1UA0A 3K6GA 5AZIB 4S04A 2VYPA 2LYCA 3NF9A 4FLTA 1W0UA 3N97A 4JI8K 2MGQA 2P9PB 4GKJK 2CGKA 3ISPA 3BR3A 3JRAA 2Y9YA 4HOBA 1P92A 1ATNA 4CEFA 2AQFA 3VPRA 4IDHA 3C6HA 4YOVA 3PQKA 2A42A 3BOQA 2M34A 4X0GA 2V1UA 2XIGA 4F91B 1N5YA 1ONVA 1K7AA 1ON2A 3ZLJA 2Q0UA 2VASA 3GX4X 5LL6Z 3S1RJ 2OF7A 5F27A 4DR2K 5HDNA 1MSFC 3BQZA 3IP4B 3E0JB 3HRMA 1E4FT 3MAJA 4GCVA 3KLIA 1YJNI 2V7ZA 4CJKA 1EETA 1AOYA 2B4JA 1OISA 3GFJA 2LD5A 4KI4A 5ILVA 4F92B 4RAZA 5IP6A 3QIOA 2CQQA 3K10A 1X4PA 1EF4A 4L3QA 2Q1NA 1VQNN 3EYZA 2KTQA 1U6ZA 2O8CB 3FXQA 4E19A 3S14J 2Q2EB 4A3GJ 1Y8QB 1U9OA 3MXJA 5BN9A 1NG6A 1XWLA 3L2CA 1S3JA 1JLCA 4OIPF 4H0VB 4M3TA 1F43A 1EXQA 2ASMA 1TVRA 2A5XA 3A02A 1G99A 4B1WB 2JA5J 4FQGA 3HSRA 2FMYA 4ILGB 1NMDA 1EH6A 1LFUP 2J4RA 1TLHB 5BPMA 3CO7C 3J7ZI 4FLXA 1YTUA 2RREA 2PLYA 1XMQK 1ETQA 3W2AA 5LY3A 3OIPA 1RCHA 4CEOA 3E1YA 4AVZA 1ZG3A 4DFJA 1F21A 3FIWA 2E1CA 3M1EA 4ENJA 4B3AA 5D5WB 1IKVA 1ZRCA 1MBGA 3S2DJ 3QNNA 2VE8A 4OX9K 2V9PA 1APLC 1LQ1A 4UY8I 2GZWA 4M3WA 1WHUA 3ULQB 4A2AA 2H09A 2ASOA 4JYAK 3BG3A 1S6LA 3K59A 5EOYA 3P9KA 5HLTA 3BG7A 4C8NA 2CUFA 2QWOA 4OMYA 3AVLA 4II2A 2TRTA 1Y0NA 3C3WA 3CC2N 3M6GA 2G8WA 4YDUC 3MWMA 3PJRA 2VC1A 1ZN2A 3BR1A 2YU9J 3IAM2 3BTJA 2P1JA 3NH0A 2XPVA 3EE8A 4NUBA 1QNTA 4D5CA 3A4CA 2FRHA 3O5BA 1R23A 4FW2A 2X6WA 3DKXA 4FLYA 2ZQBA 1BIBA 4P55A 1CGPA 4IRIA 1GXPA 1LDJA 2ZJPL 1FKOA 5TGTA 3DTKA 4CCHA 2HVRA 3OYEA 3QAHA 4BNCA 1JUPA 4CBUA 1V5GA 2FOKA 4AWXB 2CQNA 2CO5A 4ZYDA 1FOWA 3E1SA 2H94A 3CMAI 3MCPA 4WQ4C 3CJBA 1W1WE 3OS1A 2ZC2A 2I7NA 4IHYA 2E20A 2WAEA 3AGKA 2QKBA 3FXUA 4BQQA 3DQVC 4IOAL 1X1CA 3HPGA 2L02A 3DV8A 2VN2A 4I0AA 2PZSA 4BUPA 4RLQA 4DV5K 1DPUA 4JK1X 5JHUA 1X2MA 2XASA 4DV6K 3O8GA 4A2BA 2K7LA 3JREA 4M3DA 1P90A 4B9UA 1GOCA 3WXMB 2JA6J 1R5HA 4YHHK 1Q8IA 2STWA 3HTUA 2QQAA 2G8IA 5LGNA 3W3CA 1TT0A 2VQLA 4BQOA 1KVCA 2ZJPF 4OIOF 3PIOF 3SV4A 1R36A 3DLGA 5IT9Z 3J81Z 3VF2A 2IT0A 3HZJA 3EKUA 4C8KA 3CQYA 1WJEA 2MBFA 3AA2A 1JLQA 5E79C 5F1XA 3M9AA 4UHTA 3K2PA 3WNEA 3PX0A 4XQFA 4DTRA 4CICA 3HRGA 3SAFA 1V55H 3SJHA 4CFDA 2QKLB 4M63C 5D8KB 1VQ4I 1SZ2A 2YKNA 4AIHA 2M0MA 4JKAA 3DLEA 3O80A 4BR0A 4IOAF 4FASD 4A5NA 3PM1A 2FBVA 2Q0RA 3H0GJ 3ZQGA 3FZVA 2EIMH 1U49A 4AHUA 3CCUN 3PLAA 3TKYA 1TWCJ 2GELA 3KFWX 4JRPA 4MHGA 2DA6A 2CFXA 2WV0A 2D1KA 3WXIA 1U45A 1HCRA 3O9SA 4FLZA 4LLLA 5BPDA 2DPUA 3ALYA 2HZDA 5EG0B 2XGEA 1RT4A 4BQAA 1P9QC 5F0HA 1MJ9A 4A3JJ 4N76A 2LRDA 2GLOA 3EY1A 3LM2A 2A68F 3IWFA 3VB2A 4MQVA 4KTZA 3M8SA 1T39A 4LF5K 5HRSA 2L3DA 1LVKA 1DU6A 3KYLA 2AS5F 3OMYA 4RB2C 2LKPA 2IVMA 2HOSA 3F9KA 1FP1D 1Y6IA 4F2RA 4AM6A 4LB6B 3BT9A 3V42A 5JS1A 2VBXA 4F3QA 4J8FA 1BR2A 4I6MA 5EEHA 1J53A 3IH3A 1F36A 4OPKA 1VSJA 1I5ZA 2P9LB 4F52A 4GKKK 3W6VA 3OSGA 3LSTA 3ABUA 3BY5A 3O08A 3DYAA 1JXSA 2G0EA 4F8RA 2WY8Q 3G2BA 5KQ8A 3BCAA 3FWEA 1XDSA 1S29A 3DLHA 2P5KA 3E66A 1V4RA 1A5WA 1QHHD 5F6FA 5I9EB 4OKKA 1G3YA 4EJWA 2Z1HA 5D8LB 3GLLA 2CUZA 1R5GA 2NRZA 3OIQA 1TW3A 3Q7CA 2M3AA 2ZSHB 2CSOA 1YRNA 1SFEA 1UFMA 4C3IJ 3U3GA 2O8EA 2E2OA 1FMVA 5HNFA 5AQHA 3VGLA 3QWLA 2HHVA 4CD1A 1NJWA 3EUHA 4X1EA 1R5ID 1D1CA 4H0YB 3VODA 4DQSA 2JPCA 2E35A 4NCAA 4BAYA 3RPQA 4CGGA 3HSCA 1PP8F 3CCRN 3IRRA 4HX4A 4A6DA 2PY5A 4E1NA 4C3HJ 4UQGA 5HRNA 5EYRA 4NQWB 3RI4A 2EQRA 4XNFA 1J0RA 4ID5A 4CD3A 2L54A 1R9TJ 3Q7BA 1SFKA 3QEWA 4HYEA 5GP9A 4ASNA 1T56A 2DAOA 1UHWA 1ZBIA 5CVIA 4CF2A 1QSLA 1ETOA 3H5RA 1WPKA 2FLOA 2VJJA 3U3YA 2X51A 2VBYA 1VQ8I 1B72B 4O8KA 2PMZN 4UNOA 1S6PA 2JJ7A 4QCLA 2D5RA 5IOYA 1OMIA 3SQ1A 3C2HA 1YHQN 3M3ZA 1DT9A 3MD2A 1SV5A 1X3WB 1A31A 4FISA 4FWOA 2PMZA 4L9VA 5LLQA 3AA4A 2VIXA 3IC7A 3OYHA 4N4OB 3CCVI 1USSA 5AQZA 5HP1A 5AQRA 1V54H 3MDQA 1ZARA 2HNYA 1XB4A 1BO5O 4EJVA 4XOPA 2FU4A 3QPSA 1BL0A 1W5CC 4I9LA 3V4GA 2ESHA 3LQRA 1UHSA 1LE8B 4DV0K 3MEXA 2EFOA 1ZBUA 1S7OA 5B1BH 2X0LA 1KQ8A 3RQIA 5EJCA 1JXEA 1QSSA 4FK4A 