1X28A

Crystal structure of e.coli aspat complexed with n-phosphopyridoxyl-l-glutamic acid
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of C5-dicarboxylic substrate to aspartate aminotransferase: implications for the conformational change at the transaldimination step.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 136
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1x28A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1x28A01
1BJNA 3NU8A 1S06A 2VIBA 4FFCA 1GCKA 2ZSLA 4WYDA 1CS1A 1SZKA 2GMUA 4R5FA 3B8XA 3LVKA 4TN4A 2AATA 1JS6A 2AY6A 1YNUA 1WYTA 4WLHA 1JS3A 1I48A 2WK9A 2OKJA 4JEYA 3R9AA 4UOYA 3WKRA 2AY9A 4W1XA 3CQ5A 1X28A 4MKKA 2Z9WA 3B46A 1DGEA 4U1TA 4JE5A 3WZFA 3MAUA 1MLYA 1UU0A 2ZUKA 4GSAA 3PD6A 4JE5D 1YAAA 1GDEA 3P1TA 1AKAA 1BQDA 3CBFA 3GZDC 5FT4A 2R5EA 1MGVA 2VMXA 2W7LA 2W8TA 3EUCA 1I43A 1MDZA 2VMNA 2HZPA 3R4TA 5EAAA 1Z3ZA 4AOAA 4ATPA 4E3QA 4XAUA 2AY1A 3E77A 1SF2A 3KE3A 2VGVA 4CVQA 1AHXA 2W8WA 4H51A 3NU7A 4WXFA 1GEYA 5FT6A 2BHXA 4JEVA 4BQ0A 5DJ9A 4GE7A 4IXOA 4I8AA 4OCAA 1AIAA 1D2FA 2FNIA 2YRRA 4A0GA 1IUGA 4DQ6A 1OXPA 3FRKA 1H1CA 4ADCA 2HUIA 2BI9A 1GEXA 3FSLA 5G2PA 3DR4A 2V0YA 5LH9A 1UKJA 4ISYA 3OP7A 4W1VA 2AY3A 5JAYA 1WYVA 2VI8A 1YJZA 2CFBA 4ZSYA 1C7GA 1S08A 4NOGA 3WGCA 1LS3A 2VMTA 3BWOA 1N2TA 3B1DA 3ECDA 4WXGA 1C7NA 1BJOB 1M0NA 5D5SA 2GQNA 1KMJA 2D7YA 3GBXA 2GB3A 3JZLA 4B98A 4EB5A 2V1PA 3RCHB 1I29A 1SVVA 1BS0A 4WYEA 4F5GA 1X0MA 3AEJC 3VK3A 2VIAA 2E7IA 2AY8A 5M4DA 2QB3A 1TOKA 3FQ8A 4OC9A 4P7YA 3RI6A 2Z9UA 1GD9A 1GC4A 2E7UA 1AIBA 2BI3A 2VGZA 1G4XA 4WB0B 1SFFA 4ZASA 3DYDA 4R8DA 1QJ3A 3RCHA 3FQAA 4ZDOA 1ASEA 1B8GA 4OYTA 3QHXA 4GDYA 5HHYA 4B9BA 1LC5A 3DZZA 4UHOA 3AOWA 5HXXA 1H0CA 1W7LA 3BCBA 3G8MA 4A0FA 1ASMA 1CQ8A 1ARSA 3CQ6A 4F5JA 3W1HA 1I41A 4F4EA 1QZ9A 3BB8A 2OQXA 4PFFA 2AEUA 1GEWA 2WKAA 3K28A 2HP1A 2VGTA 1PMOA 4OMAA 1FG3A 1AHFA 4ADEA 1B5PA 4MQQA 4F5HA 1PFFA 4ZM3A 4LNJA 4W5KA 2X5DA 4RIZA 3ATHA 2YKYA 3A2BA 2AY5A 1W7MA 1SZUA 2YRIA 3NTJA 4IXSA 4A72A 2CH2A 5G2QA 1ZODA 1LC7A 2JGTA 3ELEA 4TV7A 3UWCA 4RM1A 2ZP7A 4IYOA 1WKGA 4A6TA 1C4KA 5EIGA 1ASGA 8AATA 1BW0A 2Z1YA 3D6KA 3WCNA 1OATA 2BWOA 3W1IA 2OGEA 1M0OA 4F5IA 5M46A 2FQ6A 2NMPA 2E7JA 2R5CB 1ORDA 3RBFA 1M0QA 2Z9XA 2DR1A 4IY7A 4KXKA 1TOJA 2VMPA 1E5EA 2W7GA 3FVXA 5EIGB 2HUUA 2EH6A 4A0HA 2QBTA 1U08A 1TATA 3HLMA 2VYCA 4ZAHA 3BCAA 3MBBA 3AEOA 2ZY4A 3TATA 3GETA 3QBOA 4RLGA 2CJDA 2W7EA 2VI9A 3PD6B 1GBNA 4K2MA 1O61A 2FM1A 3LG0A 3GWPA 2D64A 2YCTA 3E2ZA 5EUDA 4DBCA 1AMQA 3COGA 3I16A 4M2KA 4M2MA 4ADDA 3ASAA 4IW7A 3DRDA 4RJYA 1E5FA 2PO3A 3ZRQA 2X5FA 3NX3A 2R0TA 4OBUA 5DX5A 5EUNA 1ELUA 2VMOA 4MQPA 3RUYA 3DXWA 2VMYA 4F5LA 5BJ3A 1FC4A 3AEMC 2VGWA 1JG8A 3F9TA 4ITXA 5EFSA 5F8VA 4BA5A 3VP6A 2CH1A 4Q6RA 3WKSA 2C81A 3DC1A 4LNLA 3EIAA 5DB5A 1BQAA 1M4NA 2EGYA 2Z67A 2W7DA 3JTXA 1AAMA 3W1JA 1V2FA 2Z20A 2ZYJA 2RFVA 4WP0A 1DKAA 2D61A 2AY4A 4UHMA 4XJPA 1KKJA 3Q8NA 1TASA 1YIYA 3PAAA 1WYVB 1G4VA 2EO5A 3EI7A 1QITA 5HDMA 3WCOA 3E2FA 3AENA 2VLFA 1IBJA 1AJRA 2WK7A 1N31A 1BJOA 4AH3A 4ZM4A 1AHGA 3ZRPA 2BIAA 1GC3A 1BKGA 3WX9A 1MLZA 5G4JA 5BJ4A 2VGSA 3GZCA 4AZJA 4RITA 4XJOA 1EG5A 2DGLA 3AENB 2D7ZA 4W8IA 1ARGA 4N0BA 1AY8A 1PG8A 2AEVA 3GSBA 1IAYA 1VEFA 1DJUA 3EZSA 4ZDLA 1IX7A 1LC8A 1VJOA 2G6WA 1C0NA 3FTBA 1ECXA 1OXOA 3USFA 2W7HA 1QIRA 3VOMA 3HMUA 1IX6A 1KL1A 1S07A 4K2BA 2DKBA 1GC0A 5I92A 1AJSA 2JJHA 5FT5A 2XH1A 3PGYA 1X29A 3H14A 1N8PA 4ITGA 4OTLA 5EAVA 1YOOA 3G7QA 3QN6A 4WD2A 1CZEA 2VMSA 3E6GA 2QLRA 4JEZA 4XQ2A 4O6ZA 4MGRA 3AEJA 4WLJA 1YJYA 3JU7A 3HQTA 3B1CA 1AMAA 2DGMA 2AY2A 2EPJA 1AMSA 2DGKA 2ZY5A 2VGUA 3JWBA 3AEMA 2BYJA 1ASDA 3LVJA 5EQCA 1ARIA 3LVMA 4RJ0A 2CANA 4CXRA 1ASNA 4MSOA 1PMMA 2FYFA 1GC2A 2JJFA 3FFRA 3CQ4A 1QJ5A 1MDXA 3WLXA 1TPLA 3K40A 3AELA 4M2JA 1AHYA 2C7TA 3PPLA 4W1WA 4AO9A 3AEPA 4Q31A 1CJ0A 5G4IA 3NRAA 3G0TA 2R5CA 2D66A 4OT8A 5K8BA 1KKPA 4ZDPA 2CB1A 3EI5A 3CAIA 1D7VA 2TPLA 3NDNA 3BWNA 1D7RA 3FVSA 4LW4A 2EZ1A 1BJWA 1OHVA 2VMUA 1W3UA 2YHKA 1DFOA 4Y0IA 5E3KA 1AY4A 4LC3A 2FNUA 2WK8A 1KL2A 2CTZA 3ACZA 4Q76A 2FN6A 3KGXA 3ZZKA 1ASLA 4L0OA 4MY5A 3II0A 2BWPA 1WSTA 3FZ7A 3LV2A 4R5ZA 4A00A 2W7JA 3E2ZB 3FZ6A 4LW2A 1CQ7A 3FDBA 3KKIA 3VK2A 4EB7A 4A0RA 2O1BA 3FZ8A 2OGAA 4MKJA 3BN1A 4EU1A 3BCXA 4RKCA 1RV3A 4WYAA 1DGDA 2Q7WA 2YCNA 1TOEA 3LWSA 3E2YA 1EJIA 1J04A 1O62A 2VLHA 1QISA 4CBRA 