1X1SA

Crystal structure of m-ras in complex with gppnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
163
Chain Sequence
LPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of M-Ras Reveals a GTP-bound "Off" State Conformation of Ras Family Small GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ras-related protein M-Ras
total genus 56
structure length 163
sequence length 168
ec nomenclature
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x1sA00
1HTWA 4N1AA 4B3XA 5FR1A 3BERA 3D7MA 3LNCA 3QE0A 2C9YA 3R20A 1SXJA 3H4MA 2GZAA 1D9ZA 1S1CA 3IIJA 1Z8FA 4QC2A 4ZV4A 3NBZC 4FMBB 3TGPA 1QHGA 3WNCA 4LOAA 4TQAA 1S2MA 4EJSC 4FMCF 4B2PA 4XVRA 2CE2X 4DIEA 5JMTA 1EGAA 1NBMA 2H1LA 4HAUA 2IS4A 3B1VA 3ND8A 5EZ5A 4GDFA 3KKQA 4YXWD 1IAQA 5EP2A 2FSHA 4DEXA 3U7GA 2QAJA 4NDZA 4IVPA 5FOSA 5A4JA 1EK0A 5D3QA 2IXFA 3HR7A 2V6JA 3HR8A 2ZR9A 1JEDA 2C8VA 1FUKA 2B6HA 5G53C 2D2FA 3PXGA 2YWGA 1E2DA 3MWLA 2GXSA 1A2BA 1DBSA 2A5YB 2P0EA 4ERNA 1S0UA 2ZI5A 3B2EA 1Z5ZA 4PSVA 721PA 1VIYA 1SVWA 1ZM2A 1E79A 1J2JA 2WKPA 1W48A 1TL7C 1GM5A 1CTQA 2FG5A 2VQSA 1TF7A 2LKCA 2OFXA 3SEAA 2XSZA 5EXTA 2X1VA 3G82C 4Q4AB 2QE7A 2GCOA 1Z07A 1GAJA 1U99A 4DB4A 1TPZA 1JQJC 3A36A 4PFSA 2REXB 4S2EA 2EWWA 4HB0A 3UWOA 2ZXUA 4ASUD 2CMKA 3B78A 1N3BA 4PPNA 1U8AA 3C5CA 3GLIB 1G3UA 3CWZA 5KU1A 1GSIA 2QEQA 2C04A 4B35A 1FP7A 1KKLA 1TADA 2ZJOA 1OXXK 3ZS9A 5H8WA 5AJWA 3LBNA 3ZIAA 2J0UB 3FE2A 3U5ZB 2ZSDA 5J4YA 4XD7A 4ACAA 4R7ZA 3AKYA 5FL7A 4WZBE 3LA6A 1Z2CA 1W36D 2VSFA 2PZEA 1ZUNB 1E9SA 5IDVA 4PR0A 4KODA 5G3ZA 1G7TA 3CX6A 2RKOA 2XZLA 3LBHA 1GP2A 2HT6A 2HYDA 3I73A 1W2HA 1NF3A 1NI3A 2JEOA 1R8SA 2IC5A 4IFBA 2GCOB 1Z0AA 3QBVA 2G0NA 2FJUA 2O52A 5L3QA 1W36C 5TB5A 2J7PD 1XFAA 1Q12A 2NO0A 4QOSA 4DSTA 3NC1C 2PEZA 5CJPA 2ERXA 3FFBA 3IEVA 3P32A 5CJ2A 2RMKA 4ACBA 5SZHB 1YR6A 3AF4A 5KOYA 4ZI3A 2DFKB 2F43B 2OT3B 3O47A 3DDCA 1A7JA 5EXXA 3KQHA 4NYIQ 1N5IA 1NSTA 4PZZA 5FTKA 4C0HA 4D82A 2ZS7A 4ON9A 1WBBA 2Q3MA 3T12A 1G6OA 4A2WA 3QKRB 4Q01A 2CE7A 4XVUA 4KITB 1FFHA 3IIMA 4DSOA 2HXSA 2EFGA 2Q9AA 4ILEA 1P60A 2AHOA 2J0SA 4MKHA 4FMDF 4RZ2A 2PX0A 4TMKA 4BRUA 2J0QA 2HLDA 3SDZA 5JHGB 3I61A 1G3QA 4F7WA 1MABA 2MSEB 1E2JA 2OXCA 1QDEA 3AP3A 3LFUA 3QXCA 4XSHA 2BKEA 2ASEA 2FGKA 1XPUA 3ASYA 3UK6A 2V7QD 2HCJB 1XEWY 3TE6A 2BJVA 2WJJA 5AJVB 3A4NA 1Z08A 3GFOA 4QBIA 2EVWX 3W3ZB 1ZM3A 4Z51A 1QVAA 3OEHD 1E0SA 1ZYUA 1Q44A 3HJNA 3AH8A 2QMHA 1GRRA 5JWHA 1SVIA 4IDNA 5J4VA 1NKTA 1JJ7A 2WSSD 2EFHB 1S1MA 3OE7D 3BH7A 3KXKA 4HLCA 3RYTC 4DJTA 1S3SA 1II8A 4LJ9A 3B13B 2BMFA 1ZCAA 2HYIC 4HEJA 1R0ZA 4WZAE 1Y63A 2BM1A 3V00A 4DCSA 4I1OA 5F2EA 2IYQA 4JLDA 2AXPA 3SJAA 2PMKA 2IS6A 1XWIA 1A82A 2IYZA 3MD0A 4IXNA 4W5JA 1JNYA 4AKGA 1GRQA 5JJIA 4URYR 1KDOA 1CXZA 1XD2B 1G291 1AGRA 1GNQA 1GVNB 4D6PA 5KHOC 3RRYA 3H1TA 1OE0A 2P6NA 4NTZA 4OI0A 1YZGA 2MMGA 4NH0A 1P3JA 4NYJR 5D3MA 3VMFA 3LQRA 2X77A 3FVQA 4LJ8A 4KXFB 4TYPA 621PA 3DZ8A 5JWRA 3PJRA 1E96A 4M9ZA 1VKJA 3HU3A 5K8UA 5FPSA 5AWFC 3GLFB 3K70D 1E2FA 2OBLA 4BFYA 3K9NA 1IN5A 2IS2A 1SXJC 3UWKA 4HAZA 1PLJA 4Z1MD 3L2OB 3DOEA 4Q66C 1IY1A 1ZM4A 4ITRC 2IYYA 4TMTA 1PV4A 2XB2A 2KWIA 3DHWC 5FTMA 2IHBA 1WF3A 2PZGA 3MMPA 4U5XA 4DEYA 2VO1A 1T5LA 2VP4A 2XJ9A 5EZ6B 1TX4B 5FOWA 1FZQA 2CVHA 1YRAA 3TUZC 1K6MA 1E3MA 4PQRA 2ZE7A 1KO8A 3LXRA 2PH1A 1CS4C 1H8EA 5IK2A 4BE7B 1DARA 1K5GA 3QEOA 1MO5A 2W00A 3AKCA 3RC3A 1VCOA 4G5GA 5SZIA 5IRCD 1FX0B 3ZZ0A 4B2LA 3T5GA 1D2EA 3AVUA 3EWAA 2XZPA 4M1MA 2J3EA 1T0JB 2ZRDA 1XTRA 4MGZR 4UNRA 1G21E 3TH5A 1KMHA 2W0MA 1RRGA 1PJRA 3AV0B 5AUNB 4GOXA 2E1RA 4J0QA 3CLVA 5LD2B 2DHRA 1EFUA 2GILA 2WVJA 3E70C 1ZD9A 4C30A 3AVWA 3KQNA 1U0JA 1E4YA 2FEMA 1EESA 3FWYA 1MR3F 4IJMA 5EP1A 1ZP6A 3F0TA 4RD1A 4B32A 3EA0A 4ZKEA 2QUZA 2ZI4A 2QG6A 3KFXA 2QGNA 1DAKA 2GXAA 4DUGA 3K0CA 1O87A 4B43A 1XXHB 1NP6A 2ZYVX 4OQXA 4G5RA 4V0ME 2P3SA 4DLVA 2CXXA 3D31A 2WKQA 4H1VA 4MYCA 4AKEA 2QL6A 2OFOA 4A92A 2GCNA 1N6RA 4D0NA 2CEAA 3U6KA 1UDWA 3ZJYA 4OQNA 2BIFA 5FPKA 3U4QA 1IY0A 3RC8A 4NPHA 4UNSA 1Z47A 4B3DA 4LJ7A 4UJ3A 1R10A 2YC2C 5FUYA 4ZKDA 3FGNA 2R44A 3QKSA 3K0EA 1E2QA 2BEKA 4DCVA 3NBYC 1EFCA 2FSGA 2PT5A 5L3SB 1UAAA 3IDQA 3LX5A 3TR0A 3MSXA 2FSIA 1RKBA 1E2PA 1HURA 5HKKD 4YMTA 5DI3B 2OAQ1 5GJCA 4JSYA 1CJTC 4I81A 1JBKA 3BXZA 4BFXA 4U00A 3FTQA 4IOKA 4HUQB 6Q21A 3LXXA 4PQFA 2B92A 4JYCA 4FW9A 3SNHA 1OFIA 2OE2A 1OLOA 1A2KC 2GJSA 2DPXA 4LBVA 3QEJA 3WYAA 4B33A 1SVOA 2ANCA 5EE3A 2KE5A 4WBSA 1XTIA 1XBTA 4YDSA 3VKGA 4OHXA 2GZDA 3CRMA 2JJ2D 1DAMA 2FWRA 2ZRHA 1VMAA 3HYRA 2RGAA 1M7HA 4RD6A 3B9QA 5FUXA 3MJRA 4DLRA 4MDFA 5KSYA 1E1QA 4IDHA 3Q72A 2ZE5A 2XITA 2VYFA 2ZR0A 1LS1A 4W5WA 3THXA 2WJIA 1EX6A 1KK3A 3VX4A 1E2LA 3KDSE 4E5UA 1NKSA 5E3HA 3T1TA 2ZETA 3K0FB 3IBYA 4QHYA 5GADl 4B3CA 4OHWA 1KI4A 1V43A 3AGPA 2VP5A 2ZI7A 4FXPA 1R0YA 1DPFA 1ZUIA 2VHCA 2VBCA 3VHXA 2JJ1D 1JR3E 1SKYE 1F2UB 2QAGB 4O0MA 4PTLA 5KNBA 3GJ7A 2IWRA 1WA5A 3NDPA 2YWHA 2GNOA 2W58A 1MRNA 3EZ7A 2D7CA 4GL2A 2AK2A 1T3HA 3I8XA 1TAGA 1KTVA 5CDFE 4QJ3A 5KO2A 2H17A 2GDJA 1S3GA 2C98A 2DFNA 4LX0A 2ZU6A 5LD2C 1LV7A 3VR4A 2V1XA 1LW7A 3KJGA 3PQCA 3W8RA 1VG8A 2J0UA 2ZS9A 3IO5A 2NO1A 3I3SR 