2IW5A 1I1GA 3CMAN 1MBKA 2R5ZB 4IWVA 2FQ3A 3CCJI 3CJRB 1BCMA 4LOCA 4GO1A 3PX6A 3V1QA 2V9VA 4EM1A 3CUQC 1WQ2A 1KRPA 5T7BA 3FZFA 3SCXA 2ZNZA 3ULEA 2IS3A 5KPRA 1Y39A 3M4OJ 4PFPA 4PGHA 1IAWA 1FC3A 3AAFA 3SDGA 2DYSH 3B6CA 3SQ4A 3O1BA 4NB5A 5L3FA 3ZP5A 5KVRA 3HXLA 2ETJA 2QUFA 3OSFA 5CVVA 2YV0X 3RQ4A 1YT3A 3TAQA 4F4KA 1ZXOA 3KP5A 1NGCA 4KIBA 1MMNA 5AQKA 1Y0UA 2QEXI 4H4KC 1NU0A 5GINA 1LDKB 4FWNA 2OQGA 3TEDA 2NLXA 1TKDA 2WC9A 2YX4A 4JRQA 4AU7A 2ZJRF 1I50J 1F9NA 1LKXA 4IVNA 2OPRA 1KCFA 3MMYB 3ZSXA 4CJ3A 1D8YA 4XOTA 1NGFA 2HBKA 2IBDA 4KHWA 4IFYA 4CYCB 3VEPA 2QI2A 1RT2A 4Q0BA 2LY9A 2GQQA 1JKPC 3QDKA 2HHQA 4CBXA 4FLUA 1LFPA 3DLRA 3Q3SA 1PDNC 2DOEA 4HX8A 1SVOA 4CJRA 3WQUA 1CZ9A 4Z4EA 4M41A 1I6XA 3WE3A 2HVQA 3TSPA 2A3SA 1I3QJ 3FK7A 1R22A 4ITVA 5AQGA 4IF4A 5AQNA 4BG8A 3BZCA 1MNDA 4DQRA 2F8SA 4LK0F 2XY6A 2QENA 4DTSA 4BEHB 2EK5A 4S05A 1T8IA 3CF5F 2IVNA 3TAEA 3R8EA 4PWDA 2EILH 3L09A 1LWEA 4CZMA 3THVA 1Z3YA 4L0ZB 4AM3A 2LF7A 5AONA 3I0RA 4H4MA 5ICGA 1DLOA 3BJ6A 4XLNF 2W48A 3F23A 3WE2A 3ABTA 2VB6A 1N6QA 5BRDA 4BACA 2H27A 4E1MA 4ZYHA 4XSZF 1B8IB 2R7XA 4M9SA 4DS5A 3L9FA 5H6RA 4FJ7A 2RN2A 1SKRA 1XG1A 1KGSA 1WVRA 1S3XA 4FPAA 1O3TA 3VYRB 2KIUA 4OU0A 4GVEA 4D5FA 4JI5K 4JI0K 1K8KA 1KZHA 3HHHA 4I7FA 1W7AA 3O9TA 1GV5A 2LY1A 1VFCA 3J7YJ 3CERA 3CI5A 3CJ1A 4FW1A 1KFSA 3E01A 4JQFA 2WBNA 3PL8A 3CQ8A 2HXOA 1E2XA 2B63J 5GIOA 2E88A 3D2EB 1VNDA 4MLHA 2HPIA 3K0SA 2G9WA 3WGGA 5H6QA 1LOTB 1GOAA 4L8RB 2RAEA 1R4NB 3S2WA 2DT7B 2TDXA 1HOMA 1XGMA 4WF9L 4KJZA 4CESA 1P8ZA 2P6SA 5D6EA 1R6RA 4IO8A 4NC8A 2C6YA 3EO3A 4RAFA 3KP2A 2M8GX 4FVMA 3LP2A 1D4XA 2R7OA 5LMNK 3IL2A 4PL8A 5ILSA 1NGBA 3I4PA 3BC8A 3AY9A 3THYA 1X1AA 3OVNA 1DGWY 4KT6A 5AQSA 3TARA 4CEDA 2M9HA 3MEDA 4M6YA 3GDQA 1ZBSA 1ZK8A 2M4KA 1BA1A 3ZQQA 1D1AA 3PO2J 4QS8A 3V9SA 1MIJA 2O8FA 4CF0A 1WSIA 2OANA 4B9MA 1VQLI 4EMSA 1FMWA 1KSPA 3DEEA 4J01A 2MH9A 1HYSA 1XMKA 3G3ZA 4E7HA 4O0JA 1UG0A 4FZYA 3S9HA 1C0GA 3WU0A 4FM0A 5I42A 4IHSA 5EGOA 3CFPA 1YE9A 4FX0A 2DK8A 3TANA 4LC9B 2NNYA 5GPCA 3BR0A 1TL8A 1Y97A 4QIWN 4IBNA 5C10A 2NNWA 1MMAA 3OBWA 2JZYA 5DCMA 1BW5A 1WAFA 3QOPA 1JL2A 3L00A 1S9EA 3J7YP 3QU6A 3SI6A 3IH4A 1U78A 1FNNA 4BG9A 3BDDA 1CQTA 1LB2A 4C23A 1FWZA 3E3VA 1P2FA 2ISZA 4F93B 4CJ7A 1WJ5A 3VQ6A 2JSPA 1GUUA 5M1QA 2HKXA 3KZIC 3ZX0A 3OOPA 1T6SA 2LSOA 1SFXA 1I6HJ 3CCEI 3SQ2A 4BY7J 4ANJA 4AHTA 3HUGA 3TO7A 3EETA 2VKEA 3D0PA 4R5PA 2HZTA 1DTTA 2P9KA 2LLKA 4GYIA 3LAMA 1JKHA 4RW6A 1HNWK 2QEXN 4YELA 4IO9L 1KFDA 4KISA 3H0DA 3MMVA 1Q81O 3GEZA 3SUOA 4C2TA 1O1WA 4YG2F 1BN5A 2MFZA 4JD2A 2KRFA 1U0JA 2QWMA 3AGRA 3I3LA 4OLAA 5HS9A 3OL4A 3WTZA 2Q2RA 1SL0A 4CW7B 2JPBA 4BS9A 1WJAA 1OYWA 3QOEA 1OYYA 3JRHA 4HV6A 3OJSA 4FT8A 3HK2A 3K4NA 4LF4K 1A36A 1VSLA 1NGEA 3RMDA 4KIFA 2ZWHA 3F8FA 3MXIA 2X6OA 4Z4HA 2OTLI 1MSEC 4XLPF 2WTEA 1YX5A 3KP3A 2ZXWH 2E4LA 3KPHA 3K1NA 3DWLE 3EDPA 1FIAA 3OYGA 3I33A 5DM7F 4IHTA 2OA4A 1YAGA 3OYFA 1NK9A 3E9OA 1NJIO 2R7DA 4I76A 4FK2A 2R7FA 2YHWA 3PQJA 4BY1J 1SD5A 3JXUA 2P4WA 4IEJA 2P0WA 2NXNB 3MZ8A 4M72A 4I09A 2DA3A 3TWHA 1RESA 3RPUD 1X19A 2ELJA 1YOVB 1QZZA 3FXJA 1T8EA 5F1JA 4RAYA 3QBXA 3ZQHA 4JHDB 4WXDA 1NOZA 3UKRB 5BRFA 3HSTB 2ICWG 2NRTA 2EA4A 2XB5A 2YCHA 2ZJQL 2VKVA 5EX5A 3VFZA 1JGGA 3WODF 1MMDA 1R59O 3KK3A 3VQ7A 5CYQA 3S1MJ 2HDWA 4K41A 1IKXA 4KO0A 3DRPA 2E5NA 4BRMA 4Y0WA 3FISA 3K4LA 2QTDA 5MLCQ 3JRDA 2W24A 1TYQB 3VGMA 5FPNA 5AQOA 2CGPA 4C8MA 2TCTA 2IVOA 4ISGA 2PYJA 3LL3A 3EUHC 2LNBA 5DUIA 3I9V2 1XQSC 4N9HA 5D4SA 1G6NA 4L5EA 2XAGA 3EZ5A 2WTUA 1OLTA 3SEQA 1XI1A 2RPIA 5AQXA 1MH4A 3KD5E 3U6FA 2JN6A 2VWJA 3BY6A 4C2UA 3K57A 1CF7A 2BHZA 1WJBA 4DR7K 1ZR2A 3T1YK 2GTDA 4EEFG 5E1WA 4DU4A 1YXQA 4LMYA 3THWB 1W9HA 3HVTA 2R93J 5CYVA 4LSNA 3SAGA 2RF2A 4ABZA 4DYCA 3NF7A 2K3FA 1K78B 5C15A 3T8TA 1XGSA 1FTZA 3RRGA 2BGCA 1AKHA 3DEWA 4XN3A 4DFPA 1MW7A 3L0QA 3FF5A 3O8MA 