1X1TA

Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with nad+
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
236
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTLLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title d-3-Hydroxybutyrate Dehydrogenase from Pseudomonas fragi: Molecular Cloning of the Enzyme Gene and Crystal Structure of the Enzyme
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
total genus 78
structure length 236
sequence length 260
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x1tA00
3OIDA 4R3WA 5LCXA 2DC1A 3LC7O 5IZ4A 3FHLA 4BMSA 1LXCA 2G5CA 2H5LA 3PYLA 3PYMA 4AJ4A 4M87A 4FGWA 4PFJA 4NJMB 1LDMA 1O9BA 5A5EA 1MX3A 2Q1UA 4RJTA 4II2A 4E2ZA 4EJMA 3GVPA 3H5NA 3ENKA 4OJNA 1GU7A 1UZMA 3H9UA 3WICA 3AUTA 2GSDA 4KUHA 1DFHA 4J2OA 1C0KA 4I9UA 1DFIA 4OQYA 1V6AA 3RSHA 4CQLA 5DN9A 1OZAA 1XLTA 3E5RA 3OM9A 2YFHA 2EGGA 3H4VA 5DDIP 3RROA 4EEZA 1U9JA 1EVIA 3UF0A 2IRWA 3OA2A 4FFOA 3BYZA 4OO3A 3B1KA 4BV9A 3V2GA 1C14A 5AVOA 1YGYA 5L4NA 1Y8RB 2B5VA 4XKJA 5F5NA 2FR8A 2FR1A 3ROQA 1FXSA 2QZ9A 3IUPA 4CR7A 2BF7A 3QVOA 3DBVO 4P4NA 1E5LA 1MP0A 5FYDA 3DFZA 4NPCA 1XDWA 2VWPA 1K6IA 3D4OA 1ONPA 3OETA 1ADGA 2WM3A 3W4KA 3OP4A 2C7VA 3QA9A 3UN1A 3MEQA 3PEFA 4GI2A 2NU8A 4CMKA 4ALJA 3CIFA 4BNGA 4ALIA 2XOXA 3WOHA 4TQGA 1PU2A 3FD8A 4RVDA 5CPBA 4CM4A 3H3JA 4QUKA 4MJLA 1D7OA 2HU2A 2IYPA 4BKPA 4K26A 1PJ3A 1N8KA 2VZ0A 5TQVA 3WBFA 4C4OA 2CF6A 4NG5A 2VTDA 4JP3A 3VH1A 1U4OA 4GVLA 5H83A 5JAQA 1KOLA 4Z6KA 3HQ4O 5JCJD 3NYWA 1PZEA 3I23A 2NLOA 4L74A 3WYCA 3F4LA 2OP1A 3BTOA 1B3RA 1GUZA 5CAEA 3AUUA 3DBLB 3WGGA 2OL4A 4CLRA 2RCYA 2IEBA 4CLOA 2WYWA 5A9SB 1XGKA 5DT9A 1KEUA 3TL2A 4K6CA 5JDIC 2CD9A 3H7AA 2PZJA 1XQ6A 5LDHA 4MVJF 2GERA 3DAFA 1WZEA 1ZCJA 1NQ5A 2HO5A 3R3JA 4GGPA 1SCUA 3DR3A 5A3VA 4YJGA 3DZFA 4AJ2A 4FQ8A 3BHJA 1U8XX 1M6WA 2Q49A 3FPLA 4GPD1 4PG6A 4FJ0A 1NX6A 1X1EA 5JC1A 3LT1A 4QECA 1GYQA 3RBZA 4JK3A 2NQTA 3VH2A 3JQ8B 1NQAO 3NTQA 3UOGA 1N2SA 1YJ8A 3AY3A 3FCOA 3VPXA 3GVXA 5GY7A 1QLHA 5DZSA 4Y67A 4YAKA 3WG9A 4BGEA 1CF2O 1E7WA 2EP5A 1L7EA 2NUAA 2V6BA 4JBHA 4BNJA 4KDFA 1E92A 2YV1A 4FFLA 5JMPA 1E3LA 4CLXA 3AFNA 3IMFA 4GL4A 4HKTA 2I3GA 4YAGA 4NK4A 1E7MA 1P3DA 1J49A 4ZRMA 2X4GA 1BMDA 1WDKA 2QZZA 4BNXA 1SAYA 4HFNA 3CXRA 3VHRA 1JU9A 2BMAA 3GY0A 3JSAA 5JDIA 1KY4A 1K2WA 4UEKA 4Q3EA 3BTUA 3ETEA 4XRRA 2NACA 1I3LA 1UZLA 2I3AA 3JQGB 3I9NA 2WSBA 4XD2A 1CWUA 4IUYA 1CEQA 3WJ7A 4I8XA 1WDMA 3LF2A 4C7KA 5ICMA 5ITWA 1KVUA 2GN4A 1JN0A 3ZV5A 3KBOA 2CVQA 1HXHA 1T2DA 3OJ0A 3RBXA 4J43A 3I83A 1K89A 5IAAA 2V6MA 4CQMD 1DRVA 3WYBA 2YQ5A 1MC4A 3AI3A 4KTTE 3BIOA 2OBYA 3HN7A 2HKIA 2NU9A 4ZQGA 4W99A 2Y1EA 1NR1A 4RPHA 3GEMA 4DC1A 3I9MA 1YDWA 3K2EA 4Q3DA 1ISGA 3U4CA 4OSPA 4YJFA 3ZHYA 1SPXA 3PWKA 3JQAD 4UUNA 2Q46A 4JIGA 4Q3NA 1GV0A 1ZK1A 4QT0A 4ZQHA 4I5EA 5EJ2A 4LSWA 5KTKA 3TFOA 3S8MA 4IDBA 3PJFA 2YUTA 2C5AA 2Y0EA 1N9GB 2A9FA 3ZWMA 1KEPA 4BGUA 4BO1A 4NFSA 5IG2A 3ZU5A 3BMNA 2O4UX 3WTBA 1PZGA 2ZB3A 3Q11A 2AXQA 2IZZA 4U8GA 4F6LA 1U3UA 3C7DB 3PQFA 4MO2A 3FF4A 4BIIA 3DMTC 4R1TA 3A06A 3GDFA 3RFTA 3RUAA 3WWZA 1EBFA 1WXDA 2AMFA 1H2HA 3IL2A 3JYQA 1YWGO 1Z6ZA 2H9IA 4XWYA 4J90A 1A72A 4A27A 4CM4B 1YB5A 3OSUA 1F12A 1QRRA 1HSOA 4YXFA 4TVOA 3ONDA 3O9ZA 4GX1A 2Q1TA 4FN4A 3ZWYA 5CEJA 1IY8A 3AI2A 2ILTA 4DGSA 1EFLA 3NT4A 1UP6A 5I9MA 3G17A 4FBGA 3HDYA 3KXDA 4NH4A 4M54A 1S6YA 3ZHXA 4NJOA 3P2OA 1SMKA 3JV7A 3BMQB 2PGDA 2FOIA 2ZTUA 2O48X 4XCVA 1DEHA 4JP2A 3VOSA 1CERA 5DP2A 1A9ZA 2DTEA 1NFFA 4FS3A 1HE2A 1M6HA 1P45A 2D8AA 3DMTA 3FI9A 3FSRA 1LLQA 4NBUA 3U0BA 1MV8A 3BHMA 4JLWA 1ZW1A 3CZMA 2GUGA 4RF4A 1RPNA 3DL2A 3ST7A 1E3EA 2CNBA 4IZIA 4JBIA 3S2FA 2J3IA 2VTEA 1CQJA 2X86A 1GYRA 3GMSA 4ZGWA 1E7SA 2CVZA 1HDRA 3ZU2A 4B4UA 4R9SA 3ZWCA 1KEWA 2IE0A 1TT7A 4BO3A 3WR5A 1ZXBA 2Y67A 2BHLA 3HJAA 2EERA 3AK4A 3E5MA 4W6ZA 3F5QA 4ALMA 4G81A 5JS6A 4CLEA 5G0TA 1W6UA 2B0JA 5DULA 4BO6A 2J5QA 1RKXA 3WGTA 2X5OA 5DBFA 4JBGA 4Z3DA 1Q2XA 3VH4A 4FFNA 1BXZA 2JAPA 1TEHA 4Q3BA 2Z1NA 1E1LA 3L6OO 4WCDA 1O8CA 4ITUA 1K5HA 5LC1A 3W8EA 3QWIA 4HWKA 1VRWA 3IJRA 3SBOA 4EW6A 4J91A 5L7TA 3U09A 5KKAA 1TT5A 1F8GA 1LLDA 2ZB4A 5THQA 1E6UA 1HZZA 3ANNA 1B26A 2AQHA 1DXYA 2IXAA 2O2SA 3U3XA 1ISFA 1G1AA 4IGFA 1NAIA 2W90A 3D5TA 3VVBA 5L4LA 4CMAA 5GZ3A 1E3WB 5AXAA 3JQ7B 4AJLA 4GX2A 2BFPA 4S3MA 1JTVA 5EMHA 1R4MA 4ZN6A 4R68A 3D4NA 2NQ8A 4GBJA 2B36A 1H6BA 3MZ0A 3PHIA 1B2LA 2Y68A 3BA1A 4CUZA 1YS4A 4D7AA 3S2IA 1BWSA 4XYMA 3BMNB 4IS3A 1BXGB 4E0BA 2Q1WA 5KNLA 3GZNA 2PR2A 3ZNQA 1EQ2A 1C1XA 2X0IA 4AJHA 3PWSA 5ILOA 5TT1A 1O94A 1HDXA 1LLCA 5KVVA 3SJUA 4HY3A 2P5YA 3I52A 3QVWA 1UJMA 4XQ9A 3ASUA 2JD2A 1ZKMA 1JVSA 1EQUA 2X9GA 2P4QA 4CMIA 1W8DA 4BUCA 1LSJA 3GFGA 2J3JA 1I01A 1HE4A 1YVEI 5H81A 2QW8A 1XWFA 2IDZA 4J2HA 3UCEA 3TQHA 4DXHA 3OMLA 4OKNA 4OXKA 3I4FA 1V3VA 5IDWA 1OOEA 1T1SA 3TL3A 3OFSA 1ZFNA 3VPGA 3PLNA 1P33A 2C20A 2D5AA 3LSYA 2EXXA 4FGSA 6LDHA 3UCFA 3ZNNA 5TT0A 3Q9UA 3G3EA 2EF1A 4G2NA 3M2TA 2P9GA 3SLKA 2DQ4A 5JAZA 1UR5A 3KEOA 3KUXA 2QRKA 2VUTA 3AOGA 4KUEA 3PIDA 1PS9A 3SEFA 2Y1DA 1JDJA 4BO2A 3KYCA 3DBRA 4PLYA 4YJHB 1OAAA 2YYYA 4N54A 2V6FA 1B7GO 5IDQA 