5M49A 5M4BA 4FL0A 3RBLA 3K7YA 5TF5A 3NUIA 3AATA 3MKJA 1ZOBA 2ZC0A 1MDOA 3VAXA 1S09A 1T3IA 2W8JA 3ELPA 4HVKA 1LW5A 4GEBA 3BS8A 1V72A 4E3RA 2DOUA 2OKKA 3B1EA 1AKBA 4UQVA 4UHNA 1AAWA 2O0RA 2CSTA 4P3MA 3LY1A 2ZJGA 3RQ1A 4U2HA 5D95A 4WYGA 1SZSA 4A6UA 2YKUA 2W7IA 4JF1A 1W7NA 4RAEA 3F6TA 4F5KA 3GZDA 2VMRA 4GRXA 3KGWA 3WY7A 1B9IA 1Z7DA 2BI5A 1M6SA 3PJ0A 4QGRA 4Y0DA 3EIBA 5FT8A 5G09A 1OHWA 1Y4IA 2C0RA 1M0PA 1RVUA 4CBSA 4ZWMA 1OHYA 2BWNA 4WBTA 1AMRA 2QB2A 3BWNC 4J8LA 1W23A 3AOVA 1XEYA 2ORDA 1O69A 2JISA 1M32A 2D65A 2D63A 4EFFA 1WYTB 1IVRA 2HORA 3PDBA 4JEXA 4KAMA 4OBVA 4ZSWA 2Z9VA 2CJGA 2EZ2A 3FVUA 2QMAA 1MAQA 4E1OA 2BIEA 1AJSB 3A9ZA 4LNMA 4N0WA 1DJEA 4BHDA 1WKHA 1X2AA 2F8JA 3DODA 3N0LA 1EQBA 3UE8A 1S0AA 3A9XA 3PDBB 4PIWA 2XBNA 2O7CA 1ASCA 2YCPA 1AX4A 1SPAA 1C9CA 4A6RA 3NNKA 4KYOA 7AATA 1CQ6A 4TMRA 3H7FA 4XEWA 1D7UA 2X8UA 3EZ1A 3IF2A 1B4XA 3E9KA 2HP2A 1KMKA 2HOYA 1LKCA 4AZKA 1MAPA 4ADBA 1AHEA 3EI6A 3GJUA 3ASBA 2W7MA 1DJ9A 2Z1ZA 1YJSA 3NYUA 1O4SA 4MQRA 4R2NA 3A9YA 2W7FA 1IJIA 1LK9A 4GE9A 3WGBA 2BI1A 3DU4A 3MADA 4Q75A 2OATA 3FD0A 2CY8A 1G7XA 3FFHA 5F9SA 4W91A 2VMQA 3T32A 1V2EA 3TFTA 3EI9A 1C7OA 2DKJA 2X3LA 4DGTA 2BYLA 2VMWA 4WYCA 2C44A 1ARTA 1J32A 3QGUA 3F0HA 4WXBA 5LHAA 3HBXA 1ASFA 1UU1A 2VMZA 5C6UA 2D5YA 3PDXA 3L44A 2HOXA 3HT4A 1JF9A 2BKWA 1XI9A 3JWAA 3MC6C 2PB0A 4WYFA 1IX8A 1G7WA 2JG2A 2Z61A 3FCRA 4E77A 2W7KA 1D7SA 2JJEA 2W8UA 4XK1A 2W8VA 2CINA 2ZSMA 4ZWVA 3UAKA 4J5UA 3N5MA 2ZY2A 3QPGA 5E4ZA 4BA4A 1RVYA 4IXZA 1UU2A 2YOBA 4XJLA 3PA9A 4IX8A 4Y0HA 3TCMA 4EMYA 4CXQA 4F5FA 9AATA 1ELQA 4PVFA 4AO4A 2ZY3A 3MC6A 2BIGA 1AKCA 5J8QA 1M7YA 1V2DA 1DTYA 1ZC9A 3FQ7A 2BI2A 3QM2A 4PFNA 4WB0A 3ISLA 3L8AA 4F5MA 1BJ4A 1AICA 1B9HA 1ASAA 1YIZA 5E5IA 1AY5A 5DJ1A 2AY7A 3FDDA 3DR7A 3MEBA 3IHJA 1TARA 3I4JA 3N75A 4GE4A 3AV7A 3OKSA 2VMVA 3PIUA 1FG7A 2R2NA 3EI8A 4JF0A 1BT4A 3A8UX 3JW9A 3DXVA 3I5TA 1P3WA 1ASBA 3NYTA 3TFUA 3ZRRA 1ARHA 3ZZJA 2YKVA 3MAFA 3HVYA 1WYUA 2GSAA 3NYSA 1CZCA 5AX8A 3TQXA 3BV0A 3BC8A 3M5UA 3LVLB 3NUBA 4XJMA 1IAXA 1QGNA 3HL2A 1TOIA 3GR9A 3MAFB 5IWQA 1VP4A 5G0AA 1B5OA 2JJGA 3P6KA 1CL2A 1WYUB 5EUEA 3VK4A 2QA3A 2PB2A 2HUFA 2HOZA 3QI6A 4IYOB 1CL1A 4HF8A 4ZLVA 3HDOA 2CJHA 4JEWA 2E54A 4K2IA 4RKDA 4BMKA 2GMSA 2YKXA 1LW4A 3FKDA 1RV4A 4ATQA 1TOGA
chains in the Genus database with same CATH superfamily
1BJNA 3NU8A 1S06A 2VIBA 4FFCA 1GCKA 2ZSLA 4WYDA 1CS1A 1SZKA 2GMUA 4R5FA 3B8XA 3LVKA 4TN4A 2AATA 1JS6A 2AY6A 1YNUA 1WYTA 4WLHA 1JS3A 1I48A 2WK9A 2OKJA 4JEYA 3R9AA 4UOYA 3WKRA 2AY9A 4W1XA 3CQ5A 1X28A 4MKKA 2Z9WA 3B46A 1DGEA 4U1TA 4JE5A 3WZFA 3MAUA 1MLYA 1UU0A 2ZUKA 4GSAA 3PD6A 4JE5D 1YAAA 1GDEA 3P1TA 1AKAA 1BQDA 3CBFA 3GZDC 5FT4A 2R5EA 1MGVA 2VMXA 2W7LA 2W8TA 3EUCA 2G7JA 1I43A 1MDZA 2VMNA 2HZPA 3R4TA 5EAAA 1Z3ZA 4AOAA 4ATPA 4E3QA 4XAUA 2AY1A 3E77A 1SF2A 3KE3A 2VGVA 4CVQA 1AHXA 2W8WA 4H51A 3NU7A 4WXFA 1GEYA 5FT6A 2BHXA 4JEVA 4BQ0A 5DJ9A 4GE7A 4IXOA 4I8AA 4OCAA 1AIAA 1D2FA 2FNIA 2YRRA 4A0GA 1IUGA 4DQ6A 1OXPA 3FRKA 1H1CA 4ADCA 2HUIA 2BI9A 1GEXA 3FSLA 5G2PA 3DR4A 2V0YA 5LH9A 1UKJA 4ISYA 3OP7A 4W1VA 2AY3A 5JAYA 1WYVA 2VI8A 1YJZA 2CFBA 4ZSYA 1C7GA 1S08A 4NOGA 3WGCA 1LS3A 2VMTA 3BWOA 1N2TA 3B1DA 3ECDA 4WXGA 1C7NA 1BJOB 1M0NA 5D5SA 2GQNA 1KMJA 2D7YA 3GBXA 2GB3A 3JZLA 4B98A 4EB5A 2V1PA 3RCHB 1I29A 1SVVA 1BS0A 4WYEA 4F5GA 1X0MA 3AEJC 3VK3A 2VIAA 2E7IA 2AY8A 5M4DA 2QB3A 1TOKA 3FQ8A 4OC9A 4P7YA 3RI6A 2Z9UA 1GD9A 1GC4A 2E7UA 1AIBA 2BI3A 2VGZA 1G4XA 4WB0B 1SFFA 4ZASA 3DYDA 4R8DA 1QJ3A 3RCHA 3FQAA 4ZDOA 4K05A 1ASEA 1B8GA 4OYTA 3QHXA 4GDYA 5HHYA 4B9BA 1LC5A 3DZZA 4UHOA 3AOWA 5HXXA 1H0CA 1W7LA 3BCBA 3G8MA 4A0FA 1ASMA 1CQ8A 1ARSA 3CQ6A 4F5JA 3W1HA 1I41A 4F4EA 1QZ9A 3BB8A 2OQXA 4PFFA 2AEUA 1GEWA 2WKAA 3K28A 2HP1A 2VGTA 1PMOA 4OMAA 1FG3A 1AHFA 4ADEA 1B5PA 4MQQA 4F5HA 1PFFA 4ZM3A 4LNJA 4W5KA 2X5DA 4RIZA 3ATHA 2YKYA 3A2BA 2AY5A 1W7MA 1SZUA 2YRIA 3NTJA 4IXSA 4A72A 2CH2A 5G2QA 1ZODA 1LC7A 2JGTA 3ELEA 4TV7A 3UWCA 4RM1A 2ZP7A 4IYOA 1WKGA 4A6TA 1C4KA 5EIGA 1ASGA 8AATA 1BW0A 2Z1YA 3D6KA 3WCNA 1OATA 2BWOA 3W1IA 2OGEA 1M0OA 4F5IA 5M46A 2FQ6A 2NMPA 2E7JA 2R5CB 1ORDA 3RBFA 1M0QA 2Z9XA 2DR1A 4IY7A 4KXKA 1TOJA 2VMPA 1E5EA 2W7GA 3FVXA 5EIGB 2HUUA 2EH6A 4A0HA 2QBTA 1U08A 1TATA 3HLMA 2VYCA 4ZAHA 3BCAA 3MBBA 3AEOA 2ZY4A 3TATA 3GETA 3QBOA 4RLGA 2CJDA 2W7EA 2VI9A 3PD6B 1GBNA 4K2MA 1O61A 2FM1A 