4JK9A 3VF4A 3KX2A 3TP0A 5AZIA 5D6FA 1VSMA 1QVUA 2JMWA 2QSFX 5JLHA 4ZHRA 5AQPA 3T0YA 2VQFK 2P9PA 2K9SA 4CGIA 1KAYA 3G10A 4U7DA 2L7KA 4I2QA 2DA2A 2V1NA 1VQON 5IYBJ 3SEZA 3ZOBA 5C3EJ 4KTWA 1XMXA 4L9NA 2UUZA 5FPMA 4KI6A 3T3FA 3JRIA 4M3FA 4J00A 2CS3A 5M1OA 4EZ9A 4JKGB 3IUCA 4HZFA 2GXGA 1OH7A 4NLBA 2CW8A 3BG5A 3PO4A 4FTHA 4WXCA 4W5NA 5GIPA 4GFBA 2DMTA 2LMDA 4BR2A 2ZSIB 3V9WA 3G6EN 5LEJA 1ETKA 3C6AA 4TV7A 2KKOA 3QPLA 3V6DA 1UA1A 3S93A 4OGEA 3HSFA 4ENNA 2CGLA 3LSRA 1YLFA 2M5WA 3UR3C 4B1YB 4CJPA 4W1UA 4QPOA 1PYVA 3VEXA 1LW2A 4B44A 1C1AA 2DLLA 3R0AA 4IFEA 2X85A 3LOCA 2F96A 3ZT1A 3KLEA 2ZXIA 2NVUB 5KAFC 3E6CC 4BR4A 4MFBA 4LF9K 2MC3A 1UG2A 1IN7A 3K70C 2CW0F 1NGAA 4OGCA 2CGJA 3VESA 2EV6A 4BHPA 1HKGA 2O8CA 3E6MA 2LK2A 3QRFF 2Q2EA 1RBRA 1WSEA 4U0WA 1RI7A 5KPTA 4XRMA 4HWIA 2ECBA 4QTRA 4XLHA 1BQNA 4YFUA 4Q5SF 4PA1A 3V81A 2QXFA 4CF1A 2YKMA 2O61A 1TQMA 2HYGD 1VSHA 3W6JB 1OCCH 5AQFA 2KZVA 4CEAA 4KH4A 4EM0B 4UUVA 4DZPA 2CWEA 2L9SA 1BCOA 3W3DA 5CY4A 3GFMA 1BWFO 2BVLA 1HNIA 1MWMA 3C7NA 3QP6A 2F5DA 4G8XA 2FBXA 3QPTA 1FIPA 1S22A 2CG4A 1MJAA 5AQJA 4L5IA 4RBOA 2ID6A 4AUXA 3L2UA 3U9ZA 4IQJA 2QWPA 4E7KA 3RR8A 1FJGK 1Z05A 4A5AA 4YFNF 1LWFA 3D5LA 4E6KG 4XIUA 3O3HA 3KD1E 5ADXH 1OVQA 2O8EB 1QZ5A 2PBDA 2E2QA 4OIQF 3QU3A 2G8KA 2OTLN 2EPFA 4LH5A 1S9HA 1P6RA 2XHBA 2NS8A 4GY2B 3RRHA 4QPQA 4A3BJ 2M30A 3A0BC 4FJ8A 2R3SA 3AKZA 3GTOJ 3ZMDA 3NEUA 1XC9A 1U5TB 3X2QH 2O8BB 1HQUA 1ZG5A 3VSKA 2VJ5A 3ASNH 3ZN1A 1GLDG 3I56N 1X9MA 1HJRA 2FSNA 2K3PA 5CQEA 4FJLA 2CH0A 4BJTA 1FBSA 1SL2A 5CKTA 1SS6A 4PY5A 2BOLA 4E0DA 3RDIA 4FZZA 2ZXJA 3CCQI 5BPIA 4M45A 5M1KA 2D4WA 3ELKA 3H08A 4KHQA 4B1XB 3CO6C 3KLGA 1T6DA 2D0AA 2BW3B 3DRSA 3LPTA 4ZZLA 3VMFB 1JT6A 3KEYA 3Q0WA 2KZZA 4IG3A 1MBHA 1HRHA 4KMFA 2IPQX 1P4AA 1VQ7N 4H0TB 2B9SA 1X1BA 3SPZA 1M90O 4NCGA 3SQ0A 3K7AJ 1KQSM 4A3EJ 4E7ZA 4N47A 2R7UA 4LITA 2V6EA 1S8NA 2M87A 2HQRA 4AF1A 4JK8A 1JCGA 2R7QA 1XD7A 2Q0OA 4X66K 5AQQA 4BC4A 3NVMA 2IAIA 1W5SA 1H8AC 4HUGA 3C65A 5HS8A 2P9IB 4L18B 1QO0D 4YIRX 4E1JA 3ZT3A 1DQUA 5A2QK 3IKVA 3NGZA 2BANA 2XPUA 2BVMA 1I94K 1IG7A 1QZYA 4IPAA 1T2KA 2JTVA 1E3PA 1R00A 4O5FA 3H45C 4RW4A 1A04A 2E8AA 3WG9A 5TKWA 3JSOA 2DA4A 3BTLA 1B9NA 2LDUA 3Q9SA 1RTHA 2GM4A 2EFQA 3QEIA 2CUJA 1I39A 4F55A 2F7TA 3OBYA 3ZN0A 4DTXA 3K5NA 2HQAA 3O4QA 5ERIA 2IS1A 2UU9K 3QYFA 1MMGA 4HPQA 5KPZA 3FKJA 3HL8A 1BOAA 2DMPA 5K5RA 3FXKA 4LF8K 4M3ZA 3A5OC 2WAFA 3KK7A 3UKUB 3HRTA 4AC0A 2EV0A 2ETHA 5J8CA 3WNFA 2XY8A 3J8AA 5BN8A 4M42A 1EWQA 3WT0A 5EG0A 1ZTRA 1EP4A 4MO7A 1ETWA 3FZMA 4K42A 2H3GX 2F4IA 2FOWA 3P9IA 2VOOA 2PI0A 4BJ6C 1Y1VJ 4RG8A 2NYXA 2GX9A 2I5UA 4DYQA 1N8RO 2JRMA 3IS9A 2XGCA 4C1NI 2E71A 3J80K 1GLFO 4BE2A 3F8CA 3A1YA 4YRVA 5FFZA 1RC9A 2R0QC 3PNVA 3C94A 3IDHA 4GV6A 5K14A 1BIUA 2P9LA 4RMNA 4EJTA 5M1PA 4PJNA 1YITN 3BZKA 3WG7H 3NFAA 4B8CA 4IHVA 2FBHA 1DTQA 5EXWA 3S3OA 3HYIA 5DYMA 1U2WA 5LJWA 3KETA 1SANA 5AQTA 2NRRA 4DZJA 2XAHA 2YNHA 3VEWA 1S5LC 3I59A 3P38A 2KJCA 4A0XA 3KEQA 2RNGA 2XY5A 2CV2A 3FZLA 1IXSB 2IS4A 3HOVJ 1OKRA 2W40A 3BTIA 1OH8A 2XB0X 3NCIA 4KAZA 4FJHA 1QU3A 5ILUA 2Q31A 3RMAA 3WQTA 4B1VA 2QKMB 3ZX2A 3EKSA 1U48A 1HNZK 3CJAA 3L4IA 2IDOA 2VPRA 1J54A 4NQWA 1QVTA 1VQ9I 1U04A 1HQCA 4GGGA 1GVJA 4HNTA 2QYOA 1J5YA 4D0PA 3VOEA 4DTPA 2A1SA 4IQ4A 5CQGA 4BR9A 4XIDA 3K2AA 2HB5A 5M5YJ 4H5TA 1JE8A 1TUUA 4G9YA 1B72A 2Q3SA 2E34A 1TAQA 4C30A 3JTGA 1YUWA 3DXJF 4P9UA 2L7MP 2P5OA 3NF8A 5HROA 2H1KA 3BDPA 3M8JA 2VBWA 1VSDA 1ORKA 2O8XA 5FGMA 1RZ4A 4IJNA 4CHQA 2VLAA 1X3UA 4D7NA 1B1BA 1X2NA 5TKYA 5JICA 4BGBA 2CV0A 1K6OA 3HBLA 3VSLA 1NK5A 3OS2A 5IP7J 2L9RA 3LALA 2IS2A 1D0XA 3COAC 4NC6A 4XRFA 3NGIA 4AVPA 1ZBLA 5ICCA 4ENKA 1H9TA 3AL0B 1KXPA 5GAHJ 3K1MA 1IJJA 4MEYF 3DOLA 4BRFA 2GWRA 3CCQN 3RTRA 3L2QA 3RKWA 2JVHA 4UXNA 2ZKZA 3GTLJ 3KTQA 1LE8A 3O3GA 4P96A 2QLZA 1JHFA 3K4KA 5HVQC 2DT5A 