1X1TA

Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with nad+
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
236
Chain Sequence
b'MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTLLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title d-3-Hydroxybutyrate Dehydrogenase from Pseudomonas fragi: Molecular Cloning of the Enzyme Gene and Crystal Structure of the Enzyme
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
total genus 78
structure length 236
sequence length 260
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x1tA00
3NEPX 1SAYA 3BZUA 4J1TA 1Y5RA 1KOLA 4FIZA 1PGPA 3PYXA 3RC2A 1PQWA 1I2BA 5LC1A 3L6OO 1EEHA 4BO8A 3PLNA 3KVOA 4DRYA 5CEFA 3TZHA 4D3DA 5A9RA 1HYHA 3P2YA 3DTYA 2C5AA 4J4HA 4M89A 4MVJP 3ROKA 2LDBA 2R6JA 4F3YA 2X7HA 4LVCA 1XU7A 4ND3A 4R9SA 2OFPA 4FJ1A 2BGMA 4U5QA 1M76A 1SNYA 5DULA 3NV9A 1MXHA 4DYVA 4PLHA 4ZQEA 3IMFA 3D5QA 3H7AA 1GV1A 1VI2A 3L4BA 2Q49A 1R66A 4O0LA 2HMWA 3BTUA 3KO8A 1A5ZA 4NHEA 4UVEA 5A5EA 1GYRA 1GPJA 1Y8QB 3ZWYA 3K8ZA 1P3DA 2X22A 1OMOA 1PQPA 2O3JA 4IXTA 2GZ2A 1LDNA 1ZSVA 5G2OA 3UOGA 3QA9A 4TRMA 3ZNPA 3Q3CA 3V2GA 1YB1A 5GZ6A 3TSCA 3P5SA 1Q0LA 4RQUA 1JWAB 3NJ4A 1T2AA 1ZK2A 4GMGA 4I9NA 3B20A 1SO8A 3FPLA 1GAEO 1RM5A 2DUUA 3I9NA 2DTXA 4R1TA 1PSDA 3U09A 4CL3A 2PGLA 3E48A 2HMSA 5DN9A 4OAQA 3ZW8A 3S2EA 3NT4A 4B4UA 5JNLA 1GYQA 4H3VA 1PQUA 1Q7CA 3H5NA 2WMDA 4Q39A 2W2KB 3CH6A 2EP5A 4DMLA 1N1EA 1EUCA 3WOHA 1UAGA 2JAHA 4ZU3A 2QRJA 5DNAA 4INAA 3AY7A 1UDCA 5I9LA 2QQ5A 5L4NA 2PFGA 3FTNA 4ND1A 1WDLA 1EK6A 2VYVA 2NNLD 2CDCA 1JKJA 3UKOA 5IJZA 5H83A 2EP7A 3G3EA 3ZV4A 1YGYA 4EI2A 2P9CA 2GR9A 1EQ2A 1VJTA 2Y66A 3MOIA 4J7CA 3BHJA 5K6AA 3W8DA 1P33A 3KSDO 3ZNQA 1NVTA 4CLOA 3A28A 1O8CA 4MVJH 4FFRA 4GH5A 4OKNA 2IDZA 4IDFA 3PFWO 3IC5A 4LK3A 1KYQA 3E8XA 1KVUA 1JAXA 3DONA 3ZWBA 1FDWA 3ETDA 2D2IA 4BKUA 1UP6A 3OECA 4PG4A 1V3UA 3PK0A 3N58A 3JQ7A 1ENPA 2O3QA 2VRCA 1V35A 3V1TC 1BRMA 4JBIA 2I5PO 1W0CA 1LTHR 2O7QA 4WLNA 3DBRA 3O9ZA 3CXRA 1F8FA 5B12A 3NX4A 5I9MA 1U1IA 3F9IA 2PZKA 1UXIA 1Z6ZA 1SB8A 3M2TA 4BKPA 3UICA 2UUPA 1KETA 2IZ0A 3QWFA 4KUEA 2CDAA 4WECA 3U4HA 4BOYA 1U5CA 3ZHBA 2DBRA 3L07A 5CPBA 4RVSA 2ZIZA 1GR0A 5A3JA 3DHEA 2B5VA 4YWJA 1JQBA 4IMRA 1KVSA 3EZLA 4UEJA 3QV1A 1IYZA 2DU8A 4RVUA 5JMWA 1Y7TA 1LC3A 1NP3A 1G0NA 2B4TO 4YDRA 2O23A 2ZK7A 4QFDA 3ZU5A 1KEWA 2Z1MA 4DC0A 5FI5A 1NVGA 1HDOA 3PHJA 1DIGA 4BNIA 2FSVA 1Z73A 1YO6A 1R0SA 1UP4A 2LDXA 4NBRA 1KBZA 4ALKA 3JQAA 2IZZA 3BA1A 2PGJA 4P38A 5IAAA 1NFRA 3GGOA 1KY5A 3L4BC 5BNTA 5I7SA 4PG7A 5T57A 1GQYA 3LC7O 2VHYA 4DXHA 4JCOA 3NTRA 4UAGA 1M75A 2OO5A 1BSVA 1D3AA 1NQAO 3H4VA 3JYOA 5HRUA 5JFOA 5T64A 4KWIA 1IUKA 4I9UA 2JD1A 4FSHA 3RBVA 1YBMA 3TN7A 3ZW9A 4DTIA 1LDMA 5BNFA 4CMJA 1YS4A 3IKVA 3ZH2A 3C7CB 4NBVA 3GVIA 4RCVA 2IRWA 1Z7BA 1Z45A 5DZSA 3V8BA 4N5NA 3ZDFA 1N9GA 3DBHB 3EUWA 3IKTA 3FI9A 1IOLA 1XYGA 3P19A 5KVQA 4FD3A 3G79A 3ZGYA 3INTA 4RVHA 3VH4A 3WMXA 4YAKA 1U3WA 1SEPA 3C85A 5DT9A 1E7WA 2Q2VA 4TKMA 2VUUA 3WGIA 1O9BA 2G82A 2GNAA 4WCFB 3WGQA 4QUKA 2EEZA 4RF3A 3RCBA 2C2YA 3NT2A 2IE0A 5JAZA 5ILOA 2Z1NA 4K26A 5J23A 2C5EA 3IJRA 7ADHA 1HRDA 4BO7A 4NK4A 5HM8A 1WXDA 3Q11A 4HNHA 3BMNA 4OO3A 2XOXA 1F8GA 2X58A 5ENDA 4WJZA 4Y6PA 4E33A 2W98A 1UP7A 1YB5A 1PJSA 4FC6A 2NLOA 4MKXA 3TNLA 2GO1A 3AOGA 3R3JA 3JQEA 1NFFA 1P1HA 2GYYA 3GAZA 2H6EA 3WQRA 3JV7A 5ER9A 4XZ3A 5C7LO 2IXBA 3RU9A 2I65A 4NR0A 3BTVA 1XA0A 4WE3A 1ZUD1 3ZCXA 3UUWA 1RYDA 4YAJA 3UVEA 4M55A 1M6WA 2WTBA 1X14A 5L9AA 2O2SA 4DPLA 1H6DA 4U6SA 4JP3A 3HADA 4OXYA 1E77A 1EBUA 1JAYA 5K6AC 4GGPA 4NBWA 5KJ1A 3S2GA 5U9CA 2VUTA 3ZHXA 3GNTA 4PLFA 1XGKA 3RJ9A 1RM0A 4J0FA 2HJRA 2E6UX 4GX2A 2G0TA 2P9EA 5TQVA 3KTDA 3FR7A 3DXFA 4ID9A 1PWZA 4J2HA 2B0JA 4EUFA 1SPXA 4BGIA 4GSLA 2AG5A 1V9LA 2Q1TA 4YQZA 2Q3EA 4GAEA 3MWEB 1TT5B 2Q2WA 4DBVO 2G5CA 3SJUA 4CLXA 2BF7A 2W2KA 4JK3A 1JU9A 1E6WA 4RPHA 4XRRA 3RC7A 3I9LA 4C4OA 5G0SA 4B3JA 3PRJA 4N18A 1DFIA 1P1IA 3NAQA 1PZHA 3W8EA 2Q99A 4KUGA 4A10A 4M49A 3D4OA 4R01A 1NPYA 3KV3O 2B37A 4Y98A 1ZEJA 3QWIA 5KJCA 1Y8RB 1X7HA 4J9VA 4YJFA 4EEXA 4TRNA 3PQFA 4W6ZA 4Y9DA 5HS4A 4TWRA 1MFPA 4QEDA 3ZU2A 2HU2A 4DPKA 2VTEA 4WEOA 2J5RA 5LDHA 2FR0A 1BWSA 1T26A 2RBEA 1N8KA 3PQEA 4GWGA 4UULA 2YQ5A 3DO5A 1WDKA 1B2LA 1I01A 1K6XA 4OMUA 3KEQA 3WTBA 4KWHA 2C07A 3KYBA 4DQUA 5FEUA 4PZDA 1B0AA 1DO8A 2QIOA 4W82A 4Q3DA 2X1HA 3UN1A 3HB5X 4BKOA 1NM5A 1XIVA 2FMUA 3D64A 1GEEA 1LRLA 3HJAA 4XGNA 5LDGA 5IDWA 1F14A 5T8KA 3GMSA 3S8MA 2CY0A 3PFFA 1EVIA 5DCYA 3BMQA 2E48A 3GFGA 1E3SA 1NHWA 4C7KA 3HDYA 3H9EO 1GDHA 2YHUA 4NJOA 1H5QA 1OC4A 4D3SA 4BMNA 3W1VA 4G2NA 2BHLA 5JDCA 3KZVA 2GN8A 1MXFA 1UR5A 4JP2A 3CPSA 2Y0EA 4FGWA 1K0UA 2XF8A 1FJHA 4IINA 2Q46A 3ZWPA 2UV8A 1HXHA 3UH1A 2O3RA 1R16A 5JDIA 3ZU3A 1DAPA 5KJ6A 3LZ6A 5HWSA 1GZ6A 4IS3A 1VE9A 4WLVA 3U4CA 4AJPA 4E12A 3I4FA 2D3TA 4DC1A 3LSYA 3WLEA 1BVUA 2FPGA 3GGGA 3GUCA 4LW8A 3IJPA 1HDYA 1JDJA 1IE3A 1MFZA 5TNXA 4ZD6A 5T67A 3ABIA 4AJIA 2Y1EA 4R16A 4XDZA 3GNQA 2C29D 1GU7A 5CDTA 4WKGA 2D5AA 3QQPA 3ZZNA 2AEJA 3JYPA 3ZWMA 4CM5A 5C37A 3QY9A 4AG3A 1LDGA 3ADOA 2C20A 4F45A 4CR7A 3C1AA 4G5HA 3F3SA 2ZJ0A 1MX3A 2VHWA 