2BGMA 5K6AC 2HRBA 2VT3A 4MP3A 5I9NA 4DBVO 2BLLA 1EDZA 5FEUA 4URFA 4BMNA 2X5JO 1IUKA 1C1DA 1MXFA 2DFDA 5HS4A 3W4IA 4YT8A 5A9RA 3IKVA 2UAGA 3NX4A 3DMYA 4XA8A 4MVJD 4H16A 4IS2A 1MXHA 3MJ4A 1G0NA 1U2DA 3I1JA 4LW8A 3VZSA 4R5MA 4B7CA 3WQRA 2NADA 3G79A 2Y1OA 5IZCC 2PTGA 1V8BA 2X0RA 1XELA 1LA2A 4XDYA 3MWEB 1XEAA 3RC2A 4QO8A 2GZ3A 1C0IA 1I33A 4R9RA 1MGOA 4ND3A 3BHIA 3KSDO 5C5IA 4N7RA 4NR0A 4J1NA 2J5KA 3PHJA 2FHSA 4TVBA 3NJ4A 4P4GA 1HT0A 2VNAA 3E82A 3JD2A 4J16A 3JQEA 5HTOA 3RD5A 3K2BA 3RASA 5K6AA 1KVRA 1XR3A 1O0SA 1WVGA 3PHGA 3WGIA 1T26A 2DBRA 4NNJA 3UVEA 4LCJA 1EBUA 1GCOA 4R16A 1QLJA 2DFVA 1M2WA 3BAZA 4B7XA 5L45A 2IEDA 2HAEA 4IDDA 4ZHSA 1N7GA 1SB9A 1PJ2A 4XGKA 1GZ4A 4ESOA 1DIGA 4D3FA 4E5PA 1V3TA 2D1YA 1ID1A 1AN9A 4X54A 1ISMA 5KCZA 5BR7A 4TRJA 1NTOA 3A14A 5G0WA 3NEPX 3CINA 3C24A 3OJEA 4CLHA 4NJMA 4OAQA 5IZCA 7MDHA 4NHEA 2RHCA 3HADA 3L9XA 5G0VA 1R4MB 5HS6A 2EEZA 1BDMA 4D79A 2VHWA 3LF1A 1IL0A 2R2GA 1ONOA 1CIVA 1Y7TA 1IOLA 1ZSNA 4UVGA 3ETGA 3L77A 1EMDA 3TDKA 3TPCA 1GPDG 4OH1A 5G2OA 1GAEO 4CMHA 3F9IA 3VZPA 2NTNA 3ENNA 1R12A 4IXTA 1ZVMA 4U0KA 2YQ4A 4XQGA 4TRRA 4KDEA 2H6EA 2X5KO 3NGXA 3LLSA 3WFJA 3WXBA 4DL9A 1SBYA 1ZEMA 1PEDA 3KETA 1Y8RA 4MKRA 1FDSA 5C7OO 4E3ZA 3AOEC 1ENOA 3QV1A 5L53A 4TZKA 4YDRA 1IHXA 4MIOA 2WWRA 4GMGA 4W7HA 2EHDA 4R69A 1CJCA 4I9NA 1V3UA 3CKYA 1JW9B 3LZ6A 4WASA 4U5QA 4Q3CA 5EIOA 1R6DA 4XGNA 4RV9A 1UP4A 2BFOA 4FC6A 5JAIA 4LVUA 4W9NC 3RKRA 3F6YA 2C29D 4IDAA 4DPLA 1WLYA 3PJGA 4M1QA 8LDHA 1CYDA 4EUEA 5B1YA 4TWRA 1GPJA 5FI3A 4BO4A 4WLOA 5FWNA 4RPLA 3UH1A 2UYYA 2YHUA 1I3NA 2C59A 3HUDA 1ULUA 3A28A 3JYLA 3HSKA 3P19A 1D3AA 2PA3A 2OMEA 3O26A 5F21A 4MVJH 4PG4A 2UUPA 4JX8A 1WMBA 3DBRB 4J4TA 4ND1A 3DBLA 5JDCC 4BKUA 4FFPA 2OOSA 5A9SA 4LGVA 3P7MA 3I5MA 5EL0A 3DFUA 5L40A 4DQVA 3DZKA 1PX0A 3AM5A 4Q9NA 5JFOA 3I6QA 4D46A 1ZK3A 2AG5A 3RUHA 4UVHA 4UEJA 1Q7GA 3BMCB 2B83A 2G17A 5IJZA 4IDCA 4EUHA 4RPGA 3LC2O 5JCJA 3QSGA 3NDRA 4CV0A 4WLFA 4NQZA 3WDSA 1PR9A 2VRCD 3TOXA 4W9NA 4RF2A 4J4HA 4MIYA 3W6ZA 1Z7EA 2J3KA 5KVQA 4YRAA 3CUKA 3WX0A 3GNQA 4EJ0A 4CV3A 2QQ5A 5IFLA 1UH5A 1ZH8A 2D3TA 1Z74A 3E9NA 1Z45A 5HRUA 2HMWA 1CQIA 1QYCA 3ZV3A 2JAHA 3MCVA 2Q99A 1PJTA 2QRLA 5EQDA 4AJPA 1PSDA 5FF9A 5JDCA 5FFFA 1U2GA 4J7XA 4WKGA 2GD1O 4P8RA 4FCCA 1GQYA 4FPXA 3GUYA 4XIYA 4CMEC 3FBGA 3ZNPA 3FTPA 2PGLA 4NBVA 3OBBA 1T2FA 4ALLA 4IINA 1ZK2A 1HKUA 3FTNA 1EK6A 3JQGA 2ZJ0A 4J4BA 3PFFA 3PHLA 1GFSA 4FDAA 5U9CA 3DOCA 4XRGA 4UVDA 3WS7A 1WPQA 3C7CB 2GLXA 1U3VA 1XA0A 4Z9XA 3RCBA 4OL9A 2A35A 5ENVA 5HM8A 1DDOA 3K6JA 3PDUA 2OBNA 3OJFA 3F4BA 1I3KA 1I36A 2HQ1A 4CM5A 3NJ8A 5TSDA 2EKLA 1DC4A 1F06A 1GEGA 3GPIA 1E3SA 2BI8A 1ISJA 1VM6A 1KETA 4RO0A 2VWQA 3QJ5A 3S55A 3T4XA 4F6CA 4AJIA 1HWYA 5CDYA 3I9LA 1GTMA 1P31A 2E6UX 2NTVA 4CMEA 4FFMA 4YA6A 3ULKA 1P1JA 4BNNA 1N9GA 4W7IA 3GA0A 1KIFA 3D5QA 2GYYA 2FR0A 2JD1A 3LDHA 4FJ1A 4CJXA 4NU6A 3AW9A 1UDBA 1HYHA 2ZQZA 3KZVA 3N58A 4RPKA 3VZQA 3KSZO 4LRTB 4HP8A 3TSCA 1J4AA 1P1KA 1NP3A 1PQWA 1VC2A 5JY6A 4BB5A 2Q50A 3ZU4A 1QYWA 3QE3A 1Q7BA 2CDAA 1FDTA 3ADOA 3E9QA 2BKAA 3TWOA 3X2FA 3DOJA 4CR8A 3ON5A 1HRDA 1SB8A 4GWKA 4NBTA 4J0FA 2X1HA 3PVZA 4ND4A 3JQFC 3GC6A 1I2BA 4RZIA 3G0OA 3GGPA 3RC1A 4W82A 4PZDA 4MDHA 4TZTA 1X14A 5AOVA 4BNUA 8ADHA 4WLEA 3O4RA 1MA0A 4DQUA 4L4XA 1A4UA 4AG3A 5EN4A 3ADPA 3DEYX 1O5IA 2AA3A 5T6BA 1T24A 1DC5A 2AE1A 1X7DA 2J5RA 3BMQA 3DZGA 1SC6A 3D7LA 3R6DA 4L0QA 2NM0A 3O03A 5BQFA 4OMUA 5T5QA 3DZIA 3CTMA 4R4JA 4YT4A 3DXFA 2QG4A 1EZ4A 3WBBA 3F1KA 3L6EA 4DIFA 2F00A 1NVGA 3NRCA 4P22A 2VRBA 2W2KB 3VVCA 2X58A 4BKOA 3U4DA 1H93A 3PRJA 4RZHA 1NHGA 4GKVA 4QXMA 4YEDA 4R54A 3W4JA 1P1IA 3IAHA 4RF3A 4CM6A 4RF5A 4YCAA 2GZ2A 3KLPX 3MJSA 2YDYA 4WLNA 1A7KA 2Y1CA 3IDSA 3DO5A 1R37A 3TZCA 3CH6A 3JQFA 3FR8A 7ADHA 4ZD6A 3C1OA 3I9KA 4NBRA 4N18A 5GZ1A 3ZN2A 2JHGA 5CDUA 1N5DA 4E5MA 2XXJA 1JAYA 2I6TA 3ORFA 4MVJE 3R3SA 1NM5A 1JKJA 3LYLA 1Z73A 1DIBA 5CP8A 2IZ0A 1LBEA 1VI2A 1GQQA 1VPDA 1I10A 2E48A 2GZ1A 1XYGA 5L95A 4IBOA 5ICSA 1G0OA 2X22A 3OEYA 3D1LA 1PJSA 1H9BA 1ULSA 3PJEA 1I8TA 3D4PA 3K96A 1K6XA 4WOJA 4YWJA 1HYEA 1Q0LA 5CEFA 1NYTA 3EZYA 3DHEA 4K1LA 1JA9A 3H5AA 3K31A 4Z0HO 4BNWA 3JQDA 2FZEA 3PGXA 1WDLA 5JO9A 2W8ZA 1DRUA 4E5NA 2XPCA 3VPSA 1Y9AA 4I5FA 1M67A 2VYNA 4JNKA 4YTEA 4WOKA 4J0EA 1BTOA 3RAJA 4EBFA 3LQFA 2CMDA 2UVDA 1E3WA 3JQ7A 1YBVA 3HB4X 3WFIA 4CODB 3H2SA 4JN6B 2Q2VA 1U7HA 2CDBA 1ZO8A 3GK3A 4MKXA 1BW9A 4RVUA 2OO5A 3I9OA 4MP8A 2PZLA 1BRMA 4CQMB 2FPGA 2IODA 3K92A 1OC4A 1Y5MA 1BXGA 4RLHA 2DPHA 2NNLD 2X9VA 2GNAA 1Y81A 3D0OA 4CM9D 1Y8QA 5F5LA 2DLDA 1XG5A 5ES3A 4F3YA 3WB9A 3EVNA 2CZCA 1QV7A 4IM7A 4ND2A 5H82A 1WNTA 1KC3A 3JQAB 4FD3A 4LMRA 3ZHBA 1YBAA 3MJEA 3KB6A 3VAZA 3W6UA 1H9AA 4BNTA 3ANLA 4ID9A 4Z0PA 3GDOA 1LQTA 4J7CA 3RC9A 3ZCXA 2Q2WA 3HDJA 1GZ3A 1T25A 3EVTA 1UXGA 2B35A 3FNEA 3DC2A 1A9YA 2VWHA 3B1JA 3ROKA 4AVYA 1LLUA 1DHTA 3GR6A 1UDAA 3T7EA 4BNIA 1PJQA 1PR3A 3KLMX 4UVEA 5L7YA 4ZVVA 1XKQA 3PDJA 2X9NA 3F5SA 4HFMA 1JQBA 3JCZA 5DBGA 3WTCA 3SX2A 3UCXA 2OXIA 2BH9A 3E9MA 4BV8A 1KVSA 3GF4A 1YRLA 2PD3A 3GN1A 3PHHA 4J7UA 4DIOA 5KJ1A 1FK8A 3RU9A 1YB1A 5K0ZA 4XX0A 4CM1A 1W0CA 1YJQA 2X6TA 