5FO5A 3QO9A 4DTOA 4OIRF 4K2EA 1O4XA 3CC4I 1ASUA 1KLMA 2R5ZA 3DU6A 3VTHA 4CEQA 2V7YA 2NAZA 4M3RA 3I53A 2OZMA 3GBTA 3HI0A 2HHUA 2J5PA 2Y48A 2FD5A 3KK2A 1WGXA 1AU7A 2KIMA 4CZJA 3SAHA 3M8PA 2LBFB 3PUFA 1B92A 2OUMA 4NYFA 4BE1A 4ELUA 5E20A 5BOXA 4FWQA 3AVJA 2RVCA 2V9KA 2OC6A 4IEIA 4A3CJ 1QSYA 4MFEA 5HRPA 1Z25A 3H36A 3HTSB 4C8LA 3FM3A 4FJMA 1NLVA 2Z1JA 3PO5A 1W97L 2E2HJ 2DBBA 3FMSA 5IPAA 2QCOA 1NGIA 5LEKA 2KHMA 2WC2A 1XNQK 3WXJA 4E7SA 3BQYA 3LDLA 2CH5A 1W36C 3K9JA 4DTNA 1OCOH 3QB0A 2DA7A 4YOYA 2XAQA 5D5VB 3DBHB 4EQQA 3SZPA 4G6DA 5JVGF 4D1QA 4N5SA 4Y13A 2W00A 1Q82O 4JYKA 3EEQA 3PIPF 2FEZA 4Q5VA 4CYCA 3FFIA 3TR8A 5EZGA 4YIIA 1JI8A 1FOYA 3J7AO 3K69A 3C6TA 4A0ZA 3C18A 3HDDA 1HPMA 1XCBA 2FBKA 2EJRA 5BR9A 1WNSA 2CQ7A 4RB1A 3UE5A 2QKKA 4Z4FA 5AIQA 1XMAA 1NWKA 4DOZA 5GAHP 2P9KB 5HDKA 1BJZA 2XVCA 1M1EB 3CZ6A 3SDBA 3LA2A 4BDYA 1T0FA 1IKYA 1FW6A 2R4GA 5KAIC 2EBIA 1FXXA 4NO7A 5LRSA 4BEHA 3CM6A 4B8XA 1MBFA 1HSJA 2IEKA 3F5TA 2JA7J 1C6VA 2LY2A 3KP6A 2NRHA 3H92A 2NVQJ 2EWSA 3QICA 2BGGA 1LAWA 1H1VA 4H0OA 2NRXA 4B3TK 5IT3A 3KWGA 3RTVA 2BV6A 3ERED 2UXNA 1KTQA 3V9XA 4N4NB 4EIAA 2FQ4A 4A69C 4DWIA 4I7HA 2JWTA 1BQMA 3M8RA 4ZJZA 3OOUA 4JX4A 5A2QZ 3HOZJ 4FLWA 1E3HA 2O3FA 5AFUH 2R7TA 4UUSB 4U0YA 4OINF 1BI4B 1B8IA 1JJ8C 1BHLA 3U8XA 4NXMK 1JL1A 4ZYAA 3ROUA 1NM1A 1GLJO 2K4BA 3K9KA 2D5VA 2GV9A 2PG4A 4Y33A 4DFMA 5IT9K 3J81K 3CC2I 1VRTA 4CJUA 2B6AA 1LDDA 1B9MA 2Q36A 2IGMA 2RKIA 4O0IA 3K5MA 2JRTA 5JMVA 1S6QA 5BNGA 2OZSA 3VEVA 3TAFA 4LFBK 4QWQA 1E17A 3ZT4A 3P83D 3AVNA 4C8OA 2EHGA 4CJ5A 4NB4A 3KCCA 3HM9A 4XBFA 1F1ZA 1J2XA 2A05A 1C0MA 3D2EA 2VQGA 2F2EA 4PK4A 3VQ4A 4B9TA 2PAVA 5AFUA 1GLAG 3HEFA 3JAMO 1VQ9N 4KNYA 2DK5A 1RFQA 2BDPA 4CZCA 1HDPA 2UV1A 4N41A 1WKMA 3ZT0A 4FJKA 4EJUA 1W5TA 3J80Z 2VKDA 2Y1IA 2UXXA 2X6SA 4BRCA 2RDPA 3BWGA 3B73A 5IY5H 3LP0A 3G73A 4OKEA 4HQEA 1HLVA 1IRXA 4BBRJ 5J2MA 4H4OA 4FJGA 3WU1B 2KMUA 3NVKA 1HA8A 4M7YA 2R5YB 2Z9OA 1QS4A 5FD6A 3AVFA 3HL2A 5SWMA 4ON0A 3ENHA 4YOUA 2ZF5O 2MG4A 3FFKB 1BR1A 4FWSA 3CDIA 3SV3A 5IYDJ 1QZEA 2X74A 2DCEA 2QXLA 2PFBA 4LIUA 4HTLA 4HF0A 3OY9A 2O4GA 1K9MO 4WFNL 2XRLA 2XAFA 4FWRA 2HFHA 4L5JA 2XSDC 3RZOJ 4YY3K 4CDGA 5J1YA 4LG3A 2UXDK 4GV3A 5F1RA 4FK0A 3IWZA 3TMOA 5J4YA 1BI0A 5CLSA 1UMQA 2YU3A 4BDZA 3HM5A 4B08A 1N36K 2DJIA 3ZMVA 3N4PA 2GBYA 1LEBA 5FDLA 4B9LA 5JFRA 2FC0A 1BBYA 1TC3C 5FPEA 2PQ8A 3LWFA 2A6EF 3UB5A 2JT1A 4FWLA 3CCUI 2DXIA 1D9FA 4DYRA 1QHAA 4WYBA 3EPZA 3V8KA 4AHRA 5E3NA 4E3SA 3CC4N 3BG6A 2F5EA 1RT1A 4K43A 4ISFA 2E1YA 4DU1A 2W84A 4PCQA 4HSRA 1RT3A 4K25A 3JRGA 1PVEA 5EVZA 3KLFA 1TWGJ 1GOBA 3AO2A 1Z6TA 5EZHA 2QZ8A 2DN0A 4ELTA 2ZM6K 4BXXJ 2DTZA 2CJJA 3SMSA 3T8RA 4Z2YA 1XSDA 1NJXA 2QBYB 5HRRA 2CQXA 3TGNA 3AV9A 5KRTA 1S9GA 4G7OF 3LFKA 4AYBN 4MLOA 1RNHA 4YFKF 5HBMA 5IP9J 4X64K 3MKZA 1JXBA 1MKMA 2XHKA 3S3NA 3HOXJ 3DLLL 4IZ9A 4HW0A 1EO1A 3HOYJ 3KLNA 3CIPA 2E2NA 1ILYA 4DV1K 4AYBA 2HBJA 2UWMA 2QSGX 3RJPA 5LHGA 3OYCA 2OZ6A 1NTCA 3I8BA 1SFOJ 3KWIA 2P81A 2HMPA 2G8HA 4XH5A 4H0EA 2N8GA 2M7BA 2Z1GA 1N78A 4F3TA 4BVOA 2EZIA 5JVTA 2RHKA 4CECA 1X4OA 1J59A 2L0KA 1BOTO 2BE5F 1CZAN 3GZ6A 3IKTA 3SHFA 3AG3H 3EQLF 1VI0A 1A35A 4KHYA 4RM3A 3CCRI 2LF8A 2VQHA 3SK3A 3ZQFA 2HW3A 1V5EA 5DDGA 4GNIA 3LQQA 3OHRA 2CMPA 3M8QA 5B3SH 3HKZN 3DLLF 1NK7A 1O7FA 3C7NB 3CP2A 4YFXF 2FA5A 3DLBA 2XC7A 3NAUA 5H20A 1RDWX 5BRHA 3OA9A 2ZMEB 2X6NA 1FOXA 1VQKN 1A5VA 1L3UA 2KJBA 2HOEA 4RWTA 3K58A 4O44A 3SBGA 2JSCA 4JHDA 2STTA 2E6MA 3HKZA 4Z94A 3UKRA 4KHSA 2HKOA 2KW4A 1HMVA 5E41A 4CGJA 2VXDA 2H6BA 3I71A 2HVSA 1TAUA 3FXOA 5BPNA 4FOEA 1X58A 4C3JJ 3CFRA 3NBPA 2BY2A 1L3VA 2ZXHA 2JA8J 2HVIA 2I7PA 4LSLA 1BISA 3W0LA 1XC5A 1ETVA 4CEBA 2O8DB 1YHQI 3HT3A 4WQ5A 2WAQN 1TYQA 3AO4A 4YNQA 4Z4GA 4BRIA 2EFPA 1R0AA 4RGUA 1J9IA 2H6CA 2QQ9A 1Z1DA 5F0CA 1UELB 1NK6A 3CP8A 2DQRA 3QETA 4FXDA 4HNUA 2NRAC 1RGIA 