3LG0A 3GWPA 2D64A 2YCTA 3E2ZA 5EUDA 4DBCA 1AMQA 3COGA 3I16A 4M2KA 4M2MA 4ADDA 3ASAA 4IW7A 3DRDA 4RJYA 1E5FA 2PO3A 3ZRQA 2X5FA 3NX3A 2R0TA 4OBUA 5DX5A 5EUNA 1ELUA 2VMOA 4MQPA 3RUYA 3DXWA 2VMYA 4F5LA 5BJ3A 1FC4A 3AEMC 2VGWA 1JG8A 3F9TA 4ITXA 5EFSA 5F8VA 4BA5A 3VP6A 2CH1A 4Q6RA 3WKSA 2C81A 3DC1A 4LNLA 3EIAA 5DB5A 1BQAA 1M4NA 2EGYA 2Z67A 2W7DA 3JTXA 1AAMA 3W1JA 1V2FA 2Z20A 2ZYJA 2RFVA 4WP0A 1DKAA 2D61A 2AY4A 4UHMA 4XJPA 1KKJA 3Q8NA 1TASA 1YIYA 3PAAA 1WYVB 1G4VA 2EO5A 3EI7A 1QITA 5HDMA 3WCOA 3E2FA 3AENA 2VLFA 1IBJA 1AJRA 2WK7A 1N31A 1BJOA 4AH3A 4ZM4A 1AHGA 3ZRPA 2BIAA 1GC3A 3N4RA 1BKGA 3WX9A 1MLZA 5G4JA 5BJ4A 2VGSA 3GZCA 4AZJA 4RITA 4XJOA 1EG5A 2DGLA 3AENB 2D7ZA 4W8IA 1ARGA 4N0BA 1AY8A 1PG8A 2AEVA 3GSBA 1IAYA 1VEFA 1DJUA 3EZSA 4ZDLA 1IX7A 1LC8A 1VJOA 2G6WA 1C0NA 3FTBA 1ECXA 1OXOA 3USFA 2W7HA 1QIRA 3VOMA 3HMUA 1IX6A 1KL1A 1S07A 4K2BA 2DKBA 1GC0A 5I92A 1AJSA 2JJHA 5FT5A 2XH1A 3PGYA 1X29A 3H14A 1N8PA 4ITGA 4OTLA 5EAVA 1YOOA 3G7QA 3QN6A 4WD2A 1CZEA 2VMSA 3E6GA 2QLRA 4JEZA 4XQ2A 4O6ZA 4MGRA 3AEJA 4WLJA 1YJYA 3JU7A 3HQTA 3B1CA 1AMAA 2A1VA 2DGMA 2AY2A 2EPJA 1AMSA 2DGKA 2ZY5A 2VGUA 3JWBA 3AEMA 2BYJA 1ASDA 3LVJA 5EQCA 1ARIA 3LVMA 4RJ0A 2CANA 4CXRA 1ASNA 4MSOA 1PMMA 2FYFA 1GC2A 2JJFA 3FFRA 3CQ4A 1QJ5A 1MDXA 3WLXA 1TPLA 3K40A 3AELA 4M2JA 1AHYA 2C7TA 3PPLA 4W1WA 4AO9A 3AEPA 4Q31A 1CJ0A 5G4IA 3NRAA 3G0TA 2R5CA 2D66A 4OT8A 5K8BA 1KKPA 4ZDPA 2CB1A 3EI5A 3CAIA 1D7VA 2TPLA 3NDNA 3BWNA 1D7RA 3FVSA 4LW4A 2EZ1A 1BJWA 1OHVA 2VMUA 1W3UA 2YHKA 1DFOA 4Y0IA 5E3KA 1AY4A 3N4SA 4LC3A 2FNUA 2WK8A 1KL2A 2CTZA 3ACZA 4Q76A 2FN6A 3KGXA 3ZZKA 1ASLA 4L0OA 4MY5A 3II0A 2BWPA 1WSTA 3FZ7A 3LV2A 4R5ZA 4A00A 2W7JA 3E2ZB 3FZ6A 2KFPA 4LW2A 1CQ7A 3FDBA 3KKIA 3VK2A 4EB7A 4A0RA 2O1BA 3FZ8A 2OGAA 4MKJA 3BN1A 4EU1A 3BCXA 4RKCA 1RV3A 4WYAA 1DGDA 2Q7WA 2YCNA 1TOEA 3LWSA 3E2YA 1EJIA 1J04A 1O62A 2VLHA 1QISA 4CBRA 5M49A 5M4BA 4FL0A 3RBLA 3K7YA 5TF5A 2QSRA 3NUIA 3AATA 3MKJA 1ZOBA 2ZC0A 1MDOA 3VAXA 1S09A 1T3IA 2W8JA 3ELPA 4HVKA 1LW5A 4GEBA 3BS8A 1V72A 4E3RA 2DOUA 2OKKA 3B1EA 1AKBA 4UQVA 4UHNA 1AAWA 2O0RA 2CSTA 4P3MA 3LY1A 2ZJGA 3RQ1A 4U2HA 5D95A 4WYGA 1SZSA 4A6UA 3N7NA 2YKUA 2W7IA 4JF1A 1W7NA 4RAEA 3F6TA 4F5KA 3GZDA 2VMRA 4GRXA 3KGWA 3WY7A 1B9IA 1Z7DA 2BI5A 1M6SA 3PJ0A 4QGRA 4Y0DA 3EIBA 5FT8A 5G09A 1OHWA 1Y4IA 2C0RA 1M0PA 1RVUA 4CBSA 4ZWMA 1OHYA 2BWNA 4WBTA 1AMRA 2QB2A 3BWNC 4J8LA 1W23A 3AOVA 1XEYA 2ORDA 1O69A 2JISA 1M32A 2D65A 2D63A 4EFFA 1WYTB 1IVRA 2HORA 3PDBA 4JEXA 4KAMA 4OBVA 4ZSWA 2Z9VA 2CJGA 2EZ2A 3FVUA 2QMAA 1MAQA 4E1OA 2BIEA 1AJSB 3A9ZA 4LNMA 4N0WA 1DJEA 4BHDA 1WKHA 1X2AA 2F8JA 3DODA 3N0LA 1EQBA 3UE8A 1S0AA 3A9XA 3PDBB 4PIWA 2XBNA 2O7CA 1ASCA 2YCPA 1AX4A 1SPAA 1C9CA 4A6RA 3NNKA 4KYOA 7AATA 1CQ6A 4TMRA 3H7FA 4XEWA 1D7UA 2X8UA 3EZ1A 3IF2A 1B4XA 3E9KA 2HP2A 1KMKA 2HOYA 1LKCA 4AZKA 1MAPA 4ADBA 1AHEA 3EI6A 3GJUA 3ASBA 2W7MA 1DJ9A 2Z1ZA 1YJSA 3NYUA 1O4SA 4MQRA 4R2NA 3A9YA 2W7FA 1IJIA 1LK9A 4GE9A 3WGBA 2BI1A 3DU4A 3MADA 4Q75A 2OATA 3FD0A 2CY8A 1G7XA 3FFHA 5F9SA 4W91A 2VMQA 3T32A 1V2EA 3TFTA 3N4XA 3EI9A 1C7OA 2DKJA 2X3LA 4DGTA 2BYLA 2VMWA 4WYCA 2C44A 1ARTA 1J32A 3QGUA 3F0HA 4WXBA 5LHAA 3HBXA 1ASFA 1UU1A 2VMZA 5C6UA 2D5YA 3PDXA 3L44A 2HOXA 3HT4A 1JF9A 2BKWA 1XI9A 3JWAA 3MC6C 2PB0A 4WYFA 1IX8A 1G7WA 2JG2A 2Z61A 3FCRA 4E77A 2W7KA 1D7SA 2JJEA 2W8UA 4XK1A 2W8VA 2CINA 2ZSMA 4ZWVA 3UAKA 4J5UA 3N5MA 2ZY2A 3QPGA 5E4ZA 4BA4A 1RVYA 4IXZA 1UU2A 2YOBA 1KAFA 4XJLA 3PA9A 4IX8A 4Y0HA 3TCMA 4EMYA 4CXQA 4F5FA 9AATA 1ELQA 4PVFA 4AO4A 2ZY3A 3MC6A 2BIGA 1AKCA 5J8QA 1M7YA 1V2DA 1DTYA 1ZC9A 3FQ7A 2BI2A 3QM2A 4PFNA 4WB0A 3ISLA 3L8AA 4F5MA 1BJ4A 1AICA 1B9HA 1ASAA 1YIZA 5E5IA 1AY5A 5DJ1A 2AY7A 3FDDA 3DR7A 3MEBA 3IHJA 1TARA 3I4JA 3N75A 4GE4A 3AV7A 3OKSA 2VMVA 3PIUA 1FG7A 2R2NA 3EI8A 4JF0A 5KTBA 1BT4A 3A8UX 3JW9A 3DXVA 3I5TA 1P3WA 1ASBA 3NYTA 3TFUA 3ZRRA 1ARHA 3ZZJA 2EYQA 2YKVA 3MAFA 3HVYA 1WYUA 2GSAA 3NYSA 1CZCA 5AX8A 3TQXA 3BV0A 3BC8A 3M5UA 3LVLB 3NUBA 4XJMA 1IAXA 1QGNA 3HL2A 1TOIA 3GR9A 2WB6A 3MAFB 5IWQA 1VP4A 5G0AA 4H63Q 1B5OA 2JJGA 3P6KA 1CL2A 1WYUB 5EUEA 3VK4A 2QA3A 2PB2A 2HUFA 2HOZA 3QI6A 4IYOB 1CL1A 4HF8A 2FKIA 4ZLVA 3HDOA 2CJHA 3H9XA 4JEWA 2E54A 4K2IA 4RKDA 4BMKA 2GMSA 2YKXA 1LW4A 3FKDA 1RV4A 4ATQA 1TOGA
chains in the Genus database with same CATH topology