3PITA 4TLAA 2RHMA 4DCUA 3FMFA 2W6JA 3NHAA 4NYMR 2ZRNA 1HY3A 1IN8A 3REFA 5H1YA 2PJZA 1JXMA 2CLSA 2FPMA 2WJGA 4LRWA 2GHIA 1W0KA 3RS0A 2YNMA 5BXQC 1T0HB 3RLFA 4D4JA 2WMNB 4MKIA 1COWD 1WMSA 2JDID 2QAGC 2RCNA 4QKQA 2RGEA 2V3CC 3CF6R 1NMYA 2VIIA 1HQYE 5AUOB 2HXYA 1X1RA 4PZLA 4D2IA 1JB1A 1NJFA 4KBGA 3NXSA 1AIPA 1ETUA 1EFHA 2GK7A 3K8YA 2HT1A 3S1AA 2XOKA 1EX7A 4JSTA 2EYQA 1G1MA 4V0LA 1EXMA 2OEPA 1AK2A 3HP1A 1GL7A 4B48A 1G8YA 1Z0IA 2FE4A 4LHZA 3K9LA 2G1JA 3QKUA 1G3IA 4TLBA 1P2VA 3GJ4A 1W5SA 1R0WA 2UVQA 1E4VA 1X3SA 4KHZA 4MRNA 2O8EA 2IA5A 2QT1A 4BPBA 5FBWB 3VKWA 4HUTA 3EPHA 3MJHA 4NYIR 5DGXA 121PA 3GLFA 4A82A 2NO6A 4MUAA 2G6BA 5EE5B 2ODEA 5EE0A 5UKDA 1RC8A 2VL7A 1JEEA 1U81A 2LWIA 4YDHB 4OI2A 1P9WA 5DO9A 5FOTA 4A9AA 3A8TA 4XTCS 4JLJA 2JIZD 4QM6A 1W49A 3VR6A 3U60B 2G9NA 3K09C 2NPIA 4KSCA 1FMLA 3TRFA 2ZU0C 3SI7A 4F91B 4XOIA 2A5GA 3PUVA 2YHSA 3MWKA 4C9BA 5KDOA 5IHPA 1IN4A 3GLGE 4D4KA 1G5TA 1EFRA 3CW2A 3QNUA 3EARA 3CZQA 4HAVA 4QFMA 4B47A 5LB4A 3A1UA 1DAHA 1II9A 4JLAA 2X8AA 1YU9A 4IDOA 3EIHA 4LPKA 4AI6A 5DHAA 4TTQA 3WNDA 3FKSA 4A6XA 2V54A 3GFPA 1QHNA 4M8NE 4Q4HA 1JJVA 1G3RA 3LVQE 1BYIA 4US0R 4PAQA 3WP1B 1OXTA 4HLUA 4BFVA 1R5BA 2J59A 4FCVA 2R8RA 5DLQC 2ZM5A 4TTRA 3K53A 3AVPA 2WPDD 2QM8A 3JZAA 4C0QC 1E9CA 4DLUA 1SVSA 1WB9A 3W6NA 2GBLA 5EP3A 2ZQ5A 3QF7A 4CEIB 1G4UR 1TQ4A 4HLDA 2ONJA 4LGMA 2O0HA 4D25A 5IT5A 2Z4SA 5DNYB 4FI3C 1DADA 1G3MA 3IQWA 2GF9A 3LBIA 4GSYA 1OH8A 3OF5A 3OFND 4QBGB 4B74A 3RWOA 1L7VC 5J40A 3TW4A 3W34A 2Z83A 2QRZA 3CNOA 5EUMA 5LB2A 5TV2A 4YXWA 3TAHA 2Q6TA 4OHZA 4AYWA 5EJEA 1J7KA 3AM1A 1Z6YA 4MH0R 1DTSA 2XB4A 5GVSA 1E69A 4N0DA 4B6EA 5HE8A 4R98A 4M22A 5ANRB 1FW6A 3PUWA 3TSWA 3R7WA 3VU9B 4JLPA 1AQUA 1SVLA 1RE0A 2ZYWX 3CR7A 4R9UC 1V5WA 5J47A 2ZRJA 3A4LA 3A4MA 3AEZA 3C14C 4ZIRA 5BYKA 1MO6A 3RS5A 4ZDJA 3TQFA 1BOFA 4DDWA 2C5LA 4KYIB 2BBSA 4G5QA 2VP9A 1VCMA 5JRJA 4EPRA 2A5DA 1YR7A 1G9XA 1QF9A 3AB3A 3W8NA 5JEDA 3MWJA 3ZYCA 4D0LB 2F9LA 3QJYA 1JXOA 2WZQA 3OAAA 1CRPA 3GJXC 4M4SA 1I2MA 3L0PA 2CHQA 2XNDA 3SBDA 4LBYA 4GFDA 1CP2A 1DAIA 4LV8B 1T3SA 5J4HA 1X86B 1XMVA 4DRZA 3EXAA 1E9FA 4MDEA 1GILA 4JLBA 4DXAA 2ORWA 5FH9A 3BRWD 4LYJA 3QG1A 4M1WA 4ARZA 4LV5B 2QPOA 3Q5EA 4M1KA 2VA8A 4LWZA 2GBLC 1UKEA 4Q02A 4MGIR 4TL8A 1KMQA 1J70A 1NMZA 1FTSA 3B82A 1YQTA 4DSUA 4PSKA 1BMFA 1R5NA 3QXXA 2ZAMA 3BOSA 4W5HA 1KSHA 4JBXA 2DFLA 5TMPA 1ZIPA 1L8QA 3F5FA 4BUJA 3NDBB 3W90A 2VH5R 2BWJA 2DWPA 2XZOA 4ZDWA 2JLUA 1AKYA 2YWFA 4PAMA 5AJYA 3TVTA 2F6RA 3UMFA 4BLQA 2P6RA 1LS6A 3KQUA 1P4SA 1R4AA 3TUIC 4Q1CA 3I5XA 1YZNA 3W6PA 2X2FA 1W0JA 1Z28A 1GL6A 3L8ZA 2AFHE 4EJSB 3VFDA 2ODNA 4L8GA 1JR3A 1OB2A 2FZLA 3CX8A 4I1VA 3ADKA 4QBFA 3QOFA 3DEFA 1II0A 1T6NA 4MA4A 4V0MA 4P3YA 2ZJZA 4BGDA 4C0KA 2ZRCA 4EQ6A 4RFVA 5CLLA 4I4LA 4R71A 1ZM7A 4DDUA 5KDDA 2QGZA 4KYUA 4URWR 3B8HA 1OXVA 2G1KA 2ZROA 2DFTA 4G0NA 4F4JA 5JRZA 1XZPA 3DMNA 2H18A 1ZVQA 2CJWB 4UXJA 1XX6A 4HUQA 4X8LA 4MYUA 2QBYB 3NEYA 4I1UA 3VNVA 3ZLJA 1SKYB 4LY6A 3VNUA 3ZDQA 4Q4JA 4AURA 3OIWA 5E7MA 4Y0VA 3QPWA 3QY0A 3BC1A 2YZ2A 2ATVA 3VR1A 1G41A 3D3QA 3KB2A 3GLGA 1RVDA 4L5BA 1XPRA 3GQBA 4ZCMA 2AFIE 4PHHA 1E9EA 3IPXA 1NIJA 2O8BB 1GG2A 1HUQA 1KI7A 3F8TA 3H0KA 2XNSA 4G3XA 4M53A 3V9PA 4GT1A 2YWEA 1RFLA 1U9IA 2H7VA 4PO1A 4QGFA 2F3RA 1DS6A 2C9CA 1G7CA 2GJKA 3BFKA 5EE1A 2P65A 2GWHA 2WSSA 3X1YA 1FPMA 2WAYA 5L3SA 4OI4A 3UG6A 1QG4A 3I5YA 1TEVA 1QHXA 1X6VA 4WXPA 3THWB 2WHXA 1LB1B 3QF4B 1C9KA 2QZ4A 5L3QB 1W7AA 1KY2A 1RRCA 1NLFA 2C99A 2GAOA 4JL5A 4F38A 3QXJA 2QP3A 4L16A 3TMKA 1OKKA 3X1ZA 1E1RA 2V55B 1T8TA 2QSZA 1KI2A 2IBMA 2BEJA 5AK0A 1QG2A 3KX2A 2NG1A 4ESVA 4P32A 3AVXA 4UXHA 2GTPA 5P21A 3B60A 3BORA 4M9XA 3AF2A 2WOJA 1ZNZA 1RPZA 3KQKA 1U90A 3KZ1E 1ZM9A 4PHFA 5FBLB 1WCV1 4HZIA 4AD8A 2H8KA 4KLNA 5K8TA 4TLEA 4NZYA 4A1FA 1GL9B 2DYKA 3K1JA 4RD0A 4B71A 4LHVA 5GJBA 1NRJB 1KSFX 5DIFA 1Z83A 4G5OA 3TR5A 4OHYA 1LY1A 4BQSA 4K81B 3R7WB 1SZPA 3VHLB 3CRQA 2A78A 1KI6A 3U7HB 2R65A 2YJTD 1CR2A 2ZITA 3A58B 2JJ8A 3ZZUA 1E2KA 1Z63A 1E2HA 1KGDA 5IF9A 1H8ED 4JJKA 2CL0X 5JS8A 1Z0DA 3WYGA 1OHHA 2ORVA 2G77B 4FCWA 4MITA 5J5CA 3U2QA 1U0HC 2PCJA 2K5UA 4LDJA 1ZIOA 3NC0C 1LNZA 4QHTA 5H68A 4V02A 1G8FA 1KJYA 2VPPA 4KBFA 4ASUA 5LDDC 4GPTA 3RS4A 2UZIR 3UIEA 3ZVRA 2YV5A 3SJZA 2ZVQX 3M4YA 3RSLA 1SHZA 2IYSA 3ASZA 3ZQJA 1A1VA 1UADA 3ZIAD 1FP6A 1W47A 2HCBA 5CITA 4GMXA 1E98A 2QNRA 4MUBA 5KTYA 4ABYA 5L3VA 1R0XA 4TSFA 2J45A 4L15A 1OIWA 3QPVA 4Q7LA 4Q4HB 4N3NA 4A2PA 4IVQA 1YRBA 2JATA 2IHYA 5TXGA 821PA 2RGBA 1QHHB 1W5TA 2O0KA 2ZYTX 4ZCLA 4NL4H 1Z3IX 3K9HA 4OI1A 1OXUA 2GVDC 3I8SA 3CH5A 2IF2A 1KI3A 1QVRA 3HYTA 2CCKA 4U02A 2CCJA 4UQOA 3TJZA 2JLYA 1DE0A 4EKDA 1SULA 4EIWA 3ZD7A 2GRJA 1UM8A 5KDLA 2FA9A 5FTLA 3QQ5A 1KJWA 4IXMA 2QP9X 3N70A 3TW8B 1PZNA 4URXR 3ZGXA 2H92A 2Z4RA 2EW1A 5F9FA 5HKKA 5FTJA 4JKYA 1NN5A 1X8LA 4TMVA 5E95A 1JR6A 4LV6A 3BB3A 3L0OA 3VR2A 5JSZA 1GITA 1JAIA 3WRYC 1XTQA 4Z8XA 3SYNA 3T34A 4WA7A 2J0VA 2F9MA 1FQKA 2D62A 2C96A 4LPSA 5AJXA 1G17A 3QVUA 2O0JA 1WE2A 2RGXA 4Q1BA 2OESA 1FNMA 5FTNA 2WAXA 2V9PA 5EUQB 1SHKA 2SHKA 3NH9A 2XGJA 4C3ZA 1W4CA 2MSCB 5B64A 4DB2A 4RD4A 1R7RA 4MRSA 1OXSC 