4EYEA 2WD7B 4IQGA 4U7WA 4AJ1A 1WP4A 4YJHA 2NVBA 4DLAA 3GUCA 2IYOA 4LRSB 3WMWA 4CL3A 3LT2A 1ZSYA 4PRKA 4JQCA 3VH3A 3Q6IA 3L4BC 3C85A 1ZBQA 1MFZA 1LDBA 3V1TC 3O38A 5TC4A 4QTZA 2ZB7A 4XR9A 3ZH2A 4E4YA 5L9AA 1A27A 2DBVO 4WECA 3F1LA 5MGBA 1NPDA 4E33A 2O3TA 1DAPA 3SLGA 4QO7A 1YQDA 4E21A 2EV9A 2RBEA 2VQ3A 3ABIA 2YW9A 4MKZA 1T2CA 5U1PA 2D2IA 3KO8A 1EEHA 3EDMA 4GLLA 2HMVA 5BNFA 2FY8A 5DOZA 1X7HA 4HUJA 1E7YA 5TIIA 3NV9A 1F8FA 4HX5A 1V9LA 3QLJA 2A94A 4TKLA 5G4KA 3CE6A 5BNIA 1OC2A 3QWAA 4XEHA 2O23A 4MVJA 3KHUA 1B3BA 3V2UA 5ENDA 3ZWXA 3ONFA 4XGIA 4LN1A 1R4NA 3WIEA 3VKUA 1LU9A 3WGHA 3L4BA 1A5ZA 1J5PA 3N7UA 3MJTA 3KVOA 3QIVA 4IGEA 5IF3A 4YBZA 3OJOA 4PLPA 3OQBA 3OICA 3HDHA 2X8LA 5B4VA 1LDGA 4RQUA 1XQ1A 2QIOA 3ICPA 5T64A 1BVRA 3H3FA 2P5UA 4E5YA 4WGGA 3RFXA 3F46A 5A3JA 5TJ9A 1H2BA 2G76A 4OGWA 1TVEA 4JJGA 4NFHA 4KWHA 2GGSA 4ZQFA 4A5OA 2ZIZA 6ADHA 3OIGA 1MC5A 3R1IA 4ZQEA 1VE9A 1DOHA 1BW9B 1TA4A 4BNHA 4E13A 2PY6A 4CMGA 3RQSA 4D42A 4GSKA 2BGLA 4RVHA 3KV3O 3DB2A 1T2EA 3PWZA 1KYQA 1TXGA 3Q2IA 5TGDA 1YDEA 1UXKA 2PH3A 3DAGA 3INGA 3CPSA 2D4AA 5CHEA 1DPGA 1Y8QB 4RVSA 4CV1A 3N74A 1QR6A 3B20A 4DPMA 3RUIA 1DSSG 4BVAA 4Y6RA 2Q3EA 1E6WA 2PKQO 4BO7A 4M89A 1DLJA 1EUCA 1ADBA 1BVUA 1SEVA 3IC5A 1LUAA 1YBMA 4XYBA 5AXCA 5B4TA 3EC7A 3WGQA 3AJRA 1GR0A 1KERA 3AUSA 4FR5A 4LISA 2RH8A 2NWQA 2HSDA 4YAJA 2DTXA 3NDIA 1QYVA 2GN9A 3CMMA 2PFGA 4EEXA 4AJJA 1EUDA 5IN5A 3IP3A 5CDGA 3GG9A 4MPDA 4B3HA 3H9EO 2ZTVA 1NQTA 3B70A 2HCTA 4EGFA 2HUNA 4O1MA 4OSOA 2JHFA 4AL4A 5JPIA 4PIVA 4KTVE 2JKVA 3INTA 4H15A 4RCVA 3ZWBA 4O6VA 4OKIA 4J1QA 5KJFA 2EW2A 4QEDA 3LVFO 1YL7A 4BNYA 2Y93A 3RUFA 3H9GA 2Q45A 2PKRA 2XAAA 4YQZA 2GR9A 3GN2A 5F3RA 4WUVA 3L0DA 1SOWA 1R0SA 3P5SA 4XDZA 1ML3A 5A04A 1R0LA 4W4TA 2AEJA 5A06A 4IQ0A 5TS3A 2G82A 1IE3A 1U3WA 3HE3A 4PLCA 4NI5A 1KVQA 5DP1A 1DJQA 1B0AA 1YOVB 2VHXA 2EKPA 2D59A 3BMCA 3VZRA 4QQRA 4A0SA 4N5NA 1Y6JA 5BNTA 3ZWNA 1QV6A 1KS9A 5TF4A 1B14A 4DWVA 2W2LA 2FMUA 4TRMA 4WEQA 1NBOA 4WPGA 5B4UA 5C7IO 3OQ6A 4DPKA 1QYDA 3NT2A 3NKLA 4I08A 2X0JA 1LQUA 1NNUA 4N5LA 1DO8A 1OMOA 3GVHA 3KYBA 3GHHA 3MJCA 3DZJA 2VWGA 4KQXA 4XB1A 4CM8A 3ICCA 3GHYA 1KBZA 2JCXA 2VYVD 5G4KB 1VJ1A 1HE3A 3PYXA 4S1VA 3MTGA 4GMFA 4ZICA 1R15A 2DKNA 4CM7A 4BNFA 3DZBA 4D3DA 1R4NB 1HDZA 3MJVA 2WYUA 3WGYA 4IDFA 1J6UA 1B8UA 4UEOA 1I5RA 5KVSA 2WE7A 5JE8A 4E2WA 1SEPA 2YHIA 3S1LA 2DUWA 2FWMX 2IXBA 2POQX 5KWEA 3CEAA 3ETDA 1DFGA 3EZLA 3E18A 3H6KA 5CDSA 3UHAA 4HFJA 4RORA 1XCBA 2ET6A 1RM0A 1ZMTA 3F47A 4JGBA 3WJAA 1T4DA 3PGJA 4M86A 4AICA 3QWFA 1R66A 2EKQA 1B16A 3PJDA 1ZNQO 4DTIA 4WJZA 4DMMA 1PTJA 1PJ4A 1QG6A 3GPDG 3HN2A 1GUYA 4Y98A 3ZV4A 1HE5A 1MB4A 5I8ZA 2RH4A 1VLLA 4INAA 5IDYA 1IZ9A 4NZ9A 4RPJA 5C3MA 2EG9A 1AGNA 1H6DA 4PLGA 5JW6A 2DBZA 1HTBA 4J9UE 4QSMA 2E82A 1E1MA 4F46A 4BQRA 2X23A 3M2PA 1NPYA 2ZYGA 1GD1O 4YRDA 4R51A 2BI7A 2XF8A 3O8QB 4Y8VA 4IPTA 1LEHA 3ROPA 1PL8A 1YXMA 4IJWA 4B4WA 1P1HA 1GY8A 1QSGA 3WNVA 1O6ZA 2P9EA 2YY7A 2CSUA 4NU5A 2I65A 1LSSA 3OIFA 3MOGA 1N1GA 4H7PA 3RVDA 4J1TA 5DCWA 5HBRA 3RWBA 1H94A 1U28A 4OXNA 2C7GA 4E5KA 4D45A 4L75A 5JAMA 2QX7A 3PK0A 2VN8A 3JYOA 4Z9FA 1LRLA 4Q39A 5JMWA 1U1IA 5COQA 4G5HA 1YL6A 1XIVA 5EPOA 3BZUA 3DDNA 2EW8A 4U6SA 1U4SA 5JYDA 1LRKA 2OUIA 5DCYA 2HMTA 3S2GA 3CZRA 3HWRA 3RFVA 2BFMA 2UDPA 3K9QO 1Z75A 1E7RA 3W8DA 4EZBA 2J8ZA 5CDTA 3RC7A 2G0TA 3A4VA 3PQEA 4L4SA 2DU8A 3PZRA 2BELA 3GNSA 1ONNA 4DIBA 1V35A 1X7GA 3AI1A 5EQFA 4UUMA 3RI3A 3ZWOA 4I5GA 5DBIA 4Y9DA 1I3MA 2G1UA 2Q4EA 4YAEA 4YB8A 3GEGA 2JFFA 4PLFA 4RDHA 4FIZA 1PZFA 2AW5A 3ASVA 3JQ9A 3HFSA 1F14A 1I30A 1PS0A 3IKTA 5L3ZA 3VTZA 3UICA 5TRTA 2GCGA 1FDVA 2VUSA 4FOOA 4LK3A 1JLLA 2WMDA 4XQCA 2TMDA 4YT5A 2W2KA 5L4SA 3RBVA 2O3UA 5A03A 3DAPA 1P9LA 3TOZA 4B7UA 1JVBA 1ENPA 4LCEA 4OHUA 2EGHA 1V0JA 1IHYA 3GAZA 3OA0A 3PZBA 4PCVA 4E2YA 1PL6A 3WYEA 3HDQA 4A7PA 3JQBC 5ITVA 2EJWA 2JJYA 5KKCA 3ZDFA 4II3A 2OFPA 3K5PA 5AYVA 4J1SA 1IZ0A 2GDZA 2Z95A 4XIJA 1YO6A 1VKOA 1ZJZA 1FDUA 1M75A 3IOYA 4A73A 4CM8B 4EJ6A 3DWFA 3A9WA 1T2AA 4YYZA 2ZCVA 3U62A 1R16A 4IMRA 5F1OA 1IYZA 1Y1PA 2OORA 3GGGA 1X15A 5A9TA 3PXXA 2WEKA 3T4EA 2QHXA 3ZWWA 3TRIA 2YV3A 1D8AA 3EW7A 4PG7A 4YR9A 1HDYA 2YHIB 2FRDA 1LDNA 1LDYA 1LTHR 3V2HA 3ONEA 1Q1NA 4L73A 3NTOA 2ZYDA 4YRBA 4QFCA 4UREA 2C0CA 4JROA 3IIEA 4PZCA 3KEQA 1L7DA 3WSWA 3AY6A 1BDBA 4I9HA 4UUOA 4ALNA 2TMGA 5ER9A 3CMCO 3HHPA 3JQBA 3OJLA 4IQ8A 2D0IA 2Y1GA 1VSVA 1GCUA 2O7SA 2Y66A 4B3JA 1F0YA 3R0IA 3QY9A 1PS8A 3V1UA 4EUFA 1U3TA 1H6AA 3C8MA 2JFHA 3DQPA 1P1RA 1AXEA 4KWIA 3Q3CA 4CL8A 3TFQA 4E30A 4R1SA 2RIRA 4MP6A 2FP4A 2Y0DA 5BSGA 1GL3A 4M55A 5JY1A 4WCFC 1N1EA 3JYPA 1NFQA 4OM8A 1WMAA 2ZYAA 3KYDB 5DNAA 1ZIDA 4O63O 1P0CA 3LLVA 4TROA 1PGJA 9LDBA 4JXKA 2Z5LA 4MOWA 4CQMA 3VDQA 4AJOA 3T7CA 3WGZA 2HK9A 2Y1FA 4BL5A 4CPDA 3IJPA 1B15A 2WDZA 4AJNA 2RAFA 1DIRA 1RJWA 4PGFA 2GO1A 2HK8A 5TNXA 2VOJA 4B8WA 1Z82A 3Q0EA 1MG0A 2Y05A 4U0JA 3AFMA 4NK5A 2W4QA 1DJNA 1LX6A 3ZGYA 3D3WB 2O7QA 3JQAA 4B3IA 4GGOA 5HA5A 4Z3KA 5K9ZA 3B6ZA 4TSKA 5BSEA 4GKBA 1EVYA 1MG5A 4NMHA 3IP1A 4E32A 3WLFA 2Z1MA 3L4SO 3TZ6A 2HDHA 1N92A 3RUDA 1Q0QA 3PIIA 2YFQA 3GZ4A 2AQIA 2E4AA 2ZQYA 3ZZNA 