4CMBA 1NQTA 5FYDA 4W99A 3WSVA 1PR3A 1X13A 3W6ZA 1VJ0A 2JFFA 3ANNA 2ZYAA 3PHGA 5JC8A 5TSDA 1R0KA 3G0OA 5AXDA 4J7XA 1R15A 1VRWA 3E82A 4XQEA 2VYNA 4NFYA 3HN7A 4HWKA 4N7RA 3ETGA 1N7HA 3H5RA 4BNTA 4IGEA 1DDOA 2CFCA 4E5NA 5BR7A 1LXCA 3ONEA 4J91A 1BXGB 2PZMA 4NI5A 2HUNA 3OQBA 4WEQA 2AQ8A 5I9NA 1SB9A 2FOIA 4KUHA 4Q9NA 1P31A 2X0JA 3DBLB 4CM9A 1T2DA 1ARZA 2CMDA 3JD4A 4CMGA 5HTOA 4EUHA 3HG7A 2DTEA 4MP8A 3FN4A 4GX1A 3EVNA 2EW8A 4K28A 2UUOA 4WUVA 3LF2A 3RSHA 5A03A 3K5PA 3RAJA 5KIAA 2ZYGA 3QJ5A 3EK2A 1ZKMA 1E92A 2QHXA 1Z7EA 3GGPA 4GLLA 1ULUA 2FN7A 3VVCA 1WW8A 1H6BA 1OI7A 3CE6A 5F5LA 4F6LA 3TPCA 4DVJA 1QXSA 5CEEA 3GDGA 3V2HA 4CM3A 4BL5A 3HHPA 4PG6A 4BNVA 1UZLA 4S1VA 5GMOA 4MVJE 3ZU4A 1H2BA 1V6AA 3GPIA 4NQZA 4PLCA 4UEOA 3NUGA 1NNUA 3WGHA 5F3RA 1Q7BA 2OL4A 5DBFA 4MO2A 4OH1A 5KJFA 3ENNA 3D7LA 2PH5A 4CV0A 1E1KA 1SOVA 2JFGA 4K6CA 5DBGA 1P0FA 3IP3A 4IXWA 3WYEA 1DFHA 3P7MA 4GLOA 3DFZA 3L9XA 3MOGA 1GV0A 4KOAA 4YAGA 2ZTVA 1ONPA 2FZWA 1B14A 3QP9A 2DUWA 1PGJA 4CV2A 1DB3A 3U5TA 1E3WB 3ZWNA 2DPHA 1EVYA 4GI2A 4KZPA 5T8KC 3SEFA 4Z6KA 1QG6A 2WYUA 3PTZA 4DLLA 4H16A 2RIRA 4RVGA 4E32A 4Z0PA 3E5RA 3O03A 2WE8A 2BD0A 1O89A 1SMKA 2Q4BA 2A4KA 4ZICA 3LU1A 1YOVA 3AM3A 2H63A 2NQTA 3OIGA 2CF6A 4WOKA 1HZJA 3MJSA 4CM8B 3ST7A 4L4RA 3CEAA 6ADHA 1BHSA 4I08A 1E7SA 2JHFA 4PLVA 1I30A 3WJAA 2VNSA 4DMMA 1I3LA 4YJDA 2O3UA 3EMKA 4JQCA 1DC5A 1J5PA 3EC7A 4MDHA 5DOZA 4QX6A 1QYDA 2CSUA 2OORA 3OMLA 1CWUA 4M54A 3HFGA 4YT5A 3H2ZA 1M66A 1OFGA 4U8GA 4BGUA 5H82A 5JDIC 1YBAA 1IB6A 5GZ3A 1E7RA 1PIWA 1F06A 2WD8A 3DB2A 3FCOA 3GVCA 5IN4A 3AI3A 4E4YA 3GRPA 4EJMA 3RFVA 2D1YA 3F46A 3JQ8B 2BI7A 1SEVA 4DYDA 5JSFA 3RJ5A 5BSHA 1R4MB 2TMDA 4YXFA 2X5JO 1RJWA 3O8QB 5JS6A 2ZTMA 5BSFA 2EJVA 8LDHA 3EVTA 4N54A 1DIAA 4GBJA 1QV7A 4FCCA 3RASA 1I3KA 5EJ2A 4J43A 4Y6SA 3S1LA 2Y93A 2VZ9A 4FB5A 5A9TA 3VH3A 4XGKA 1UZMA 4WGGA 3ANLA 3GOHA 3HN2A 1BXZA 1V8BA 1PZEA 4GX0A 3KSUA 3I9KA 3IUPA 2P4QA 3JYLA 3L9WA 3PIDA 4NPCA 1P74A 1NQOA 3RUHA 1E3JA 1ZK3A 1B8UA 1ENZA 1K89A 2CNBA 1HYGA 5AXAA 1X7GA 1CEQA 1PL8A 4CMAA 3BHIA 4G81A 5L95A 5KNLA 1NASA 4HXYA 4PZCA 2GUGA 4XD2A 2HAEA 4OSPA 2FP4A 4WCFC 4LCJA 3W4KA 4WASA 4AJ1A 2GGSA 1DHRA 1ZBQA 3E18A 3IDSA 4IMPA 4J6FA 4MVJD 3OETA 6LDHA 3KXDA 3SC4A 4M86A 1ZFNA 3GEGA 4CL8A 4DGSA 2W4QA 3M2PA 4BNMA 2ZKLA 1MC5A 1NFQA 1LQUA 1PS9A 1BVRA 2PKRA 1H93A 5A5FA 2QZZA 3PGJA 2ZB4A 3E9NA 4L0QA 4FJ2A 4TKLA 1FDSA 3WYCA 3GHHA 3E9QA 4PLZA 3GDOA 4CR8A 2X4GA 2H1SA 1WZEA 1DAOA 3CZRA 4PG5A 4ONEA 1RPNA 5BQFA 5KJEA 4E2YA 3LT0A 5A4DA 2C7GA 3DOCA 2D5CA 3SJ7A 4MIYA 5AXBA 2PV7A 4ALNA 3U4DA 5F1PA 2QYSA 1UDAA 5JAQA 1E5QA 5ITWA 2C82A 3UF0A 4D0SA 3LT1A 4LISA 5EERA 3VDQA 1I2ZA 1DHTA 4K1LA 1QYCA 2W2LA 4U6QA 3WTCA 1VSVA 2X0RA 3DWFA 5JCXA 1DC3A 1BXGA 4CMIA 1QYXA 2ZCUA 3ICPA 3O4RA 2AMFA 4E31A 4MP3A 4IDBA 3V5NA 5G0UA 5DBIA 2FWMX 1M2WA 3DBLA 3NDIA 1LU9A 5HA5A 5F1KA 5KKAA 3KOUA 1PJLA 3NRCA 4FJ0A 4PN3A 4M87A 2YV2A 2R2GA 4IM7A 4TQGA 2JHGA 4O63O 2QRKA 3QWAA 3RD5A 4CQMA 1P44A 1HT0A 3DHYA 1MG0A 1W73A 4FPXA 3DZJA 1I10A 4J2OA 5JE8A 2VN8A 3TWOA 1J4AA 2BRUA 3KYCA 5A9SB 1C0LA 2FZEA 1SBYA 1VPDA 2YHIB 2ZB8A 4E30A 4MJLA 4LSWA 2X9GA 1QORA 4IDAA 5DCUA 5IXYA 3GR6A 3L77A 4A5OA 2PR2A 3WDSA 4M1QA 4RZHA 5JCJA 3GN1A 3A9WA 3OQ6A 1GUFA 2P5UA 1IHYA 5THKA 3AM5A 1K5HA 3AY3A 1CQJA 3D3WA 4BO6A 3OIDA 4R51A 4UUOA 5JO0A 1UXGA 3GEMA 4TRJA 1E3WA 3WGYA 3AFMA 4ZQHA 1LX6A 4FFPA 5A06A 2YV1A 4WK6A 3T4EA 3WQSB 4EEZA 1HTBA 2P91A 5IDQA 2GZ1A 2RH8A 2CVQA 2VNAA 3X2FA 5ICSA 1KVRA 2RAFA 2V7PA 5GZ1A 5G4KB 1XR3A 4TZKA 1IULA 1C1XB 5L3ZA 4EJ6A 4JLWA 1I3MA 3T4XA 4XB2A 1X0VA 3NTOA 4XYEA 5L7YA 2Q1WA 4L8VA 5BSEA 4B4OA 4YJGB 2JD2A 1NWCA 3U4IA 3FF4A 4WLOA 2EIHA 4I5GA 4D46A 3C7AA 1QSGA 1BW9B 3MJ4A 4IPTA 2WYWA 4R3WA 2NM0A 2PY6A 2NUAA 3M1LA 5AYVA 4AFNA 5KWEA 4E2ZA 1ZEMA 3GUYA 4CLRB 4DWVA 3SX2A 1D1SA 1DIRA 4C7JA 5IDXA 3QHAA 1LEHA 1T4BA 4CR6A 1E1LA 1KEUA 4YB8A 2Y67A 4M8SA 3H5AA 4FBGA 2VRBA 1UUFA 1XU9A 4RZIA 4D79A 4OYRA 1NX6A 1PU2A 3OJOA 3GZ4A 3GF4A 3LLVA 4I1IA 5HBRA 5DF1A 5C7OO 5I8WA 1HLDA 4MVJF 3PP8A 1RM4A 1C3VA 1IHXA 3B70A 3GVHA 3OSUA 1XSEA 1ONNA 4Q3NA 3TOZA 1LRJA 1ZSYA 3CZMA 3A14A 3ONFA 2X6TA 3F5SA 3PGXA 1FDTA 3VVBA 1EZ4A 4CUJA 1ZMOA 1GD1O 3AI1A 4IY1A 1P1KA 1VM6A 4N5MA 2PA3A 4NG5A 1XKQA 3RU7A 5HS6A 1XHLA 1SZJG 4HADA 4CM1A 5EPOA 5JY1A 1QYVA 4NBTA 1A4IA 3RBXA 5DOVA 3GZNB 1ISMA 3I9OA 3PZRA 1RKXA 1YDEA 4NJMA 1PJBA 4ZVVA 1PR9A 4BMSA 4P4NA 4WCDA 3U49A 3PDUA 3E03A 3S2IA 1DLJA 4FFMA 2E49A 3DZKA 4PG8A 4Q3CA 2JD0A 2NQ8A 3FNGA 1KY4A 3AOEA 2XXJA 2HMTA 4YA6A 2VYVD 1T1SA 3RFTA 5A04A 2Y99A 1Q7GA 1R0LA 4ZQBA 2GCGA 2G17A 2Y1FA 2JFHA 3BMOB 4FFOA 4JJGA 5IZCA 2JJYA 3SXPA 3L4SO 4J1SA 1A27A 3WGGA 1KEPA 3F6YA 5L7WA 4CM4A 2HKIA 1J6UA 4IDEA 1PJCA 4OM8A 3BMCB 1Y81A 4YAIA 2HO5A 3O26A 4J4TA 4FOOA 1EBFA 4UVDA 4XYGA 1UZNA 3OP4A 4OL9A 3BAZA 4GVXA 2O50A 2FSSA 1ZNQO 1WZIA 2YDXA 2RHRA 3I9MA 1NPTO 4O6VA 2BGKA 2VRCD 5IN5A 2V6MA 3FWZA 4CMCA 4CUZA 3WXBA 1XQ1A 3KETA 2J3HA 4QTZA 1K3TA 4MKZA 4Z0HO 1WP4A 1S7CA 1P1JA 3VHRA 1R6DA 3VPXA 2PD3A 2BH9A 5F21A 4O59O 4OJNA 4DQVA 3HNPA 2VOJA 1PJQA 3V1YA 4XWYA 3HQ4O 1Y1PA 1BGVA 2X9VA 3MWDB 1MGOA 