3SHWA 1I4LD 2WSMA 1AJEA 1FX0A 2IYUA 1XJCA 5BYJA 1W44A 1ZW6A 1E6CA 1IQPA 2IF0A 1ZNYA 4PC7A 3MGCA 4DCNA 3CRW1 1HA3A 2GXQA 3LD9A 4XWOA 3OIUA 3OESA 1TQ2A 4MGYR 3LO5A 2O8EB 2RAPA 3M1IA 4XWAA 5HCNA 1GKUB 3J81k 3GD7A 2CL6X 2B7BA 4AYXA 2V6IA 2QBYA 3AGQA 2D3WA 1OYYA 2N46A 3DMDA 3GFTA 3KTAB 4RFSB 1OF1A 2GEUA 2GXUA 2A7QA 4P4UA 2L0XA 4ZPXA 4LC0A 2VP2A 3SR0A 3WYFA 3CKLA 3GEHA 1P9NA 2GEVA 4EFMA 3DPUA 3KXIA 4NHOA 4OHVA 2Z5FA 1K8RA 1P9RA 1X8KA 2W6JD 2O8BA 2CK3D 4C0LA 1XEXA 4O25A 3SE0A 3R8FA 2OILA 2V8OA 3GLHE 4DSNA 5J4KA 1ZMXA 1GKYA 1COWA 4DIDA 2Z43A 3KXLA 4LHYA 3QKSB 4MRRA 2HJGA 2ZRAA 4KFUA 1OPXA 1TNDA 1G5PA 3IQXA 1Z0KA 4GP6A 3C41J 5SZJA 4CT4B 1ZCBA 2D74A 1NMXA 1YZKA 1ZAKA 2FSFA 3B1YA 4TT3A 3X1DA 3GLIA 4PX9A 1Q20A 1N5JA 4A0GA 3O8CA 2BMDA 2FEOA 3THYA 1AZTA 1IXRC 1M1YE 1ZINA 3DO6A 3HPQA 3K0FA 3PUZA 1G19A 1VYUA 2RGNC 3LAWA 4QJ5A 4A8JC 1Z6AA 1ONBA 1VIAA 2YVUA 3BH0A 5FI1B 2YKGA 4A0HA 1OH7A 5BN3A 3CBQA 4IHQA 5E7JA 1KI8A 3L8YA 2W6IA 1ELOA 1XJQA 2P5SA 4TLCA 1J99A 1IHUA 3TAUA 4KO8A 5JSZB 3UG7A 3P1JA 5C2JB 2YOFA 2ZJ2A 3UMSA 1J8YF 4I1SA 3LLMA 3U7FB 3OIVA 3W9YA 4B76A 4LSGA 3EC2A 4TMWA 2BCGY 1ZJ6A 2ZEJA 4UKDA 4KI0A 4B3FX 1CEEA 4LC1A 4B3BA 2JIZA 4GOKA 3FHCB 5DE3A 2RHDA 5C46F 3U44B 3K70B 1Q21A 2OLKA 2MMCA 3FB4A 1SXJE 3GEIA 3MUFA 3PEVA 4AC9A 2OCPA 1R5OA 2IEZA 3EW9A 4JLNA 1S4QA 1XEWX 1SVKA 2NPFA 3TNFA 2XTNA 4LJ5A 5CB6A 1IM2A 1F3OA 1T9HA 4Q1EA 3L0IB 4M2LA 5JEEA 1YR8A 2HEIA 1P75A 1RYFA 2J9RA 2NO9A 1G7SA 3G0HA 3NEJA 4IOMA 4CEJA 221PA 4A8JB 4CT5A 4PAOA 3GPLA 1QRAA 1D6JA 1UBGA 2C03A 3AVTA 2ZJAA 1KO5A 1ZC4A 2JLQA 1VPLA 2BOVA 2E87A 1XDBA 3I32A 1CR4A 3A1SA 3LDAA 3RRZA 4RFSA 2OLJA 1F48A 1E0AA 2AKYA 1AS3A 3CWQA 1JQLB 2QQ0A 1XCMA 1M8PA 4XWKA 4M1OA 4CYMA 4FMDB 2P2LA 5B58C 2ZYUX 2ECKA 2BJWA 2OZEA 3K0SA 4M1SA 3QKTA 1LVGA 3OHMA 4BEJA 1ZRHA 2YOHA 1W46A 2WM9B 1ESNA 3C5HA 4ZCIA 3IKJA 3QENA 3FHOA 1YZQA 1KK2A 4AWXA 2H5EA 3VAAA 4TYNA 1J90A 4K46A 3WMEA 3WP0A 2BBOA 3ZS8A 3U3OA 1CR0A 2WICA 4EPYA 1DO0A 2AD1A 1OFUX 4LI0A 1PUIA 2W2TA 4MYHA 1CF4A 1II8B 1DG1G 2QM7A 3GLIE 2KB0A 1ODFA 3R9XA 2CVFA 2O8DB 3T61A 4JL8A 1G8PA 4URZR 2IYVA 5L3RA 4GP7A 5FR2A 1N6IA 3DKPA 2OBMA 3THXB 4LHXA 3HDTA 3LWNA 1OYWA 4HATA 5G41A 5LBIA 3RRNA 4TTPA 1G18A 2FU5C 1OT3A 1DAFA 2GESA 4QNMA 4C0SA 1M7GA 1DAGA 3T5DA 4HDQB 2WWHA 3I92A 1T91A 5CYOA 2FPLA 4PHGA 3GLHB 5JI2E 1BIFA 2PJRA 3OAAD 3OZXA 5HZHA 4JMPA 3QSYA 4OJQA 1P2UA 1KDTA 3I1FA 1KDRA 3M6AA 3N2EA 1XRJA 1M74A 2F55A 4FWIB 2J87A 2RGDA 1UEIA 4E09A 3C4JA 4G1UC 4Z8YA 3B7GA 4TMZA 3GCGA 1H8HA 5BN5A 3THOA 4Q21A 1N6LA 3B6EA 4C0BA 2AX4A 2IL1A 3B1WA 1UKYA 1GRNA 3MFYA 2J41A 2VRWA 4UNQA 1JECA 3QG5A 2YC4C 1KI9A 5EXSA 3IO3A 3QI2A 4TL6A 2C9OA 4JYBA 1UBFA 5F9HA 4UJ5A 2Q9BA 3QXHA 1HH4A 1E32A 2I1VB 3THYB 5B57C 1Q22A 3BWDD 5JLJA 1PVOA 2XTMA 2ZRIA 5E4FA 2B21A 4YMUA 4RCZA 1CJUC 3MG9A 4C2TA 1JPJA 2DWQA 3PR1A 3UATA 4PZYA 3AP2A 4RCYA 2NMVA 3GJ0A 2NIPA 1CLUA 2R2AA 4P31A 5G3YA 5JI3E 1S8FA 4B73A 1YZLA 1LFDB 3CONA 3RS2A 2ZRKA 4RZUA 3N2IA 1H65A 1AS0A 3AF3A 1OFHA 4ARZB 4QL3A 4R2IA 4LUCA 1BO6A 3VR5A 2AXNA 4GOJA 4QRHA 2P6UA 1MT0A 2BCJQ 2WWXA 3KTAA 2NZ8A 4KCGA 5HTKA 4EFNA 1VHLA 2PT7A 1Q1ZA 2PX3A 5KUTA 3TIFA 5BQ5A 4OQMA 4NCJA 1DOAA 4H9GA 4Q7JB 3CB4A 4QBHA 1XTKA 2Q9CA 4OQLA 3K0AB 1NL3A 3ICQB 2P67A 5M04A 3KUDA 1QHIA 1RRPA 1GWNA 2D06A 2FH5B 2UZ3A 2WJYA 4OBEA 3R8CA 3SU8A 4BLOA 5F98A 4A36A 4OL0A 3TVDA 3BB1A 4PQYA 2WIBA 5ELXA 2A3RA 5FL3A 2GVZC 3V4RA 4LJ4A 3KB1A 4GRAA 5CYPA 2OFWA 4NYMQ 2WIAA 4RSGA 4W9MC 4Q9KA 3UKDA 2V7QA 5CM9C 3BB4A 2HF9A 3CIOA 2ZSEA 3EC1A 4JIMA 4M0LA 3FMIA 1Q3TA 4M1YA 4ZIRB 4GZLA 3CZPA 3LH5A 4A4DA 4Q9LA 1TUEA 2IX3A 1BYUA 1S9HA 4P33A 4BASA 3ZD6A 5H70A 1YKSA 2GJ9A 4RVCA 5DH9A 3R9IA 5KNDA 4B3GA 2ODBA 2IEYA 1MV5A 3OE7A 1CJVC 3DKVA 1VCIA 4Q9IA 1IY2A 4BLTA 4E07A 4HZUA 4MYTA 3BE4A 1L4YA 3WHKA 4MGKR 2B7CA 3CPEA 3RS3A 3GLFE 1B23P 5FBQB 3KUCA 1E94E 1KZ7B 1WXQA 1Z22A 4DLYA 3EIQA 2JCSA 2DWOA 5D3MB 2C2HA 3AKDA 4DWJA 5KPJA 1WQ1R 1OSNA 1U94A 1C1YA 3RWMB 4D26A 4DLSA 2HF8A 3FYHA 1FQJA 3EX7C 4IOJA 4MQBA 2WJVA 1XTSA 3TKLA 3C7KA 4KFSA 3KKMA 1GNRA 3EWSA 4BLRA 2ZIAA 4PHTA 5SZKB 2G0TA 2QA5A 4BECA 3CM0A 1XCPA 2NGRA 1X8JA 4PC3A 4YMVA 2VEDA 4TZ0A 3T1VA 1IONA 2ODWA 2ZUBA 4V03A 2Q21A 1R8QA 3D8BA 1YHNA 1KY3A 2A9KA 1ZUHA 2WBLC 3ZVMA 5DN6A 2VP0A 2PLFA 1SKQA 1ZD8A 4M9SA 1XD8A 1E79D 3A1TA 1AA9A 5FPHA 4ZI2A 1G5RA 4D4LA 3PUYA 1XU4A 5GVRA 3R9WA 1HEIA 2PBRA 5DYIA 1U2RA 2C77A 4IDQA 1WDTA 4HAWA 5HZKA 3U6BA 4JT4A 3AKEA 2I1QA 2XJ4A 1RIFA 1Z29A 2F1JA 3V4FA 2BHRA 2QE7D 4IEEA 4WVFA 4MRVA 4PXAA 5FOUA 4BZXA 4TMXA 1Z6TA 2IK8A 2WKRA 4X8OA 2O8DA 2QN6A 3NBFA 3KKPA 3L82B 5HCIA 3TQCA 4CEIA 1SXJB 4QM7A 1RZ3A 2ZRGA 1WBDA 1G7RA 2QU8A 3OEEA 2G88A 3MWYW 1G64A 2CL7X 3BH6A 2ZI9A 3ECCA 3MRSA 4LZZA 1CJKC 1QHYA 3IHWA 4IOLA 1D9XA 4NCIA 1F2TB 3EASA 3SQXA 1XTJA 4DUGD 4TQ9A 4PC1A 4JS0A 4UNNA 1F6BA 5FL7D 1JAHA 1EFRD 1L4UA 1XXHA 2IUSA 3EAQA 3NG1A 1KAOA 2ZJYA 4C7OB 2A5JA 3SFVA 4Q7MB 1NN0A 3GJ8A 3UMRA 2QMOA 5HPYB 3AVYA 1L2TA 3LLUA 4AKHA 2NQ2C 2B8TA 2R62A 2FX3A 2ORIA 3U3KA 3CPHA 4Q1AA 2EFCB 1HYQA 2A2ZA 1JPNA 1YVDA 3TBKA 3TSZA 2C95A 4Q9JA 3IIKA 1F5NA 2IYTA 