4KUGA 4O5OA 2PD4A 2AE2A 1XU7A 3V1YA 1YKFA 4R1UA 1DIAA 4CM9A 3IUSA 3P2YA 5JSFA 3GVCA 1LJ8A 3RKUA 2HJSA 4GH5A 4WCFA 1A71A 1ENYA 3H5RA 1HDCA 4IY1A 1E7QA 3F3SA 3DOOA 4L76A 4DLBA 3G49A 1ARZA 3H9JA 2DPGA 2CY0A 1T4BA 3DBHB 4QX6A 4Z0TA 4N5MA 5GMOA 3COSA 5JBIA 3HZZA 1M76A 1HYGA 2WD7A 5ER6A 1MUUA 3C3XA 4E6PA 4YT2A 1DRWA 2LDXA 4U6QA 1FJHA 1UXHA 1U8FO 2B4RO 4YJDA 4A26A 1QMGA 1HDGO 3C7AA 2AQKA 2C82A 3RJ9A 2SCUA 4GQAA 4PLVA 1NWHA 4UUPA 4GX0A 3ZI0A 4ND5A 1NPTO 3D64A 2VHVA 4J49A 2ZJ1A 2CFCA 5TLSA 1UAYA 2VUUA 3DTYA 4ONEA 1L1FA 1HETA 2Y0CA 1RM4A 2HMSA 4JCOA 3GH3A 1LC3A 4CLDA 3ROMA 3INRA 2H63A 4DREA 1FDWA 1ZJYA 3OECA 4B79A 1YE3A 1LC0A 2OP0A 4BNVA 5G0SA 5A05A 3WWYA 1GADO 2BRUA 3VPFA 3E6AA 1WWKA 4IIVA 3QVTA 1EK5A 2EWMA 5I7EA 1BGVA 2GRAA 3ZNOA 2WE8A 4J6FA 4PLZA 4YPOA 4PG5A 3DTTA 1KY5A 1D4FA 3DHYA 2C2XA 3W1VA 1UDCA 2QYTA 5BSHA 1HZJA 2V6GA 2W98A 4OOFA 1NQOA 5TX7A 2HRZA 3KOUA 4DC0A 2I5PO 4HFRA 1AHIA 1I32A 3G1TA 4H3VA 3BMOB 5ILGA 3ZW9A 3PP8A 1WZIA 1PQPA 4KQWA 4AJEA 1CETA 2BGKA 2NV6A 3GEDA 4L9RA 3VPHA 1UP7A 3QWHA 4UULA 3OH8A 4NFYA 5I7SA 3E1KA 4D3SA 2PK3A 3I6IA 3JQCA 1HF3A 5COAA 2HJRA 4CUJA 4DYDA 4ZJUA 4IDEA 1E3JA 3PLRA 4PVCA 1YQGA 4RDIA 1E1KA 2P9CA 4BO9A 5J23A 4M8SA 4PVDA 1H0KA 5I7FA 4DA9A 4PG8A 3E48A 3VDRA 4HV4A 1OFGA 5B37A 3LU1A 3EK2A 2EP7A 3LT0A 4GLOA 2I76A 2NVWA 3ZV6A 4E12A 1IULA 1X1TA 4LVCA 4O59O 3M1AA 4CQLB 4OIMA 1TLTA 1BHSA 1VL6A 4PN3A 4MIEA 2OHXA 2WD8A 3WLEA 1E0DA 1QORA 5TJHA 1YQXA 3DONA 4E31A 3MOIA 4ALKA 1ADCA 2DM6A 5JC8A 2VZ8A 1IPEA 1PIWA 3JQ6A 5DOVA 5G0UA 2O3RA 2O4CA 3EAGA 4GWGA 3QVXA 4HNGA 4CMBA 4R5HA 4ZA2A 3EGOA 1BXKA 4CV2A 3UXYA 2DBQA 9LDTA 5BT9A 2AHRA 3AY7A 4A03A 2I67A 2NU7A 4IXWA 4XJSA 4BNLA 4L4RA 2BFAA 3FNFA 3W8FA 4B4OA 1ADFA 2PZMA 4WCFB 3UAGA 2ZK7A 1UXIA 2VCYA 5JO0A 5A4DA 2A92A 5IXSA 3FRJA 1AE1A 1PGOA 2WYVA 4QFDA 1TI7A 5KIAA 1SZJG 1EVJA 2NTJA 1OBFO 4FJ2A 1NWCA 3MTJA 1D1TA 1ISHA 3WQQA 2A4KA 1HDOA 5B12A 3LK7A 4D41A 2Y99A 2CUKA 3A1NA 3L9WA 2YZ7A 3K30A 5F1PA 3TJRA 3GRKA 2FZWA 1ZMOA 5I8WA 2P68A 1PJBA 1GYPA 4ZRNA 4MINA 4IJKA 4D0RA 3AU9A 3E8XA 4CLRB 2C54A 4CLOB 1M66A 4PLWA 1PJCA 3ITKA 4BNZA 2FPIA 4CR6A 5CFZA 1KC1A 2OZPA 1C0LA 1UZNA 1I2ZA 1YOVA 4MVJI 1ISIA 2Q1SA 3VC7A 2AQ8A 4YJGB 4R3NA 3QVSA 2Q2QA 4P4LA 1HL3A 1A4IA 4KMSA 4BQPA 3ZWPA 4MVJP 3RJ5A 1MFPA 2B69A 5DCUA 2WJPA 1JAXA 4P38A 1TB4A 4BGVA 4XZ3A 5BSFA 5KJEA 2P91A 3JD3A 2OGUA 1FF9A 4YACA 1VL8A 3PFWO 4Q3AA 1K3TA 3QP9A 4IIUA 3G1UA 3UFXA 1AXGA 2AG8A 4XYEA 4IDGA 1ZK4A 2V7PA 4XQEA 3BTSA 4GAEA 1GDHA 2X0NA 4WNIA 4EDFA 4RL6A 5LDGA 4BB6A 1GV1A 4WEOA 3QW2A 3M1LA 5KOIA 2O3QA 2FN7A 2LDBA 2PKQP 4CMCA 4HNHA 2YV2A 5THKA 3ZU3A 2VYND 2VOEA 1CRWG 1U7TA 3EY4A 4ZQBA 1AUPA 5HWSA 1I0ZA 1VJ0A 5CEEA 4ROSA 1LDEA 3BXXA 1Y5RA 2VHZA 2HK7A 4WLUA 4XYGA 2YDXA 1WAMA 2JCVA 1B8PA 1P44A 5U4QA 4BNKA 2V65A 2VYVA 3JYNA 4F45A 2GF2A 2JD0A 4RVFA 3ZWVA 3HFGA 1PL7A 2I99A 4J3FA 4R1NA 3WQSB 2DVMA 3DZHA 3ZHZA 1DLIA 2VZ9A 2YJZA 2DAPA 2FPPA 1EE9A 5KJCA 1UAGA 1ZEJA 4BO5A 3I4CA 5C37A 3QWBA 4ZU3A 1RM5A 4DUPA 3GGOA 3U9LA 2PH5A 4YJFB 3GRPA 4NBWA 4JJFA 2NVUA 2P4HX 4PZEA 3E03A 1LSOA 1PWZA 4CUKA 3O8QA 3Q2KA 2O3JA 1A7AA 1E5QA 1NHWA 4WLVA 3U49A 3SXPA 4LSMA 4A10A 3RUEA 1NFRA 1P74A 3GAFA 2R00C 4PLHA 4XYLA 4FC7A 5CG1A 3QQPA 2GN8A 3SJ7A 2WTBA 3PTZA 4BHTA 3LT4A 3IS3A 1DAOA 4FW8A 4EI2A 2NSDA 3GOHA 1Z7BA 3L6DA 4TKMA 4DYVA 1XSEA 4RQTA 1QYXA 1DB3A 1NVTA 3FR7A 3AM3A 2GN6A 1MLDA 3TN7A 2O3SA 2B37A 4C7JA 3EHEA 2B5WA 3STHA 1DIHA 3UGKA 4K6FA 2P2SA 4XR4A 2JL1A 1JKFA 4GSLA 4AFNA 3FBTA 5ADHA 3WMXA 3AU8A 1SOVA 4B8ZA 2GASA 3KRTA 4E2XA 3MWDB 1ZK0A 2DTDA 1I2CA 3S2EA 3QRWA 4LMPA 1DC3A 2HMUA 3RIHA 1KEVA 2R6JA 2ZCUA 3KTDA 2HLPA 5T8KC 3FNGA 1PZHA 3JTMA 5C7LO 3FPCA 2R00A 3EYWA 4J9VA 2JFGA 2PWZA 5COBA 4RGBA 1P1FA 3OEWA 1ZZEA 3GFBA 5IDXA 1JKIA 2GPTA 2C2YA 1U5CA 3NT5A 1SNYA 3HNPA 2VNSA 1UXJA 1E1NA 1PQUA 1G6KA 1NR7A 3D3EA 4XJTA 5FI5A 4DRYA 1QKIA 1X13A 4Y6PA 3LC1O 4DVJA 4JJIA 1O89A 1P77A 4Z9YA 2ZKLA 3GDGA 3RU7A 4KP7A 1I24A 3IQDB 2ZB8A 3DHNA 3EUWA 3V8BA 4CM3A 1UUFA 4FB5A 3KM0A 1YB4A 5EERA 1Q7CA 4BGIA 3UW3A 3Q1LA 1Y9EA 1BG6A 4CMJA 3TZKA 1X0VA 1XU9A 4RLSA 3NGLA 4GVXA 4HXYA 5L7WA 3HB5X 3JD0A 4PRLA 2H1SA 1ZUD1 5DF1A 1NVMB 1PWXA 5I9LA 2VRCA 4OOEA 1HEUA 3ITDA 5T8KA 4YQYA 5T67A 2CF5A 1XHLA 2AEMA 5L51A 2PD6A 3GLQA 4WK6A 4NDNE 5AXBA 3GQVA 5IN4A 4IJVA 3WSVA 3H9QA 2VT2A 2CDCA 3GMDA 1R0KA 4K9DA 4L8VA 1LRJA 3SVTA 3U5TA 1HLPA 1JWBB 2Q4BA 1DHRA 4HBGA 4M49A 3M6IA 5G4LA 2FSSA 4FOSA 4BNMA 2E49A 4R41A 3NDJA 2C07A 3WGOA 5KVCA 4IZHA 4OXYA 2PV7A 1LI4A 4BMVA 4DQXA 1OI7A 1TT5B 4IJUA 1E77A 1C0PA 3UKOA 4KZPA 3GG2A 3GT0A 3Q9NA 1W4ZA 2E37A 1RYDA 2F1KA 3V5NA 2O50A 1O95A 1NASA 1NAHA 1JWAB 1EE2A 3TF5A 4UVIA 1WW8A 2NU6A 1LSUA 4MVJG 4I1IA 5CG2A 3TZHA 1PGNA 4R01A 2NVUB 3KYDA 1IB6A 5A1TA 5IXYA 1T1RA 5AXDA 3VKVA 1VKNA 1KVTA 4TRNA 2RHRA 1EDOA 4YVFA 1H5QA 3JQ9C 1D1SA 1EFKA 1RYEA 4PLTA 3ZWAA 1HLDA 4BS9A 3GZNB 4G65A 1PGPA 4RVGA 3U4IA 3FWNA 3NTRA 1C1XB 1C3VA 4OYRA 4I5DA 5JCXA 3NAQA 3D3WA 4A2CA 2D5CA 4BO8A 2UUOA 3TZQA 2IZ1A 2O2YA 3CSDA 4D43A 3WNQA 4BKRA 5I7VA 4FFRA 2DT5A 4O0LA 2VHYA 4WE3A 1SO8A 4CMIB 3FN4A 1Q0HA 2EIHA 3HG7A 