1DRWA 3TZKA 1DPGA 5C3MA 1DIBA 2CUKA 1LDYA 1B3BA 3JQGB 4RPGA 1LSOA 4Q3EA 5EINA 3ASUA 1JVBA 3D4NA 3ZNOA 3FNHA 4R1NA 1ISIA 1Y8QA 3I9JA 2NVBA 4GPD1 3DBVO 5FI3A 5KOIA 4XR9A 3H3FA 5I7EA 4JBGA 9LDTA 4A0SA 2NTNA 4KDEA 3JQAD 4PLPA 1HSZA 2YZ7A 1WDMA 2YHIA 4KDFA 2UYYA 3RUDA 2NACA 4D7AA 4R4JA 3OQ1A 1QLJA 1C1DB 3HUDA 2V6FA 2ZTUA 4HFNA 3SBOA 4F46A 5MDHA 4J0EA 1HETA 2ZYDA 4PLWA 4MP6A 1XG5A 1DJNA 5BT9A 4WOJA 4CV1A 5JW6A 2DC1A 3I83A 1EE2A 1VL0A 4AJHA 1ZSNA 5EMHA 4XR4A 4UVHA 3ZNNA 3I3OA 5JYDA 3B1FA 3MJVA 5TF4A 3DAFA 3SC6A 4BO3A 3LK7A 4BUCA 2EG9A 5G4KA 1P0CA 4RO0A 3RFXA 2P5YA 3G1TA 4J1NA 4IZIA 1FDUA 5ES3A 1C1XA 1U2GA 4BO0A 3D5TA 4QXMA 4GWKA 2BI8A 2VT3A 1WMAA 5U1PA 3MEQA 1ISFA 1KVQA 3QVWA 5DP1A 4YJHB 3F1KA 3NGXA 1WNTA 4JIGA 1NYTA 1IY8A 4BNGA 1BW9A 2PTGA 3VAZA 4FS3A 1GADO 3AUSA 4OIMA 3WWYA 1MG5A 1UXJA 3VZQA 4RJTA 1CERA 1U2DA 4DQXA 4R9RA 5C7IO 1AHHA 3AWDA 4BNFA 4HV4A 4KMSA 3I4CA 4BO5A 3WQQA 3AOEC 3GAFA 1ADFA 2Y1DA 4R68A 5TGDA 1LJ8A 3AUUA 1FK8A 2VTDA 3VPHA 3OH8A 3QWHA 1E3LA 2EERA 4MKRA 3ROPA 5B1YA 1CIVA 1Z74A 3IOYA 5IZCC 2X23A 3TZQA 4CQLB 1C0IA 3M1AA 2ILTA 4B3IA 3WGTA 1LA2A 2HRBA 4FW8A 1YVEI 1DRUA 1I8TA 3ASVA 1A71A 2HJSA 1ZK1A 3V1UA 3BHMA 1EQUA 2Y05A 3GDFA 1W6UA 2YUTA 2A92A 2EKPA 1KIFA 2I3AA 2C59A 2NADA 2ZQYA 1OOEA 1QLHA 1W4ZA 1ZH8A 4XJTA 3VC7A 3HSKA 2I6TA 4NU6A 4A2CA 4YYZA 3BXXA 3U0BA 1VL8A 1YXMA 3K31A 3H3JA 4E5PA 3MJTA 3W4IA 1F12A 4ALLA 2DM6A 4AJJA 4FFLA 1IPEA 3F4BA 1D8AA 4A73A 3ZI0A 2HMUA 3ON5A 3DZIA 1H0KA 4E6PA 3C3XA 1LLQA 5EQFA 4HP8A 2IZ1A 1P1RA 1F0YA 1X1EA 2O7SA 3PI7A 3JQ9C 1PWXA 2BFPA 3NJ8A 4PIVA 4JXKA 4R41A 4LN1A 5TS3A 3ZHZA 5CAEA 2PK3A 2EGGA 1I3NA 1Q1NA 3BYZA 2AQKA 1P45A 5CPFA 1U7TA 3JQ6A 3R1IA 1KVTA 4AVYA 4HX5A 5JY6A 4Y6RA 4Z3DA 2PKQO 1ORRA 2DT5A 2E82A 1K2WA 2HSDA 1H2HA 3KEOA 1PL6A 2WE7A 3GG2A 2PZJA 3JD2A 3UCFA 3DTTA 1NAIA 2I67A 3VPSA 3TZCA 1XCBA 4IS2A 4L9RA 5L53A 3OEWA 1CJCA 5G0WA 4YT4A 1OAAA 1YB4A 3G17A 2J3KA 1KC1A 1P9LA 3GRKA 1MLDA 1B8PA 3K2BA 3C7DB 9LDBA 1U28A 4RORA 2NVUB 4JNKA 2PNFA 3X2EA 3DBHA 4P4GA 4Z9YA 2BMAA 4D0RA 5DDIP 1T24A 2GN9A 2VWQA 4NIMA 4GSKA 4AJEA 3DMYA 2AQHA 3G49A 4RVDA 4WCFA 3HDHA 4GL4A 4XQ9A 4IZHA 2Y0DA 4ND2A 3DZBA 2OP1A 3VDRA 4PLGA 4BKRA 4RF2A 3L6DA 3JQGA 2QYTA 2WD7B 4NNJA 3TL2A 4EBFA 3U9LA 1DC6A 2X0IA 1B7GO 2O3TA 5L45A 3WR5A 5LCXA 4BV9A 4ITUA 2OZPA 5ICMA 5A1TA 1EUZA 2DLDA 1DBVO 3VPFA 3F1LA 2BLLA 1HYEA 4DREA 1XQ6A 4RPLA 2J3IA 3VTZA 1HDZA 4B7CA 4JROA 1ZXLA 4OHUA 3WWZA 5KVCA 4CMEA 5FFFA 1C0PA 1ISHA 1FXSA 1VLLA 1E3IA 1B3RA 1R37A 3JYQA 3QLJA 4YPOA 5EQDA 3CKYA 3OM9A 4MVJM 4IQGA 3DZGA 4MVJI 3JD1A 2C2XA 1N5DA 2B36A 2WSBA 3DOJA 2X9NA 4LVUA 1IZ9A 4B4VA 3GN2A 4XJSA 3W8FA 3PWZA 1N2SA 1EK5A 4CODB 4EITA 1ZK4A 3ZWCA 4KTVE 2NWQA 4NZ9A 3U62A 3UW3A 4XYMA 1RM3A 3OHSX 1WLYA 1U5AA 3BTSA 3ZWXA 1ISJA 2HDHA 2WJPA 2VYND 1ADBA 4NH4A 4CLDA 1EVZA 3RUAA 4ZQFA 1B16A 1GCUA 2D4AA 3OA2A 3WNVA 4Q3AA 1PS0A 1TT5A 2GSDA 2OMEA 1I0ZA 2HK7A 2WWRA 4A03A 2AA3A 2Y68A 3WNQA 3GHYA 1PGOA 2JL1A 3U3XA 2NU7A 3RUCA 4RF5A 4PGFA 2VWHA 4L75A 2G76A 3ZWVA 2XAAA 2D8AA 1T2EA 4CM9D 1ADGA 3NT5A 1TEHA 1QYWA 1GY8A 2EKLA 4OSOA 4RQTA 1Y8RA 4BNNA 3R6DA 2JCVA 1MC4A 4LSMA 2JKVA 4WLFA 4CLEA 1U3VA 1LSUA 3ETEA 2VT2A 4BNKA 2OP0A 3K9QO 1HDCA 1AXGA 4XQGA 3WFIA 4E21A 5KCZA 1KC3A 4J16A 4IDDA 2WM3A 4NU5A 4XKJA 5ILGA 2PGDA 1HWYA 5AOVA 4AJLA 4BQRA 2BGLA 4ALIA 4CQLA 1Y9EA 1XDWA 3KB6A 4NDNE 3LVFO 5ER6A 3H9UA 1U3TA 2ZTLA 4K6FA 4TSKA 3HWRA 5COAA 4TVBA 1BTOA 3VZSA 2P9GA 5AXCA 2B4QA 5K0ZA 3TFOA 3ZHYA 1A7KA 3AUAA 3E5MA 3GLQA 1F17A 2YJZA 4JBHA 4DIFA 3A1NA 2EJWA 4OXKA 1O94A 3WS7A 3DEYX 2OHXA 4HFRA 3K73O 1HF3A 5JXWA 2AEFA 3QRWA 3PVZA 1WPQA 3PYMA 4MVJG 2GRAA 5JMPA 4AICA 3IS3A 1BMDA 4BNHA 1MA0A 2DBZA 4I5EA 2EHDA 2ZB3A 1YQGA 2BFAA 3AU9A 1CF2O 4DLBA 4Y67A 1MB4A 4PVCA 3K92A 1DEHA 5DP2A 4DBZA 4LRSB 3MJCA 1U8FO 3JQ7B 3QVTA 3KYDB 1OC2A 3JQDA 1YQDA 1GYPA 3M6IA 4KQXA 4Q3BA 3FRJA 1B8VA 3DMTA 3N7UA 2W8ZA 3FSRA 1QKIA 1DJQA 3LT4A 3KHUA 2BELA 3C24A 4BNWA 4J1QA 3UHAA 3LQFA 2DVMA 3OEYA 5CDYA 3EYWA 2B35A 1Y6JA 4LRTB 1ZIDA 1HZZA 3EW7A 1E3EA 4AL4A 3NGLA 1PJ4A 4A27A 1NBOA 4XA8A 4IQ0A 2DPGA 4R1UA 3VH1A 4JX8A 1U7HA 2HK9A 4GKBA 4OXNA 4AJNA 4IGFA 4BQPA 3CTMA 1UAYA 1GUYA 4ZA2A 2I3GA 3WJ7A 1KEVA 2O48X 2J6IA 4CM7A 4CMEC 2NVUA 4QSMA 4U0JA 3TQHA 1QR6A 1AN9A 3LDHA 3W6UA 1NPDA 5BSGA 2AW5A 4G65A 1NQ5A 4CPDA 3PJFA 4NMHA 4YRAA 3R3SA 3WX0A 4O5OA 4XGIA 2AE1A 1YH3A 3FNFA 1L7EA 3ORFA 5AVOA 2YYYA 2UAGA 4L74A 1UH5A 2JAPA 3CIFA 1GUZA 4GGOA 4RDHA 2GERA 1I32A 3V2UA 1TT7A 1UXKA 1ULSA 2RH4A 4WLEA 2GZ3A 1W8DA 4IDCA 1X7DA 5TIIA 2NU9A 2RCYA 2F1KA 3I5MA 1HE2A 1YONA 1CDOA 4CLHA 1Z75A 2J5QA 4FDAA 3RI3A 1P77A 3B6ZA 3HFSA 4CV3A 1N9GB 3CSDA 4BGVA 2VWGA 3GVPA 5G0TA 1EDZA 1LSSA 3L6EA 2X0NA 4RVFA 5JYEA 4PRKA 4QO8A 4XRGA 1U8XX 2WYVA 3AFNA 2PLAA 1P1FA 2HK8A 4YQYA 2IODA 4TVOA 4I9HA 3STHA 1T2CA 1MP0A 4XB1A 3ROQA 3JSAA 4LMRA 2UVDA 4RF4A 2X5OA 1JW9B 1GPDG 4J3FA 1JKFA 2P68A 4ZN6A 3BMNB 4HY3A 4R5HA 1H9BA 3QVXA 2OOSA 2X8LA 1GEGA 4H15A 3ZN2A 4IDGA 3IL2A 3HZZA 4BHTA 2H5LA 4YRDA 3WGOA 4AJ4A 4LCEA 3BTOA 1H6AA 3C1TA 1HE5A 1X1TA 3DZHA 4XDYA 1CETA 3GNSA 5JBIA 2W2LD 4PVDA 5CDGA 