4LJAA 2J7PA 1MABB 3ONWA 4TL9A 1W0JD 4JVLA 1AQYA 5EE9A 3SYKA 3WBKA 4A8JA 3HU1A 1IOZA 4A15A 4Q48A 4PPGA 3T06B 1MOZA 2OXRA 1TF2A 4C2UA 1UPTA 1XP8A 4KVGA 1SXJD 2N42A 2BBWA 4YMWA 4YQFA 4HB4A 3WMGA 4XVQA 2DR3A 2V1UA 3CUEF 3IEUA 4Q5IA 1GKIA 3EPKA 4HYYA 2AN9A 4P0TA 3VKHA 1FNNA 2QPTA 1NBMD 3IHLA 3PG5A 2HJVA 2JJ2A 4BZQA 4DKXA 2ZPTX 3RAPR 1Y3AA 1OIXA 1ZBDA 2ZSFA 5JCZA 3U7EB 3AUYA 2FDCA 2GJAA 3CF2A 3SBEA 3P4YA 5K8LA 3AVVA 1D2MA 1FOEB 2VTKA 3K0AA 4HB2A 1MO3A 2JA1A 3MLEA 5KYKA 4L9SA 2LCFA 2X2EA 1UF9A 3P4XA 4X8MA 5TDHA 3NKVA 2N1BA 5AUQA 3H84A 3BFVA 4JVSB 2JLRA 3GJ3A 2R6AA 1KIMA 3AVOA 1DELA 3BS4A 2WOOA 4XTRA 2QQEA 4XSGA 3M0EA 1NBME 1YZTA 1O3YA 1XF9A 3PCRB 4GI7A 3QPUA 4IW3B 4BEBA 4RKEA 5B30A 1YZUA 2Q3HA 3SN6A 4DC9A 1XMJA 5C1BA 1FTNA 5FUVA 1IBRA 1AN0A 3TK1A 2XX3A 2I4IA 1NVVQ 3BFXA 1VCNA 1XMIA 4URUR 1IN6A 5JCPA 3B1ZA 3LW8A 421PA 1CRQA 4Y0AA 3T35A 3N5CA 3ZVLA 2IWHA 5KSZA 1XJ0A 3Q8XB 4QJ4A 1OB5A 3SZRA 1FMJA 1KZGB 1CJMA 4NONA 5JECA 5A0FA 3WRXC 5JJKA 5FOVA 4JLKA 3DZDA 2WWGA 3RVBA 4FWTA 5AJZA 2PCLA 4XD7D 4EDHA 3P27A 1UKZA 1ZC3A 3NH6A 1AKEA 3Q9LA 4PO9A 3RNLA 3SJBA 5C4GB 4Q47A 2OCAA 4HSEA 3EIEA 4Q4JB 5GJVC 4NYJQ 1I4DD 5DI9A 1W4RA 2A5FA 1CR1A 2KI5A 2ZE6A 4Q7KA 2WWYA 3CRRA 2VSXA 3ETLA 2WWFA 2R6GA 1S9DA 4M1TA 4JZKA 1CIPA 3W6OA 1Z06A 4W7SA 5B2ZA 3U4QB 4TT3D 2IYLD 1RJ9B 2ANBA 3AP1A 1E0KA 3LQQA 1NVWQ 2Y8EA 1NG1A 4HB3A 2JLXA 4JBYA 5FPYA 2CHGA 3VX3A 2OBNA 1N2CE 2NOAA 5TARA 1JR3D 1AS2A 1Z0FA 2F3TA 1UFQA 1RYHA 1GNPA 2CNWD 2O8CA 1QZXA 3BIFA 4HAYA 4OK5A 4LYAA 3G5UA 4GMDA 1OHHD 4RKFA 4WOPA 5C18A 1CULC 2AWOA 3WHLA 1VTKA 2HUPA 4OKSA 4ZDKA 1N0WA 3UPUA 4OQFA 3WY9A 4FIDA 2J7KA 1GFIA 1KSJA 1X1SA 3CNNA 5DSZA 4H1UA 2ZTSA 4AK9A 4US2R 3CO5A 3ZVNA 2AWNA 4URVR 1PUJA 4Q1FA 1NG9A 3RSOA 1Z0JA 2EFEB 5JS7A 1N6OA 1KK0A 1S96A 2Q3FA 4MRPA 3S1AB 4F93B 4HAXA 4TSFD 3VTKA 1P73A 1N6NA 2RGCA 2AR7A 2EQBA 1TUIA 3DM5A 1P6XA 4IVRA 4LCBA 3FKSD 3OEHA 5GJWC 3WBJA 1M7BA 2D7DA 4YONB 4AKIA 1IN7A 521PA 1YE8A 8OHMA 3SC3A 1U8ZA 2FMXA 4JLMA 3SJCA 3H86A 1R6BX 3RABA 3NBXX 5KPDA 2Z6VA 3KJIA 5HR5A 1DG3A 4D80A 5E7IA 1QBKC 2GEDA 3EZFA 3LVRE 3W3AA 2OV2A 2WPDA 3PFIA 1AZSC 4NE2A 3GMTA 1XD2A 3X1XA 2JLSA 2CLDX 2ZRPA 1KMHB 3EG5A 1TF5A 2ERYA 5EQTA 3X1WA 4EPTA 2BV3A 4FN5A 4G01B 1D8TA 1F2UA 1E2IA 3DM9B 3OFNA 2YINC 4JKIA 5CM8B 4EFLA 3BK7A 4RZ3A 4O2RA 3P20A 1A5TA 2G3YA 2LKDA 3FKQA 2EFDB 4CVNA 2G83A 1U98A 1WRBA 2FF7A 4BWYA 2MSDB 4IKEA 1KNQA 1M2OB 2J46A 1U8YA 1E1QD 3Q7PA 1G20E 4BFSA 1G8HA 1G4AE 4Q9HA 4AG6A 2XXAB 2P5TB 4QGGA 1Z6XA 3VU9A 4A2QA 3U44A 5LPNA 2REBA 1NLYA 1G6HA 2IYRA 2QTHA 4Z1MA 2GETA 2I3BA 1P62B 2GF0A 1XPOA 1OH5A 2FN4A 2JLZA 4DDTA 5DYGA 4TYWA 4CF7A 2FFHA 3GEEA 2JJ1A 2GCPA 3BAFA 2BKUA 2JLWA 1KDPA 4AG5A 4R2HA 3EZ6A 1UJ2A 1XEFA 2XSZD 5FUWA 5AUPB 2EU8A 5JBQA 2XNDD 1VDZA 4JBWA 1UBCA 1IJFA 2ZVPX 3PEWA 3BD9A 4KSBA 1EWRA 2Z0MA 2VSOA 2IW3A 5FI0B 5CLQA 3WMFA 1E2EA 2PZFA 5CIQA 1NJGA 1UEJA 4LYFA 3IILA 2WTUA 4EAQA 4B34A 4EJSA 4RY2A 4YLGA 1M6NA 1RJ9A 1QHSA 4IFEA 3AF1A 3KJEA 4TLDA 1NN3A 1OW3B 2IUTA 2AD5A 1KO7A 3UANA 3IPYA 3JVVA 1Q3HA 1EWQA 3VR3A 3L43A 1DEKA 2FOLA 3NHBA 5CK5A 5FOXA 1BS1A 2RH5A 2JDIA 2BMEA 1P61B 4DT1B 2CHVA 1MH1A 1VYVA 4CRWB 2ZSBA 1TEXA 1CKEA 2EYUA 2QENA 4NCHA 2OCYC 1IJEA 3GJ5A 3A1WA 2VLIA 5CK4A 3REGA 3ICEA 1N5KA 1SGWA 2VP6A 3E5HA 2XOKD 4DHEA 1KO4A 3IBGA 1NIPA 3PENA 1VYTA 2QT0A 3AQ4A 2FPKA 4FD2A 5AR1A 3QXSA 4KLZA 4PO8A 1W4AA 3PEYA 2QORA 5CIWA 4GBMA 4OJKA 4PANA 1T8UA 3P26A 4F92B 4NCKA 3CNLA 3A37A 3AUXA 1XXHE 4DLZA 1UBEA 3GLHA 4HI0E 1E9AA 1N6KA 5CDFA 2QP4A 1KO1A 2ZUDA 3QBTA 1KSGA 4JLVA 4UXIA 1N6PA 4WAUA 3W5IA 3ZH9B 1T3LA 1SQ5A 4V0OA 4B6FA 4P4TA 2ZJ5A 2ZAOA 3RDPA 1Z6GA 2DBYA 2QMEA 1P2SA 2ZSAA 4LBWA 1I4TD 1FL9A 2HLDD 4KU4A 4UNPA 4TN1A 1PLKA 1GUAA 1NY5A 1EG7A 2DB3A 1AGPA 2OM2A 4DDVA 4NBSA 3K0CC 1PLLA 3EZ9A 1TTTA 2V4ZA 4AIIA 2QAGA 3FPAA 3O8BA 4POAA 2O8CB 1KKMA 5KSOA 4QGHA 2E9SA 4TQUS 2FGJA 4N0EA 1MRSA 2BM0A 3C8UA 4US1R 3KKNA 3U61B 4DCTA 3RRMA 2CLCX 5DHFA 2PEYA 4B2IA 4LYHA 1DO2A 2KSQA 2ZJ8A 5JHHB 2CBZA 1G16A 2ZS8A 4YC7A 3U3JA 2KJQA 2DY1A 2H16A 4IEIA 4MKGA 1NVVR 3QF4A 2XTZA 2CCGA 1WP9A 2IXGA 1XD9A 1M34E 3FOZA 2WWIA 2QPAA 3SS8A 3GP8A 2CDNA 3O8RA 3BJIC 4EPVA 1NSFA 2D2EA 1TQ6A 4A0FA 2ZANA 2D4HA 3MCAA 5F3WB 2QTVB 1GZSA 1W0KD 1OKKD 1ZNXA 2OHFA 3QIAA 4PC2A 3WXMA 5C4MA 2O8FA 1ZU5A 4Z54A 2VHQA 3CRVA 2ZUCA 4LBZA 3B85A 1ANKA 2BDTA 1US8A 4RJLA 1ZU4A 1AM4D 1HE8B 1VECA 4GNKA 1XEXB 4JL6A 1HV8A 2ZRFA 4YMSA 1N0UA 1OJLA 1E9DA 5JWOA 2QY9A 3PV0A 2PLRA 4A6PA 2NZJA 3B9PA 3JVUA 4P4SA 2WJHA 1KHTA 3A6PC 3LY5A 3TLXA 1XZQA 2W0SA 4ZO4A 4F4CA 1W4BA 2XEXA 2IS1A 3EA5A 1EFTA 2KBFA 2XXAA 3LRPA 4JVNA 2AKAB 4BLSA 4AYTA 5IK2D 1N5LA 1E2MA 1B0UA 1W2GA 1KNXA 5HE9A 2OSBA 3Q3JB 4Q00A 3C16C 5KSPA 2GK6A 1MKYA 2F43A 4TYYA 1HQCA 1P7CA 4RZXA 4PC6A 2RGNA 4NU0A 1P2TA 4WXRA 4XH9B 3FHTA 1Z2AA 4AY2A 2GAAA 4KV9A 3EPJA 4PSAA 4PPQA 4ESHA 1RW4A 4E22A 4M9QA 1KI1A 2QRNA 1NVXQ 4QXAA 1GIAA 4I99A 3ZQ6A 3RHFA 3EZ2A 1Q1EA 3K09A 2FFBA 3BBPA 3JZMA 1K5DA 3DVLA 3LW7A 4QGAA 3SOPA 5FPTA 1MO4A 5TY0A 3TUJC 4CW7A 5JFGA 3CR8A 3A1VA 4OK3A 2IUUA 4JVMA 1SVMA 4G5SA 3Q85A 1OH6A 2H57A 