3PI7A 1ZXLA 2ZTMA 3TNLA 5A02A 1DBVO 1EUZA 3PQDA 2PGJA 4AJKA 4YAIA 1X0XA 4XB2A 4B4VA 1ENZA 2PNFA 2ZATA 1S7CA 5KJ6A 2JCYA 1VSUA 2UV8A 3UUWA 3I3OA 5JLAA 2I66A 3SC6A 4OQZA 3KSUA 1H6CA 1GQ2A 4DMLA 1ORRA 1YONA 4EITA 1N7HA 4KOAA 3U4HA 3I9JA 4UAGA 3DBHA 4BO0A 3C1AA 4DLLA 3GNTA 3OHSX 4K28A 3WIDA 3AWDA 4BOYA 2W2LD 3KYCB 1QXSA 2AEFA 1VJTA 1CDOA 3ANMA 5EESA 1FMCA 2ZTLA 2J3HA 3FNHA 1AHHA 1B8VA 1PJLA 3AOEA 2PZKA 2QYSA 2XXBA 1YH3A 3K8ZA 1J0XO 2FSVA 2EJVA 5JXWA 5F1KA 5JNLA 3OF2A 2I9PA 5EINA 5JYEA 5A5FA 1C1DB 2DUUA 1NXQA 1YL5A 4IMPA 5CPFA 2B4QA 3GVIA 4GX5A 1EVZA 1VL0A 1U5AA 4BKQA 3H8VA 1GEEA 2B4TO 3BTVA 3L07A 3NUGA 5GZ6A 3B1FA 4WNCA 3AM4A 3JQ8A 2CVOA 3EMKA 3QHAA 3SC4A 1RWBA 1HSZA 4NIMA 5MDHA 3JD4A 1E6EA 4D0SA 2BD0A 4FSHA 1GZ6A 2X7HA 1PGQA 1P0FA 1QP8A 5T57A 1IPFA 2QRJA 3JD1A 3ZW8A 4HADA 4D44A 3VTFA 1DC6A 4Y6SA 2C5EA 3OQ1A 3PPIA 1GUFA 3RUCA 4DBZA 1F17A 1E3IA 2J6IA 1RM3A 3BMOA 3FWZA 3C1TA 1K0UA 3H2ZA 1BSVA 4ILKA 4MVJM 1LNQA 2PLAA 3X2EA 5AQ1A 1W73A 1K6JA 3K73O 4TMFA 3H65A 1ZSVA 3AUAA
chains in the Genus database with same CATH superfamily
4CQNA 1K88A 2OCKA 1XC7A 3AF4A 3KSBC 4G4GA 4K6HA 4CZ2A 4RMNA 4XDHA 2X41A 1FZQA 1XE3A 2YRXA 1GSAA 2H5LA 2G5CA 4BMSA 3CKLA 3T9CA 1CLEA 1XKLA 4M87A 5E4TA 2RGXA 3OY7A 1GDDA 2GXUA 2R79A 2C2GA 2ZIVB 5DX1A 3CCCA 1TVKA 2HY7A 1MX3A 1R64A 2Q1UA 5EHIA 3M4JA 4AQ7A 1NLUA 3FOCA 3ZDQA 1KRWA 5GV8A 5AK6A 1KZ1A 4IICA 1E9FA 1UMKA 4UC0A 3GQBA 5H4GA 3H9UA 3LIIA 1E1CA 2QD2A 2FQWA 3AUTA 4KUHA 5DHQA 5DK6A 3R5XA 2OCLA 3PC4A 4TTRA 4I9UA 4OQYA 1V6AA 3OY2A 1TZBA 5DN9A 1EJBA 3GFFA 4O4IF 1A5SB 4YO8A 1BEUB 1U9JA 2H8GA 2IRWA 1CUYA 1J56A 4H9GA 4OO3A 5EJ7A 4RY8A 3OJWA 1O8BA 1M2VA 4BV9A 4WZZA 2WVGA 1EVQA 2Q8QA 1XMVA 4JU9A 1PVDA 4W5QA 4WFKA 3FPSA 1YGYA 2ZBVA 2GAFA 3OWHA 3UENA 5HF6A 4CIBA 4I19A 2GN2A 5I7AA 8MHTA 2LR0A 5AW3A 1ORWA 3IUPA 4Z54A 4QASA 3W3ZB 4CR7A 3DBVO 1WB5A 1E5LA 4IX9A 1JMVA 4QWMA 5FYDA 3I1FA 1SXJC 2ORYA 2PYZA 4CIXA 4AMYA 1CZNA 2WPNA 5JARA 4Y2HA 2Z8YM 5AW7A 1J8MF 1AU9A 2GNOA 1BEEA 1BHJA 5A7GA 4M1EA 4QU9A 3EEBA 3WK9A 2FKNA 5JZSA 4GI2A 3AEYA 4CMKA 3T9EA 3WL7A 1AD2A 1JU4A 4N8EA 2ERCA 2ID4A 2X5XA 3H3JA 3M49A 4KOEC 4QUKA 4MJLA 2N9UA 1DPFA 1CUHA 1Z0ZA 4J6EA 2IYPA 1L9KA 4R8KA 4K26A 2VZ0A 5TQVA 2VBCA 1QB7A 4C4OA 4DV1B 1ND5A 3VH1A 1T0JB 5H83A 2GBPA 1J23A 1I0LA 2G70A 1A2KC 2IKQA 3NM4A 5CIWA 1NMYA 3PC6A 1HQDA 4JI1B 3FZGA 4C76A 4EM6A 4D26A 2BEKA 4NOMA 4BCCA 3H6HA 4BBPA 1CUUA 3F4LA 4EUNA 3BTOA 4OGLA 2BFFA 1B3RA 1E2GA 3KJZA 1AV6A 3B6JA 3WGGA 2DY1A 3OC6A 4BVLA 1U2QA 3FA2A 3IILA 1XK6A 3P27A 4GOOD 5EVJA 4C4AA 1X6VA 3DVQX 4NKRA 5JANA 2FWJA 3EPKA 3TL2A 1L7BA 1EFRD 1RZRA 1D1QA 3EZFA 2CD9A 3RK1A 5CLIA 1N6RA 4GIBA 4ABYA 5LJIA 1UMDA 3NPAA 3DAFA 1WZEA 1SXJA 1NQ5A 1P6UA 1ZCJA 1Z8FA 2IHJA 2ZROA 1VDZA 3BVPA 2IWHA 1X1SA 3RB8A 3DZFA 4FQ8A 3BHJA 2Q49A 5AVXA 4FJ0A 1NX6A 1D03A 4BMZA 4FOPA 3LT1A 4CHTA 1D2GA 3R0XA 1ZGBA 1V7ZA 3O1IC 3E53A 1NQAO 4EW2A 4D4LA 3L4KA 3Q7RA 3AY3A 4IEIA 3TZEA 3ZUGA 3MG9A 4K8RB 3GVXA 5GY7A 2RHDA 4JYPA 5ED4A 4G1CA 3PCRB 4YAKA 4OL0A 3U4QA 3SR4A 1W2HA 4G6ZA 2IL1A 1L8XA 3EODA 2QD3A 2NUAA 2ZSEA 3CLTD 3O8OB 4OXXA 1QONA 4JBHA 4BNJA 4FFLA 2EJBA 1EK0A 1ECJA 1E3LA 1L4KA 2ZVQX 5JMPA 5A2QA 1OXXK 2PJDA 1YI1A 3AFNA 1A3CA 4QT4A 4NK4A 3OT1A 5JADA 3TD2A 4JX9A 5HKKA 5FLXA 1DKNA 2EKZA 3BEDA 2X4GA 1QHFA 4KQCA 3E3OA 3EPHA 2GHQA 3E1GA 5DI3A 3KKPA 4BBAA 1QK5A 5D5QA 3VBCA 5JG7A 1YDFA 4QYWA 3UJHA 1JU9A 3GY0A 5LP6F 3JSAA 2IEAA 3BTUA 5F78A 3WLNA 3A58B 3AB8A 3ABQB 3F7OA 4DC9A 1I3LA 1UZLA 3JQGB 4RA9B 4FWBA 2WSBA 1CLUA 2O1EA 3TD9A 4DS3A 1CEQA 3WJ7A 2J7PD 3BK1A 4Q1FA 1LCIA 1PHPA 2VPWA 5ICMA 1US8B 2ZQ5A 2AF4C 4XOIA 3CX7A 1E0JA 4ZV9A 3JVVA 1T2DA 4JJEA 3IAEA 3OJ0A 1N36B 1FNBA 3EIXA 5EJ6A 3CO0S 3GJ5A 1USIA 2GRJA 1K89A 1J2TA 4EVRA 2PPVA 2HK6A 2V6MA 1OXMA 2RSLA 3H2GA 1YBHA 4KH1A 3GFTA 3NBYC 1SBNE 4M2LA 5BRAA 1MC4A 2WABA 2NPFA 4MWBA 2RBGA 3V8PA 1K97A 4ZK6A 2VYFA 4TS4A 1RXEA 3HCRA 2JJ8A 4ZQGA 4IF4A 5CFQA 4UCXA 3GEMA 4DC1A 4FUTA 5E1DA 1RYZA 3U4CA 1TZJA 4OSPA 1YFZA 2JGRA 4I1OA 3UQYS 3PWKA 1LV8A 4M1WA 4G5OA 1LW6E 3JQAD 4UUNA 4DJEC 4Q3NA 5KMGB 4JT2A 2IYRA 1TVMA 2J5BA 1HFJA 1ZK1A 4QT0A 3WJ2A 5IYZA 5IASA 5KTKA 5JXGA 4NYIR 4NL4H 1OAKA 1SQ0A 3RSFA 3S8MA 3PJFA 2BCGY 1PUXA 2A9FA 2QYHA 1PT8A 4MQMA 1R27A 3ROXA 3ZWMA 5FTKA 3ZU5A 2PANA 1N2CA 5FNVB 5CFMA 4OI0A 1BKDR 1FFDA 4NC9A 2NO5A 3C2QA 4F6LA 4U2CA 4C9BA 5C4IA 1D2CA 4YXWD 3TZLA 3FF4A 1DS6A 4BIIA 1M8JA 3DMTC 3WWZA 3Q5GA 1MPTA 1WG8A 1AHPA 4CEIA 4G8BA 1TJNA 3SF8A 1JEDA 4XWKA 3OKPA 2QMUA 2ENWA 3CR3C 3A25A 5BW4A 1Z6ZA 2H9IA 1QO7A 2JFYA 2ICAA 4FEGA 3RVQA 1QP4A 3T9DA 5KNDD 5FPTA 4A27A 1QX4A 1YB5A 2RB5A 1FFXB 1QRRA 1ZGJA 1J33A 2C5GA 3PNOA 4UM9D 5IXJA 4IDPA 3V1KA 4MDFA 3O9ZA 4GX1A 1DINA 1ND6A 3IX7A 3NIDB 3GUZA 2HHAA 3CISA 3HB1A 4GPBA 3ZWYA 5CW1A 1ZVVA 1T0UA 1DOAA 1ZICA 3PNSA 3DKRA 3MWDA 1EG2A 5FKJA 3URMA 3LOUA 1OROA 1I5OA 5ALHA 5I9MA 2GM5A 5K05A 1PDWA 2P8SA 3HDYA 1NLYA 3KXDA 2FJ0A 4NH4A 3ENQA 2B30A 2V97A 4M1TA 3JZFA 2V96A 2CYBA 1MAAA 2Z30A 3CGGA 1WV1A 1SMKA 2JFXA 3JV7A 1L4EA 2FX3A 2PGDA 2WKQA 1WKVA 2ZTUA 4LG1A 4XCVA 3SZ3A 2C3UA 1KK2A 3A2LA 2EQ5A 3AT1A 3RM3A 