2V4JC 4LLNA 1WBDA 2DMNA 2V51B 2EINH 2WAQA 4Y1DA 5EF6A 2MH2A 4PJ0C 2P9NA 4BJ5C 3PIOL 1VZ0A 5E3MA 2PMUA 4A0YA 1MNMC 2DFIA 3AO5A 4IHXA 4G6QA 1LPQA 4DIQA 4R1HA 3THWA 3TTCA 4BU2A 1I27A 5EDNA 2OQRA 4KRFA 1K78A 2EWNA 3SFIA 3HP9A 4FX4A 4LF6K 4G9ZA 1KA8A 5BPLA 5JI6A 2HDCA 2NS7A 2JA2A 2L9VA 2RV8A 1HW1A 3PFIA 4RB0A 5C2DA 1YW7A 1WLJA 2OPTA 2E1OA 3H3VK 3GOIA 4ZDOA 3JTHA 2PX9A 5D4RA 5AJ3K 3F72A 2VG6A 1R7JA 4MGRA 4FO0A 4DUZK 3AG4H 4BHCA 3NGYA 1NK4A 2IVPA 3JAMZ 5FLXO 4IXAA 5EEAA 3CD6I 4W5RA 1XC3A 1J09A 3A0HC 1QQNA 3OYLA 1WH7A 1BW6A 4IL6C 4JKGA 3VA0A 2LVSA 3C2GA 1LFBA 2HTJA 1POGA 3ULDA 1R4MB 3ZSZA 2QQBA 2ZFUA 3ERMA 2EA2A 3BR5A 4LFUA 4DR5K 3TPQA 1SAZA 3AVIA 4BRGA 2CFOA 2WOMA 3MKLA 3ZCOA 2GOXB 4BXUA 4CJ4A 1LCUA 2Z99A 2AA4A 3V7SA 3CETA 3MKYB 1PJRA 2VBZA 1C0WA 2BE2A 4CXFA 2OPSA 2MA3A 1YS6A 5DM6F 4DHYA 3DXMB 1GXQA 2UUAK 1K4SA 3TSQA 4R8HA 2B0LA 4BDPA 3JRCA 1WJFA 2AP1A 4WX9A 1EKEA 2EB7A 1RTDA 1ZC6A 3AG2H 1JLAA 1R49A 2X6YA 4RW9A 1KQ0A 5CHIA 4NNJA 1FYKA 2RQPA 1GLBG 4YOXA 3TW6A 2BEOA 3BPXA 2WWYA 3WU2C 4FWMA 3NMUA 3CMEI 3S8PA 2F8TA 5J1EA 3OYJA 4RDUA 2NOJB 2A69F 4KN4X 2X48A 2KDZA 2L9NA 1IH7A 2K85A 4OLBA 1KLNA 4H5RA 1B4AA 3U4LA 3ZQIA 3VQ5A 3ZR8X 4BRDA 2XKPA 3AAPA 4ICLA 2E36A 3LSIA 1UJ8A 1L3LA 1SKWA 3RPUA 2HS5A 1OCPA 3ASMA 3RKQA 1Z9CA 4I9QA 2FNPA 3F0CA 1W0TA 1DKGD 3B6OA 5B66C 1NH3A 1KAXA 1O57A 1PUEE 5JR3A 3TSUA 4AH9A 1YVUA 2YHYA 2Q97A 5GPAA 3PY8A 4OO1J 1FSEA 5EEGA 4DQQA 2G7HA 4ZTJA 3I59B 1U9NA 3R6SA 3VPZA 4BC5A 1T95A 1QA6A 4QS9A 2R7ZJ 4PJMA 1JLGA 4CYDA 5LMUK 1H88C 1TK0A 1LWCA 2KQRA 2BH1A 1T0FC 1ETYA 2NRWA 4DV3K 4RM2A 3KLOA 2HPMA 2VE9A 4MTEA 3S3MA 3HTVA 1U5TA 2O8BA 1R1VA 2FJ1A 1WI3A 1NKCA 1BGXT 1BI3A 1MDUB 3MX2A 4A62A 3S17J 4U88A 4V2GA 1FTTA 3HB9A 1XS9A 2HMIA 2IAJA 3GF2A 1TNSA 1S1WA 3VN5A 4FOIA 4KTQA 2WFBA 3REOA 4AHSA 2E60A 4J2AA 2XAUA 4BL0B 1GLCG 5AQWA 2L5QA 4FM1A 3H1QA 5AIPA 3WTSC 4JKCA 5B1AH 5C4JJ 2W82A 1XHZA 3NAEA 2XV4S 1HSTA 5KTQA 4QAGA 1WOQA 3PV8A 1HBXG 2BW3A 3RKYA 2YHXA 3S1NJ 2GBZA 1GDTA 2Y0SN 3VQ8A 4JEPA 4CHYA 5M5WJ 4K0KK 4ESBA 2BXYA 4A6EA 2KLAA 3P31A 2W6KA 3OJUA 3LMMA 3B02A 4IEEA 4CHNA 2ATQA 1W7PD 1IDZA 1RR8C 2W42A 1IXCA 1XTAA 1HW2A 1FX7A 1Z3XA 4KFCA 3NH2A 1R1UA 2RGVA 2Y0SA 3I55N 1I3AA 5HL7L 1IRZA 3TAGA 1WSGA 3G0ZA 4UB6C 5IWAK 2D0BA 5AR0A 4FZXC 3FHZA 4CZKA 3ID6A 1D8JA 2P9IA 2VT2A 1JLFA 2HBMA 3CPEA 5KCMA 3VQQA 2VGNA 2LSNA 1Y1WJ 3M07A 5F2RA 3PFYA 5DUKA 5CVJA 1TL3A 3DJCA 1QPIA 3OR2C 3MVPA 1OPCA 1S1UA 2PYLA 4CJSA 4I0BA 1K8AO 2VOPA 3HJEA 3H3ZA 1NG7A 3DM2A 4EV0A 2ZJRL 3SJMA 4DTUA 2A5YB 2JQ7A 3L3VA 4DSFA 3BF1A 3AVMA 5E8IA 1MDMB 3SZTA 3OWTA 5J40A 4I99C 2IS6A 3BTCA 1FPQA 2FSWA 1MJBA 1LAVA 4CFBA 1U8RA 5J1UA 1ZLKA 4HDVA 4JI3K 4I2OA 3UKUA 3MK6A 3ISNC 4XKBA 5FROA 3HSEA 3FDYA 5FKLA 4D9JA 3FLCO 2E7XA 3CD6N 3L1PA 2Y31A 3N05A 2PJRB 3TI0A 1ITYA 1RT5A 3MEEA 5E3OA 3O3FA 3CF5L 3HXMA 2MLKA 4FM2A 1XX5A 3DXKB 2JUGA 4KUMA 3L7WA 3BEXA 4B1ZA 3TAPA 2COBA 3AO3A 4YORA 3GCMA 2F4MB 4HVJA 1WZ2A 3MCZA 1BI1A 5JS2A 3P7NA 1K6YA 3VQ9A 4CCKA 1HUXA 3QEXA 1OYIA 2EFNA 3S1QJ 5K7FA 1W2BM 4WK8F 2ZO4A 4G94A 1S7AA 1UOCA 3I8DA 3MN7A 5FLXZ 2ASPA 1JCFA 2H8RA 4OKJA 4NC7A 5CVRA 1JKRC 4XLCA 4XR6A 4JOMA 1NNEA 4Y4RA 1TL1A 2W4SA 5E8GA 2WUSA 4CK2A 1HLUA 4CJFA 2VJ4A 3CM5A 1FBUA 2D0PA 2MABA 5K7HA 4N9IA 1OH5A 2GEMA 3TW7A 3CMEN 1ENHA 2BUPA 3MKWB 3VERA 4CBWA 3DOKA 3OS0A 3VTIA 1SMYF 1IRFA 2IA2A 1WRJA 3ZQ7A 5IT9O 3J81O 3QYEA 1C0TA 4BC2A 2P9UB 1V3FA 4GVMA 1T98A 3O6WA 4V19K 2E1MB 4CVNE 3SQNA 4P5OA 4A3DJ 2YNGA 2O6GE 1EQYA 4XLAA 3N4QA 3LSMA 4I2PA 5K7ZA 3WNHA 3ZPLA 2DU9A 4JS4A 1KYWA 3C0BA 2FBYA 4W5QA 4CJEA 2EV5A 2JWKA 4KH5A 3GFLA 3KZZA 4HG2A 1F4KA 3U2RA 3LAPA 3HIFA 3LA3A 1ZBFA 1FYMA 4QSHA 3CCMN 1BC8C 4AQYK 2XUBA 1S1XA 4L9JA 3LWLA 1WN7A 2O03A 4FPBA 4CJWA 3ZT2A 2X9DA 5LJVA 3BJAA 3JYTA 2VC0A 3GTQJ 2D1HA 3BUZB 1WBBA 2HGCA 4NYNA 2GA1A 4IG0A 