2VHJA 4CGZA 1CBUA 4KFTA 4MKFA 5EXPA 2ZRBA 4C4PA 1E0JA 3ND9A 5L8VA 5JJLA 3E1SA 4OYHA 1FUUA 1T4GA 3BGWA 2GA8A 2RGGA 4V0NA 4DT1A 4JLOA 1BH2A 1C4OA 4D81A 4JT2A 3T1QA 3K70C 1ZNWA 2R6DA 2OCBA 4LJ6A 5J4LA 2ZR7A 2IYWA 4PPFA 2OUKA 3ADDA 3EPLA 2R6FA 1W1WA 1E2NA 2UKDA 4FINA 4D4MA 4Q4AA 3QVVA 1VG1A 2ZRMA 4TL7A 1YJ5A 4LJYA 2DCUA 4Q03A 3GLGB 4DLXA 3OIYA 4QG7A 4HLQB 1F2TA 5DISB 1XNJA 4D0GA 1XB2A 1KK1A 2GZHA 5FBRB 1U0LA 2OO7A 3AVQA 3NVAA 1GOTA 3SHFA 3UXMA 1D5CA 2BVNA 2OG2A 2O5VA 2VHTA 4EQ6B 2J5XA 1HT1E 1UDXA 3NWJA 4C0AC 2XAUA 3IUYA 2AL7A 4XIGS 1Q57A 4GZMA 2TMKA 3FMPB 1TQDA 3GJ6A 4NCNA 4HDOB 4BZPA 2ZRLA 4HLUC 2CJWA 3KL4A 4CDGA 4B75A 1OV4A 2ZREA 1KAGA 4WW0A 4P4SB 3KKOA 3KJHA 4KAXA 2F1IA 2JASA 3B5JA 4LK2A 3ADCA 2F1HA 2O8FB 2IYXA 2B8WA 1XMSA 1US8B 2A30A 1VHTA 1T5IA 2X19A 3Q7QA 3PIRA 2WMOB 2FFAA 4KVAA 3CH4B 2OAP1 1W36B 1ESMA 1JI0A 4QNRA 5KNCA 2R6CA 1IXSB 1P5ZB 4LHWA 1LTQA 4Q18A 4BLPA 2ZJBA 4NMMA 2HDNB 3TSOA 1LF0A 1D2NA 2W83A 1VG9B 4DVGA 1H8HD 3SQWA 1ZD1A 2ZI6A 1GDDA 4TZ6A 4B44A 2GJ8A 2WWWA 2QROA 4EUNA 5DI3A 4Q4LA 4V0KA 1NN1A 1E1RD 2CK3A 1TU4A 1KYIA 2JGNA 3HWSA 4K8OA 2BC9A 4FMCB 4CZ2A 3PVSA 4ZDIA 1BMFD 4WZ6A 1E99A 2C78A 2Q0HA 3CPJB 3QUSA 4KJZA 1DVRA 2PL3A 1NLZA 4U7DA 4DZZA 3PEUA 1TU3A 4EPWA 1Q0UA 4Q1DA 1OFTA 5TVKA 2QTFA 1UKVY 3I62A 3THWA 2FV8A 3DL0A 2HV8A 1HT2E 1KI6B 2QSYA 1Q1QA 2PMDA 4Q19A 5EP4A 3CX7A 4HDCA 2IXEA 5BN4A 1R2QA 2KBEA 1JALA 3B1XA 4II7A 3WNBA 5DN6D 3LV8A 4IDPA 3IGFA 5BWMA 1Q1BA 2WV9A 2FFQA 1TMKA 1KOFA 4FCTA 3KQLA 3D6TB 3DOFA 4HZUB 1LF5A 1N0VC 4WIAA 4DBLC 3NTUA 1RRFA 1U9IC 1YR9A 1GTVA 3QKRA 3I72A 2VF7A 4RD3A 3HU2A 4BFZA 4X8HA 1VG0B 3RS7A 3FFAA 3SYLA 2CNWA 3U3MA 3U3RA 3MAAC 2BMJA 4C0JA 3CF0A 1KJZA 2VF8A 2W6ID 3RANA 1OIVA 2FNAA 4TYQA 3VQTA 4CEHA 3K9GA 4E03A 4CEHB 2REOA 3F3YA 3OEED 3X2SA 3E2IA 4JJZA 4BRWA 4DLWA 4S35A 5JZVA 2W2VA 2ATXA 3W5JA 1E9BA 2IT1A 3AF0A 5A5GA 3ADBA 1E9RA 4OK6A 4BFWA 4L9WA 2JAQA 2YOGA 2YYZA 3FMOB 1E2GA 1J8MF 3SFZA 4M21A 4XJXA 4A0RA 2NO7A 3ZZTA 1N6HA 1F60A 4NKRA 1NNEA 2R9VA 2JLVA 2F7SA 3L0SA 3KFVA 4O2LA 1XCGB 5CB8A 4KFRA 2BBTA 1I2DA 1CU1A 3FDIA 3HPRA 4RD2A 1A4RA 4TWZA 1N25A 2W2XA 3H2YA 2AK3A 3C15C 2F1RA 5FFMA 2FZ4A 4IRUB 4O3MA 4NP6A 2VHUA 2GKSA 4F4IA 2RB4A 2ZE8A 2ONKA 3I4LA 4CEJB 4C7OA 5G40A 1P72A 3LX8A 4CIDA 2ZI3A 3PUXA 4BFUA 2J1LA 2QI9C 1G8GA 3NIBA 4QHSA 5BW8A 1HE1C 4EPXA 1NY6A 1BKDR 3O8DA 3Q5DA 4DLTA 1QHHA 4BFTA 2QMUA 2NTYC 1DAEA 1NVUQ 2EWVA 3T1OA 5K8IA 3T15A 4L4UA 1IXZA 5FBVB
chains in the Genus database with same CATH superfamily
3BL6A 3AMVA 2O2DA 2P9QA 3G1TA 1QM5A 4OB6A 3JQQA 3E9MA 1N1EA 1SXJA 5GV8A 4KNVA 3WYBA 1A5ZA 2IZ1A 2PFKA 4XUGB 3K4HA 3V46A 3ZWCA 4DJFC 2Z09A 4EHBA 2UUCB 1S2MA 4C6TA 2CNKA 2CE2X 3WGYA 3ZWXA 4CLRB 5HQTA 5ICMA 4GDFA 1IAQA 3U7GA 2FN9A 2DTDA 5TS2A 4OQQA 4NDZA 1TKAA 4XCVA 1XA3A 4XIFA 3N2YA 2ISSD 5A4JA 1LSOA 5SYMA 4X6LA 2R8EA 5KINB 3T38A 2ZR9A 1NP3A 1GCAA 2C8VA 2QVZX 5G53C 1R6DA 5AHKA 3MWLA 1E2DA 2GXSA 1A2BA 4MA0A 4I4IA 3EG9A 1U0GA 1S0UA 2ZI5A 1Z5ZA 4BNDA 1W8IA 1VIYA 4JLUA 1ZM2A 1E79A 5IASA 4ZARA 1QF7A 1J2JA 2PGIA 2WKPA 4ID9A 1H3EA 1TO1E 4DMCA 1SOAA 1NT2A 1YJAA 4NG5A 1QPBA 1TF7A 3AHEA 4C4TA 2QLFA 4LI3X 2OV4A 2OFXA 1M5TA 4OX9Y 5EXTA 4CLXA 2RHBA 2ES4A 1M72A 3DL2A 4P1ZA 2GCOA 3L7LA 4KLAA 1U99A 1RPJA 4XM2A 1TPZA 4HYQA 4ECAA 5JLAA 1TA4A 3TFQA 1SUDA 4A8TA 1NVDA 3RVSA 2CMKA 2H2AA 1N3BA 3B78A 3P0IA 2QYSA 4PPNA 4RVOA 4X3CA 3DOJA 3STWA 2IZ0A 3OLVA 3CN9A 1WU8A 3W9SA 4HSGA 2QEQA 5F64A 3TVYA 4DWWA 4UAUA 5KU1A 2D0IA 2WIGA 4RBNA 5EZYB 1S7GA 4H0CA 5M7EA 2B37A 4RTNA 1O94A 1PF7E 5AJWA 4DQLA 4U63A 3ZIAA 3FE2A 3TDNA 3W2FA 3SY8A 1CEXA 1EE2A 2QV0A 3FMGA 3OTGA 4MB6A 5IVIA 1FRFS 4R5MA 4R7ZA 2XVZA 3AKYA 4N6OA 5FL7A 4WZBE 2R7AA 4Z4QA 4ZHQB 1PL8A 1P1JA 1Y42X 3W5VA 1WPXA 2PZEA 4HTFA 5FTWA 1ZUNB 2J32A 3LBFA 1WD5A 1DI0A 5G3ZA 4KXMA 3KWJA 5DX0A 3VXKA 3LU1A 4QT0A 3DV2A 3LBHA 1HZJA 3FOWA 1GZ4A 3G02A 5BR7A 4R41A 2HYDA 3E5NA 4TN5A 5CP8A 4AO8A 2WY2D 1NI3A 1WMFA 4HDAA 2W8BB 1E8MA 4K9PA 2IC5A 1N2EA 4CIYA 2OMKA 1K97A 1M2JA 3IERA 2FJUA 3C3WA 3SEFA 4KTTE 5L3QA 4H1WA 4AMUA 3VI4B 4RDIA 5C31A 4W63A 2NO0A 4L9AA 5F78A 3MWEA 2ZTUA 2PEZA 2ICAA 3FFBA 5CJPA 5A3QA 3HVRA 3O3NB 1JEYB 2EV9A 3ZE2B 3BIJA 5DXJA 3AF4A 2Z8XA 5K2OA 5DYWA 2HOQA 5EJ5A 2WU3A 1AKWA 2XA9A 5J1SB 1DQRA 4NYIQ 4EGFA 1NSTA 2B69A 3QWFA 4LQLA 4C0HA 4ON9A 1JF8A 1R0LA 4MIKA 1J9EA 3T12A 4DEVA 2XCSB 1PGQA 5THQA 4HKTA 3RU2A 4EYQA 1EFPB 1UWCA 2X9QA 3F4KA 4TXLA 4KITB 2XDYA 1NXVA 2QTGA 3EFOA 1QP0A 1N5RA 1UMCB 3ASUA 3U3DA 1TVMA 3Q7TA 2BL4A 4FMDF 4QOGA 2AOXA 3SDZA 5JHGB 4TRMA 1ATIA 4ZICA 2CD7A 2NTJA 2Z2XA 1T3ZA 1WMAA 3P9CA 3AL3A 2OXTA 4XSHA 3LFUA 3FSRA 3E0QA 4BCCA 4RIFA 1V39A 3FYDA 5ILOA 2JGIA 5DM4A 1RI3A 2BFCA 4JEUA 1JT9A 4V0QA 1UJ4A 4RKYA 3HA3A 3LRTA 3VNAA 3OP1A 4G23A 3GLVA 4KNYA 1EDZA 1I32A 3DE6X 2BJVA 2WZBA 2P9JA 3D43A 5AJVB 1F2VA 1GQYA 5LZ9A 3A9CA 1Z08A 3TD9A 2CDBA 4JCCA 4WXHA 4ZT7A 5HCUA 4H6VA 3W3ZB 3OEHD 1Y8QB 1JG6A 2W6NA 3GFFA 1PDWA 5JQGA 1K2WA 2QMHA 1GRRA 5AH0A 5JWHA 2X6TA 4IDNA 3BRQA 5BN1A 4TWBA 1Z6ZA 5J4VA 3RSZA 1IM8A 2WG2A 3IESA 1MC5A 1S1MA 2C5EA 4GX2A 1ZDMA 3L49A 4CHGA 4DIUA 5AVZA 