1BJNA 3NU8A 1S06A 2VIBA 4FFCA 1GCKA 2ZSLA 4WYDA 1CS1A 1SZKA 2GMUA 4R5FA 3B8XA 3LVKA 4TN4A 2AATA 1JS6A 2AY6A 1YNUA 1WYTA 4WLHA 1JS3A 1I48A 2WK9A 2OKJA 4JEYA 3R9AA 4UOYA 3WKRA 2AY9A 4W1XA 3CQ5A 1X28A 4MKKA 2Z9WA 3B46A 1DGEA 4U1TA 4JE5A 3WZFA 3MAUA 1MLYA 1UU0A 2ZUKA 4GSAA 3PD6A 4JE5D 1YAAA 1GDEA 3P1TA 1AKAA 1BQDA 3CBFA 3GZDC 5FT4A 2R5EA 1MGVA 2VMXA 2W7LA 2W8TA 3EUCA 2G7JA 1I43A 1MDZA 2VMNA 2HZPA 3R4TA 5EAAA 1Z3ZA 4AOAA 4ATPA 4E3QA 4XAUA 2AY1A 3E77A 1SF2A 3KE3A 2VGVA 4CVQA 1AHXA 2W8WA 4H51A 3NU7A 4WXFA 1GEYA 5FT6A 2BHXA 4JEVA 4BQ0A 5DJ9A 4GE7A 4IXOA 4I8AA 4OCAA 1AIAA 1D2FA 2FNIA 2YRRA 4A0GA 1IUGA 4DQ6A 1OXPA 3FRKA 1H1CA 4ADCA 2HUIA 2BI9A 1GEXA 3FSLA 5G2PA 3DR4A 2V0YA 5LH9A 1UKJA 4ISYA 3OP7A 4W1VA 2AY3A 5JAYA 1WYVA 2VI8A 1YJZA 2CFBA 4ZSYA 1C7GA 1S08A 4NOGA 3WGCA 1LS3A 2VMTA 3BWOA 1N2TA 3B1DA 3ECDA 4WXGA 1C7NA 1BJOB 1M0NA 5D5SA 2GQNA 1KMJA 2D7YA 3GBXA 2GB3A 3JZLA 4B98A 4EB5A 2V1PA 3RCHB 1I29A 1SVVA 1BS0A 4WYEA 4F5GA 1X0MA 3AEJC 3VK3A 2VIAA 2E7IA 2AY8A 5M4DA 2QB3A 1TOKA 3FQ8A 4OC9A 4P7YA 3RI6A 2Z9UA 1GD9A 1GC4A 2E7UA 1AIBA 2BI3A 2VGZA 1G4XA 4WB0B 1SFFA 4ZASA 3DYDA 4R8DA 1QJ3A 3RCHA 3FQAA 4ZDOA 4K05A 1ASEA 1B8GA 4OYTA 3QHXA 4GDYA 5HHYA 4B9BA 1LC5A 3DZZA 4UHOA 3AOWA 5HXXA 1H0CA 1W7LA 3BCBA 3G8MA 4A0FA 1ASMA 1CQ8A 1ARSA 3CQ6A 4F5JA 3W1HA 1I41A 4F4EA 1QZ9A 3BB8A 2OQXA 4PFFA 2AEUA 1GEWA 2WKAA 3K28A 2HP1A 2VGTA 1PMOA 4OMAA 1FG3A 1AHFA 4ADEA 1B5PA 4MQQA 4F5HA 1PFFA 4ZM3A 4LNJA 4W5KA 2X5DA 4RIZA 3ATHA 2YKYA 3A2BA 2AY5A 1W7MA 1SZUA 2YRIA 3NTJA 4IXSA 4A72A 2CH2A 5G2QA 1ZODA 1LC7A 2JGTA 3ELEA 4TV7A 3UWCA 4RM1A 2ZP7A 4IYOA 1WKGA 4A6TA 1C4KA 5EIGA 1ASGA 8AATA 1BW0A 2Z1YA 3D6KA 3WCNA 1OATA 2BWOA 3W1IA 2OGEA 1M0OA 4F5IA 5M46A 2FQ6A 2NMPA 2E7JA 2R5CB 1ORDA 3RBFA 1M0QA 2Z9XA 2DR1A 4IY7A 4KXKA 1TOJA 2VMPA 1E5EA 2W7GA 3FVXA 5EIGB 2HUUA 2EH6A 4A0HA 2QBTA 1U08A 1TATA 3HLMA 2VYCA 4ZAHA 3BCAA 3MBBA 3AEOA 2ZY4A 3TATA 3GETA 3QBOA 4RLGA 2CJDA 2W7EA 2VI9A 3PD6B 1GBNA 4K2MA 1O61A 2FM1A 3LG0A 3GWPA 2D64A 2YCTA 3E2ZA 5EUDA 4DBCA 1AMQA 3COGA 3I16A 4M2KA 4M2MA 4ADDA 3ASAA 4IW7A 3DRDA 4RJYA 1E5FA 2PO3A 3ZRQA 2X5FA 3NX3A 2R0TA 4OBUA 5DX5A 5EUNA 1ELUA 2VMOA 4MQPA 3RUYA 3DXWA 2VMYA 4F5LA 5BJ3A 1FC4A 3AEMC 2VGWA 1JG8A 3F9TA 4ITXA 5EFSA 5F8VA 4BA5A 3VP6A 2CH1A 4Q6RA 3WKSA 2C81A 3DC1A 4LNLA 3EIAA 5DB5A 1BQAA 1M4NA 2EGYA 2Z67A 2W7DA 3JTXA 1AAMA 3W1JA 1V2FA 2Z20A 2ZYJA 2RFVA 4WP0A 1DKAA 2D61A 2AY4A 4UHMA 4XJPA 1KKJA 3Q8NA 1TASA 1YIYA 3PAAA 1WYVB 1G4VA 2EO5A 3EI7A 1QITA 5HDMA 3WCOA 3E2FA 3AENA 2VLFA 1IBJA 1AJRA 2WK7A 1N31A 1BJOA 4AH3A 4ZM4A 1AHGA 3ZRPA 2BIAA 1GC3A 3N4RA 1BKGA 3WX9A 1MLZA 5G4JA 5BJ4A 2VGSA 3GZCA 4AZJA 4RITA 4XJOA 1EG5A 2DGLA 3AENB 2D7ZA 4W8IA 1ARGA 4N0BA 1AY8A 1PG8A 2AEVA 3GSBA 1IAYA 1VEFA 1DJUA 3EZSA 4ZDLA 1IX7A 1LC8A 1VJOA 2G6WA 1C0NA 3FTBA 1ECXA 1OXOA 3USFA 2W7HA 1QIRA 3VOMA 3HMUA 1IX6A 1KL1A 1S07A 4K2BA 2DKBA 1GC0A 5I92A 1AJSA 2JJHA 5FT5A 2XH1A 3PGYA 1X29A 3H14A 1N8PA 4ITGA 4OTLA 5EAVA 1YOOA 3G7QA 3QN6A 4WD2A 1CZEA 2VMSA 3E6GA 2QLRA 4JEZA 4XQ2A 4O6ZA 4MGRA 3AEJA 4WLJA 1YJYA 3JU7A 3HQTA 3B1CA 1AMAA 2A1VA 2DGMA 2AY2A 2EPJA 1AMSA 2DGKA 2ZY5A 2VGUA 3JWBA 3AEMA 2BYJA 1ASDA 3LVJA 5EQCA 1ARIA 3LVMA 4RJ0A 2CANA 4CXRA 1ASNA 4MSOA 1PMMA 2FYFA 1GC2A 2JJFA 3FFRA 3CQ4A 1QJ5A 1MDXA 3WLXA 1TPLA 3K40A 3AELA 4M2JA 1AHYA 2C7TA 3PPLA 4W1WA 4AO9A 3AEPA 4Q31A 1CJ0A 5G4IA 3NRAA 3G0TA 2R5CA 2D66A 4OT8A 5K8BA 1KKPA 4ZDPA 2CB1A 3EI5A 3CAIA 1D7VA 2TPLA 3NDNA 3BWNA 1D7RA 3FVSA 4LW4A 2EZ1A 1BJWA 1OHVA 2VMUA 1W3UA 2YHKA 1DFOA 4Y0IA 5E3KA 1AY4A 3N4SA 4LC3A 2FNUA 2WK8A 1KL2A 2CTZA 3ACZA 4Q76A 2FN6A 3KGXA 3ZZKA 1ASLA 4L0OA 4MY5A 3II0A 2BWPA 1WSTA 3FZ7A 3LV2A 4R5ZA 4A00A 2W7JA 3E2ZB 3FZ6A 2KFPA 4LW2A 1CQ7A 3FDBA 3KKIA 3VK2A 4EB7A 4A0RA 2O1BA 3FZ8A 2OGAA 4MKJA 3BN1A 4EU1A 3BCXA 4RKCA 1RV3A 4WYAA 1DGDA 2Q7WA 2YCNA 1TOEA 3LWSA 3E2YA 1EJIA 1J04A 1O62A 2VLHA 1QISA 4CBRA 5M49A 5M4BA 4FL0A 3RBLA 3K7YA 5TF5A 2QSRA 3NUIA 3AATA 3MKJA 1ZOBA 2ZC0A 1MDOA 3VAXA 1S09A 1T3IA 2W8JA 3ELPA 4HVKA 1LW5A 4GEBA 3BS8A 1V72A 4E3RA 2DOUA 2OKKA 3B1EA 1AKBA 4UQVA 4UHNA 1AAWA 2O0RA 2CSTA 4P3MA 3LY1A 2ZJGA 3RQ1A 4U2HA 5D95A 4WYGA 1SZSA 4A6UA 3N7NA 2YKUA 2W7IA 4JF1A 1W7NA 4RAEA 3F6TA 4F5KA 3GZDA 2VMRA 4GRXA 3KGWA 3WY7A 1B9IA 1Z7DA 2BI5A 1M6SA 3PJ0A 4QGRA 4Y0DA 3EIBA 5FT8A 5G09A 1OHWA 1Y4IA 2C0RA 1M0PA 1RVUA 4CBSA 4ZWMA 1OHYA 2BWNA 4WBTA 1AMRA 2QB2A 