1USTA 2UZKA 4CZLA 4KREA 4LFAK 1TT5B 4F2SA 4CZFA 1P7JA 4BC3A 2V52B 3VENA 4EATA 1V5FA 3D6RA 1UAXA 6PAXA 3SNNA 1P4XA 4HNVA 1HKSA 2HHXA 2DODA 5GAEJ 4CCMA 1HKCA 1HNXK 3UNGC 1EV7A 4MIMA 3ENBA 3VQCA 4H8KA 4CA0A 3SFZA 4EGYA 1ZR4A 4G6TB 1YF5L 2PMHA 4GYGA 3I54A 1REPC 3OW2M 1RTJA 3DTEA 2E2PA 3MZYA 3GO5A 1MGTA 3KP4A 3CCLN 2O8KA 3CCSI 1TWAJ 1M1KO 2M45A 3V9UA 4WQ5C 4BR7A 5FKMA 1RUOA 3ZSVA 4A3MJ 1JTYA 4C2MJ 1VQOI 3GTJJ 5HNHA 1J5EK 4XK4A 4LY7A 4JBAA 3LA7A 2OBPA 1ETXA 1O13A 3WEEB 2Y30A 3GL1A 3ECOA 4NBQA 1A5XA 1IN6A 2O0YA 5F0FA 2KLOA 4B8AB 1P7IA 1HNVA 2P51A 1YYVA 4CSWA 3TABA 3DPUA 1Z21A 4FSVA 5HS7A 2NVYJ 4EZ6A 4WE1A 2LBFA 3ZQLA 2V79A 3G6EI 3KKSA 2HDDA 3EYIA 4LG0B 1BC7C 2HNDA 3FM5A 3VETA 3MCAB 1U47A 4OVLA 3E97A 4BWJA 2LOOA 2VQCA 1PUFB 3Q9VA 2XF6A 1G4DA 5KNLA 3JRFA 2K02A 3VEYA 1BUPA 3R60A 3ZMZA 1T33A 3GTPJ 1NOYA 3WTXC 2VWKA 1I1SA 1BL3A 4AM7A 1TTYA 4CCOA 2E5LK 2IIRA 3CESA 1EH7A 3DPTA 3HOWJ 4MEXF 3BR6A 3A01B 1IKWA 2WV1A 1VF9A 3RMCA 1X9SA 3H9JA 3A2FA 3ZSRA 2D1VA 3WTVC 1UHMA 1QGPA 4OMZA 3TDUC 4UV9A 3D45A 1L3SA 2VCPA 2QVOA 3S2HJ 3AA3A 4EFHA 1OR7A 2K9MA 5BQTA 2HQNA 4CHPA 3PX4A 2RE2A 3G25A 4E4HA 5GAEP 4PJLA 2OJED 4IXCA 5DM7L 2YX6A 4FJ9A 1O3QA 1GV2A 4FETA 3EE9A 3ZSYA 2WBMA 3S16J 1VQPI 2MC4A 3NQOA 1JHHA 2R92J 2CW7A 1W4MA 3H6EA 1G59A 2ELHA 3IHUA 1VK0A 1RBTA 1NGGA 2VG7A 4A59A 2IGNA 4JI2K 4KT5C 3T1AA 2G7UA 1EH8A 4XH1A 3S41A 1TQPA 5F08A 5KGXA 4E89A 3QFUA 1Y56A 5ELZA 4XRSA 4CH7A 2R7WA 4PGGA 3OYNA 4UUSA 1B6AA 1BI4A 3F3XA 4U0VA 3ZGKA 1RBSA 5GTHC 4CHOA 4D7MA 4AHVA 1XHXA 3H3OB 1RDUA 2X78A 4DB3A 4CGHA 1IUFA 1VQ6I 4HSTA 2A40A 2DT6A 4LFCK 3ITHA 3GUDA 1ASWA 1LJ9A 3Q0VA 3L2VA 3EZWA 4YOWA 3I56I 1FOKA 4JS5A 3ZXSA 3GW2A 4B3XA 2F4OB 1B9FA 2NOGA 4Z6YA 3FHNA 3L6QA 4HUFA 2NS0A 5C42A 3RSEB 2FE3A 3WUHA 3OTOK 2UYTA 2DTRA 2KFZA 4IOXA 3R3LA 1NKEA 5C4XJ 3I0SA 3OYBA 1HKQA 2OCEA 1NGDA 2ME0A 3QFPA 3CJ7A 3ENOA 3HPHA 3ZSOA 2QK9A 2KFNA 2PN6A 5J4VA 1NJYA 5AQMA 3NARA 2QWLA 1WSUA 3NE6A 2IXSA 2Y9ZA 4C9YA 1SAUA 2GIZA 4HBLA 4F9OA 1DP3A 2A3ZA 3BCBA 2UXCK 1VQ7I 4CJVA 4O8UA 4YOTA 4DR6K 3UIQA 3G1LA 2KP6A 2VI6A 1W0HA 3KK1A 5GAGJ 2QWNA 3T7ZA 4M3UA 3LZIA 1VHXA 2X4HA 2P7VB 3O3KA 3F6OA 2YS9A 3GTGJ 3U9DA 3HYFA 4MFDA 4KBOA 2R5YA 1U5TC 2KISA 5I3UA 2YX7A 3GYHX 2MD5A 4UB8C 3O6BB 2P9NB 4G7ZF 1K73O 3WTWC 4BRHA 2HXIA 4ESFA 4M6VA 3FZKA 1BR4A 3IAYA 3KVGA 5DD8A 3DI6A 2VXZA 4H5WA 5F0XA 3LAJA 4DMNA 3P1GA 2GUPA 3V7RA 4EM2A 4M9ZA 4RAGA 1D0ZA 3D5SC 3JW4A 5FD5A 3TBIA 2ACJA 2IOCA 2VPLA 2L4MA 2IRFG 5DMRA 3I4NJ 2LC2A 4FLVA 1QZ6A 2VJIA 1U8BA 3NF6A 3MN6A 3CCSN 4KA4A 2GXAA 3VWBA 1TUYA 1XSXA 3ZETB 3KEOA 3B6PA 4FYDA 3N4MA 1GLNA 1F5TA 5FFXA 4CZEA 3CC7I 3JSMA 1D1BA 2ZBKA 1DGKN 1H0MA 3ZSWA 4IRHA 2DDAA 5CJ9A 2HOAA 4IOCL 4HTUA 3QNOA 1HYVA 4PZJA 4HCBA 1YX3A 2MW8A 4BVPA 4DBQA 5TRDA 2KZMA 2FUG2 3QINA 3FGUA 4A2UA 2YSRA 5J47A 1YJNN 2QBYA 2P9SB 4M3EA 3W6KB 1KYZA 5L3DA 3SUNA 4PKIA 4JK7A 2BY3A 1KU9A 2L2OA 1JUSA 4PJJA 1QQOA 3HOSA 1Q9XA 1MH3A 4ZZDA 4WFBL 2A6HF 3CFOA 4HUEA 3JS6A 3FXRA 3IRXA 5GAGP 4BHBA 3RZDJ 4B3OA 1ON1A 1YITI 4CE9A 2EZKA 3IMXA 5IOZA 1RRJA 3MFKA 1XGOA 2L01A 2BZTA 3TAMA 2BYVE 1MBJA 4YEJA 3DRRA 3S15J 3FE1A 2AJQA 4CFAA 2CQKA 3ZRGA 4DUYK 4IOCF 3PO3J 5AQIA 3AARA 1IRGA 5TISC 3KZYA 4XH4A 1OVYA 4KHPK 1EJ9A 1RILA 5DK5A 2BY1A 4DSIA 4J2DA 1J9AA 1E3OC 5M1NA 1KAZA 3GE1A 1UZCA 4M74A 2DTUA 4EHTA 3EL2A 2IA1A 1UWBA 4PSXA 3FBIB 1JTXA 2M2EA 2JGUA 4LB5A 1ZKGA 5E1XA 2ZE2A 4EAHD 4UVBA 1VQPN 4I02A 4BR5A 5CPRB 2WY7Q 2KIQA 3GLXA 3ZEUB 3QIPA 1HX1A 3EUKL 1QQIA 1IBMK 4LK1F 2I5JA 4BBSJ 2HTSA 4MO4A 3ZMUA 2ZMEA 1C0UA 2NNNA 5DD4A 5LHIA 3K5OA 3BG9A 4XKCA 1T6CA 5IYCJ 3DBRB 2X1CA 5M3MJ 5H1SQ 4CIFA 4DV7K 1RIOH 3UKGA 2HHSA 1XNRK 4HRIA 1Y8RB 3D2FB 2F5CA 4M3XA 5LRRA 4XKWA 4EGZA 1D8KA 4IX7A 3CJTB 3KKRA 4XEIA 2DOAA 3HHGA 1XMOK 3ESWB 4BKXA 4N0BA 5K5OA 2O8DA 1VQ6N 1YJWI 2O5RA 5DTDA 