5SICE 3T3EA 4B6RA 4F1JA 1FRZA 3A0UA 3V00A 1Y63A 2BM1A 1M1YA 3MUNA 4QTTB 1KAMA 5F2EA 4AUMA 4YUXA 2HTEA 5JNRA 1EWVA 4UAVA 3S40A 1IMOA 2PMKA 2GTIA 1GUZA 1Y1PA 3C7CB 1RHMA 5B3JC 3X2FA 2YXDA 2R11A 5JG7A 2AQHA 1SHLA 2GEKA 3D2AA 5ALQA 5EWLA 5M2QA 4D79A 1NNSA 4MWBA 4AKGA 1GRQA 2JI7A 4PAWA 1AU9A 1E0DA 4E33A 1P1RA 1IL0A 2LUOA 1NYQA 3PPXA 3RC7A 2HRQA 3WLPA 5LP6F 4U0KA 3I0ZA 4QZVA 4RFLA 4MVJE 3WNQA 2YWJA 5B4UA 2XY4A 1SMKA 1YZGA 4FFBB 4NOLA 3UT6A 4D5EA 3DBLA 2YR0A 2X4IA 4HZGA 4KXFB 4DV7B 3DZ8A 1E96A 3BEOA 4YRGA 4N5HX 3PQ7A 1LQUA 4QUKA 1X80B 2ACKA 2O7RA 3E81A 4M8LA 5AWFC 5KYNA 2C0QA 2FZEA 1IN5A 3K9NA 4BFYA 2CVQA 3U9LA 1PLJA 2QYOA 3LGXA 3DOEA 4JX9A 1IY1A 4PHCA 4TSKA 2XEDA 5BUCA 5G0TA 1E5VA 1SXIA 2UXCB 3R9XB 1WF3A 2PRKA 2C84A 3AR4A 2VO1A 1T5LA 3WB1A 2XJ9A 3R5KA 1U0EA 1XQ6A 3E35A 2W43A 3KJZA 1TOAA 2O2HA 5CGZA 2VJPA 4YQZA 1CQXA 2NUTA 4PFKA 5HYVA 3LXRA 1CS4C 3IJEB 3L6RA 5HDQA 3SWWA 1IK4A 1MO5A 1XZJA 3AKCA 1JYSA 4G5GA 5KHAA 4OP1A 5IRCD 1N9KA 2VF4X 1FX0B 2CLKB 4FHZA 1USUA 3ZZ0A 3AVUA 1D2EA 4BFCA 3EWAA 4XOUA 1MZPA 1ZUD1 3DG9A 4EY4A 1T0JB 4EY7A 1B2LA 1VE9A 1EVKA 4R83A 4NPAA 3SQMA 1PJRA 1QTIA 2X7JA 3L8GA 2E1RA 5BO5A 3C5VA 3CLVA 1K9VF 5JAQA 3L7YA 1EMDA 2JBWA 3PA6A 2XDAA 3GLSA 3CNQS 4PZ9A 1CQWA 2A6PA 3EBPA 3AVWA 4CKXA 3KQNA 1TU0A 2VDVE 1MR3F 1VBFA 3WSVA 5LNK1 3TRDA 3WLEA 3L41A 3F46A 4ZKEA 2I5PO 4AMVA 3INTA 1LDGA 3LYLA 5JSKA 3C97A 4LYEA 1DAKA 1M34A 4NY1A 4I4TF 2VXCA 1S6YA 1GGKA 3PPVA 1L8AA 4DLVA 3OKFA 1NFRA 1JKJA 2GN2A 5FBHA 4FYXA 4AKEA 3TX6A 2WNHA 1RQPA 1U02A 2WTMA 5C80A 5C34B 1D6SA 2OFOA 1JIJA 2GCNA 4ZU6X 1N6RA 2WHPB 5IC6A 1VFPA 3B3QA 2P77A 4FE7A 5BXYA 2PLNA 4M89A 1F2DA 3QMPA 1NXTA 2ABWA 4EY6A 2YHIA 4RQAA 3HR4A 1P6UA 4HDMA 1CE8A 1CRZA 3G68A 1Q0PA 1K8QA 5F4BA 2HLNA 4O63O 1Z47A 2QVYX 2J9XB 4B3DA 2CFCA 2Q6KA 4J2TA 4EB6A 3FGOA 2LR0A 3HB4X 3I9JA 4XIJA 5BWCA 5FUYA 2X0RA 3EGCA 4D46A 1V4NA 1BZYA 1GA1A 2FEXA 3QUBA 1J1IA 1E2QA 1YBHA 1EFCA 1QGZA 1UAAA 1V4VA 3TR0A 2G72A 1FNSA 4RA6A 3UXYA 4H60A 1E2PA 4BMZA 1J56A 4Y6OA 4YMTA 3G8CA 3PQ5A 4ZEOA 1CJTC 4BVGA 3NC4A 5DVZA 4U00A 3PX7A 1QGDA 1UBLS 4Q3LA 4XQCA 2BTQA 1EDOA 5IBPA 3LXXA 3S8YA 3A2LA 2Z6AA 1JHQA 1GRVA 1UL1X 4L0CA 4IZHA 3LQYA 2FMUA 3SNHA 2OE2A 4FEGA 1ND5A 1I5RA 5AKXA 4MQLA 4PG7A 1SIWA 1THZA 1XBTA 1O6CA 4TPKA 1OI7A 5AW2A 1ZGBA 3NTLA 4EHDA 2OV6A 1VMAA 4JITA 3ZTWA 3AKZA 3MBOA 3C4VA 1E1QA 3KQQA 5EEHA 2CUTA 1GLNA 1U0TA 4W5WA 3SC2B 3EF3A 3BILA 4KO2S 1KK3A 3OX2A 2ZIFA 2JBAA 3KDSE 3IR5A 4E5UA 5E3HA 2E0IA 3K0FB 2QXTA 3AINA 3IBYA 4B3CA 4CMGA 5KKNB 1ONPA 2BR4A 5GADl 1BMTA 2ZI7A 1QFJA 4HH0A 3UHJA 4CG0A 2P62A 4DGSA 2PUHA 1T1IA 5E3IA 4AMYA 4P5EA 2X3UA 5HIAA 1PS9A 1DAOA 3W3AH 1PJZA 1YR3A 4UE3S 2BZ1A 4K9RA 2QAGB 3ZK7A 4CMJA 5TGZA 3GJ7A 2P4SA 2IWRA 3NDPA 3JQ8A 2W58A 3LBYA 1GARA 3MTAA 1U7WA 2K7ZA 4L0QA 1R8JA 1TAQA 1YGYA 2PXXA 3PQ4A 2P2SA 1ISPA 4KN5A 1KTVA 3NHLA 3ZI0A 4QJ3A 2ZLBA 1I13A 2HA0A 5CX4A 1T8SA 3S7TA 4F9GA 4UAGA 2R25B 2QRPA 1LW7A 2V59A 2AA3A 3KJGA 3OQ6A 2HX1A 3PQCA 2WUWE 4GHWA 1CUIA 1N1GA 3W0LB 4EMUA 2J0UA 3D02A 3EB9A 1P1KA 3IO5A 1TKRA 2NO1A 4JUCA 4KGDA 1ZH0A 3PITA 4NFLA 3QTTA 2NU8A 1JE1A 4DCUA 3FMFA 3NHAA 2ZRNA 1IN8A 1EIZA 3SBXA 3REFA 4ARBA 4ZHQA 3V8QA 2FPMA 3T1HB 4LRWA 4HGNA 4IZ6A 2O4CA 4RF5A 3RS0A 2Y77A 3SSOA 4URHA 3UWDA 4D4JA 4ESOA 1B0PA 4TVSA 1AHPA 3CXUA 4MPJA 3DR3A 4I9HA 2RGEA 3LKZA 3WLHA 5LN1A 3X3HA 1UMDB 1YZVA 1HQYE 2FMHA 2GM5A 3GJRA 5KNLA 1T2VA 2EBHX 4D2IA 5HKAA 1NJFA 3ANNA 4J4BA 8MHTA 3OZSA 2PIAA 2H06A 4P4NA 5C7OO 3K31A 3RSGA 1ZGJA 1VC2A 1XRMA 4CGYA 2BUAA 4FNOA 5DK6A 3UVEA 1GTRA 2ZSHA 4C29A 4GDMA 3S1AA 2XOKA 2WE7A 1UKCA 1GYQA 3IAS6 5BRAA 1HWYA 1MX3A 3M9XA 3MTJA 3IUPA 5MDHA 5ITZA 1U9CA 4L02A 3REQA 1A4XA 3FUUA 3HP1A 1FJGB 3RF7A 4AMZA 4AFNA 1LQTA 2FE4A 1ULBA 3ZDZB 2BN4A 4XM1A 4CM3A 3AG6A 2G1JA 3DFFA 1G3IA 1LJLA 3K9LA 3QKUA 4GYKA 1ORTA 3ORHA 4TLBA 5IAJA 4M9UA 3RRFA 4CQLA 4TTVA 1SIBE 3QSGA 2PRYA 2BAGA 3QYPA 4KHZA 5C0OE 3GVPA 9ABPA 2O8EA 2ZSKA 4HUTA 4D02A 3ZV5A 4JI4B 2AKEA 2E2WA 5EPOA 3K32A 1TM2A 4AF8A 4TQGA 5TF0A 5DGXA 2NO6A 2G6BA 4BP8A 4EB3A 1AUXA 3RSQA 1U3FA 5LM3A 4KUGA 1U81A 4YDHB 2QKYA 1WXDA 2HWUA 3H5LA 2D4AA 4WFKA 1IOVA 2JCXA 2E4AA 2Y05A 4JLJA 1WPGA 5E38A 4IJ6A 4IIJB 4BOYA 4QM6A 2EEZA 4LOHA 4LNAA 3C3BA 2AUMA 3U60B 4BC0A 4YCCA 1EXNA 3OI7A 3TRFA 5TLSA 4UW9A 3FVWA 5LP6B 4HT3B 4HRYA 3NALA 2GAFA 2YHSA 5KDOA 3VH3A 3GLGE 2GOYA 4MI6A 5KYVA 4D4KA 5JCJD 2QGFA 4IXDA 1FXUA 3EEOA 2IOQA 5LB4A 4NSNA 2MINA 2R2GA 3LK6A 3JYQA 4EKDA 4UNIA 2HCFA 1MU0A 1OWMA 1YU9A 4IDOA 4WLNA 3G5LA 4AI6A 3EDYA 3GUYA 4TTQA 4ZCPA 3LUKA 3W8FA 4F06A 2V54A 3NX4A 3QUCA 3U4IA 1EGVB 1RM4A 1E3JA 3IS3A 5DIZA 3PUHA 3ZWBA 3WVNA 3UT0A 3SX2A 5LC1A 1F38A 2A1TR 3W4KA 4S1VA 1C7IA 3T4XA 3ZHUA 3RH0A 1G59A 3IYLW 3DZJA 4KDRA 1GSHA 2R8RA 2ROQA 1RPNA 1QGED 3EXEB 5CM2Z 2ZM5A 1NJ5A 2AEJA 2RHLA 3AVPA 3QW4B 4HDMB 5JIBA 1QF6A 2V5UA 4KR7A 1VBKA 4NFHA 4C0QC 3KOYA 1O6ZA 3H0EA 2QOEA 1PL7A 5EIHA 4DLUA 1SVSA 4UEJA 1WB9A 2OD7A 1PK9A 2CXUA 2G71A 3IUEA 1Y34E 3NJ4A 3PF8A 1BXKA 4IAOA 4RXUA 4F3YA 5AVRA 1QK5A 1KERA 1ONOA 3E9CA 2G5TA 4HLDA 2O0HA 3DEIA 1T1RA 3QY9A 4Q9NA 2Z4SA 4U6SA 5EN4A 