3BWNC 4J8LA 1W23A 3AOVA 1XEYA 2ORDA 1O69A 2JISA 1M32A 2D65A 2D63A 4EFFA 1WYTB 1IVRA 2HORA 3PDBA 4JEXA 4KAMA 4OBVA 4ZSWA 2Z9VA 2CJGA 2EZ2A 3FVUA 2QMAA 1MAQA 4E1OA 2BIEA 1AJSB 3A9ZA 4LNMA 4N0WA 1DJEA 4BHDA 1WKHA 1X2AA 2F8JA 3DODA 3N0LA 1EQBA 3UE8A 1S0AA 3A9XA 3PDBB 4PIWA 2XBNA 2O7CA 1ASCA 2YCPA 1AX4A 1SPAA 1C9CA 4A6RA 3NNKA 4KYOA 7AATA 1CQ6A 4TMRA 3H7FA 4XEWA 1D7UA 2X8UA 3EZ1A 3IF2A 1B4XA 3E9KA 2HP2A 1KMKA 2HOYA 1LKCA 4AZKA 1MAPA 4ADBA 1AHEA 3EI6A 3GJUA 3ASBA 2W7MA 1DJ9A 2Z1ZA 1YJSA 3NYUA 1O4SA 4MQRA 4R2NA 3A9YA 2W7FA 1IJIA 1LK9A 4GE9A 3WGBA 2BI1A 3DU4A 3MADA 4Q75A 2OATA 3FD0A 2CY8A 1G7XA 3FFHA 5F9SA 4W91A 2VMQA 3T32A 1V2EA 3TFTA 3N4XA 3EI9A 1C7OA 2DKJA 2X3LA 4DGTA 2BYLA 2VMWA 4WYCA 2C44A 1ARTA 1J32A 3QGUA 3F0HA 4WXBA 5LHAA 3HBXA 1ASFA 1UU1A 2VMZA 5C6UA 2D5YA 3PDXA 3L44A 2HOXA 3HT4A 1JF9A 2BKWA 1XI9A 3JWAA 3MC6C 2PB0A 4WYFA 1IX8A 1G7WA 2JG2A 2Z61A 3FCRA 4E77A 2W7KA 1D7SA 2JJEA 2W8UA 4XK1A 2W8VA 2CINA 2ZSMA 4ZWVA 3UAKA 4J5UA 3N5MA 2ZY2A 3QPGA 5E4ZA 4BA4A 1RVYA 4IXZA 1UU2A 2YOBA 4XJLA 3PA9A 4IX8A 4Y0HA 3TCMA 4EMYA 4CXQA 4F5FA 9AATA 1ELQA 4PVFA 4AO4A 2ZY3A 3MC6A 2BIGA 1AKCA 5J8QA 1M7YA 1V2DA 1DTYA 1ZC9A 3FQ7A 2BI2A 3QM2A 4PFNA 4WB0A 3ISLA 3L8AA 4F5MA 1BJ4A 1AICA 1B9HA 1ASAA 1YIZA 5E5IA 1AY5A 5DJ1A 2AY7A 3FDDA 3DR7A 3MEBA 3IHJA 1TARA 3I4JA 3N75A 4GE4A 3AV7A 3OKSA 2VMVA 3PIUA 1FG7A 2R2NA 3EI8A 4JF0A 5KTBA 1BT4A 3A8UX 3JW9A 3DXVA 3I5TA 1P3WA 1ASBA 3NYTA 3TFUA 3ZRRA 1ARHA 3ZZJA 2EYQA 2YKVA 3MAFA 3HVYA 1WYUA 2GSAA 3NYSA 1CZCA 5AX8A 3TQXA 3BV0A 3BC8A 3M5UA 3LVLB 3NUBA 4XJMA 1IAXA 1QGNA 3HL2A 1TOIA 3GR9A 2WB6A 3MAFB 5IWQA 1VP4A 5G0AA 4H63Q 1B5OA 2JJGA 3P6KA 1CL2A 1WYUB 5EUEA 3VK4A 2QA3A 2PB2A 2HUFA 2HOZA 3QI6A 4IYOB 1CL1A 4HF8A 2FKIA 4ZLVA 3HDOA 2CJHA 3H9XA 4JEWA 2E54A 4K2IA 4RKDA 4BMKA 2GMSA 2YKXA 1LW4A 3FKDA 1RV4A 4ATQA 1TOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJN A;  3NU8 A;  1S06 A;  2VIB A;  4FFC A;  1GCK A;  2ZSL A;  4WYD A;  1CS1 A;  1SZK A;  2GMU A;  4R5F A;  3B8X A;  3LVK A;  4TN4 A;  2AAT A;  1JS6 A;  2AY6 A;  1YNU A;  1WYT A;  4WLH A;  1JS3 A;  1I48 A;  2WK9 A;  2OKJ A;  4JEY A;  3R9A A;  4UOY A;  3WKR A;  2AY9 A;  4W1X A;  3CQ5 A;  1X28 A;  4MKK A;  2Z9W A;  3B46 A;  1DGE A;  4U1T A;  4JE5 A;  3WZF A;  3MAU A;  1MLY A;  1UU0 A;  2ZUK A;  4GSA A;  3PD6 A;  4JE5 D;  1YAA A;  1GDE A;  3P1T A;  1AKA A;  1BQD A;  3CBF A;  3GZD C;  5FT4 A;  2R5E A;  1MGV A;  2VMX A;  2W7L A;  2W8T A;  3EUC A;  1I43 A;  1MDZ A;  2VMN A;  2HZP A;  3R4T A;  5EAA A;  1Z3Z A;  4AOA A;  4ATP A;  4E3Q A;  4XAU A;  2AY1 A;  3E77 A;  1SF2 A;  3KE3 A;  2VGV A;  4CVQ A;  1AHX A;  2W8W A;  4H51 A;  3NU7 A;  4WXF A;  1GEY A;  5FT6 A;  2BHX A;  4JEV A;  4BQ0 A;  5DJ9 A;  4GE7 A;  4IXO A;  4I8A A;  4OCA A;  1AIA A;  1D2F A;  2FNI A;  2YRR A;  4A0G A;  1IUG A;  4DQ6 A;  1OXP A;  3FRK A;  1H1C A;  4ADC A;  2HUI A;  2BI9 A;  1GEX A;  3FSL A;  5G2P A;  3DR4 A;  2V0Y A;  5LH9 A;  1UKJ A;  4ISY A;  3OP7 A;  4W1V A;  2AY3 A;  5JAY A;  1WYV A;  2VI8 A;  1YJZ A;  2CFB A;  4ZSY A;  1C7G A;  1S08 A;  4NOG A;  3WGC A;  1LS3 A;  2VMT A;  3BWO A;  1N2T A;  3B1D A;  3ECD A;  4WXG A;  1C7N A;  1BJO B;  1M0N A;  5D5S A;  2GQN A;  1KMJ A;  2D7Y A;  3GBX A;  2GB3 A;  3JZL A;  4B98 A;  4EB5 A;  2V1P A;  3RCH B;  1I29 A;  1SVV A;  1BS0 A;  4WYE A;  4F5G A;  1X0M A;  3AEJ C;  3VK3 A;  2VIA A;  2E7I A;  2AY8 A;  5M4D A;  2QB3 A;  1TOK A;  3FQ8 A;  4OC9 A;  4P7Y A;  3RI6 A;  2Z9U A;  1GD9 A;  1GC4 A;  2E7U A;  1AIB A;  2BI3 A;  2VGZ A;  1G4X A;  4WB0 B;  1SFF A;  4ZAS A;  3DYD A;  4R8D A;  1QJ3 A;  3RCH A;  3FQA A;  4ZDO A;  1ASE A;  1B8G A;  4OYT A;  3QHX A;  4GDY A;  5HHY A;  4B9B A;  1LC5 A;  3DZZ A;  4UHO A;  3AOW A;  5HXX A;  1H0C A;  1W7L A;  3BCB A;  3G8M A;  4A0F A;  1ASM A;  1CQ8 A;  1ARS A;  3CQ6 A;  4F5J A;  3W1H A;  1I41 A;  4F4E A;  1QZ9 A;  3BB8 A;  2OQX A;  4PFF A;  2AEU A;  1GEW A;  2WKA A;  3K28 A;  2HP1 A;  2VGT A;  1PMO A;  4OMA A;  1FG3 A;  1AHF A;  4ADE A;  1B5P A;  4MQQ A;  4F5H A;  1PFF A;  4ZM3 A;  4LNJ A;  4W5K A;  2X5D A;  4RIZ A;  3ATH A;  2YKY A;  3A2B A;  2AY5 A;  1W7M A;  1SZU A;  2YRI A;  3NTJ A;  4IXS A;  4A72 A;  2CH2 A;  5G2Q A;  1ZOD A;  1LC7 A;  2JGT A;  3ELE A;  4TV7 A;  3UWC A;  4RM1 A;  2ZP7 A;  4IYO A;  1WKG A;  4A6T A;  