3ROMA 1VSUA 4J7UA 3ULKA 2EW2A 4JJIA 1U3UA 3DHNA 2B5WA 3VOSA 2PWZA 3Q9NA 4ZGWA 3GG9A 4BGEA 2H9IA 1UJMA 2DQ4A 4UUPA 5L7TA 2NU8A 3QWBA 2O4CA 3GY0A 2GD1O 1LBEA 1YJ8A 2F00A 4E0BA 3W4JA 4RL6A 2B4RO 4RV9A 4XYBA 4CM8A 1EMDA 1PEDA 3GVXA 1HL3A 3LF1A 2A35A 2CF5A 4FR5A 4W7HA 4L4SA 5ITVA 3DC2A 2Y1GA 2C7VA 2JCXA 4YEDA 1CYDA 3PWSA 4EZBA 1H94A 2HRZA 4AJOA 2Q1UA 5JLAA 1EFKA 5JC1A 3D3EA 3TZ6A 2Y1CA 3FHLA 1ONOA 4CQMD 2DBVO 2P2SA 3DMTC 1GFSA 1GQ2A 1L7DA 3HE3A 3GQVA 5U4QA 5I7FA 1EDOA 1EVJA 1HDXA 2AQIA 3JQ8A 4IJUA 3WIEA 5TRTA 1T2FA 1R4MA 4OOEA 4B7UA 1MV8A 3PWKA 3KBOA 3Q2IA 4IUYA 1EFLA 1RWBA 3O8QA 3PJEA 2UDPA 2BFMA 5IXSA 2VZ0A 2AEMA 1Y5MA 1V3VA 1XELA 2I9PA 1HKUA 4IJWA 5B4TA 4YJFB 3GK3A 1BXKA 5JCJD 2E37A 2YFHA 3RKRA 5CG2A 2V6GA 3GEDA 3QVSA 1KERA 2QRLA 1YDWA 4UVGA 1WAMA 1LLDA 3IUSA 1PX0A 5CP8A 4RPJA 3IAHA 5JPIA 5B4UA 5CFZA 3RROA 4DPMA 4LMPA 2GF2A 1K6IA 3OFSA 3K30A 3TJRA 3PZBA 1A4UA 3OJ0A 3JD3A 4E2WA 3WGZA 3ITDA 2NSDA 4AJKA 1B15A 3KYDA 1DRVA 1E6UA 3NKLA 3MTGA 4YR9A 1OBFO 4MINA 5TC4A 1PTJA 3BIOA 4XIYA 3RKUA 4D42A 1FF9A 3FWNA 4BKQA 1LLCA 3G1UA 5KVSA 3MTJA 2HQ1A 4E3ZA 3BMQB 3EHEA 4B8ZA 1G0OA 1DLIA 2ZJ1A 1G1AA 5JAIA 4J90A 4YCAA 1PL7A 1XLTA 3OA0A 4IIVA 2HCTA 4KTTE 5G4LA 3ADPA 2O4UX 1ZJYA 2W90A 3H6KA 1NR7A 3I52A 1E0DA 1ZO8A 2VHXA 4BNYA 3GH3A 4BIIA 1H6CA 4B8WA 1DSSG 2QZ9A 1Y9AA 4QQRA 1LC0A 1T25A 2J8ZA 2IEBA 3AUTA 1DOHA 3E9MA 2EWMA 3E1KA 3TOXA 4URFA 4ESOA 4PLTA 1O95A 4R5MA 3WICA 1I2CA 2CDBA 2OUIA 4J49A 3GA0A 1QMGA 4U7WA 2JCYA 3VKVA 1TLTA 5COBA 1JVSA 5IFLA 1JKIA 3PDJA 1JLLA 2Q50A 2CD9A 3DOOA 3P2OA 1WWKA 4WPGA 1PJ3A 1YRLA 3F47A 5IDYA 1D4FA 3TL3A 3WBFA 2BFOA 4GKVA 4GMFA 1GL3A 3FTPA 4IJKA 2PD4A 5L4SA 5TT0A 3FD8A 3C8MA 1JN0A 4FGSA 5B4VA 5KTKA 1I24A 3JQ9A 4YT8A 2NTVA 3NDRA 2ET6A 2Z5LA 1QRRA 2PH3A 2Z95A 4FC7A 1EUDA 1YL7A 3AI2A 3UXYA 3SLGA 1BDMA 1ISGA 3T7CA 5CDUA 4HBGA 4BO1A 1BDBA 4BO2A 5ADHA 1NR1A 3OJLA 4Z0TA 2NTJA 2NVWA 4I5FA 3TDKA 4E13A 4EYEA 3PJGA 3GMDA 2Q4EA 5EIOA 4EGFA 5A9SA 3VPGA 3K2EA 3CMCO 1U9JA 2IYOA 3LC2O 4ROSA 4DIOA 3FBGA 3QE3A 3GC6A 1VKNA 2B69A 3N74A 8ADHA 1AE1A 1AXEA 3TRIA 4UUNA 4AJ2A 3FPCA 5F1OA 4NBUA 3S55A 2C54A 5FF9A 3F5QA 1WVGA 1GCOA 3QVOA 3RUIA 2VWPA 1E1MA 1ENOA 1ZXBA 4ALMA 4D43A 2EF1A 1LDEA 5H81A 4EJ0A 1ZK0A 4TZTA 4I8XA 3ZV3A 2D59A 4L4XA 3DZFA 4D3FA 2IXAA 5TJ9A 4ZJUA 2VOEA 4JJFA 4BV8A 1VC2A 4R69A 3LLSA 3AJRA 2HMVA 4BNUA 1ZVMA 4P8RA 1BG6A 1E6EA 2A9FA 4YVFA 3WBBA 4MOWA 3I6IA 5ENVA 4BVAA 2CVOA 4DIBA 1NXQA 4YJGA 1HE4A 1U4SA 2FR1A 3WIDA 1HE3A 5MGBA 5TLSA 1LI4A 4UVIA 4YBZA 4CJXA 5EN4A 2SCUA 2FR8A 3ICCA 4XCVA 4PLYA 3JQCA 4B4WA 4E5YA 3H9JA 4UUMA 2YW9A 3FBTA 2VZ8A 3JQBA 2GLXA 5L4LA 5CEJA 4CLRA 4D44A 2I66A 4B79A 3KLMX 4J9UE 1S6YA 1T1RA 3HB4X 1PS8A 3RUFA 1OZAA 3EZYA 4MIEA 4FOSA 1R4NB 2VUSA 4IBOA 4X54A 3DAGA 1IPFA 1GTMA 4OKIA 1SC6A 1A72A 1YOVB 1LLUA 2FHSA 4FQ8A 4OQZA 2V6BA 4KQWA 2P4HX 3CMMA 4XEHA 2ZCVA 4YTEA 3VKUA 3KUXA 5I8ZA 2R00A 3H8VA 1E7YA 1TI7A 1I36A 3LC1O 4XX0A 4YT2A 4CM6A 1I5RA 4RLHA 1X15A 5G0VA 4DA9A 3LT2A 1V0JA 3H65A 3KSZO 3TFQA 1PJ2A 4WNCA 1SOWA 3FNEA 5IG2A 3MJEA 2DAPA 4CMHA 4CMKA 3OIFA 1ENYA 2PD6A 3HDJA 3WYBA 2QW8A 2VQ3A 4NFSA 1DIHA 5EESA 5GY7A 3KM0A 1D7OA 1XWFA 3GZNA 1JTVA 2G1UA 3ITKA 2YQ4A 3DAPA 3QSGA 3WMWA 3Q2KA 3DDNA 1IZ0A 4WLUA 2GPTA 4A26A 4QFCA 1JWBB 4PFJA 3B1KA 2O3SA 1PGQA 2Y0CA 5L40A 4H7PA 3UFXA 3MZ0A 4IQ8A 3RQSA 4JGBA 1Q0QA 2GN6A 3BMOA 4O1MA 1HDRA 1A9YA 1HSOA 2GASA 1J0XO 1NAHA 3NYWA 1A9ZA 4L76A 3A06A 1N7GA 4ZRMA 4RDIA 3BMCA 3ANMA 3ZWAA 3D0OA 3Q1LA 1YBVA 4UREA 5BNIA 2POQX 3F4LA 4I5DA 3RVDA 5K9ZA 4W7IA 4E5MA 2AHRA 4TMFA 1HLPA 3KRTA 1GZ3A 5IZ4A 1O5IA 2XPCA 1LNQA 2ZATA 3H9GA 1AHIA 4U0KA 2FPIA 2YV3A 4OOFA 4Z9FA 1CRWG 3I23A 3PJDA 5A02A 3QW2A 1KS9A 3ZWWA 3RIHA 1WMBA 3PHHA 4BNJA 5KKCA 1RYEA 3AK4A 3NDJA 1G6KA 3R0IA 4RLSA 3TF5A 3H9QA 3HDQA 3I1JA 3JYNA 2CVZA 2YFQA 3EGOA 2TMGA 5T6BA 4DUPA 3PQDA 1B26A 3AY6A 4Z9XA 3AM4A 1U4OA 4R3NA 1C0KA 3OJEA 3Q0EA 5DCWA 4BS9A 3JQFA 4J4BA 3UCXA 2I99A 4F6CA 1C14A 4EDFA 4EW6A 2CZCA 3IQDB 3INRA 1DFGA 2DFDA 3VH2A 3O38A 4FFNA 1SCUA 1I33A 3PHLA 2E4AA 3GPDG 4XIJA 3WSWA 4CMIB 5C5IA 4QO7A 2XXBA 3ONDA 5THQA 4FN4A 1YL6A 3GFBA 3JQBC 1NHGA 3VZPA 4EUEA 2J5KA 3AU8A 2EKQA 1XEAA 4R1SA 2DFVA 1C1DA 1YQXA 1IL0A 4XQCA 4A7PA 3DL2A 2I76A 3WFJA 4W9NA 1ID1A 3E6AA 4IJVA 4HNGA 4NK5A 1H9AA 2AE2A 1ZJZA 3INGA 1V3TA 2DBQA 3PYLA 2VHVA 3JTMA 4CQMB 3CINA 2IEDA 2WEKA 3OBBA 3RUEA 3MCVA 2YDYA 1R12A 2V65A 5T5QA 3ZV6A 2A94A 4WNIA 2R00C 5TJHA 2FY8A 4KP7A 4BB5A 5A3VA 3PLRA 3KYCB 3S2FA 1HEUA 1CQIA 3L0DA 3OICA 5COQA 1GQQA 2YY7A 3UCEA 4W4TA 3Q6IA 2GN4A 1X0XA 1TVEA 2VHZA 2D0IA 4OGWA 3A4VA 3RC1A 3D4PA 1YWGO 5IF3A 2FRDA 3AW9A 4YJHA 1JA9A 1Q0HA 4HFMA 3D3WB 1GZ4A 4B7XA 3CUKA 3ZWOA 3SVTA 3ZV5A 4GX5A 4MPDA 4PCVA 4YACA 1HDGO 3I6QA 2DTDA 4TROA 5A05A 3H2SA 2AG8A 5TT1A 1FMCA 1R4NA 1QP8A 4Y8VA 3Q9UA 4B3HA 4UEKA 2ZB7A 2J3JA 1M6HA 4GQAA 4YAEA 5JO9A 3VZRA 2X5KO 2GDZA 5JDCC 1Q2XA 4HFJA 3SLKA 2WDZA 4MVJA 4QECA 3WLFA 2OXIA 1LUAA 3FR8A 4ILKA 4BNLA 5CG1A 1PJTA 3IIEA 4P4LA 4PRLA 4XYLA 3EDMA 4CUKA 5FWNA 3VTFA 1PZFA 2VCYA 2EGHA 1UXHA 1MUUA 1YL5A 1LRKA 1YKFA 1VJ1A 4ZRNA 1N1GA 5CHEA 1NWHA 2DKNA 