4FR0A 4L3VA 1W5FA 4TLLB 1XVUA 1JHYA 2WY2D 3N0TA 3VNBA 2HBYA 1JHRA 2R2AA 4N12A 2DTEA 3K9NA 1HE2A 1D4AA 1VOTA 5F7XA 1P45A 3DMTA 1W48A 4NBUA 2A0UA 4DMHA 2XYRA 1MV8A 1UFRA 2R6AA 4XWWA 1KYXA 4JLWA 3EXG1 1X38A 3HUEA 3EQ2A 3ZY3A 2HCBA 3LW7A 3CCFA 5JAOA 2VSOA 4IZIA 1UPCA 4GOXA 3T3GA 4BNGA 2VTEA 1CQJA 3NEAA 4WZAA 3D8SA 3GMSA 1NX9A 4JVNA 1HZZC 5EIHA 4YP0A 1E7SA 2CVZA 4K9NA 4Q47A 1NW6A 3OI7A 1HDRA 2YWRA 4B4UA 2JFQA 3UPUA 4UTPA 2WJWA 5IC4A 1XT6A 4K9SA 2IE0A 4FK8A 5ICEA 2WW8A 2KX7A 2BHLA 3D0KA 3DO6A 3CVUA 4OEHA 2ACEA 3BE5A 4CKBB 1GUDA 3E5MA 1GXSA 4PZPA 4RK5A 4IV8A 5ECYA 3F5QA 1J39A 3C6QA 5EE5B 1JKJB 2FMKA 1TA0A 2FLVA 2B0JA 3N6VA 4F8JA 2Q6TA 3IQFA 3T5DA 3MWEA 1YS9A 4IO1A 5CR9A 4IGKA 4MYRA 2NYAA 3HRIA 4JBGA 10MHA 3MLBA 4RVNA 3L1KA 3ZBTA 3ZCVA 2C2OA 2WMYA 1E2UA 3IP5A 1M7HA 2JAPA 521PA 4Q3BA 3WRYC 3T5AA 1QFJA 1OGYA 1WKBA 4NVRA 4Q15A 1ZYUA 4X1OA 3VC1A 4ITUA 3MVEA 3ZGZA 3CEJA 5LC1A 3W8EA 3A1TA 4HWKA 4R2HA 3IJRA 3CH7A 3SBOA 2DY0A 2D5BA 3U09A 5EY5B 2PYDA 1GVNB 1H2EA 1TT5A 2ZB4A 4JLJA 3TZBA 1U8AA 1HZZA 1MB9A 2IYQA 5BV7A 3ANNA 2XA2A 3Q0TA 4P1ZA 2KSQA 3PUWA 4QDXA 2PTHA 5DWQA 3FFWA 2JGEA 2IXAA 3U3XA 5HHTA 3DOEA 3MNFA 2GPYA 1OJ7A 4IGFA 1JG1A 1AUOA 1WR8A 3N70A 3UQZA 1C1HA 1S2NA 1U7OA 5FPSA 5CYPA 3QYFA 4BFLA 3JQ7B 4L51A 1M7BA 2UVQA 4PTYA 1HEYA 1GZ7A 1R4MA 4ZN6A 4R68A 1ATZA 3D4NA 4GBJA 1J42A 2B36A 1H6BA 4O1IA 4WESA 4F2HA 3M6AA 1EZ1A 4JI8B 1O9HA 2RH9B 4RZSA 3V8VA 1STOA 3BA1A 3CGWA 3QOFA 3U39A 4ASUA 3GJSA 4BATA 4G4IA 1T5BA 2R8XA 3WRYA 2J9ZB 3A11A 4IS3A 2FI1A 1L7XA 2Q1WA 3H1FA 1HC7A 1QH9A 1C1XA 1ULAA 2W2NA 4JQOA 3ZVKA 5J43A 1HDXA 4JLPA 3WKEA 1JALA 2PGIA 2EQBA 4PXAA 5KVVA 3QVWA 2IIBA 3G8BA 1UJMA 2AFHB 3QZUA 5HZGA 3ASUA 3H1AA 3NOXA 4RU1A 2Z4RA 4KPEC 1JVSA 3FCEA 4ABTA 2HQRA 3KYIB 4DMUB 3BDAA 3G2IA 5HIAA 3OVMA 2WUFA 1SJ9A 3QFCA 2FVYA 4TKVB 4BUCA 1I01A 1YVEI 3UCEA 1FSPA 3TQHA 2WJJA 3A6KA 1JMYA 1O96A 1NKSA 1KZ6A 3CRW1 4MGZR 4S35A 3OUTA 2Q62A 3HZRA 1OXSC 5KI6A 1R5BA 1QDEA 1T1SA 1X1QA 3NRBA 4GOMD 4F9GA 1WJGA 2W8BB 1H1LB 2JGIA 4BEWA 3OFSA 2DFKB 1W93A 3BG5A 3VPGA 3ZXXA 1SKMA 3RODA 4NCAA 5D84A 3FAZA 5B30A 4FGSA 1G98A 5E0OA 5BW8A 5TT0A 1APBA 1N0WA 2QS9A 5IHPA 1OBOA 4RFSA 3T5GA 3ZTWA 2EF1A 2VNHA 2AX4A 4INOA 4WK0B 5H0IA 3WZMA 4HYQA 2C88A 2P9GA 3LWNA 3SLKA 3OEHD 2RGDA 3AG5A 3IV7A 1Y4UA 3KEOA 5HUJA 5FFNA 1JFRA 1RBMA 1TKBA 1F2VA 3PFGA 2DFTA 2VUTA 2AF3C 2SECE 1QV9A 4KUEA 4BP9A 1W0KA 1PS9A 5CX4A 3SEFA 4ZJYA 5I51A 2Y1DA 1JDJA 1MC1A 3H04A 3IUYA 1Z62A 3JWJA 1M34B 4PC1A 4M9QA 4Y1RB 3WGNA 5H16A 4EKNB 1OLSB 3DOUA 4J16C 4EPWA 3VVLA 3GV0A 4R2JA 1NUQA 5CT8A 1TMYA 2VT3A 2WSSA 3LH5A 4KO4S 5I9NA 3V1MA 2BLLA 3LA6A 1JLMA 2Q1YA 3AFOA 4YJ2F 1L7RA 3T94A 4C0BA 4URFA 3I6ZA 1QGOA 4OI1A 4WY2A 5JWOA 2JCGA 1MXFA 1YMQA 2BDEA 3GRAA 2Z3VA 1QDLB 4JVMA 2UAGA 3FSJX 4IIJA 2JLRA 1FPMA 4UD6A 4XA8A 1Q1QA 2H1CA 3EBOA 4MVJD 4H16A 2MR6A 2XQFA 3H84A 1W581 5B5SA 3I1JA 2XR1A 1CCWA 4PIMA 3VZSA 4P35A 1ACLA 2X6RA 2NZ2A 2Y3IA 4B7CA 5B55A 4KQ2A 3R5SA 3EIQA 4RGVA 2Y1OA 5K2OA 3VVMA 4H1WA 2PTGA 1V8BA 2X0RA 1XELA 5A7FA 3D7SA 1WPXA 3G7SA 1QWOA 2Q8PA 2RI6A 3AHDA 3LPLA 1SKUA 4HXEB 1J8QA 4QO8A 1KSGA 3V3TA 1P2BA 1MGOA 2I7VA 2BBWA 3BHIA 3RV3A 2PIDA 5F52A 5HUHA 3GLGA 1IXZA 3AEQB 3FCSB 3L92A 2J5KA 4W5WA 1SC9A 2JI7A 3HABA 1E8MA 1XP8A 3E82A 3I04A 3JD2A 1V16B 1NXPA 2YZMA 4J16A 3JQEA 4JFAA 5HRCA 2H4WA 4COOA 1KVRA 1KEEA 3CLHA 4B6FA 1XR3A 1T26A 2Q6IA 4JJ4A 4UZEA 4YI5A 2H51A 4R16A 2B78A 1TIKA 4LZPA 4Z99A 3RS0A 4B7XA 5L45A 4URUR 1NF9A 3ZLVA 3W5BA 1GGFA 1GARA 2W0MA 4B4DA 1SB9A 4JAVC 3DE5X 4QA9A 1DIGA 3TUJC 2ORVA 3FWKA 2C42A 3OPQA 3LECA 3LT5A 3PE4A 1NE2A 3HCBA 5SZIA 3SZMA 4F4JA 5KCZA 1NTOA 5BQ5A 4G5RA 3HKDB 4CG1A 1Z08A 4UHHA 1FUEA 1D0IA 4AKTA 1E2FA 2A30A 1WSAA 2QJWA 2XTAA 4OAQA 3SZUA 4NHEA 3KLBA 3EC1A 2RHCA 3D2AA 1CQZA 4U7GA 1E6KA 5KYXB 1XF1A 2UZ0A 4WIAA 5BMOA 1E3TA 1NI4B 1N0IA 5ITZB 4G25A 2VHWA 3LF1A 1IL0A 1AZTA 1ONOA 2PCJA 2VTBA 4OI2A 1ZSNA 5FI0B 2R7NA 3TPCA 5A62A 5C35A 3TCXB 4CMHA 3SEAA 3WLLA 3GGJA 1U81A 1X7WB 1OHHD 4IXTA 1Q20A 4U0KA 2BJWA 1PFWA 3R0JA 2YQ4A 4JOBA 2V8OA 2GD6A 2X5KO 3QX9A 4FBMA 4QLOA 2JK1A 3S4YA 1SBYA 2NTEA 3SQNA 3WXBA 3ZOZA 1KQ3A 4X62B 2IGBA 2PZGA 3S7TA 3T1YB 3EPJA 1D5WA 3AOEC 3QV1A 5AM4A 2G3YA 5BN3B 3C43A 1YFJA 2O54A 2DUNA 3PDIB 1IHXA 1L5YA 5DYNA 3G9XA 5FO1A 5GJBA 4YAOA 3L82B 2GK4A 3LQQA 3KPVA 5KYWA 2W43A 4TQUS 3LZ6A 1QIEA 4U5QA 2XT6A 4KV9A 3TEJA 1E79D 1BE0A 1R6DA 2WU8A 2XQKA 3T7TA 5TPWA 3WGLA 2HYIC 3DC7A 1WUKS 3L3BA 3U5ZB 3COZA 3AONB 5FB3A 4D9KA 1UP4A 3GLHE 1KOJA 2H57A 2W6IA 2GM4A 5EJGA 4OQEA 3BREA 2ZM6B 4AUMA 4W9NC 4Z2AA 2I1QA 3OOHA 4IDAA 4YDHB 2Z83A 3PWTA 3VR5D 3HO8A 4M1QA 3HB7A 3MW8A 8LDHA 2XDWA 4EUEA 4JY7A 1CUVA 3QKIA 4UQPA 4AY3A 5B1YA 1GPJA 4BO4A 2I62A 3Q10A 4A8JC 1ULUA 3PGVA 3KDAA 3RE1A 3HSKA 1Q7RA 2CXOA 1D3AA 2BGRA 3AIOA 3O26A 4JUIA 4PG4A 4Z9BA 3TRDA 1NVAA 3N86A 4JX8A 4ND1A 4PPQA 3DBLA 3AR4A 1JFLA 5JDCC 3WB0A 4D4HA 4YY3B 2H1WA 2OOSA 2NYVA 4QWWA 5A9SA 2LRHA 3KVRA 2YOFA 1UANA 7GPBA 2NXWA 2V74B 3D3KA 4EW1A 3CX8A 3CW2A 1SG6A 3EZ6A 4DQVA 3DCYA 5C9ZA 1PX0A 3AM5A 5CGZA 1ZK3A 3CG4A 1VG1A 2OXCA 3WYNA 1E1YA 2QUZA 2FWPA 3QEAZ 