1C4K A;  5EIG A;  1ASG A;  8AAT A;  1BW0 A;  2Z1Y A;  3D6K A;  3WCN A;  1OAT A;  2BWO A;  3W1I A;  2OGE A;  1M0O A;  4F5I A;  5M46 A;  2FQ6 A;  2NMP A;  2E7J A;  2R5C B;  1ORD A;  3RBF A;  1M0Q A;  2Z9X A;  2DR1 A;  4IY7 A;  4KXK A;  1TOJ A;  2VMP A;  1E5E A;  2W7G A;  3FVX A;  5EIG B;  2HUU A;  2EH6 A;  4A0H A;  2QBT A;  1U08 A;  1TAT A;  3HLM A;  2VYC A;  4ZAH A;  3BCA A;  3MBB A;  3AEO A;  2ZY4 A;  3TAT A;  3GET A;  3QBO A;  4RLG A;  2CJD A;  2W7E A;  2VI9 A;  3PD6 B;  1GBN A;  4K2M A;  1O61 A;  2FM1 A;  3LG0 A;  3GWP A;  2D64 A;  2YCT A;  3E2Z A;  5EUD A;  4DBC A;  1AMQ A;  3COG A;  3I16 A;  4M2K A;  4M2M A;  4ADD A;  3ASA A;  4IW7 A;  3DRD A;  4RJY A;  1E5F A;  2PO3 A;  3ZRQ A;  2X5F A;  3NX3 A;  2R0T A;  4OBU A;  5DX5 A;  5EUN A;  1ELU A;  2VMO A;  4MQP A;  3RUY A;  3DXW A;  2VMY A;  4F5L A;  5BJ3 A;  1FC4 A;  3AEM C;  2VGW A;  1JG8 A;  3F9T A;  4ITX A;  5EFS A;  5F8V A;  4BA5 A;  3VP6 A;  2CH1 A;  4Q6R A;  3WKS A;  2C81 A;  3DC1 A;  4LNL A;  3EIA A;  5DB5 A;  1BQA A;  1M4N A;  2EGY A;  2Z67 A;  2W7D A;  3JTX A;  1AAM A;  3W1J A;  1V2F A;  2Z20 A;  2ZYJ A;  2RFV A;  4WP0 A;  1DKA A;  2D61 A;  2AY4 A;  4UHM A;  4XJP A;  1KKJ A;  3Q8N A;  1TAS A;  1YIY A;  3PAA A;  1WYV B;  1G4V A;  2EO5 A;  3EI7 A;  1QIT A;  5HDM A;  3WCO A;  3E2F A;  3AEN A;  2VLF A;  1IBJ A;  1AJR A;  2WK7 A;  1N31 A;  1BJO A;  4AH3 A;  4ZM4 A;  1AHG A;  3ZRP A;  2BIA A;  1GC3 A;  1BKG A;  3WX9 A;  1MLZ A;  5G4J A;  5BJ4 A;  2VGS A;  3GZC A;  4AZJ A;  4RIT A;  4XJO A;  1EG5 A;  2DGL A;  3AEN B;  2D7Z A;  4W8I A;  1ARG A;  4N0B A;  1AY8 A;  1PG8 A;  2AEV A;  3GSB A;  1IAY A;  1VEF A;  1DJU A;  3EZS A;  4ZDL A;  1IX7 A;  1LC8 A;  1VJO A;  2G6W A;  1C0N A;  3FTB A;  1ECX A;  1OXO A;  3USF A;  2W7H A;  1QIR A;  3VOM A;  3HMU A;  1IX6 A;  1KL1 A;  1S07 A;  4K2B A;  2DKB A;  1GC0 A;  5I92 A;  1AJS A;  2JJH A;  5FT5 A;  2XH1 A;  3PGY A;  1X29 A;  3H14 A;  1N8P A;  4ITG A;  4OTL A;  5EAV A;  1YOO A;  3G7Q A;  3QN6 A;  4WD2 A;  1CZE A;  2VMS A;  3E6G A;  2QLR A;  4JEZ A;  4XQ2 A;  4O6Z A;  4MGR A;  3AEJ A;  4WLJ A;  1YJY A;  3JU7 A;  3HQT A;  3B1C A;  1AMA A;  2DGM A;  2AY2 A;  2EPJ A;  1AMS A;  2DGK A;  2ZY5 A;  2VGU A;  3JWB A;  3AEM A;  2BYJ A;  1ASD A;  3LVJ A;  5EQC A;  1ARI A;  3LVM A;  4RJ0 A;  2CAN A;  4CXR A;  1ASN A;  4MSO A;  1PMM A;  2FYF A;  1GC2 A;  2JJF A;  3FFR A;  3CQ4 A;  1QJ5 A;  1MDX A;  3WLX A;  1TPL A;  3K40 A;  3AEL A;  4M2J A;  1AHY A;  2C7T A;  3PPL A;  4W1W A;  4AO9 A;  3AEP A;  4Q31 A;  1CJ0 A;  5G4I A;  3NRA A;  3G0T A;  2R5C A;  2D66 A;  4OT8 A;  5K8B A;  1KKP A;  4ZDP A;  2CB1 A;  3EI5 A;  3CAI A;  1D7V A;  2TPL A;  3NDN A;  3BWN A;  1D7R A;  3FVS A;  4LW4 A;  2EZ1 A;  1BJW A;  1OHV A;  2VMU A;  1W3U A;  2YHK A;  1DFO A;  4Y0I A;  5E3K A;  1AY4 A;  4LC3 A;  2FNU A;  2WK8 A;  1KL2 A;  2CTZ A;  3ACZ A;  4Q76 A;  2FN6 A;  3KGX A;  3ZZK A;  1ASL A;  4L0O A;  4MY5 A;  3II0 A;  2BWP A;  1WST A;  3FZ7 A;  3LV2 A;  4R5Z A;  4A00 A;  2W7J A;  3E2Z B;  3FZ6 A;  4LW2 A;  1CQ7 A;  3FDB A;  3KKI A;  3VK2 A;  4EB7 A;  4A0R A;  2O1B A;  3FZ8 A;  2OGA A;  4MKJ A;  3BN1 A;  4EU1 A;  3BCX A;  4RKC A;  1RV3 A;  4WYA A;  1DGD A;  2Q7W A;  2YCN A;  1TOE A;  3LWS A;  3E2Y A;  1EJI A;  1J04 A;  1O62 A;  2VLH A;  1QIS A;  4CBR A;  5M49 A;  5M4B A;  4FL0 A;  3RBL A;  3K7Y A;  5TF5 A;  3NUI A;  3AAT A;  3MKJ A;  1ZOB A;  2ZC0 A;  1MDO A;  3VAX A;  1S09 A;  1T3I A;  2W8J A;  3ELP A;  4HVK A;  1LW5 A;  4GEB A;  3BS8 A;  1V72 A;  4E3R A;  2DOU A;  2OKK A;  3B1E A;  1AKB A;  4UQV A;  4UHN A;  1AAW A;  2O0R A;  2CST A;  4P3M A;  3LY1 A;  2ZJG A;  3RQ1 A;  4U2H A;  5D95 A;  4WYG A;  1SZS A;  4A6U A;  2YKU A;  2W7I A;  4JF1 A;  1W7N A;  4RAE A;  3F6T A;  4F5K A;  3GZD A;  2VMR A;  4GRX A;  3KGW A;  3WY7 A;  1B9I A;  1Z7D A;  2BI5 A;  1M6S A;  3PJ0 A;  4QGR A;  4Y0D A;  3EIB A;  5FT8 A;  5G09 A;  1OHW A;  1Y4I A;  2C0R A;  1M0P A;  1RVU A;  4CBS A;  4ZWM A;  1OHY A;  2BWN A;  4WBT A;  1AMR A;  2QB2 A;  3BWN C;  4J8L A;  1W23 A;  3AOV A;  1XEY A;  2ORD A;  1O69 A;  2JIS A;  1M32 A;  2D65 A;  2D63 A;  4EFF A;  1WYT B;  1IVR A;  2HOR A;  3PDB A;  4JEX A;  4KAM A;  4OBV A;  4ZSW A;  2Z9V A;  2CJG A;  2EZ2 A;  3FVU A;  2QMA A;  1MAQ A;  4E1O A;  2BIE A;  1AJS B;  