4CKCA 5IT5A 5KNDH 1NJ6A 4MARA 4QOFA 1SUCA 4GSYA 1OH8A 2HQOA 3FF1A 4QBGB 4F6LA 3VAZA 3JQ7B 3AFIA 5K3EA 3VJRA 1L7VC 1ABEA 3M6FA 3PWKA 2Z83A 2FPXA 2EJVA 3CNOA 3RYFA 1RJWA 3RRJA 3I45A 3JASB 2Q6TA 1ZSYA 1V16A 1RPAA 4MH0R 2YASA 2YCBA 5GVSA 2SKDA 1D4FA 5DBOA 4EA8A 3I30X 2O3RA 4QPDA 3T5PA 3DVRX 4MUEA 3DLPX 4K6HA 4WZAA 2OLEA 1SVLA 3M3DA 2XMBA 1PGJA 4UATA 4DNOA 1MO6A 3ZCVA 4ZDJA 3U1VA 3P0RA 4FR5A 1HG0A 5HM8A 1EVQA 1V1MB 3DOOA 4YRZA 5IZCA 4JXZA 1LBHA 3DLIA 2PWBA 2C5LA 3MWDB 2BBSA 4KYIB 5EL0A 4A5SA 5GIOE 3AR9A 4EHHA 2WT4A 4EKNB 1SXQA 2VHZA 2P30A 2PUJA 1I6WA 2EGUA 3MWJA 5EJ2A 1Y7PA 4D0LB 1IXKA 1QNFA 2OZPA 3QJYA 4LWQA 1IZZA 6AT1A 5HRCA 5L40A 4OBXA 5TC4A 4BX8A 2CHQA 1PO7A 4NOMA 5A7FA 1Z26A 3N6XA 3S55A 2PS1A 1KIAA 3RUCA 5DTRA 3KEMA 4ARIA 1R00A 5J4HA 1FBTA 1X86B 1ISMA 3N3BC 5K99A 1XP5A 1FFBA 4MDEA 1S2NA 3F6YA 1DC7A 4ZVUA 3RSHA 5JU6A 1GILA 2ORWA 3H16A 4CMCA 4D3SA 3QG1A 5EWLB 3Q88A 1FXSA 5LBTA 2VA8A 1ZIXA 1E92A 1A4IA 1FJ2A 2AFHA 2QR3A 2CBXA 3KPVA 3TZCA 4RORA 5HIMA 2ZYRA 4FB4A 1NMZA 3IVMA 4ZHQF 2V6FA 1VLQA 3Q40A 1RD4A 3T7DA 3VZBA 3B82A 3NRJA 2NQTA 3JYOA 4PZPA 2AGVA 1BMFA 4GM1A 5ARBA 3A3PA 3C98A 4ZPJA 1AMOA 5IULC 3LHIA 3OQPA 3UWMA 2DFLA 3SIXA 1FS4A 1LBTA 5HS6A 3EUFA 4C3OB 3JW8A 1ZIPA 3T7IA 4FLMA 4BUJA 4JAVC 5BSUA 1V5GA 1QYCA 2I7XA 4RPIA 4ZDWA 1L5HB 4HDSB 4UTPA 4FUTA 3F49S 1HOXA 4NARA 1OLUA 3KJNA 1OLUB 2VAXA 1C3LA 3LDGA 4PAMA 5AJYA 4ZAWA 3TVTA 3W8EA 4BLQA 5C9ZA 3W7AA 2C61A 2OVBA 4MX8A 4KR2A 3ZJ4A 3DAYA 1P2DA 2BKVA 1W75A 2A9QA 4NAVA 2E7ZA 1DQNA 2IV7A 1YZNA 3ML1A 4AX4A 3BCRA 3FCSB 2M9MA 1T36B 1GL6A 1Z28A 3KXDA 3VFDA 4L8GA 1JR3A 2AZXA 2NYUA 1P1HA 3AB7A 3CVXA 1EK6A 3LLVA 1FFSA 1MB0A 1QH9A 4I1VA 5HF6A 3U39A 4QBFA 4I9UA 3DEFA 3ZGZA 3RIXA 1EHCA 2BELA 4HVAA 3IUMA 4EQ6A 1UPXA 2Q07A 1CZUA 2G0AA 4PTYA 3UN1A 1UCFA 1LBEA 3IALA 4I4LA 3IUSA 1C2YA 4C14A 5T4HA 1NLMA 3I5AA 4BIMA 4KYUA 1QG6A 4URWR 2VXBA 1OXVA 4G0NA 4X3OA 1RI2A 3M9WA 3PUKA 2YW9A 4HUQA 2Q29A 4RL6A 4HQLA 5JSHA 2E4UA 3DDNA 1W4ZA 2XF2A 5AI5A 3INNA 3TI9A 4C5BA 4C7VA 2QBYB 3JYNA 3ZLJA 2C2ZA 1JFSA 3B5EA 2ATIA 4OY3A 3HHEA 3RSSA 4CNBA 4Q4JA 3OIWA 2X7XA 3DH0A 3EVNA 3JQEA 3T4PA 4LMRA 2QLJA 2J6BA 3PFGA 3JQ9A 1VLVA 3BC1A 3QPWA 5DGTA 3RHZA 3RQSA 3VR1A 5JAUA 3D3QA 5CBPB 3GLGA 2J8ZA 3AHCA 1XPRA 3GQBA 4D9KA 1V3UA 5KVAA 2C9DA 1G9TA 4ZVPA 3LHKA 1SXHA 4PRKA 3CCCA 3T7KA 5IWAB 1L5FA 2OHOA 4GT1A 3ZIDA 2CY0A 2YWEA 3EWIA 2VK2A 3THSA 1I1HA 4RKWA 1K7XB 1U9IA 4EG4A 1C7EA 2F3RA 3H5WA 2P7IA 4MI3A 3LT2A 2NTEA 4Q12A 4N18A 1QQBA 1YVUA 1MAHA 2Y9PB 3PHJA 1H05A 2IUYA 4BU0A 1JR2A 4XYMA 1X6VA 5EHIA 5AVSA 1M2KA 5FF9A 1FQWA 3CIFA 3HEAA 1LB1B 1QIKA 4JZYA 4ZQGA 3ZH2A 4DBZA 2J3KA 2QZ4A 1W7AA 1GFZA 4BNZA 1LLDA 2C99A 5T5QA 4CCAA 3AI3A 5K3FB 3OZRA 1TUBB 4J6FA 4GM0A 3ES9A 4L16A 1NQOA 1OKKA 1QAOA 1XV5A 1NWCA 1U7XA 2RHRA 2V55B 3TEMA 1YB7A 2O7VA 4BO0A 2XYHA 2ID7A 1LWNA 2IBMA 5K0TA 1ZJJA 1Z62A 2NG1A 1T5DX 2YQZA 1DXHA 1T1EA 1S01A 2X8WA 4P32A 4C0WA 3AVXA 1Z35A 1XAJA 1I01A 2EKPA 2WHRA 3B60A 5P21A 1CQJA 4M9XA 2VF2A 3AF2A 1LUAA 3ZHVA 1INLA 4FNGA 5FEUA 4AJOA 1RPZA 3RVRA 4CDRA 1AXRA 4MCIA 4RGQA 2VSNA 3OECA 5FBLB 1FMFA 1WCV1 2HWWA 3OEYA 3SJ7A 4BN5A 4OP2A 4XQEA 2AR9A 3FPKA 2VJYA 4PRLA 4TLEA 1AT1A 3HJHA 3EZXA 1GL9B 2DYKA 2R4TA 2WU0A 4IFIA 4RM2A 4B71A 4M6WA 5A3RA 3IP8A 1Y5LA 4Y2GA 5GJBA 1E6WA 2WPNA 4YJGA 5G40A 1XZEA 4GI2A 3E82A 4OKIA 3ZDYB 3IPLA 4BS9A 1Z83A 3F9RA 3TXXA 4BQSA 5DFAA 2Y4OA 3AJRA 1Z8DA 2A78A 1Y4ZA 1UK6A 1TW2A 2OO5C 1PD1A 1CR2A 2YJTD 1YJCA 4Q9AA 4U2BA 5THXA 1PYOA 1QKJA 1E2HA 4KL8S 2H11A 4O2AF 3SS9X 3CZRA 1WZUA 1O77A 3K05A 4FNAA 4HGYA 1QQAA 1B1AA 2FEKA 2AEFA 2ZYSA 3O73A 4TZTA 4ZOQI 1ZD3A 1XCLA 2BHNA 5FAXA 3TX2A 1Q19A 3D4IA 3G7UA 4MTLA 2PCJA 2K5UA 3K15A 4LDJA 4RWEA 1UPUA 4DR3B 5DTEA 3A70A 1KJYA 5LDDC 4KBFA 1KMNA 4ASUA 3DFZA 4GPTA 3SM3A 1C8BA 4JJIA 5KWIA 2YVLA 4BO9A 2IEAA 3I9V1 3D5QA 4P4GA 2WIDA 3NTXA 2PPLA 1CY1A 1RNLA 2JAUA 1QO0D 3TF5A 4PVCA 3TZEA 4BMVA 2B61A 1R6AA 4D4GA 2IYSA 2IZ6A 2LXNA 2WVGA 3DTVA 2XLBA 2J0EA 4OLBA 1MJHA 5CITA 2Z6UA 2QNRA 3BMQB 3RT7A 3A1NA 2GRUA 3ONEA 5SY4A 5L3VA 4X1IB 4TSFA 4X1IA 2VNHA 3G1WA 3PQ8A 4HDKA 2J45A 4ARVA 1G5FA 1CR6A 2PTGA 4A2PA 4Y3UA 1L5OA 3MJTA 1CW2B 4HQ6A 4IVQA 3JWJA 1KVQA 4RSMA 2JATA 2DLCX 4GOOD 4AJKA 4QPNA 4U9IS 4DE5A 3FNGA 2FHPA 1VSQA 4HPWA 2X4DA 4BO8A 821PA 1W5TA 3DE5X 2BM9A 3L46A 2QW8A 2ZYTX 4O4JB 4ZCLA 1EVEA 1BXGB 1QO9A 1DWOA 4R51A 1Z3IX 4A5OA 4CCYA 2GVDC 3I8SA 1U8XX 2Q6OA 2IF2A 1J22A 1KI3A 1M2VB 1QVRA 1X7ZA 3EZLA 3HYTA 3BQ9A 1QAMA 2CCJA 3MJ4A 3OIDA 4U02A 4UQOA 5J2UB 4PYJA 4YIKA 1EUCA 5K3CA 1UMDA 4QARA 4UEWA 3H2IA 1KJWA 4ZO7A 1AOXA 4JI8B 1EP1B 3N70A 2QWXA 4WPGA 1TGYA 2P91A 1LBQA 3RG8A 5F9FA 2LP4Y 2DRIA 1YC2A 1X8LA 3MOSA 4MQ6A 3ER8A 5CTJA 4FFNA 4A1OA 4B4UA 2GN8A 4FN4A 4YP6A 4AN4A 3WRYC 4Z8XA 4EVRA 4PIMA 3BQNB 3JQ9C 3M49A 1OCEA 2O0JA 1WE2A 2RGXA 4WGGA 1FDWA 3GLKA 3V1UA 1GZ3A 3HBJA 2R6JA 5LMZA 1FNMA 5FTNA 1M2GA 2WAXA 4GGMX 3O8LA 5FT9A 2W2MA 2V9ZA 1M8GA 4DMHA 5AIAA 1T0PA 1G8AA 1EUQA 2CBGA 3WL5A 4L51A 5F23A 5FX2A 1OXSC 3WIOA 3IKVA 4AF6A 4V1CI 2X22A 4HFMA 5KOHA 3EYAA 4UU1A 2PV7A 4BKMA 2FOIA 3KVRA 1ZNYA 3ORSA 4PC7A 2X5OA 2WDZA 3CRW1 1HA3A 2ZCVA 2B1QA 2J4CA 4XFJA 2LBPA 4IDBA 4IHKA 4MS4A 2B20A 5ALWA 1TQ2A 1ZISA 2ID8A 4MGYR 2O3TA 1ZH8A 1RCTE 3P9PA 4XWAA 1PQWA 3AUSA 5HCNA 3VSAA 1T34A 4PNHA 4CV1A 3F47A 1JDJA 2B7BA 2C3UA 1PNVA 3DBIA 4JJ7A 4YTEA 2WZDA 2AJDA 1T5OA 5B2EA 4ALJA 2H4HA 3F97A 1CERA 1JPUA 1XZKA 3KTAB 4RFSB 1GXSB 4XPIB 5GGYA 2BYTA 2V7BA 5JATA 2HV9A 3RUDA 5KWVA 4Z1OA 2VP2A 5EVJA 3RVJA 4U6QA 4AJ2A 1L7EA 2BRUA 4MMZB 2VPXA 5GINE 1ZI6A 1P0MA 2B2CA 3GEHA 1EP2B 3PT9A 2CSXA 1RKXA 2BZGA 3FN4A 4FOPA 4NHOA 3OLWA 4N54A 3U4DA 3L0CA 1P9RA 1X8KA 4V2UA 2F8TA 2WUEA 3EISA 3GNTA 4C0LA 2I6QA 1FA9A 1KTIA 3MNFA 1NTRA 4IQ8A 4P53A 5TF4A 2X7HA 3F71A 3OKCA 2VZ9A 1L3CA 1JIVA 4IRXA 4M0PA 4XW2A 5D1NA 1UZNA 1L4BA 1A5AB 4X93A 5E1MA 4ZI7F 5KWSA 3KXLA 4YUVA 5CH5A 2RHGB 3NPAA 2UDPA 1U5AA 1TT5A 4HC4A 1P7YA 4FS3A 2HJGA 4Q34A 4BO2A 2P1DA 5KB3A 4YAEA 1OPXA 4D3XA 3LA8A 1B2RA 2VLBA 2OD2A 1ZGZA 2ZZKA 5KYYB 2ZXUA 3UAVA 3ERCA 2Y1WA 5H16A 4PCUA 4I9GA 4RPLA 3CKMA 2QD3A 3IVXA 1JDZA 1HTBA 3TTVA 4K3UA 3O8CA 3A6GA 1R88A 3DUFB 4G0WA 3LI2A 3HPQA 2MYTA 2HMYB 3MCVA 4QJ5A 4RQBA 4K7JA 2DBQA 1SK8A 4WBNF 1H22A 1W5AA 4RUKA 4AQYB 4NCAA 2A0XA 1PIWA 3KLMX 3PE3A 5FI1B 4FGLA 1HT3A 5E1BA 1OH7A 1T5TA 3ESDA 5BN3A 2AEEA 4IHQA 2RGRA 5E7JA 2EL9A 4HEA1 3L8YA 3P5SA 4TLCA 1MLDA 4ZOBA 2X1LA 5F12A 1FP4B 3UG7A 4RM3A 3RIHA 3OSUA 1RLUA 3H9GA 2DUUA 3IEPA 5E9AA 1E5LA 1YVRA 3IQZA 4I1SA 4I19A 1M1ZA 1K7YA 5KYXA 1PL0A 3U7FB 3RFCA 3HCRA 1NUTA 1X7XA 1DNPA 1N8TA 2BCGY 4LSGA 4PLWA 4TMWA 3W9UA 4CQNA 4KI0A 3VC7A 3FOCA 4B3BA 2F1OA 1TZ2A 2Y1OA 4KE7A 1HLFA 5BVHB 5KYYA 1CY7A 5C46F 5EJ8A 1JWLA 3GRPA 2R8XA 3MOGA 1SXJE 3C39A 2QW0X 4RWZA 2NW6A 3AR8A 4LTNA 1TYDE 1QRRA 2JI8A 3A25A 3L84A 4NNPA 5ESWA 3CT4A 3MS7A 4JLNA 4UBMA 3KD2A 3T8YA 3TNFA 4BFLA 4LJ5A 3M2TA 5CB6A 5LOVA 1RQLA 3FPSA 3PPIA 5AW3A 2E4ZA 4AWAA 4FLFA 4M2LA 2HC9A 2HEIA 1JHAA 3T9BA 4L6IA 2NO9A 3AUJB 3CURA 5L7TA 1RKUA 4D9HA 3G0HA 4MW1A 221PA 4CT5A 1P5RA 3X2EA 5U9CA 1GDTA 1M66A 2NO5A 5JFTA 1QRAA 4YVFA 3WQSB 3IUJA 2BFPA 1W2WB 4YAGA 2QLBA 2JLQA 5B3LA 4IX9A 4DIOA 1VPLA 2UZ4A 1W19A 2X23A 2XUOA 3RO7A 4D3DA 4G9GA 1Z4PX 5KBYA 1CR4A 3LDAA 3R6WA 4RFSA 1XL1A 1F48A 2GYWA 3S2EA 3CWQA 1A9XB 3AU9A 4IHJA 2QQ0A 3GA7A 4UBOA 5AW9A 1EEHA 2IY8A 5CB4B 2PIDA 1TLLA 5BSVA 5F21A 4G8JA 1KH2A 4JI2B 4H18A 1ZMBA 4XLTA 2BJWA 2OZEA 3WB9A 1IG0A 3D7LA 3ZDEA 3GGDA 5KKCA 1EVLA 1PZHA 1LVGA 1QRTA 3MLBA 3OQJA 4G97A 4E94A 1JVSA 4MS4B 1W46A 2WM9B 3FFTA 3OPMA 4HD8A 4ZCIA 2JEYA 4GIBA 1MENA 3FHOA 3O4RA 5I4CA 5AKLA 1MHPA 3A3OA 1NJ2A 1YQ9A 4GLBA 4DCMA 1J90A 3B6MA 4TYNA 3WMEA 2YRFA 4P2GA 4LDNA 3WP0A 1SUPA 1VP3A 1DBRA 2O06A 3WK5A 3KT3A 4XIYA 4B6JA 1SJ9A 4XVCA 1PUIA 2W2TA 3NBMA 2QM7A 3GLIE 4DREA 3HJUA 3R9XA 1LSUA 3S5JA 3UH1A 2HIGA 3K35A 2CVFA 1NNI1 2O8DB 2Q1UA 3T61A 1RXVA 2IYVA 3N6VA 4IYJA 2OK7A 2B35A 1VA4A 3PGMA 2CZGA 1VHQA 1T5SA 4II2A 3BSWA 4GBGA 4IFTA 3S6JA 4HS4A 3WL7A 3PIIA 4C06A 8GPBA 4FFPA 2A88A 3RRNA 3VO1A 3WLLA 2FPPB 5L4NA 4DOMA 1LPBB 4NEQA 4QNMA 3CC8A 3FNRA 3I52A 4HDQB 4OCZA 5TT0A 2Q1WA 1T91A 2VWPA 5CYOA 5ECDA 1PJQA 1YTLA 1V41E 3BEDA 4NNOA 3ND7A 4MR7A 2PJRA 3OZXA 4PONA 4P7GA 4IL5A 3LKVA 4YACA 4OJYA 3M6AA 1HI9A 1VLJA 1M74A 3PI6A 1Q6ZA 1BX1A 1P31A 1QZ3A 1H66A 1GGJA 3PHIA 5LP6C 3UHFA 1UEIA 2BGTA 1ZITA 5IBQA 3OCYA 4Z8YA 1HKHA 5ED0A 3GCGA 1H8HA 2FWAA 3GJYA 2FW1A 3KRTA 2NVBA 5E6RB 1BEEA 5BN5A 1N6LA 4C0BA 3CYFA 1MD9A 2V8BA 1T0IA 2OZVA 2DOKA 2BZ0A 1BDJA 1GRNA 1KMIY 4U9HS 5EWMB 1OTYA 2AZDA 4UNQA 3WKEA 4BKRA 1N1MA 4D9FA 4DJJA 3EEYA 2E21A 4QELA 1KI9A 2P6MA 5K4AA 1IEVA 2OAEA 2YMMA 3DDOA 3GXOA 2XGOA 3EIWA 3QI2A 4FGSA 4TL6A 3ZZNA 2C9OA 4C4RA 5FDFA 1UBFA 1VKRA 4UJ5A 2FP4B 3SCZA 4BV3A 4GPIB 4D0RA 4D9NA 4EW6A 1HH4A 1D7OA 3FHLA 1A88A 4KRGA 4N9WA 3WLSA 1MJNA 4G1CA 2Q6VA 1XQ1A 3FUWA 1UMKA 4JUAA 5E9QA 2ZRIA 5F1YA 5E4FA 3UAWA 4YMUA 3BKXA 4RCZA 3HKDA 3AZPA 4ZQFA 3MG9A 2SICE 3NO4A 2Z1MA 1FYWA 3ST7A 1H2AS 1VGVA 3ORYA 3OZBA 4M36A 3AP2A 2FMTA 3GJ0A 3H5NA 1J8FA 1L5MA 3T3PB 1NXPA 2R2AA 2OK8A 4WZZA 4Z7QB 4LQDA 3R7BA 3CONA 4QEKA 4RZUA 1NUPA 1XVLA 3KU1A 1AS0A 5KEIA 4JBNA 4QL3A 4R2IA 4LUCA 2C82A 2ZATA 2VTEA 2O2YA 1GPJA 4W5OA 10MHA 2WWXA 1GT6A 1MT0A 2BCJQ 3KTAA 2NZ8A 4UCFA 3S2SA 1B16A 2VKTA 2BFMA 1VHLA 2PT7A 3FRIA 4WLOA 5KUTA 3BTOA 4QU5A 1MA0A 5DEIA 4GSKA 4NCJA 5CA1A 4H9GA 2QUIA 4PYLA 4HGRA 2NX2A 2VBFA 3WLMA 4N6GA 2DPMA 3AESA 3R4VA 1HFEL 3K0AB 3UC9A 5M04A 5H82A 3KUDA 1QHIA 4PXYA 4BYMA 4OBEA 2RHWA 3NNDA 4BKPA 4C4AA 2V7PA 4R05A 1E3TA 3R8CA 4BLOA 4UQLA 5F98A 1G0NA 1ST2A 5EKSA 5JRDS 2HAEA 2NVWA 4MYSA 3HDJA 1CZLA 3X1MA 2ZJ3A 4OD0A 2CDCA 3KQPA 1MQSA 3VR6D 3UMCA 5AW4A 3KB1A 2CN1A 2V96A 3GHHA 4C04A 2UVPB 3FSGA 4B84A 2WIAA 1VMEA 3OOSA 1CUHA 4MCJA 4WOJA 1UQRA 3H5AA 3QW2A 4BQRA 3NAGA 3J81A 2R00C 4F8YA 4W9MC 2N3ZA 5CM9C 3PL1A 2ZOSA 3CIOA 3EC1A 1WHTB 2PYIA 4IWYA 3FMIA 4M0LA 5CXUA 4LTMA 2RE8A 3ETCA 5ESRA 4JUBA 4Y1RA 3CZPA 3T3DA 2IX3A 1TUEA 4ZT2A 4JXJA 1BYUA 3OUZA 4Q9DA 4N8DA 3TRHA 1JQ5A 4P33A 3VPAA 5KOHB 3T9DA 4J7XA 1YKSA 1J0AA 5KNDA 5BRNA 2C42A 5LU8A 3D6AA 4TTJA 3U0BA 1J9GA 2I3GA 4LYGA 4YROA 4MPRA 4NFSA 3TBFA 1VCIA 1Z25A 1TVKA 4MYTA 2BFOA 1Z56C 4WCVA 4YJ