4Z3KA 4TRRA 2RHCA 4HUJA 4BMVA 2QG4A 4MIOA 3PEFA 4PZEA 4QT0A 4CLOB 5JAMA 3RC9A 2OGUA 1D1TA 2HLPA 4ND4A 1DC4A 1QV6A 2ZQZA 5I7VA 2FPPA 4RGBA 4E2XA 4S3MA 4NFHA 4ALJA 1NVMB 1YJQA 1AUPA 3RWBA 2Y1OA 1K6JA 3C1OA 3UAGA 4BO9A 5CDSA 4D45A 1ADCA 1E5LA 4P22A 3WB9A 4BB6A 1M67A 1ZCJA 3IP1A 3DBRB 4BNZA 1J49A 1Z82A 4IIUA 7MDHA 3COSA 2EXXA 2Q45A 3OJFA 1N92A 2C0CA 2IYPA 3DQPA 3JCZA 3NTQA 4GVLA 4HKTA 3WG9A 3JQFC 4ZQGA 3K6JA 3T7EA 2QX7A 3B1JA 3ENKA 2PZLA 3UGKA 3OF2A 2O2YA 2BKAA 4D41A 3KLPX 4ZHSA 2OBYA 1ZW1A 1PZGA 4L73A 4II2A 4OQYA 3PIIA 2Q1SA 4RPKA 1ZMTA 4NJMB 4BNXA 1A7AA 3EY4A 1ML3A 5KVVA 3DFUA 5B37A 1EE9A 1O6ZA 3RBZA 2AXQA 2NV6A 1ZZEA 2EV9A 1E7QA 1E1NA 1TA4A 4N5LA 1L1FA 1DXYA 2PKQP 5L51A 1AGNA 4ND5A 3D1LA 4LGVA 4DL9A 4W9NC 4II3A 3JQAB 3PPIA 5F5NA 4DLAA 1VKOA 2X86A 1TB4A 1FDVA 3PXXA 4R54A 5TX7A 4CM4B 2Q2QA 4JN6B 3JD0A 5EL0A 1TXGA 1LSJA 1E7MA 2OBNA 1VL6A 1O0SA 4YRBA 2B83A 1LQTA 5AQ1A 3PHIA 4K9DA 1T4DA 3EAGA 1LDBA 4BO4A 2WD7A 3GT0A 2NU6A 3LYLA 3K96A 1UDBA 4E5KA 1PGNA 3QIVA 1YE3A 1NTOA 3DR3A
chains in the Genus database with same CATH superfamily
4HQ6A 3BUSA 4QBHA 1SAYA 3TR5A 4HH0A 1KOLA 1E8MA 3FZGA 4A4DA 1PQWA 3GARA 2BEUA 4XSVA 5LC1A 4L95C 2J0UB 3IVCA 4KO3S 1EEHA 1KMMA 4U7GA 5EFOA 4AX8A 1MHPA 3RHTA 4I1SA 2FRDC 1CQWA 2EX1A 3DE5X 2ZIUB 3KVOA 4KR9A 2QMZA 1IZYA 5F23A 3DCIA 3P2YA 3Q3VA 2C5AA 4J4HA 4MVJP 3WRYC 3ROKA 1CP3A 1G20E 4KG7A 5DM1A 4NZOA 3UGTA 2Q6TA 2X7HA 2FMTA 3EFOA 2OFWA 1T5BA 4Y2PA 4FJ1A 2O6HA 5HF6A 3ITNA 3QVVA 1WP9A 3I9FA 4HQ0A 4TKVA 5DULA 2BZ0A 4ARIA 3NV9A 4N41A 4ZQEA 3IMFA 3D5QA 5LBTA 3K4HA 1KHHA 2A1UA 2YINC 4UBLA 5JALA 2O5VA 1N2OA 1R9MA 5ARDA 3M7IA 3NTLA 2J45A 3K8ZA 1FNNA 4YRRA 3I1YA 3I34X 4EL5A 3ZEAA 1P3DA 3GPLA 1NUSA 1KAOA 2KB0A 1OH6A 4KXYA 1EM6A 4D02A 1EHYA 5JWRA 1EXDA 1ZSVA 1HT1E 3ORHA 5AJZA 1R0BA 3V48A 1SY7A 2C03A 3GLHB 3IPXA 3UOGA 4BX9A 3LUKA 4TRMA 2GEJA 1A96A 1II9A 3Q3CA 7MHTA 5H8WA 1NG1A 4DHEA 3C6QA 5K0EA 4CKEB 4F0JA 4Q15A 1K8YB 4OSEA 2P2DA 2V4MA 1T2AA 2V4UA 3GELA 3RAGA 5BMVB 5L3SB 3B20A 5BW6B 1B0PA 2Y4NA 4N6OA 1JSLA 2QK4A 3LY5A 1IBCA 4AECA 1GILA 2J4DA 1NXWA 3ROZA 2DUUA 4ENTA 2DTXA 5LYYA 5I45A 4C0SA 3U3ZA 1Q44A 1AKRA 4ZT7A 4LAFA 4HAYA 5BWMA 3U09A 1EWQA 3W5HA 1WPXA 1NVAA 4EPTA 2KWIA 4LUCA 5EKSA 4HUQB 2YMQA 3AB7A 2GETA 3WRWA 4OJKA 5JNLA 1GYQA 4H3VA 1PEKE 4B1FA 3D31A 4F1WA 4HQFA 3ZD6A 2RHMA 4EH1A 1VB3A 4OXRA 1Q7CA 3S2UA 3UATA 3W5BA 1GDTA 2JFZA 3IMEA 3BD7A 4RESA 1TCUA 1X1DA 1WRBA 2W2KB 1H2EA 2FWAA 3DJFA 4KBGA 5K4AA 1EUCA 1UAGA 3DQQA 1GA4A 3MRVA 3T1VA 3DLHA 4MR9B 1JEAA 2QRJA 1NQXA 3FPFA 4ZU3A 3R20A 4C29A 2Z43A 3CLUD 3AY7A 3FLMA 1LJLA 3S5UA 5IC5A 1RAAA 3HU3A 3RDPA 5TVKA 4TMKA 1GNLA 4TYWA 3KEGA 2BYTA 2O8FB 3DMNA 2VYVA 3B5IA 3FTDA 1QQ6A 2EBUA 1C9YA 2NNLD 4HSEA 4EKNB 2IFTA 2EP7A 3ZLTA 2B1JA 1DI0A 1WTCA 2OG2A 1Q17A 3LCUA 2P9CA 9ATCA 5EYPB 1BWRA 1POWA 2PUEA 4GEGA 1TD9A 5EP4A 3SFVA 5B1IA 1W88A 1KPHA 3STVA 2H2AA 1ZI8A 5C53B 3BHJA 3IQWA 3U17A 1P33A 3ZNQA 3IUYA 4O4IB 1Z7GA 4M6WA 4D9CA 3L5OA 4J07A 4OKNA 4DKXA 2Y6UA 4R2JA 5GPBA 1CX9B 2RI1A 3RRXA 3PFWO 3U26A 1E5TA 3WNDA 2XUPA 1VYUA 1Y0BA 3E8XA 3G6KA 3MUOA 3DONA 4AIIA 2H31A 1WUYA 1V8FA 2IK8A 1UP6A 1Z13A 2UZIR 3AILA 1JRLA 1NJFA 3IKLA 4IZ6A 3V1KA 3DAYA 1Y3BE 2CHQA 3CN9A 3G59A 3JQ7A 2CLOB 3SM9A 1OFUX 3T3MB 3W04A 3UPTA 5B6JA 2NX2A 1UFRA 2PIAA 4NH0A 1DUVG 2DRIA 1ZGCA 2CB9A 1F8FA 1GR1A 1GQOA 3CXRA 4EK9A 5B12A 5KX5A 4BQSA 3O3MB 2IX3A 2PX0A 3EBOA 3DWEX 3WZMA 1DUSA 1REQA 2BBWA 1O8BA 2B7BA 4WESB 5FPQA 2UUPA 3JWJA 5KYYA 4KUEA 1AGPA 3MT0A 1MB2A 2QUIA 3EY9A 1P4AA 2H08A 1RBQA 3H5IA 4OMCA 1C3OB 4BOYA 1SVMA 1SVUA 2EFDB 2WJ6A 4RVSA 4UHHA 2ZIZA 4BJ3A 2HXSA 5A3JA 1JAZA 4URHA 1W35A 5ALKA 4AYWA 1JQBA 1ZOPA 4Q1VA 5CVVA 2C2WA 2Q3MA 4UEJA 5DM0A 3W7VA 3MG9A 3ECCA 3KCNA 5D6NA 2VSQA 3NONA 3UBMA 2CJWA 4C89A 4O4HA 1X42A 2DU8A 1M1YE 2AZXA 4RVUA 1Y7TA 5KINB 1DT5A 1PSWA 4UM7A 4Q1BA 1VSQA 1G0NA 2B4TO 5JWOA 4DMCA 5AKHA 1V9CA 3RQIA 4HPWA 3ZGZA 2IZ5A 5ALJA 4DC0A 1NVGA 1HDOA 4DIKA 3UMFA 3GCDA 4N3AA 3PXBA 3QIAA 4QATA 1QQ7A 2IZOA 2IZZA 2QUHA 3ZPXA 4R98A 5JARA 3GGOA 5C5CA 5BNTA 5I7SA 4PG7A 5T57A 1GUAA 1E6CA 4HDMB 1Z5WA 4JCOA 3GP8A 5C2JB 1M75A 1NX9A 2CHVA 2GJ9A 3FFAA 3F7OA 3LFHA 3U4QB 1G19A 1FYXA 3ACCA 3RHZA 5JFOA 4KWIA 4NBNA 3G23A 2ZXUA 4H0NA 3BDVA 4D1YA 2QU7A 3TN7A 1EFHA 4QOIA 1PV2A 2C9MA 3CVUA 2A0XA 1TIPA 3LBNA 4ARSA 1OU0A 2RC5A 3RVQA 1FNCA 3DKKA 3IKVA 1QS0A 1TD1A 4A0FA 5HNKA 3QPDA 4R0NA 4ZARA 3VR5A 4DLXA 1H2YA 4LWOA 2C7BA 1Z5PA 4N5NA 2I2AA 1G21A 3DBHB 3HH8A 3PD7A 1NV9A 3G7UA 3SIRA 3IKTA 3H4MA 5KVQA 4X3OA 3BSFA 3G79A 4FD3A 2YCBA 1V4VA 3D1JA 2PZFA 2G0NA 1IQRA 1SEPA 1XP8A 3INTA 4JJ6A 3ZDZB 2OHGA 1ODJA 2Q8NA 1E7WA 4H08A 1PFUA 2Q2VA 1W19A 1WZCA 3MUNA 4TKMA 3GJ6A 3WGIA 3OZEA 2GNAA 4DT1A 1OFTA 2J9RA 1T8SA 1K8XB 1GU1A 5D7BA 3RCBA 4GYYA 1OPXA 2IE0A 4XAQA 5DW0A 3TIVA 2Q6IA 2Z1NA 3C5EA 4K26A 2C5EA 3IJRA 3T3NA 1HRDA 4XPIB 4HNHA 2WFZA 3PXDA 5LWQA 4WBNF 5ENDA 4HYEA 4DIMA 2VCEA 4TWJA 4Y6PA 3UWMA 2WKQA 2HGZA 4G37A 2JVJA 4FC6A 3K71B 3HCDA 2GO1A 2XB4A 3LH5A 4MW2A 1NT4A 3EPLA 1P1HA 5G1NA 2CL0X 2C7PA 1J2EA 3GAZA 2H6EA 4MJXA 3JV7A 1NC3A 5ER9A 3LY9A 1DCKA 5DM2A 