1XCVA 3GBGA 3M5RA 4CZHA 2M0CA 1WSJA 1YIJI 3HJFA 3K9TA 3MXMA 2KRHA 4HA8A 4DNCA 2HU9A 4HQMA 3E9LA 3THXB 3ABMH 3GWZA 1T05A 3K4JA 5C0YA 1G3TA 1E0EA 5E84A 3M7GA 1V4TA 2V1XA 2R7SA 3F9MA 5SZTA 5BREA 1RPWA 1IN4A 4WFAL 1JKQC 1ZYQA 5ADXA 2JUCA 5FLMJ 3E5QA 4BY9C 2DMQA 2L7ZA 3AA5X 2VQEK 1T38A 3DBLB 3VQPA 1GHCA 1Z7UA 5FKNA 4IHWA 4BWMA 3MX5A 2LTPA 3LP3A 2CYYA 3F8NA 3VA3A 3VQAA 3O4WA 4LD0A 1C1CA 1XSVA 4Y17A 2VONA 4CFCA 1CXUA 4CCNA 1VQ5I 4KIGA 3WTTC 1YO5C 2DDBA 2UXBK 1JLEA 1OCZH 4JX6A 4OOIA 2OYQA 4KB1A 1G15A 1QE1A 1DP7P 2IGKA 1VRUA 2B5JA 3QESA 4CZGA 1OFCX 5AZJB 1NHAA 2WADA 1YJ9I 4GDFA 5C25A 1VQ4N 4DF4A 4KPYA 3W2WA 2UUBK 1LW0A 1HXDA 1G3WA 3LSPA 4JX5A 4DKWA 4XICA 3R0JA 3AL0C 3IH2A 2AXTC 2XF7A 4LD5A 3C6UA 4NDLA 4MNUA 3CF2A 4RB3C 2F48A 1VSFA 4A3FJ 1JLBA 3HGYA 1E4GT 5J3LA 2ISYA 3TO9A 4DU3A 4Y3OA 1J75A 2HYJA 5KQDA 2HR3A 3SXYA 4B43A 1SD6A 1IV0A 4CK3A 3V9ZA 5LFAA 3R4KA 2DQLA 4JV5K 3E5XA 3E5UA 3WHCA 1FLIA 1N77A 4M9XA 1QQMA 4IDKA 3VOVA 4J2BA 4BRKA 4G7HF 3RIRA 3VYTB 5FJ8J 3CC7N 3DXMA 3QEPA 4JP0A 2VGMA 3VQBA 4R79A 3MN2A 3G1MA 3WTYC 3LP1A 3HG9A 1SC7A 3FZHA 1VSIA 1RDAA 4DQPA 1G8XA 2Y1JA 3PSFA 5J2PA 4HLXA 5C2FA 3LDQA 3LDPA 3C95A 2ME6A 1YS7A 3T69A 4HEA2 3H1CA 1LNWA 2K9NA 2FBTA 4GMJB 4B9VA 4RS8A 5KRSA 1CZBA 5FB2A 4CJLA 3PNTA 2VKHA 4CIGA 2ZCWA 2KIFA 2A1RA 1GLEG 3O9QA 4FE7A 3K0LA 1U6GA 4DR3K 1SMTA 4PFOA 4XL9A 1QTMA 3CLOA 2K40A 2W41A 3SMPA 1HQEA 4IZZA 4DR4K 4KV8A 5HOOA 3FXLA 2VL8A 1S7EA 1NK3P 1BDGA 1KVBA 1G3SA 3M8EA 2BXZA 2RC4A 3F22A 1R58A 4FJIA 3ID8A 3L4QA 2Z1IA 1UB9A 1OR7C 2BHYA 4CHUA 1SD7A 3G4SI 2F6CA 1XPXA 1ZH5A 4DLEA 1FSHA 2DMUA 2GA2A 1QHGA 2EIJH 1HW5A 1JUMA 3SBTA 4ESJA 1K83J 2A07F 5GADJ 3WXLA 3SUPA 1J5OA 3BJOA 2YHAA 3I0TA 1ZELA 2V7FA 1BA0A 3M3YJ 3EYYA 2YNFA 2GOMA 1XDUA 1ACIA 5AQLA 2A61A 2HHWA 2HI3A 2W57A 2YHBA 1VQ8N 2LG4A 1RT6A 3PNYA 2JVGA 3CUQB 1U2VB 3V4IA 1ZHFA 2QF7A 4IRGA 4TSXA 1QHTA 4B9SA 1C0FA 1N75A 1MWKA 1SD4A 3AG1H 4JN4A 1Q9YA 1RNLA 3LL7A 4CGZA 2CV1A 3M8FA 2D45A 1VSKA 3P5JA 4E7IA 4DCHA 2EFWA 1IDYA 3I5UA 3NWSA 1MMSA 1A6IA 3FKIJ 1WAJA 5EY4A 1Q18A 4K8ZA 3CCVN 4H0PA 2X1DA 1T44A 1UCRA 3U9GA 4RGRA 1YJWN 5CE3A 4G12A 3Q5FA 3F6VA 4AD9A 5KHDA 4ID1A 3CLQA 4DJAA 4Y7NJ 4DSJA 4GW6A 2Y0MA 1TKXA 2CH6A 4PKGA 3TU5A 4XMYA 1YIJN 1IN5A 3H3UA 4RLFA 1VAZA 2VWBA 2FBIA 4XN0A 3D0SA 4CGFA 2R7RA 2HHHK 3I4MJ 4JI6K 1IF1A 3SZGA 2E2IJ 5HDGA 2CRGA 3FX3A 3O8HA 1MA9B 4B3MK 3CCJN 1WFXA 2QWRA 4B3SK 1MNEA 2P7CB 1VTNC 5DEQA 3O2PE 3O4NA 5FKOA 4FJNA 1DDNA 3F2KA 4O55A 2DA1A 3IG1A 3U1KA 4A61A 1T7PA 3CYMA 3RKXA 3LDNA 3H1VX 5JVGL 1D0YA 1V4SA 1RUNA 3T5XA 3NDKA 4NCBA 1JKOC 3PIPL 4KN7X 4LLGF 3ZMTA 3MECA 4X6AJ 1YI2I 2K27A 5LHHA 4A5BA 3P9CA 3MAQA 5GADP 1N33K 4K8XA 3SPYA 3NWTA 3AAQA 1MDMA 1YW9A 1VQ5N 1KVAA 2MD0A 1TK5A 3HP6A 2LR8A 4HLYA 4M3YA 2H8WA 4S0HB 1JCEA 2M4GA 3MWPA 5HLFA 3SLCA 3O1WA 2DI3A 2E1ZA 1YJ9N 4GV9A 2PBIA 3QERA 2LREA 3J7ZO 2HNHA 4KH6A 4BRNA 4IFVA 3HPOA 4Q4ZF 3WGIA 2HNZA 2PJRA 3M1CA 2DA5A 1IZ1A 3LSGA 4Z4IA 3RCOA 1TZLA 2ZB9A 1ZRFA 1BA5A 2PJPA 4GXOA 3DXKA 1NK0A 2GWKA 3RYRA 3U1DA 1ZBHA 1BIAA 3GMEA 4KKOA 1ZYRF 1AA7A 1A5JA 4UY8O 3BP8A 1IC8A 3E7LA 3KJVA 3CPWM 2Z5UA 4HV5A 1QPMA 3QP5A 2IA0A 1O3SA 3R6MA 4CCLA 5E17F 3V1OA 4XORA 1QVFM 2KZGA 3QQAA 1TP4A 2GAUA 3IAS2 2XGXA 2Z3YA 3KLHA 4IO9F 3TP3A 4MLEA 1RKWA 1TW2A 4DSEA 3RR7A 1NK8A 2PFUA 1MZBA 1LVAA 4GRIA 4XLEA 1Q7YO 5F04A 1DEJA 4BQZA 2P6TA 4ZDLA 2A6AA 2HF4A 2LKSA 4OWRB 1D3YA 5KI6A 2WONA 4BRPA 1U4BA 3LFUA 3ONQA 2W7NA 4PDKA 4IJAA 5HLGA 3CUOA 1WJDA 1Z91A 1J6ZA 2ZD1A 1VSEA 1K4TA 1O3RA 3RWUA 1VQKI 3GTMJ 3NHGA 4KFBA 4DS4A 4CJQA 1EX4A 4XKVA 4LF7K 2Z33A 4F3OA 2P9UA 2ID3A 2DOFA 1Z67A 3AVCA 4I98B 2FF3B 1ULYA 4V2FA 3LNQA 3JCUC 1HJOA 2DFHA 1WCMJ 2P5GA 3DEUA 5BR8K 3BGRA 2BY0A 3JAMK 4HF2A 4W5TA 2A5WA 4FCYA 2OCCH 3FMRA 1QQCA 2CUEA 3DU5A 3TOAA 4CZZA 4FJXA 5L3BA 1S1TA 4DQ2A 2VUMJ 