3JAMA 5IMSA 3T3HA 2QN7A 1HDIA 2AN3A 2RONA 1ATIA 3IQIX 3O73A 5KEIA 1QZXA 1C29B 3PDCA 3OPYB 1TIPA 2ZR0A 3NTUA 1CJVC 3KQQA 2G17A 1XEWY 4IDCA 3KJGA 1EXNA 3LC2O 3NDRA 2JIPA 3HVHA 1ZGCA 1ZJ4A 2YRFA 1BXRA 3DL4A 2VRCD 2IZ6A 5YASA 4K6MA 4C4ZA 1Y6FA 3H2IA 3EGWA 4W9NA 4AQDA 1EGAA 3NASA 4MIYA 1GZSA 5LOVB 1Z7EA 2J3KA 2WWGA 4H59A 4IILA 1OH6A 3C6ZA 4NX2A 3TXAA 2PA0A 4V1CA 4JLKA 3K5HA 3ER8A 4KYVA 2CMKA 1EGHA 1TK9A 2QQ5A 3DYBA 4IIBA 2ZEJA 1ZH8A 2D3TA 1BKSB 3I5XA 5JZ9A 3T3IA 3Q1KA 4AJPA 5JDCA 3AJEA 5C3UA 5HQ3B 1NUTA 2BKLA 1UBNA 3U9TA 3QU2A 3QEOA 4M0CA 4P8RA 2V55B 1A69A 4FCCA 4C78A 2AS0A 3IT0A 3PD7A 3GUYA 1A8UA 1POWA 4CMEC 3ZNPA 3ZWQA 2E9SA 3C3WA 5I5EA 4NBVA 4W5TA 2ZJ5A 3OBBA 1T2FA 3AVUA 2PUVA 3FUXA 4ALLA 1DT3A 4IINA 5GM2A 5JMTA 1XMQB 3D6HA 1EK6A 1I4TD 2QPLA 3W1WA 3PFFA 2O2IA 1FUIA 3FYUC 3EDQA 4J0JA 8OHMA 3RU3A 4OU5A 4UVDA 3CWZA 3UJ9A 3ECCA 3RS8A 3NBFA 1II0A 4OL9A 2UZ4A 2IVFA 2C9ZA 2O7NA 5FUWA 3PDUA 1LD3A 4EI9A 4C3UA 3EARA 3VDNB 1W0JA 3F4BA 2RHHA 1QO0A 2MJLA 1I3KA 3GBPA 4EVSA 1G4UR 4TXLA 4CM5A 3AO0B 1GA1A 3NJ8A 4QGHA 1PR2A 2EKLA 4RXUA 5TSDA 2XYPA 3PDHA 4KAXA 3OAAA 4ROTA 1DC4A 4NMWA 3R7NA 3V7UA 1F60A 4LF4B 1LH0A 1LPPA 5FL3A 1FRFS 3CLKA 3GPIA 1CG6A 1E3SA 2BI8A 3GRVA 1GG8A 2C4MA 3ND6A 2HQOA 2A0XA 3UOWA 2KS6A 3RADC 4DUZB 3K1JA 4RO0A 4AG5A 1C4WA 3P26A 1FW8A 1U5BB 2QRQA 2AIRA 2NUPA 2YHAA 4TWBA 1KJWA 3TG8A 5GV7A 4UM5A 3PTLA 1GTMA 2GCNA 4CF3A 2E6UX 3V4LA 4CMEA 4RHXA 3PTAA 4LNUB 4FGLA 1E18A 1N9GA 3BWDD 2W83A 4QDZA 3TLJA 5FBWB 3EFOB 1WB6A 3GA0A 1KIFA 3D5QA 1Y4DE 1JG2A 3I30X 3FYUA 3ZDRA 3C5HA 4KR7A 1JB9A 1JFVA 3LDHA 2XMGA 2ZPUA 4FJ1A 3PX2A 4CJXA 4CIYA 1D0SA 2B7BA 4NU6A 2IYWA 5B6JA 1KK0A 4C14A 4DCJA 3AW9A 3IALA 1HYHA 2ZQZA 3NO4A 1XAIA 3W3AA 3ABOB 4M6WA 4EQ6B 3D5EA 3OT5A 1F38A 3HYCA 1NP3A 1PQWA 3U13A 3SHFA 1QYWA 3YASA 2OENG 1CUBA 1CS4C 5IF9A 2JGLA 5KWJA 4KXXA 2CDAA 4RABA 1FDTA 2WNSA 2DQSA 2G7MC 4H3KB 3TTVA 3EXEB 2HB6A 3X2FA 3ILYA 5ALMA 1INLA 1DBWA 2IUFA 2BZ1A 1B42A 1HRDA 1ZRMA 2ZVDA 5EYPB 3VOTA 4NBTA 3BF7A 1SWVA 5DGCA 1BMQA 2VPQA 2IYLD 1X8KA 2UYQA 1JL3A 4EJFA 4DA4A 1JEQB 2BEWB 3M4XA 3GGPA 2C77A 4TZTA 1X14A 5HXAA 4ZYYA 4P3PA 3UMFA 1MA0A 2QGZA 4DQUA 4RQAA 4L4XA 1X77A 3ZR4B 4AG3A 3MB5A 1W25A 4O3MA 4GD3Q 1O5IA 1RCFA 3E3AA 4JJAA 3BC1A 1I0IA 4LYJA 4AO6A 1NVDA 4MUAA 1RFGE 2ZI6A 3BMQA 5BQFA 3IKLA 3ND5A 4JJ8A 3SG0A 4LXGA 4R4JA 4YT4A 3WLPA 5KYUB 2FFRA 2NVOA 2WHPA 1EZ4A 2QGNA 4G5FA 1UBJS 4HUQA 3WBBA 3F1KA 4KMOA 1Q77A 1N78A 1W36B 3EPPA 1VCHA 121PA 1NG1A 5AUNB 1WZ2A 4BKOA 3LUGA 1CNEA 3SP1A 1KOGA 2WINI 1NHGA 4DUGA 4YEDA 3WRXC 2ZWOA 5FJJA 1FUYB 3TGPA 1P1IA 1S4MA 4RF3A 5JS8A 4CM6A 4MQFA 3UBTA 3EQ9A 4RY0A 4WTOA 3REQA 2RGWA 4UATA 4BVEA 1UBLS 3N9IA 3DO5A 1R37A 2V7VA 2QT0A 1RPJA 1NXXA 1M74A 3PXBA 4NXMB 2Q9UA 4P34A 2VDWA 3C1OA 3FZYA 5CURA 4N18A 5FWXB 1GKIA 3UHOA 1OSNA 3LP8A 2OXIA 1PDVA 5AVJA 1CQIB 1IZYA 3JVIA 3FLMA 4C0QC 1O4VA 4P4TA 4PSKA 3SQLA 1ZX1A 4OTZA 3LOPA 4MWSA 1P80A 3L0OA 2ZS7A 1DIBA 5AI4A 1EM6A 1UF9A 3WB2A 4AC9A 3KJQA 1SKYB 4IXDA 4B6SA 4ZAXA 1TM4E 2JLZA 1QZTA 3ILVA 4G4SP 4H17A 2C4NA 3B7WA 3EIFA 2OO5C 2R8BA 3LL4A 4L0DA 1DWUA 4E1AA 2E48A 1NY6A 5ALFA 4LJRA 2MSDB 2VDLB 2XRYA 4MVXA 4LY0A 1WULS 2OGSA 1N6LA 1ORVA 2A9PA 3D1LA 3LQ2A 2WWVD 4QM7A 4Q3LA 5TXGA 3U3DA 3D4PA 3KSAC 1EDDA 1NMEA 3O92A 1OYOA 5DPMA 1DQSA 2EVWX 2O8FB 1NRWA 2DG2A 1Q0LA 3IPLA 3U3RA 5CT6A 1PEAA 2DCMA 3AP2A 1DAGA 1GKKA 1RHQA 2CVFA 2OZLB 2ZGVA 3DVRX 1KI6A 1FPQA 4K1LA 5J63A 4Z0HO 2NGRA 3Q98A 3NHBA 3WRXA 3DZ8A 4BNWA 5JZBA 4KR2A 4C2TA 3IQZA 3IEUA 3AV3A 4LVNA 1YIDA 2J5XA 2X9LA 4PC6A 3U37A 4MS1A 3LKZA 2E85A 1FQKA 1HDEA 3FDZB 4IHQA 5FTJA 2G04A 2NO9A 3W2EA 2VYNA 1XCMA 3HZHA 4C5AA 3QFHA 4WOKA 2C1XA 3OZIA 4K81B 5KHLB 2X2FA 3RRYA 3SQOA 3G0GA 4CKXA 1BZYA 1IHUA 2CCJA 2CMDA 2GPSA 2UVDA 4NBLA 4M76B 1E3WA 5LLSA 2JLUA 2QN9A 3A4YA 1IVYA 6Q21A 3O4VA 1WXWA 2R7AA 3WFIA 4RXTA 1BWRA 4ER0A 1JHXA 1OWMA 4PM4A 3WNZA 1X7ZB 4QTXA 4CKYA 5LL6P 1U7HA 2CDBA 1ZO8A 3BCSA 1IZ8A 4EG7A 5KSWB 5JNVA 4MKXA 1YK1A 2AGVA 2O8BB 1BW9A 4PO3X 2H1OA 2OO5A 4EELA 4DLWA 4KSYA 3R3HA 2FPGA 5TQ0A 3K92A 5KWIA 3E35A 1YZTA 2DPHA 4JL6A 4ZI7F 2XBMA 2JFVA 3BXGA 2IYAA 1AQLA 1M2OB 3K15A 3SHOA 3EY9A 1Y8QA 4HEA1 1V8FA 5F5LA 4ZEMA 5ES3A 4EFDA 4YCMA 3WB9A 1DAIA 1VQ1A 3C16C 1UZAA 3R6LA 4WZBB 2GPWA 3EVNA 3QEMA 4P31A 1KQGA 1QV7A 5A5GA 5FWYA 2REXB 4MEAA 1OA1A 4FILA 3NOOA 1IOZA 3KB6A 3W6UA 5MF6A 1PFYA 2BR3A 3HCPA 4ID9A 4Z0PA 4BNTA 3CX4A 3UBMA 4J7CA 1XVTA 1L4NA 1JNXX 4ZAFA 3HMQA 1T25A 1P81A 1TYZA 3PXAA 4S1TA 3VU9A 1NNI1 1W85A 4CF7A 2YRWA 3NAMA 4KAFA 3KPJA 3FNEA 2VP3A 2QTGA 4FZ3A 2VWHA 3B1JA 4U3JB 3TK1A 2Y0BA 4M1ZA 4FMDF 4IUDS 1DHTA 3OCYA 2FPRA 3E7WA 2BMDA 5SYAA 3KLMX 2G71A 3A9RA 1UBKS 2K6GA 4O4IA 4XLZA 3PUYA 2X9NA 3F5SA 3O8RA 2R1ZA 3WTCA 3SX2A 5C80A 5JZMA 2HT6A 3CZPA 1XZPA 4BV8A 1KVSA 3GF4A 1JQ5A 1ZH2A 4PAWA 4X60A 2PD3A 3PDWA 3I2YX 3QPWA 3R5FA 2XJ4A 2W2MA 1N8NA 3KJIA 2HWYA 4KO2S 4DIOA 1R9NA 2O6LA 2CWWA 3KKMA 3O9VA 2WM8A 2J3MA 1YJQA 2YWHA 3CZ5A 2VP4A 1P2VA 1VSQA 4EYEA 2FMTA 621PA 1SQ5A 1Z5NA 1LK0A 2HSGA 3NUZA 1WP4A 3LC0A 1HFWA 3KT8A 2GHTA 2G08A 4ARZA 1ZSYA 4KN9S 4A0FA 4TMXA 3OJXA 2VDOB 