4BCCA 3DPIA 3RU9A 2WT9A 1XZKA 3FH0A 1YDGA 2PRKA 4L5IA 3D0KA 4WMLA 3T5AA 4NG4A 2R7AA 4G0UA 3UUWA 1L0BA 3T9FA 3EWNA 2N0SA 2C7QA 1N2ZA 3UVEA 2WTBA 1X14A 5L9AA 3BH0A 4C7MA 3T12A 4FVTA 1H6DA 3BREA 1J9GA 1J97A 1YRBA 4KW7A 4C0XA 4RDXA 3HADA 5IPFA 4N9QA 3TCNA 2UUCB 5ALEA 4E2FA 5K6AC 4GGPA 4NBWA 1FRNA 3G02A 1DG3A 1H8HD 5U9CA 3WLJA 3CB2A 3IR6A 2Q9AA 5BN3A 4CCSA 3UAWA 3JR3A 2ZEJA 5TE9A 4KC0A 3NBFA 5TQVA 2F3UA 3T9EA 2HPVA 2XGGA 4KFCA 1L4UA 1Q83A 2QD1A 2V96A 2VZLA 3AFIA 2PNJA 4K88A 2IUFA 4FT2A 4LF5B 4QUIA 2GS9A 4IH4A 1BC5A 2AG5A 3FCXA 1SQ0A 1TUEA 2R6GA 3IJ5A 4HZUA 4IX9A 4GAEA 4KQ9A 1TT5B 2Q2WA 4DSUA 4CQJA 4JK3A 5HF5A 2EX0A 1JU9A 2PL5A 1E6WA 1USVA 4RPHA 5EY5B 1CBUA 3P2IA 3UJDA 2RKOA 4PRYA 4TYQA 4B74A 3UPDA 5TY0A 3RSGA 4JOSA 4NULA 4B3JA 4CEJB 3CFYA 2VPWA 2V4ZA 1RXYA 2RGAA 3MWGA 4KUGA 4A10A 1U5BA 4M49A 5C8XA 1NPYA 4GMXA 2CVHA 3AEUB 4FYPA 4M7RA 4NE2A 4QOEA 2FK7A 2Q7XA 1E0JA 2FPKA 2WWVD 2ZZNA 1FYWA 2FF7A 2R11A 4HYYA 1XDUA 4J9VA 3RVMA 3WWOA 5HQ3A 1X1AA 1JDBB 4IRUB 2FX2A 2HU2A 1XF1A 4MQ6A 1KXZA 4DPKA 4NXMB 2WIBA 5LDDC 4RELA 5EKUA 2P90A 2WSIA 1T26A 4G24A 3HGTA 5I4IA 3E23A 4MPRA 3YASA 5CVCA 1RZRA 5ETJA 1B2LA 5FB3A 1K6XA 3WLMA 2XNHA 4OMUA 2DUNA 2ZAOA 5IABA 4O2BF 2OYCA 3VA7A 3KYBA 1XNRB 1VB5A 2WWIA 2YJ4A 5DW3A 4PZDA 3UN1A 4L7QA 4I46A 1WF3A 1XNQB 2YN0A 4KWTA 1I6WA 1TO6A 2MIIA 3M9LA 3WGMA 1OYVA 3QTBA 5EIEA 2B3DA 4S0XA 1US8A 3D64A 3BB4A 2IUSA 1LRLA 2XOEA 3BEOA 4H60A 4I1VA 4XGNA 2WTEA 1F14A 5LDGA 3T3GA 4BC0A 5EJ6A 1BDJA 2W71A 2FEWB 5AUNB 3QBEA 3QI2A 1MPXA 3GQBA 5DCYA 5KOJA 5K99A 4HSGA 4C7KA 4EY7A 4IWNA 2J9FA 1QFMA 3H11B 3H9EO 3KPJA 4NJOA 3CT6A 4QBFA 4CKWA 1DO0A 3NI2A 2H9YA 1FSSA 4I1UA 4BMNA 2BUCA 4F97A 1YB7A 5EE5B 3KZVA 1B8NA 2C1EA 1AQLA 3UT5B 1H4VB 5MN4A 1UR5A 4RTPA 1RZUA 1QIHA 3A2MA 2BR3A 4FGWA 1C9EA 1NBAA 2XF8A 1ZKDA 3MYRA 5FD8A 2Y0BA 1SXJC 3FWYA 4G89A 4EYKA 4QKQA 2Q46A 3EZFA 3QF4B 3AHJA 3ZWPA 4C01A 3UH1A 1RWXA 2CMGA 3DL4A 1IPHA 1D5WA 1T1EA 4JH0A 4E1BA 1H4SA 5TGZA 5F51A 4IS3A 1VE9A 2RB4A 3U4CA 1Z8NA 3E3NA 1AB5A 2XSZA 5I5EA 3C39A 1W76A 4JT8A 4DC1A 4B33A 4DMGA 4CG0A 2G28A 1BVUA 2FPGA 3GUCA 3UXYA 3IJPA 2YKGA 1JDJA 3TDNA 4DA0A 5F4BA 4KL8S 5FPTA 3TG8A 4HNQA 2Y1EA 4JBWA 3B9PA 4RJ2A 4ZRDA 4KDCA 5J59A 2JBAB 1CZNA 2C29D 4RAQA 4TMYA 2NUTB 3LP6A 3LUFA 3IV6A 2Z09A 2P9ZA 1PEYA 4Y9RA 3R44A 2D5AA 3SIWA 4E4TA 3GLIA 4OGLA 4CM5A 1T6NA 2YY5A 3EASA 2JGDB 5A7FA 1N2BA 2O06A 2C20A 2X77A 4D9GA 4G5HA 4R81A 2HJ9A 1GQSA 1W52X 3AC0A 1QHXA 3M1YA 5FA8A 3U39A 4XUCA 2PUGA 1X13A 1TAGA 2RK6A 2QRVA 4N0DA 1IHOA 2GVDC 3SE7A 4RIEA 4D9EA 4UHJA 3B9RA 4PYNA 4H7JA 3G0OA 2H1IA 1WG8A 4J7XA 1R15A 1VRWA 4XQEA 1M2OA 4AZ0B 1XKLA 1Y3DE 5CX4A 3ICVA 2YWBA 3HN7A 4NFYA 1GNVA 4YP5A 5DFAA 1QGUA 4MZXA 1EJ6A 4N7RA 3WGLA 1QRDA 2Q7OE 3H5RA 1XLWA 3EGDA 3PKJA 2UZ0A 3AKEA 3DE3X 4OK3A 3KUKA 3TO5A 5J5VA 3X1MA 1KMQA 2FAXA 4QT4A 1YR7A 1DADA 3SYTA 3A11A 1WUJS 3CWQA 1I3OA 3M6LA 3OQBA 5ECWA 1P4HA 5IT0A 2AQ8A 4MW5A 4UCXA 2PU5A 3BCSA 2CNKA 2X0JA 2VT7A 4S04A 2IOYA 1ARZA 4CU5A 5C51B 1DCFA 1DWPA 1ZAYA 2HLHA 4FOPA 5DKFA 1DQYA 4RTOA 1P1BA 3S7TA 4C87A 4WX2B 3EVNA 2UUOA 3PR3A 3KWMA 3LF2A 4FKMA 5DNUA 5A03A 5AM1A 2A67A 4IMIB 1KK0A 3EN0A 2G88A 3BJRA 1G5QA 1MX9A 3KQSA 3LD9A 4DG9A 5DM4A 4AY4A 2B4YA 2Q3FA 4O2LA 3CSSA 1Z7EA 1FLAA 1MQSA 3HXLA 3PVCA 1UWCA 4NOJA 5EXDA 2XQFA 5LJIA 1FNMA 1YZUA 3X2SA 1O3YA 2J0EA 1TKRA 1WW8A 2P2NA 1CRZA 4JI1B 1Z22A 2H5JA 4HK4A 3TPCA 3TTTA 1D4OA 1E58A 1HFWA 3A3OA 5AW8A 2I78A 1KSJA 2WV7A 1HOXA 3IEUA 3Q7IA 1U2RA 4PG6A 4RCYA 4UU1A 5DI3B 3SD7A 4NQZA 4HV4A 3L7YA 1ZIYA 4C4RA 2PQ6A 2BF4A 2KPOA 3SLRA 3DV2A 2X40A 1YAJA 4RMNA 2WFAA 4RZ2A 4MO2A 4OH1A 1Z33A 3D7LA 2JGJA 2HNAA 3I2GA 3SJBA 1E1KA 2JFGA 2VHQA 3OE7D 1M8JA 3WYEA 3S8YA 3DTVB 1HQDA 4OJTA 1R4AA 4BMYA 4LPSA 2G8LA 5DHSA 5BW4A 3NBUA 2HHCA 4YAGA 1ONPA 2FZWA 3G2PA 3WL5A 1NM5C 3N8GA 3ZWNA 3LX5A 2BFNA 3MHPA 2JLZA 3HYRA 1BQ4A 1Q0UA 1EVYA 2G4LA 3VZBA 5DTJA 4E22A 1RYNA 3STYA 4DA6A 4Z6KA 4BPBA 4CCWA 4FE4A 3W6PA 5KNCH 1E6MA 4Z0PA 3G85A 5EZ5A 3VYWA 5AKLA 4WK2B 1D2HA 1G20B 5EMLA 2NU8B 2H2FA 3LWBA 2AN3A 2A4KA 3FYUC 4G4SP 4MQUA 4RK1A 4ZICA 1Y33E 1COZA 4R8VA 1U9IA 1C30A 3MJSA 4S1PA 3CEAA 6ADHA 1BHSA 1TF2A 2OHFA 3I58A 2JVIA 4GYJA 5T3YA 4CGYA 4BQEA 1D9XA 1I30A 2X42A 4Q0MA 4UZFA 3WJAA 4BZZA 2GPSA 2O3UA 1MAAA 5EWJA 3MINA 4UD2A 1HO3A 1O08A 2XQKA 2DERA 5DOZA 2A5YB 4QX6A 3U7EB 1ESDA 1QYDA 1SURA 2OORA 2XUOA 3LS2A 1VP3A 4EO4A 4M54A 1KI2A 1A82A 2WIAA 2JIMA 1XZQA 1UJNA 1ZVKA 1KFKB 2C57A 3H2ZA 5E1DA 5FTWA 1IB6A 4B84A 1AJEA 4MIKA 5JZBA 4Q7JB 3OU7A 4ZO4A 3GVCA 2QM8A 5IN4A 4TN5A 4E4YA 4FMBB 4QUHA 5B7PA 1JEYB 2I87A 3RRJA 3JQ8B 1SEVA 2OXFA 3JVVA 3QX7A 4ZJZA 5BSHA 4UBJA 1R4MB 3QJGA 1W5BA 4UFOA 4NX2A 1RJWA 3CVWA 3RVSA 5JSUA 5E1OA 1ZYUA 2EJVA 1ZVQA 4E7PA 4GBJA 4FCCA 4KQ6A 4HWPA 4NE9A 3IH5A 5AW0A 2OCIA 3UXMA 1I3KA 4GOLD 2ID7A 1X8KA 4DC9A 1GTG1 5FUVA 3NOVA 5SY4A 4JYPA 3QXCA 4TXJA 2I03A 3ABSB 2HYIC 2ZBUA 1Z37A 4AUMA 1GGKA 2YC4C 1L5MA 1XVIA 3LQRA 3PL5A 5CA0F 1CLEA 4D6XA 3IUPA 3IEKA 4N6GA 3ZGNA 2AX4A 4DZRA 4ZYLA 3JYLA 2H2WA 3PIDA 4NPCA 1PHPA 3RUHA 4YFYA 4P5DA 2CNBA 1K89A 4FSDA 4X1YA 4CKBB 5AXAA 4FMPA 4EGCB 