5DV5A 3MN9A 2QA4I 3G4SN 3DTIA 4ZDPA 2HF3A 3ABLH 4B48A 5AQUA 2F9TA 1W7PA 1BM9A 2ZJQF 2FSKA 4E7JA 2Y75A 4M6XA 1SQKA 2XRIA 3LWMA 4DV4K 3PSIA 2V26A 3ML6A 3J7AY 4QOZB 1N32K 4H5NA 2Z16A 4FVUA 4O5BA 1H89C 3A2KA 3A5MC 2GXBA 2ZMEC 2DYRH 4WXHA 1REVA 3AVHA 5F64A 1KU3A 1L5UA 1ZREA 1TKTA 3KIOA 3CHWA 3QYBA 4B9QA 2EZLA 4OAYA 4J2EA 1SFUA 3OYMA 2FXAA 1RBUA 1IJWC 2YPRA 2OA8A 3WGHA 3A5LC 1QBJA 3H46O 4LH4A 3MN5A 3SUQA 3H5NA 3CJNA 3K5LA 4X65K 1VQLN 1X3MA 4LIVA 4UVCA 4JNEA 4I6ZA 3HC7A 4HDUA 5K5QA 3WEEA 5FKKA 3V8LA 2QWWA 3CMYA 2KRCA 3MEGA 1TBXA 3O9UA 2GIVA 3R9PA 3LSJA 5LGTA 1YW8A 3ZX3A 4RGXA 3K4CA 3ECHA 3QPHA 3MQ0A 4ZYGA 5D5XB 2Y2ZA 5JLXA 3LDOA 4AILC 1XGNA 4ISEA 4V19S 1MU2A 4IKFA 2OPPA 4LG0A 1RDCA 4JKHA 4BRQA 3K70D 3P4IA 5L3GA 1FBQA 1PUFA 1OJLA 1JT0A 1GVDA 4BRLA 1RR7A 1ZRDA 5M3FJ 1L0OC 3DP7A 2W6LA 1AHDP 2ZGYA 5JHFA 4UUTA 1KC8O 4W97A 4DQIA 4ENMA 2DFEA 4O3MA 2BBYA 2VT3A 2XDVA 1K79A 1YI2N 1X3NA 3CCEN 3HRUA 1BI2A 2G8FA 1HF0A 4P9FA 3A01A 1DU0A 4Q47A 3CCYA 4O6JA 2IC3A 1ODDA 4I6MB 1Z26A 1Q86O 1LV5A 5AQVA 2R7YA 3CQZJ 3E6DA 3HVRA 4P1WA 1IUYA 2ZNYA 1IN8A 1XUPO 1NMNA 2OPQA 5JVHL 4KHUA 4DTJA 2PEXA 4FWKA 4U67L 4JKFA 4DG1A 1FJLA 1B59A 4DFKA 2QWQA 3GFIA 1IV6A 2FF6A 2HYFA 3P39A 2XO7A 2NVTJ 2DJNA 3HO1A 2R7VA 3L2RA 4A3LJ 4N56A 3FR0A 1NBWA 4FJJA 1RTIA 1YRNB 1UAAA 2ECCA 1FKPA 2K9QA 3DKYA 2H1LA 4ILJA 2OAZA 1MBEA 1JJ6C 3CTAA 4DW6A 4B1RA 1OCRH 3DMJA 1OCTC 1ASVA 2O4IA 3I64A 4BE0A 2XPWA 1SEUA 1YIOA 2X1EA 4B9NA 2HSTA 4HCCA 4QS7A 4JI7K 2YI1A 1DGRM 4W5OA 1JJ2M 2KPMA 4ELVA 2FSJA 1S72I 1IBKK 2D0CA 1IBLK 1EWRA 5DS9A 4OPAA 1TV6A 2HHTA 3V7CA 1NGHA 2DFFA 2EIKH 5FRMA 2KT0A 2HVHA 3D1NI 3DCFA 4CEEA 3IRQA 1SUQA 2XF5A 1TWHJ 1VQMI 1IV8A 2HEOA 4KDPA 4Y52J 4ZH4F 2D2WA 4WF2A 1DPRA 1YVNA 3IKMA 3RSEA 3K4BA 2FX0A 3AO1A 3TTFA 1A6QA 1RETA 2LH9A 4JAXA 2GUIA 2DW4A 5TJJA 1ZGWA 4X62K 3NRVA 1YQAA 2IJLA 4LGWA 4YIFA 4DQ8A 2MLGA 2GWJA 3IFRA 2L4AA 2WB1N 1WWXA 1Z0XA 5CYMA 4A57A 1GT0C 3E9PA 3L8BA 4RGSA 1YTAA 1X9JA 4CCJA 4HX7A 1SVMA 4CJTA 1Z77A 4DSLA 1YTYA 1IG8A 3BZ6A 1N34K 3C2BA 2W1OA 3DWLA 2AXLA 1NK2P 1WUAA 4MTDA 2G8UA 2HWVA 3GZNB 5L3EA 4EP4A 3TOBA 2WB1A 5FRNA 2W25A 2X6XA 2QA4N 2F4VK 3I55I 3SZ2A 4ILHA 1HKBA 5E1ZB 3LSKA 4G1QA 2P5LC 3WNGA 2JK3A 4AIJA 2IGIA 3L3UA 4M3BA 3T1HK 3CJ9A 1WB9A 4KITB 3CMMA 4KHNA 3OR1C 3KP7A 1SL1A 1PP7U 2KQ2A 1HDDC 5FLVA 5C12A 3QLHA 2CU7A 3LPUA 5FLXK 2XAJA 4XRSG 2NVXJ 3ULEB 5LGUA 5DCFA 1ZGAA 3CJQB 1FY7A 3R1XA 3CXCM 5HLIA 1H9GA 2Z2SB 2LFBA 1Q1HA 4WCEL 1FP2A 5A2QO 5CZ1A 5M1FA 4BREA 2AO9A 1WJCA 1KD1O 3G71I 4DV2K 1BOBA 3IUOA 4A12A 2QM1A 4JI4K 3KHYA 3ZETA 4C1NK 3V8JA 2I10A 4XSXF 2QW9A 2KFDA 2JWLA 5DM6L 5HODA 1RBVA 3H9QA 1R1TA 2K86A 4CF9A 1R71A 4B4CA 5EU7A 4FL9A 4FWPA 1O7LA 2E2JJ 3CQXA 1IG9A 4QLCU 1ZAOA 5JLWA 3ABKH 2FXUA 2A6TA 2LKXA 1Y64A 3BROA 2RN7A 2ADUA 3HGGA 4DGWB 2WA0A 3SYTA 2ZJ2A 1S5JA 2EH3A 2E5ZA 4O4GA 2P9SA 4MDAA 2F5FA 2UUCK 1KONA 3FMQA 2Q8KA 5E3LA 1NKBA 1WSFA 3PUBA 3ZSQA 1BIZA 1ATSA 4Q48A 3DFGA 4BQNA 2AHQA 2DY4A 5D5UB 1SVLA 1FK9A 2I8DA 1LUJB 1TQIA 1KQ9A 3OIOA 4F7ZA 4HAMA 3J80O 4Z4CA 3CDHA 1TNTA 5KK1A 2XY7A 2W85A 1NJZA 4Z0UA 2DPNA 1LEAA 4MQ9F 4YDUA 3DLKA 3Q0UA 3EN9A 3GXOA 5E18F 3LM9A 4JLHA 2HBLA 5J2QA 4UV8A 3JR9A 2K4JA 2ESNA 3TO6A 2ITMA 4XLFA 1EA3A 1ERDA 1BJAA 4LJZF 3RMBA 3FXMA 5B5EC 1QVGM 1FEXA 1YG2A 4DLGA 2J5OA 4KB0A 3KZBA 1FYLA 1ESVA 4OPJA 4E70A 2B7EA 2OZUA 3O9RA 3AVGA 3VDXA 4UVAA
chains in the Genus database with same CATH topology
3OYLA 5FDLA 4QCLA 1BL3A 3KLHA 5J2PA 2D5RA 4FVMA 4B9LA 3LP2A 2P1JA 1ASUA 1KLMA 4ZTFA 2FC0A 4PQUA 3NH0A 3C95A 4DU4A 3CFOA 4HUEA 3SQ1A 4AHCA 1TK8A 4CEZA 3IRXA 3VA0A 4DSEA 3AVBA 3DMJA 4CEQA 3RR7A 3LDSA 1ASVA 1NK8A 1IKWA 4M3RA 3ISNC 1W9HA 4FW2A 4B3OA 4CE9A 3HVTA 2FBTA 4GMJB 4HUGA 4FLYA 4B9VA 2O4IA 5FROA 2ZQBA 4BE0A 1D9FA 2OZMA 1SV5A 5KRSA 2HHUA 3RMCA 1TGOA 4LSNA 1X9SA 1CZBA