2WV9A 5EKSA 4BEVA 1XZDA 5EIAA 3Q6IA 4PXYA 3I9V6 5EE3A 1BCRA 4JBXA 4EGQA 1IEWA 1YE8A 4QUAA 5GOZA 3V1TC 2PBRA 1QMPA 4DDMA 4EGAA 4XR9A 3ZH2A 1IWBB 1A27A 1QHXA 4Z4HA 1A96A 1TYEB 3F1LA 3KT3A 2PIAA 4Q16A 1M5RA 3SLGA 4R0VA 4QO7A 4UJ3A 2YVKA 4C7VA 4C21A 3ABIA 5CTAA 4DA6A 2RGEA 1WVMA 4KPGA 4QHTA 1SVIA 3EEFA 4ETIA 1XMXA 4KI7A 4JSTA 2H07A 4R1OA 2JLAA 2XLBA 5JT1A 1KHTA 2UXBB 2OBXA 1XDUA 2WKWA 3OOWA 1V45E 1JR3A 1PE0A 1X7HA 1E7YA 4HH0A 4PSAA 5TIIA 2CJFA 1W5AA 2BP7B 2ZRGA 3BK7A 1BDHA 4EKIA 3CN9A 4OJKA 1PUIA 3LG2A 5LP6C 1XDDA 1T5LA 5BNIA 4XEHA 3QWAA 4ZDKA 1SIOA 2GARA 3V2UA 1B3BA 1H9CA 2VH1A 2AOWA 2QGFA 5ENDA 3BXHA 1F6DA 1GPWB 4BDTA 3FB4A 3E7XA 4Y6QA 1ZHFA 4QG3A 4I6JA 3AEZA 2YX1A 1YQEA 5JTUA 1X7YB 4KR0A 1WBDA 3VI3B 1QH1B 4AKIA 2QROA 2WKPA 3N7UA 1F3OA 3KFXA 3QIVA 3ZH9B 4RY2A 3NNNA 5IF3A 2CYAA 4C87A 1UAAA 3VZCA 3ACDA 4RQUA 5KNCA 3RK0A 1U2TA 1BVRA 2EAUA 2P5UA 4HEQA 5ALZA 4DHWA 1V7PC 4E5YA 4LDPA 2FQQA 4WGGA 2VHUA 3ZCUA 4U02A 4MGIR 4OFXA 1XA3A 5TJ9A 5AHOA 3KWMA 5EIXA 3ADDA 3MRXA 3OUUA 3R3YA 3N2KB 1GAJA 1UM9B 4UE3S 5CNMA 4YS6A 4UDNA 4JJGA 4NFHA 3RVMA 4F7DA 1CBUA 3EVDA 2GGSA 3THYA 4A5OA 2ZIZA 3M6WA 3OIGA 4S12A 3MAGA 4BNHA 4UHDA 1A9SA 4X85A 1N2IA 3UJ6A 4C0XA 1SH7A 4CMGA 4FUQA 4F3TA 3LE8A 2CGEA 2F7SA 3DB2A 1KY3A 1TXGA 3PWZA 2FPSA 1UXKA 3LNTA 2AWOA 2E2WA 2EX1A 1YDGA 2ECFA 3EMDA 5CHEA 5LP6A 3L1JA 2C1EA 4RVSA 3N74A 1QQ7A 1QR6A 3THSA 4WJLA 3B20A 4MS3A 3GJRA 5EFOA 5J40A 2AJDA 1Z33A 4ZEWA 3QEBZ 1K7YA 2LV8A 3O9MA 3BJIC 5EA2A 1GN8A 1WRBA 3HO6A 1SM4A 1JG4A 3A7EA 4IKOA 3DOHA 5ALTA 4XYBA 3ZIAD 4HTAA 1RS0A 4DCUA 5B4TA 3EC7A 2NO1A 3RHSA 2Z8YA 2QM0A 1QJ4A 1V9SA 3MCUA 2KQUA 2YVUA 3C3JA 5IBRA 3II6X 3LUCA 4KSBA 1J0DA 3G23A 4IEFB 4LISA 3A1SA 5AHWA 1E9DA 3K6RA 3GLFA 1N75A 4RPIA 3NDIA 4JYCA 3GT7A 5C34B 1RYBA 1EWYA 4ZO9A 5LBTA 3O2NA 3CN7A 4A1FA 2IZ7A 4XSHA 1L8AA 3B1YA 1RAHA 3KALA 3OTGA 2ZTVA 1NQTA 3T8YA 3WHPA 1KO5A 2G0NA 4OJYA 5FUYA 4EGFA 1L0BA 2PX5A 4YMSA 4C03A 2JHFA 3GLKA 3TKLA 1RHKA 2OWDA 2NZVG 4BBZA 1MH9A 1FDIA 3W9UA 1PNOA 4J0IA 5JPIA 3ZKWB 2GTPA 3NHSA 2IP2A 3KIPA 4JVSB 2AC2A 3ZWBA 1K3FA 3QPAA 3BORA 4L5YA 1JIJA 4MK4A 1YL7A 4BNYA 2QT1A 1IJFA 1VJGA 4TUYB 1ORDA 1YCFA 1YZQA 2F1RA 4UXIA 4JXXA 3ADKA 2QUBA 4PS0A 1C7QA 3TBKA 1CUAA 3H6GA 2GR9A 5IHXA 3ICEA 1UJBA 1Z07A 4G37A 5ALGA 3ROFA 3DJFA 3QBDA 3P5SA 4H1TA 1P2UA 3DAOA 3GYGA 4JD5A 1YKGA 3C3PA 2CNOA 2IEZA 1FFBA 2FPIB 4EDHA 4B40A 1Q6YA 3HE3A 4HVTA 1A9QA 3BFKA 2R60A 2TYSB 3L49A 4NI5A 1Q92A 1KVQA 5JNWA 3OFVA 1YOVB 3CSUA 3C3AA 2YMMA 1TRHA 1WD5A 2EKPA 3BMCA 4GI1A 5CJJA 1SN7A 2DZDA 1M6VB 5BNTA 3N7TA 3E2PA 3ZWNA 5JQWA 1WVIA 4CKCB 2QRUA 5TF4A 1URPA 4DWVA 2DJ5A 4N3CA 2PVCA 3NQ41 5FD8A 2GEFA 1T4CB 3ZY6A 3I62A 1QLWA 3AINA 1DQPA 1HO3A 4DKJA 1S1MA 1MH1A 1NBOA 5B4UA 5C7IO 1U2RA 4JOSA 5LU9A 1JSZA 3REFA 3TIFA 4DSOA 5EFZA 2UYCA 3QI2A 3CUWA 3BKXA 3GVHA 3MJCA 2YC4C 1ZINA 2E5FA 1RXVA 4YRRA 2XOKD 2FZVA 3N53A 5BN4A 3ICCA 5C5DA 4IZ6A 2JCXA 1J0AA 1BAPA 1U90A 2WSIA 2GYVA 5IJ0B 3JATB 1VJ1A 5FTMA 1Y7LA 3IEMA 5M3BA 2R96A 2ETVA 3KDPA 4J0HA 1R15A 3UOAB 2DKNA 1MVNA 2C2KA 3EF3A 4BNFA 3V4RA 1O9GA 2DETA 4D3DA 1G8PA 4L3OA 4P3OA 3R9WA 3GT3A 1B41A 3ITEA 3Q87B 4BX9A 1NXOA 1HEIA 2ASEA 4JGGA 2H29A 1XALA 5KVSA 1CHNA 4QXOA 3WHKA 2K4MA 1EIWA 2WE7A 1XFAA 1T3LA 2WJYA 1PFQA 1EGQA 4AMVA 2IXBA 5JWRA 1U28C 5CW2A 5KWEA 3DDOA 2VXCA 4LGMA 3H6KA 1YZ3A 4B3XA 5F76A 3RANA 1FUUA 1XCBA 2W2VA 3W06A 1JUDA 4OFZA 2XWSA 3WJAA 3PGJA 3WV5A 1RCUA 3KJHA 4M86A 5D01A 5FNVF 1BMTA 4D9JA 3QWFA 2X4IA 3LUHA 2J9YB 1B16A 3ZWDA 4CODB 5B2FA 3PPWA 1SRRA 3HUUA 4KE7A 4DTIA 4WJZA 4DMMA 4N0MA 1ZNZA 4G8JA 1QG6A 4Y98A 1K1EA 1GUYA 2AT1A 1Z88A 3KUKA 5JXIA 4JLBA 3USES 5IDYA 3CT4A 1BE6A 4W7SA 1FP6A 3Q2OA 3HLTA 4ZCIA 1ZN9A 1Z7WA 1ZL0A 2CNKA 4PLGA 5CXUA 5FA8A 2DBZA 4QGGA 4M0MA 3R7AA 1E8NA 2HI0A 3RIMA 1KK1A 1WCV1 2F62A 2FW7A 5LZ5A 4F46A 5HZMA 4HDMA 1HT3A 1PKEA 3PR1A 4E5DA 2B4YA 3ZLJA 3E70C 1ABEA 1GD1O 2ZSFA 3G2NA 3FM9A 3L4EA 4ZVQA 2BI7A 4Y8VA 3OEEA 3L8CA 1BMFD 5EP4A 1YXMA 1PV1A 2PUAA 2OHOA 1P1HA 1TPZA 1QSGA 2GFHA 1EFAA 2ZIXB 4NZZA 4INZA 3K4HA 4NU5A 2I65A 1IBSA 3MOGA 1GQRA 4E51A 1Z22A 1GKUB 5G53C 3L8HA 1H94A 1U28A 1UC4B 2K87A 2P9YA 2ZJ2A 3TJZA 4E5KA 1F9EA 4DDHA 4Z4GA 2GLUA 2X7JA 2Q5EA 2P6UA 3NG1A 4IG4A 2F9FA 1MQ9A 1RLOA 2E4VA 3KTAB 1ZU4A 1LGYA 3ZD8A 2G9NA 3AHIA 3TQIA 5K8LA 3JYOA 4A0HA 2I8LA 1JIXA 3QW4B 1YAHA 1P4SA 3N0VA 2F8MA 2Z8XA 3RS9A 1DELA 2V4UA 1QH8B 4P6VF 2QLMA 3SOZA 3B12A 1U1IA 1WETA 2IXEA 1U8EA 1XIVA 3B7GA 5EPOA 5IARA 3BZUA 3IAXA 1XZJA 2EW8A 5DMHA 3TVYA 3VMMA 5EIBD 2OUIA 3THOA 1PFGA 3CSSA 3TLXA 2XODA 3CB4A 4M99A 3HVJA 3UMCA 1G6Q1 3ZJYA 4PFQA 2SKEA 4UZSA 4FYKA 1KFJB 1TQ2A 5CVVA 2JGKA 2AZMA 3AKCA 2P78A 5IWCA 5CDTA 3B1ZA 2G0TA 5AIAA 4RJIA 1XTUA 3A4VA 3AETA 1L7VC 3A3YA 3RC7A 1B8NA 4L4SA 1F8UA 1K8YB 2QMYA 2REQB 1JAIA 2AMYA 3EGDB 5AM1A 4F92B 1RXYA 4MI9A 1MIHA 5K0LA 4ICIA 2BTEA 5TR9A 4DIBA 1X7GA 2DHCA 3TGLA 2Q5CA 3RI3A 4EVQA 3OG9A 4I5GA 2FFQA 1Z0KA 3RTCA 2EP8A 1KO7A 4N41A 3D8NA 3AL3A 5B64A 1BH6A 2JIOA 4I1YA 3ID6C 4PLFA 2B8TA 2XLCA 3COVA 4RDHA 4TSRA 4B83A 1N25A 1F14A 1I30A 1PS0A 1UC8A 1KTIA 1JNYA 4RDXA 1WB9A 3VTZA 2ZAYA