1X7GA 1PL8A 1XD2B 1XHEA 2QP9X 3BHIA 5K3CA 3HYTA 3P0EA 1NASA 2GB4A 3GBSA 4HXYA 1JILA 2JIDA 1K75A 2GARA 2NYVA 2FP4A 2W70A 4AJ1A 4N82A 2P1RA 4WASA 1DHRA 1EXMA 2GZAA 4I4NA 2EDAA 2JIOA 1KI3A 4J6FA 2AOTB 4U7FA 5TEVA 5JS2A 1NDHA 1UKVY 4AUEA 4OCZA 3SC4A 4CVNA 3K70B 2AFRA 2BFFB 3GEGA 3I4LA 5GQSA 2IVZA 2XTJA 3LWDA 4Z7QB 1LQUA 5EJAA 3LZDA 1Y3CE 1H93A 2A3NA 1XCMA 4O2RA 5A5FA 1IVSA 2XB6A 5HGJA 3CZAA 3L06A 3LHKA 4H1HA 2J6CA 3D4LA 3PGJA 1CY6A 1GGJA 3E9NA 3E1SA 3QXHA 4TKLA 4XUDA 3VO8A 5KNDD 4QNMA 5EMJA 3QE4A 4TS3A 1GN9A 3RAPR 3U37A 1WZEA 1DAOA 1K7EB 3CZRA 3BE4A 3ISVA 3OE5A 5AKEA 5KJEA 4BN5A 4E2YA 4DTCA 1E1QD 1G7SA 4WD3A 3OQJA 3V9AA 3FOBA 4NVRA 2XT9A 2D5CA 1JSXA 3RK4A 3OCXA 4MIYA 4WXEA 2RJ3A 1AUVA 1RLJA 2A88A 1CRPA 3PPWA 3DDOA 3VU8A 4ALNA 1X7WB 5DBEX 3U6BA 3P1JA 3WKAA 3ME5A 5F1PA 2QYSA 4OI4A 4R8LA 3A2NA 3HB9A 4B6RA 3T34A 3RADC 2ODPA 1NW3A 2JKYA 4D0SA 1R5OA 2RAUA 4KXWA 3UW1A 4GT1A 1QVVA 1XTPA 2W37A 2QG6A 4K1LA 4OQPA 2VXCA 1QYCA 4KN5A 1JIXA 1VSVA 2COUA 2WF6A 4Q6BA 3DWFA 1YD7A 5DNDA 2YIJA 5KO2A 2ROQA 2X6RA 3LFUA 3KKOA 5TEWA 2D5BA 4HX9A 1DC3A 2QAJA 1BXGA 1DEOA 4CMIA 2QQFA 4G0PA 2ZCUA 3KE8A 4IX1A 2R66A 3UENA 4D74A 6CHYA 3QVLA 2GHIA 4E31A 1AQJA 4MUNA 4IDBA 1W9MA 1P3JA 3QG1A 5DN6D 1M2WA 2X0EA 3NM6B 5HA5A 1Y6ZA 5F1KA 1JIQA 5CT9A 1GGNA 5KKAA 1XROA 1CULC 3D3KA 4F9GA 3KQPA 1Z88A 1YBFA 4QREA 1E9BA 5BN5B 5JZMA 3ND6A 4PN3A 4QJ5A 4IIJB 2IXEA 1PFYA 1M1YB 2XUDA 2BP7B 4K87A 3I2KA 3DWIA 4JDUA 2IOQA 2JHGA 2XMSA 4O63O 3ZDBA 1F0NA 3KR2A 5JWHA 3RKSA 4KPYA 5B53A 4ARZB 2HRCA 3K1AB 5K3FB 2WJ3A 3QWAA 4R7GA 2PH1A 2PGIA 3REQA 3DHYA 4CQMA 2BCGY 1SUEA 1T5HX 3WVNA 3ZKAA 1FPQA 3G5UA 1QO9A 4G9GA 4HN2A 1I10A 3T3PB 4J2OA 4PO8A 3RVNA 3UJCA 4GPIB 3IQFA 4OB8A 3RTEA 4ZZ0A 3W7AA 2AKYA 3Q7RA 5KI6A 4DV1B 3VU3A 5A9SB 5K01A 2FZEA 1OX5A 2J33A 3AEQB 4MWSA 2NTEA 2YHIB 1TEVA 3E70C 3M5WA 2Z2YA 2G40A 2X9GA 4AW9A 2ON6A 1C2TA 4IDAA 2C97A 4QUEA 5DCUA 3GR6A 1B2RA 5EIAA 4A5OA 3D43A 3GWGA 5FBLB 2HA6A 1FFXB 2DFPA 4M1QA 5FJJA 5JCJA 3A9WA 1WW3A 1IHYA 2Q62A 2G4VA 2G63A 3AY3A 3JW8A 3T1NA 2ZUEA 1P5RA 1GTRA 3ZJVA 3D3WA 1JKMA 1T3SA 4YI5A 3ZQJA 1UXGA 1X86B 4D9NA 1IWBB 1NKSA 2OHOA 2VSXA 4LZNA 3RYIB 3R8FA 2GXSA 1LS6A 5A06A 4UDXX 1G5TA 3T4EA 3UWKA 3HBFA 2G7ZA 2DJIA 1T8YA 4QYIA 2P91A 2WUDA 5FI1B 2IT1A 1D09A 4EEZA 2VNAA 2V7PA 2W2NA 3VX4A 5GZ1A 5JADA 4UBIA 2A59A 2PZGA 4KYUA 2OQIA 3I0MA 3QEAZ 4X7MA 2TECE 3IQHX 4JU9A 1I3MA 2I7XA 3T4XA 5KMGB 2P69A 2YS6A 3NTOA 2Q1WA 4EUNA 4D9MA 4UPEA 5BVGB 3RVBA 2C8KA 3G88A 5AKJA 3T7RA 2C8JA 5FAKA 3U4IA 4FZJA 1OLOA 4Q16A 1QM5A 4L28A 5CIQA 2X0FA 1ZW6A 4BEBA 2ILVA 3C7AA 1GPKA 5HZGA 2ZE7A 5KQGA 1BW9B 1YC2A 3BEDA 4R3WA 4AFNA 2NM0A 2H2HA 3QF7A 5IUKC 4ENVA 5GTDA 2XD4A 2ZI6A 3HUUA 3DVAB 4J0IA 3AUKA 4IIBA 4M1SA 4BV3A 4DWVA 1D1SA 1QAQA 2BEVA 1KJNA 3B1ZA 2RGRA 2COEA 5TR9A 5IDXA 4Z0NA 4FOTA 3BDIA 1R2QA 1RMQA 1E1LA 4FCTA 2Y67A 3IVXA 4AWBA 3H5AA 3Q0TA 2PJDA 4FBGA 4MA5A 4EJ0A 5BNZA 2VRBA 3DMHA 4RZIA 2FW6A 4RJIA 4UE6A 4OYRA 3P9XA 4L07A 5FO0A 1M0TA 3VSDA 5JS8A 1G5FA 1OVGA 2ADFA 1XTZA 4MW9A 3OJOA 2RHOA 2P3SA 2QU8A 3IEPA 5BRJA 1KIMA 4B44A 4I1IA 4I8DA 5IVDA 3D6MA 2G8NA 1EDEA 3ZXSA 3AEYA 3CLKA 3KZNA 4X63A 5DSZA 4CHTA 2RSLA 4MVJF 3Q5EA 4MQ4A 1FW8A 1H4QA 4MQBA 3OD5A 3F6RA 4KQ1A 3JALA 4AP5A 4I55F 4FBMA 1NUTA 2VK2A 5MGNA 2XZPA 4Q3NA 4J0CA 4EHHA 1SWVA 3N2LA 1QX4A 1TM3E 3F5SA 3PGXA 4TLBA 4N9WA 4C21A 4YK7A 3GEPA 3TEJA 1ZMOA 3HCFA 3RU7A 3UM9A 2PA3A 1XKQA 5CT5A 5JEEA 1YFJA 5AM0A 1KO1A 3ZY6A 2QEQA 1CS0B 2RCNA 3EXHB 4RIGA 4CM1A 5EPOA 3P0HA 2H4HA 3BGSA 4TWZA 3RBXA 5IVKA 3ILSA 4A2WA 4HXGA 3LVRE 2O0MA 4E07A 3E0QA 2B8TA 2IYLD 2VHEA 2XQGA 1T36B 1OW3B 3PZRA 3D81A 4LECA 5TVGA 1PR9A 5HZKA 5ALYA 1NVFA 1RQ7A 3M4YA 4HZIA 1DLJA 3S2IA 1N1MA 4Q3CA 4LBYA 5LUBA 3H0KA 2GK4A 1F2UA 1QH8A 3PRKE 1GL6A 1Z18A 1R8SA 2H4JA 1AQNA 1SXJE 2AW3A 1RXEA 2VYVD 3RFTA 4RIHA 2Y99A 1XRSB 4D4LA 1P7YA 2GCGA 5K8LA 3D7MA 3IPAA 4M46A 5IZCA 4JT2A 2BAGA 3BMOB 4JJGA 3DP7A 2ZZKA 4Q3LA 3D8SA 3BWEA 4R2HA 4TTAA 3MPOA 4HH4A 5EIBC 2JJYA 2YFKA 1KEPA 3PXCX 3O8BA 4NAHA 3FFBA 1E2DA 1PJCA 4GKJB 1Y81A 4YAIA 1N8TA 5AVTA 2ZRAA 4UVDA 1UZNA 3OP4A 5DNVA 3V42A 2D5LA 4OL9A 3ZDXB 1RWQA 3VYRB 3GNLA 1NXPA 3NC0C 2BRUC 1L5ZA 2BGTA 4GVXA 3ZXUB 3UO8B 2VTBB 1XTUA 2PE5A 3SSNA 2M6KA 2G1PA 4NJEB 3CLUC 3FSEA 4PRZA 3GJYA 4I19A 2BGKA 2KM1A 2ZXEA 4U6NA 3MGAA 4PZLA 4R2MA 5IN5A 4CF3A 4CUZA 5KB3A 1M9NA 3UPUA 1N2HA 4H7FA 4KGDA 4P86A 2GCIA 1XQ1A 2WM8A 3P26A 1BS9A 4RSMA 1OX4B 2J0UA 1DEKA 1IH8A 1K3TA 3MB8A 2I55A 3ANSA 3W90A 3GGSA 3JVIA 3AERA 4X20B 4IO1A 2JPDA 1P1JA 4PZ9A 4M60A 2PD3A 1W4LA 4O59O 4V0RA 1QIKA 4P3OA 3V4PB 3G9QA 4ANFA 1QGED 2UVPB 1F9AA 3KXLA 1QKJA 1F7VA 3NQ41 2H0RA 3NVAA 1MMFB 3EQ9A 3HQ4O 4OXIA 4XWYA 2Y2VA 1UFOA 4GUAA 2BBSA 1Y1QA 1OR8A 1J25A 1ORTA 3DW1X 5EJIA 3AHFA 1ZJWA 1C8KA 5FOQA 1RKBA 1YR8A 2PZEA 3ABQB 2FF5A 1K3UB 1LF0A 2VYQA 1SUSA 1XK6A 2IXDA 4G84A 4WN3A 4EY6A 1JVBA 2PLRA 1P4RA 4JLNA 2Q5HA 3D4NA 5AW9A 3FNHA 2AB0A 2ZUTA 1QH9A 1C7JA 4R1NA 2RG7A 4L3WA 3I9JA 4X9XA 4RK0A 1X8JA 1FQOA 4I1RA 3DBVO 5LUAA 3IAS1 1SCUB 4P2GA 1G9TA 4JBGA 9LDTA 3N2GB 2NUBA 4KDEA 1WCV1 1TJYA 4TV8A 1L5NA 1QQ5A 1Z6XA 4B3MB 3VU9B 3DE1X 3GLHA 1QZXA 1TA9A 3KHTA 5CTAA 2XTNA 1EXWA 5TMDA 1SR8A 2WT8A 1OF1A 1YTLA 5GWXA 3OZ7A 3O4VA 1QUEA 4CKEA 2FSUA 1Y9ZA 2OXTA 4D7AA 1R5NA 5BMVA 1KI6B 2MSLA 3OHMA 1AT1A 1M8FA 4MLCA 3LX6A 3R8XA 5L3SA 4DV0B 3LAWA 4JYBA 1M6EX 2V6FA 2YJ6A 3X1WA 2XCRB 1SVOA 3NEYA 2D00A 4HFNA 4XCXA 4F46A 4J0EA 1JFFB 2X15A 5LD2C 1PYOA 4RHFA 5BT9A 1DJNA 2SHKA 2QX8A 3AZPA 1QTRA 1XQ9A 2Q2OA 4WOJA 2P7HA 4WN9A 4CV1A 3VR5D 5JW6A 2DC1A 1HPLA 2ZRPA 2IYYA 1VL0A 1GLGA 3CCBA 1L6RA 4HUQA 4K2AA 2PWBA 2BDEA 1DKUA 4M9ZA 4UVHA 5EMHA 4UDNA 1EZZA 1PT8A 4E03A 1UIRA 3NWOA 5JXJA 4OFXA 1XDZA 3DDCA 1GUDA 4EOGA 3KWFA 3ECSA 1Y5LA 4LHWA 3U1VA 1J00A 1OI2A 2PPLA 3CLHA 5G4KA 4RO0A 2Z5GA 3W2HA 4WDRA 1L1QA 2H4XA 1VIMA 1EWYA 1FDUA 1C1XA 1R8JA 4RABA 1U2GA 2X1VA 3IP7A 2AD1A 2YOHA 4Q7EA 2EX4A 3LCRA 4GRAA 3OIUA 4MR9A 4R40A 1VLMA 1IN7A 8MHTA 2D7JA 3LSTA 3MEQA 2WAMA 1ISFA 3F0TA 1KVQA 1QR2A 2H92A 4QUAA 4BAUA 1U65A 4IVQA 4JR0A 1SBCA 2V58A 3NGXA 3TLBA 1AN0A 3I1FA 4G9EA 2ZS8A 4L7VA 4TX1A 4EI7A 2O8FA 3EQ2A 3VAZA 3SGLA 1GADO 4FFWA 1MG5A 2QMYA 1JLMA 1UXJA 5MFZA 1N33B 4L72A 3EIWA 3VR6H 1U2DA 5C7IO 4N0EA 4C7VA 4DQXA 5G1PA 4HAOA 2ZITA 4LSGA 5EYPA 3K32A 4PFSA 3ZIUA 3NHFA 2J46A 4LDAA 5JUWA 3FTEA 3IUBA 2WF7A 3R3XA 2A2ZA 3I01M 4ZP1A 3AOEC 5BQOA 3WQQA 2IPLA 3NO4A 2LV8A 3GJZA 1XN1A 3CH4B 4L9WA 4H27A 4O4IA 3AUUA 4U2DA 3B7GA 1SBZA 1YOBA 3VPHA 1G2IA 2EERA 3QOYA 3NFRA 4MKRA 2GAIA 4CI9A 1OYOA 3AYZB 2JIQA 3GJXC 3IBTA 1ZA1A 2V0CA 3D6TB 3M1AA 3VM6A 4B40A 3F90A 3QGMA 2W4MA 4NNPA 3UHJA 2BKEA 3TECE 4EG4A 1I8TA 3ASVA 2HJSA 4YRNA 2DGDA 2Y05A 1WUHS 2AMVA 4TVSA 3W9BA 4NCIA 4N03A 4DJ5X 4WH0A 2QI9F 5G02A 3HMQA 3WWCA 2EKPA 1ZD3A 1P60A 4TTIA 2Z2IA 2ZQYA 3GGDA 4PE5B 3NALA 1OT5A 5DB4A 5AW5A 2PSFA 1W4ZA 1KJJA 2I6TA 4IGIA 4A2CA 1EG7A 1J2RA 4DEXA 4DEYA 4YYZA 5TLSA 3OZCA 1VL8A 1Q7TA 3ELYA 4JAVC 4BVJA 3OTQA 1QGZA 1XTVA 3SVLA 2GPYA 1GNRA 4ES6A 3KUDA 2Y76A 3L41A 4YJ3F 1F12A 3W78A 4E5PA 5KQLA 5LNK1 3SYMA 3EISA 1EXVA 4CIDA 4UU7A 5A5VA 3MCAA 5JH7F 2Y9PB 3ZI0A 5CR9A 4I4CA 1USKA 1KO4A 1AKUA 3CPHA 4G0WA 4OV6B 4L5CA 5IJ0A 1P6QA 5BR8B 1LLQA 3E9DA 1YIAA 4HP8A 5EQFA 3WXMA 5C35A 1X1EA 3PI7A 4A2PA 1EZ1A 1MF7A 2ZSBA 3HJTA 3AVOA 4R8RA 5D85A 4B47A 4PIVA 3IHTA 3NJ8A 4R41A 2GCOB 4J8PA 3QM1A 3PNBA 1I3NA 1MNAA 5PNTA 5CPFA 3RR2A 3D3QA 2IHBA 1RJ9B 3W5DA 2DSTA 1Q0RA 3NTXA 5LZ8A 3R1IA 1TOAA 3ID6C 2WNSA 5CX1A 3A4MA 1UXOA 2ZUWA 3N86A 2G25A 3HBMA 4HDMA 1K2WA 5WRFA 1PL6A 4C30A 4XWTA 4CT5A 1RZRD 4M9SA 4QPZA 3U4QA 2R4UA 2Q5JA 1H0SA 4L9RA 5L53A 3OEWA 3WQHA 3HY6A 4ZVNA 3EPKA 4WZ6A 1YFKA 1QRTA 1YB4A 4O4LF 4EHLA 1ZLXA 2J3KA 1P9LA 3Q10A 3FOWA 1UT8A 3GRKA 3A27A 5KTNA 1VDZA 3EVGA 2GJAA 1RMTA 1YZLA 3C8ZA 3M82A 4RORA 2NVUB 2FQWA 4KZKA 2B7LA 2IXFA 3DBHA 1PWEA 1UZUA 5AJYA 1RQGA 3PSHA 1XDGA 4Z9YA 2QM0A 2OESA 5A7GA 3WHLA 5IAKA 1G8AA 2IV3A 2BMAA 1AY0A 1KFJB 3UTCA 1W1IA 2VF7A 1PDWA 5CLQA 1B74A 2LE0A 1L5RA 1XQVA 1T24A 2GN9A 3FPBA 4GSKA 5LKRA 3CIOA 4MV5A 3AZQA 2PMBA 2FUKA 1H2AS 1GCIA 1RJGA 2EYUA 2X0KA 3HDHA 4GL4A 3GFFA 3HKCB 3L40A 2H4WA 1RFLA 4XM2A 5JIBA 2EFGA 1G9XA 1GPWB 1W0JA 4ND2A 4C5CA 2PJRA 3DFIA 4AKSA 3L1UA 3H7IA 3X1DA 1QIEA 2JB9A 4NNJA 2JFBA 3NAZA 2NU6B 1G3MA 4MTCA 3U9LA 3G8YA 2X0IA 5L8VA 3WSTA 1B7GO 2IQ5A 2V5AA 3K05A 2NU9B 1E4VA 3B1VA 4ITUA 1IVNA 4YQEA 3RYHB 3JZMA 5A1TA 5ICMA 4IEIA 4Z4GA 3PE6A 1ZHHA 3NDBB 1RJFA 3ND8A 2B2NA 3DMPA 1IM8A 1XJ0A 3B9BA 1AS3A 1VKJA 1FDIA 1XQ6A 3PXUA 5GV7A 4L85A 1BMFA 5DMXA 4UD6A 2KHZA 5HEKA 1SK8A 4JROA 3TAHA 3PV0A 3RVJA 4Y1EA 1I5OA 3FPHA 5K2MA 4N6NA 3ZZ1A 3NMUF 5KVCA 2TRSB 3THOA 2VRWA 1C0PA 4MCIA 2DT8A 1AQ6A 1WEHA 1LLFA 1C3EA 2F43B 2JBHA 1B3RA 2QOEA 3RSLA 3G2KA 2YUIA 2QENA 4A6XA 1NN0A 3OX1A 2QTAA 4GBMA 5ESDA 5K3BA 3BWMA 4HYTA 4MVJM 4X93A 4MVJI 3T9AA 3D3NA 2ZJFA 1XMXA 1WOYA 3I72A 4B3BA 1U7XA 2B36A 3FX2A 4KIWA 2X9NA 4LVUA 2NZJA 2H0AA 3DXZA 3LDGA 5ALMA 1GITA 1NP7A 2NPIA 3N2KA 4PYIA 4B82A 1N2SA 1THMA 5JCOC 1ZK4A 4PQRA 1PZMA 4KTVE 4F56A 4FILA 5L6MB 2QTNA 4YMLA 1WLYA 1W29A 2G9VA 3BTSA 3E84A 3ZWXA 2A0FA 3ZVKA 2BKXA 1B6TA 3V1NA 3N28A 4WQMA 3E22B 4NH4A 1FYEA 3RUAA 3N6RA 5HMMA 5MHTA 2CLDX 2E2WA 3OA2A 3R0ZA 1TT5A 2EL7A 1W2GA 2GPNA 1I0ZA 4GOOD 4GPAA 4H6VA 4KI0A 4A03A 4DR5B 2Y68A 3KSRA 3GHYA 2JL1A 3U3XA 2I8AA 1Q74A 2GEBA 3RSCA 5ISMA 5FA6A 3DXYA 5LU9A 2HR1A 3PC6A 2DOKA 1R1DA 4RNDB 4IOKA 2ADOA 2D8AA 2XAAA 2FN9A 2R5FA 4CEJA 3OBIA 1I80A 1QHHB 2FPMA 2H1RA 2H3EA 3NIFB 5GOZA 4HTAA 3QZUA 1TEHA 5BQ5A 3COJA 4MSUA 3AEUA 1P2SA 1FUIA 1I7NA 2VJAA 4KLNA 1CEYA 1GUBA 4W5WA 4LSMA 3BFKA 4JXZA 3RRMA 1NC1A 1Z4LA 4B80A 1JDNA 2BW0A 1DARA 4FYYA 4HZGA 1ZUIA 1LSUA 3LUGA 3QX9A 5TS2A 1MKYA 3TEMA 3HSYA 3NOQA 3WFIA 4GL2A 2ENWA 4J16A 2Z0MA 2O8CA 4J7AA 4NU5A 1TCAA 1II8B 2P79A 1PFVA 4HC4A 3V7NA 5ILGA 2PGDA 4DRXB 2IP2A 2NO9A 3WOVA 3HJBA 3OU6A 1ECBA 4GBED 4AF7A 1Y9EA 5FYQA 5JRJA 2GILA 3FUUA 1FZTA 4ZVUA 4YMUA 3GFOA 4KCGA 4O3FA 5ER6A 1I2DA 4REQB 3CEMA 1FNDA 1FFYA 2ALJA 5COAA 4TVBA 1AF4A 2IGTA 2V45A 3C5HA 3LZCA 4EAQA 1E2BA 3LA8A 1JKJB 3GCZA 1VE3A 1Q91A 1TO1E 3F98A 5DSXA 2R85A 3E5MA 3K5WA 3GLQA 4TMTA 1XMSA 1Y89A 3LA6A 2EJWA 4OXKA 3H11A 3U7GA 3DEYX 3F8WA 3FLEA 3IBYA 3K73O 4HFRA 4KYTA 2AEFA