3A9Z A;  4LNM A;  4N0W A;  1DJE A;  4BHD A;  1WKH A;  1X2A A;  2F8J A;  3DOD A;  3N0L A;  1EQB A;  3UE8 A;  1S0A A;  3A9X A;  3PDB B;  4PIW A;  2XBN A;  2O7C A;  1ASC A;  2YCP A;  1AX4 A;  1SPA A;  1C9C A;  4A6R A;  3NNK A;  4KYO A;  7AAT A;  1CQ6 A;  4TMR A;  3H7F A;  4XEW A;  1D7U A;  2X8U A;  3EZ1 A;  3IF2 A;  1B4X A;  3E9K A;  2HP2 A;  1KMK A;  2HOY A;  1LKC A;  4AZK A;  1MAP A;  4ADB A;  1AHE A;  3EI6 A;  3GJU A;  3ASB A;  2W7M A;  1DJ9 A;  2Z1Z A;  1YJS A;  3NYU A;  1O4S A;  4MQR A;  4R2N A;  3A9Y A;  2W7F A;  1IJI A;  1LK9 A;  4GE9 A;  3WGB A;  2BI1 A;  3DU4 A;  3MAD A;  4Q75 A;  2OAT A;  3FD0 A;  2CY8 A;  1G7X A;  3FFH A;  5F9S A;  4W91 A;  2VMQ A;  3T32 A;  1V2E A;  3TFT A;  3EI9 A;  1C7O A;  2DKJ A;  2X3L A;  4DGT A;  2BYL A;  2VMW A;  4WYC A;  2C44 A;  1ART A;  1J32 A;  3QGU A;  3F0H A;  4WXB A;  5LHA A;  3HBX A;  1ASF A;  1UU1 A;  2VMZ A;  5C6U A;  2D5Y A;  3PDX A;  3L44 A;  2HOX A;  3HT4 A;  1JF9 A;  2BKW A;  1XI9 A;  3JWA A;  3MC6 C;  2PB0 A;  4WYF A;  1IX8 A;  1G7W A;  2JG2 A;  2Z61 A;  3FCR A;  4E77 A;  2W7K A;  1D7S A;  2JJE A;  2W8U A;  4XK1 A;  2W8V A;  2CIN A;  2ZSM A;  4ZWV A;  3UAK A;  4J5U A;  3N5M A;  2ZY2 A;  3QPG A;  5E4Z A;  4BA4 A;  1RVY A;  4IXZ A;  1UU2 A;  2YOB A;  4XJL A;  3PA9 A;  4IX8 A;  4Y0H A;  3TCM A;  4EMY A;  4CXQ A;  4F5F A;  9AAT A;  1ELQ A;  4PVF A;  4AO4 A;  2ZY3 A;  3MC6 A;  2BIG A;  1AKC A;  5J8Q A;  1M7Y A;  1V2D A;  1DTY A;  1ZC9 A;  3FQ7 A;  2BI2 A;  3QM2 A;  4PFN A;  4WB0 A;  3ISL A;  3L8A A;  4F5M A;  1BJ4 A;  1AIC A;  1B9H A;  1ASA A;  1YIZ A;  5E5I A;  1AY5 A;  5DJ1 A;  2AY7 A;  3FDD A;  3DR7 A;  3MEB A;  3IHJ A;  1TAR A;  3I4J A;  3N75 A;  4GE4 A;  3AV7 A;  3OKS A;  2VMV A;  3PIU A;  1FG7 A;  2R2N A;  3EI8 A;  4JF0 A;  1BT4 A;  3A8U X;  3JW9 A;  3DXV A;  3I5T A;  1P3W A;  1ASB A;  3NYT A;  3TFU A;  3ZRR A;  1ARH A;  3ZZJ A;  2YKV A;  3MAF A;  3HVY A;  1WYU A;  2GSA A;  3NYS A;  1CZC A;  5AX8 A;  3TQX A;  3BV0 A;  3BC8 A;  3M5U A;  3LVL B;  3NUB A;  4XJM A;  1IAX A;  1QGN A;  3HL2 A;  1TOI A;  3GR9 A;  3MAF B;  5IWQ A;  1VP4 A;  5G0A A;  1B5O A;  2JJG A;  3P6K A;  1CL2 A;  1WYU B;  5EUE A;  3VK4 A;  2QA3 A;  2PB2 A;  2HUF A;  2HOZ A;  3QI6 A;  4IYO B;  1CL1 A;  4HF8 A;  4ZLV A;  3HDO A;  2CJH A;  4JEW A;  2E54 A;  4K2I A;  4RKD A;  4BMK A;  2GMS A;  2YKX A;  1LW4 A;  3FKD A;  1RV4 A;  4ATQ A;  1TOG A; 
#chains in the Genus database with same CATH topology
 1BJN A;  3NU8 A;  1S06 A;  2VIB A;  4FFC A;  1GCK A;  2ZSL A;  4WYD A;  1CS1 A;  1SZK A;  2GMU A;  4R5F A;  3B8X A;  3LVK A;  4TN4 A;  2AAT A;  1JS6 A;  2AY6 A;  1YNU A;  1WYT A;  4WLH A;  1JS3 A;  1I48 A;  2WK9 A;  2OKJ A;  4JEY A;  3R9A A;  4UOY A;  3WKR A;  2AY9 A;  4W1X A;  3CQ5 A;  1X28 A;  4MKK A;  2Z9W A;  3B46 A;  1DGE A;  4U1T A;  4JE5 A;  3WZF A;  3MAU A;  1MLY A;  1UU0 A;  2ZUK A;  4GSA A;  3PD6 A;  4JE5 D;  1YAA A;  1GDE A;  3P1T A;  1AKA A;  1BQD A;  3CBF A;  3GZD C;  5FT4 A;  2R5E A;  1MGV A;  2VMX A;  2W7L A;  2W8T A;  3EUC A;  2G7J A;  1I43 A;  1MDZ A;  2VMN A;  2HZP A;  3R4T A;  5EAA A;  1Z3Z A;  4AOA A;  4ATP A;  4E3Q A;  4XAU A;  2AY1 A;  3E77 A;  1SF2 A;  3KE3 A;  2VGV A;  4CVQ A;  1AHX A;  2W8W A;  4H51 A;  3NU7 A;  4WXF A;  1GEY A;  5FT6 A;  2BHX A;  4JEV A;  4BQ0 A;  5DJ9 A;  4GE7 A;  4IXO A;  4I8A A;  4OCA A;  1AIA A;  1D2F A;  2FNI A;  2YRR A;  4A0G A;  1IUG A;  4DQ6 A;  1OXP A;  3FRK A;  1H1C A;  4ADC A;  2HUI A;  2BI9 A;  1GEX A;  3FSL A;  5G2P A;  3DR4 A;  2V0Y A;  5LH9 A;  1UKJ A;  4ISY A;  3OP7 A;  4W1V A;  2AY3 A;  5JAY A;  1WYV A;  2VI8 A;  1YJZ A;  2CFB A;  4ZSY A;  1C7G A;  1S08 A;  4NOG A;  3WGC A;  1LS3 A;  2VMT A;  3BWO A;  1N2T A;  3B1D A;  3ECD A;  4WXG A;  1C7N A;  1BJO B;  1M0N A;  5D5S A;  2GQN A;  1KMJ A;  2D7Y A;  3GBX A;  2GB3 A;  3JZL A;  4B98 A;  4EB5 A;  2V1P A;  3RCH B;  1I29 A;  1SVV A;  1BS0 A;  4WYE A;  4F5G A;  1X0M A;  3AEJ C;  3VK3 A;  2VIA A;  2E7I A;  2AY8 A;  5M4D A;  2QB3 A;  1TOK A;  3FQ8 A;  4OC9 A;  4P7Y A;  3RI6 A;  2Z9U A;  1GD9 A;  1GC4 A;  2E7U A;  1AIB A;  2BI3 A;  2VGZ A;  1G4X A;  4WB0 B;  1SFF A;  4ZAS A;  3DYD A;  4R8D A;  1QJ3 A;  3RCH A;  3FQA A;  4ZDO A;  4K05 A;  1ASE A;  1B8G A;  4OYT A;  3QHX A;  4GDY A;  5HHY A;  4B9B A;  1LC5 A;  3DZZ A;  4UHO A;  3AOW A;  5HXX A;  1H0C A;  1W7L A;  3BCB A;  3G8M A;  4A0F A;  1ASM A;  1CQ8 A;  1ARS A;  3CQ6 A;  4F5J A;  3W1H A;  1I41 A;  4F4E A;  1QZ9 A;  3BB8 A;  2OQX A;  4PFF A;  2AEU A;  1GEW A;  2WKA A;  3K28 A;  2HP1 A;  2VGT A;  1PMO A;  4OMA A;  1FG3 A;  1AHF A;  4ADE A;  1B5P A;  4MQQ A;  4F5H A;  1PFF A;  4ZM3 A;  4LNJ A;  4W5K A;  2X5D A;  4RIZ A;  3ATH A;  2YKY A;  3A2B A;  2AY5 A;  1W7M A;  1SZU A;  2YRI A;  3NTJ A;  4IXS A;  4A72 A;  2CH2 A;  5G2Q A;  1ZOD A;  1LC7 A;  2JGT A;  3ELE A;  4TV7 A;  3UWC A;  4RM1 A;  2ZP7 A;  4IYO A;  1WKG A;  4A6T A;  1C4K A;  5EIG A;  1ASG A;  8AAT A;  1BW0 A;  2Z1Y A;  3D6K A;  3WCN A;  1OAT A;  2BWO A;  3W1I A;  2OGE A;  1M0O A;  4F5I A;  5M46 A;  2FQ6 A;  2NMP A;  2E7J A;  2R5C B;  1ORD A;  3RBF A;  1M0Q A;  2Z9X A;  2DR1 A;  4IY7 A;  4KXK A;  1TOJ A;  2VMP A;  1E5E A;  2W7G A;  3FVX A;  5EIG B;  2HUU A;  2EH6 A;  4A0H A;  2QBT A;  1U08 A;  1TAT A;  3HLM A;  2VYC A;  4ZAH A;  3BCA A;  3MBB A;  3AEO A;  2ZY4 A;  3TAT A;  3GET A;  3QBO A;  4RLG A;  2CJD A;  2W7E A;  2VI9 A;  3PD6 B;  1GBN A;  4K2M A;  1O61 A;  2FM1 A;  3LG0 A;  3GWP A;  2D64 A;  2YCT A;  3E2Z A;  5EUD A;  4DBC A;  1AMQ A;  3COG A;  3I16 A;  4M2K A;  4M2M A;  4ADD A;  3ASA A;  4IW7 A;  3DRD A;  4RJY A;  1E5F A;  2PO3 A;  3ZRQ A;  2X5F A;  3NX3 A;  2R0T A;  4OBU A;  5DX5 A;  5EUN A;  1ELU A;  2VMO A;  4MQP A;  3RUY A;  3DXW A;  2VMY A;  4F5L A;  5BJ3 A;  1FC4 A;  3AEM C;  2VGW A;  1JG8 A;  3F9T A;  4ITX A;  5EFS A;  5F8V A;  4BA5 A;  3VP6 A;  2CH1 A;  4Q6R A;  3WKS A;  2C81 A;  3DC1 A;  4LNL A;  3EIA A;  5DB5 A;  1BQA A;  1M4N A;  2EGY A;  2Z67 A;  2W7D A;  3JTX A;  1AAM A;  3W1J A;  1V2F A;  2Z20 A;  2ZYJ A;  2RFV A;  4WP0 A;  1DKA A;  2D61 A;  2AY4 A;  4UHM A;  4XJP A;  1KKJ A;  3Q8N A;  1TAS A;  1YIY A;  3PAA A;  1WYV B;  1G4V A;  2EO5 A;  3EI7 A;  1QIT A;  5HDM A;  3WCO A;  3E2F A;  3AEN A;  2VLF A;  1IBJ A;  1AJR A;  2WK7 A;  1N31 A;  1BJO A;  4AH3 A;  4ZM4 A;  1AHG A;  3ZRP A;  2BIA A;  1GC3 A;  3N4R A;  1BKG A;  3WX9 A;  1MLZ A;  5G4J A;  5BJ4 A;  2VGS A;  3GZC A;  4AZJ A;  4RIT A;  4XJO A;  1EG5 A;  2DGL A;  3AEN B;  2D7Z A;  4W8I A;  1ARG A;  4N0B A;  1AY8 A;  1PG8 A;  2AEV A;  3GSB A;  1IAY A;  1VEF A;  1DJU A;  3EZS A;  4ZDL A;  1IX7 A;  1LC8 A;  1VJO A;  2G6W A;  1C0N A;  3FTB A;  1ECX A;  1OXO A;  3USF A;  2W7H A;  1QIR A;  3VOM A;  3HMU A;  1IX6 A;  1KL1 A;  1S07 A;  4K2B A;  2DKB A;  1GC0 A;  5I92 A;  1AJS A;  2JJH A;  5FT5 A;  2XH1 A;  3PGY A;  1X29 A;  3H14 A;  1N8P A;  4ITG A;  4OTL A;  5EAV A;  1YOO A;  3G7Q A;  3QN6 A;  4WD2 A;  1CZE A;  2VMS A;  3E6G A;  2QLR A;  4JEZ A;  4XQ2 A;  4O6Z A;  4MGR A;  3AEJ A;  4WLJ A;  1YJY A;  3JU7 A;  3HQT A;  3B1C A;  1AMA A;  2A1V A;  2DGM A;  2AY2 A;  2EPJ A;  1AMS A;  2DGK A;  2ZY5 A;  2VGU A;  3JWB A;  3AEM A;  2BYJ A;  1ASD A;  3LVJ A;  5EQC A;  1ARI A;  3LVM A;  4RJ0 A;  2CAN A;  4CXR A;  1ASN A;  4MSO A;  1PMM A;  2FYF A;  1GC2 A;  2JJF A;  3FFR A;  3CQ4 A;  1QJ5 A;  1MDX A;  3WLX A;  1TPL A;  3K40 A;  3AEL A;  4M2J A;  1AHY A;  2C7T A;  3PPL A;  4W1W A;  4AO9 A;  3AEP A;  4Q31 A;  1CJ0 A;  5G4I A;  3NRA A;  3G0T A;  2R5C A;  2D66 A;  4OT8 A;  5K8B A;  1KKP A;  4ZDP A;  2CB1 A;  3EI5 A;  3CAI A;  1D7V A;  2TPL A;  3NDN A;  3BWN A;  1D7R A;  3FVS A;  4LW4 A;  2EZ1 A;  1BJW A;  1OHV A;  2VMU A;  1W3U A;  2YHK A;  1DFO A;  4Y0I A;  5E3K A;  1AY4 A;  3N4S A;  4LC3 A;  2FNU A;  2WK8 A;  1KL2 A;  2CTZ A;  3ACZ A;  4Q76 A;  2FN6 A;  3KGX A;  3ZZK A;  1ASL A;  4L0O A;  4MY5 A;  3II0 A;  2BWP A;  1WST A;  3FZ7 A;  3LV2 A;  4R5Z A;  4A00 A;  2W7J A;  3E2Z B;  3FZ6 A;  2KFP A;  4LW2 A;  1CQ7 A;  3FDB A;  3KKI A;  3VK2 A;  4EB7 A;  4A0R A;  2O1B A;  3FZ8 A;  2OGA A;  4MKJ A;  3BN1 A;  4EU1 A;  3BCX A;  4RKC A;  1RV3 A;  4WYA A;  1DGD A;  2Q7W A;  2YCN A;  1TOE A;  3LWS A;  3E2Y A;  1EJI A;  1J04 A;  1O62 A;  2VLH A;  1QIS A;  4CBR A;  5M49 A;  5M4B A;  4FL0 A;  3RBL A;  3K7Y A;  5TF5 A;  2QSR A;  3NUI A;  3AAT A;  3MKJ A;  1ZOB A;  2ZC0 A;  1MDO A;  3VAX A;  1S09 A;  1T3I A;  2W8J A;  3ELP A;  4HVK A;  1LW5 A;  4GEB A;  3BS8 A;  1V72 A;  4E3R A;  2DOU A;  2OKK A;  3B1E A;  1AKB A;  4UQV A;  4UHN A;  1AAW A;  2O0R A;  2CST A;  4P3M A;  3LY1 A;  2ZJG A;  3RQ1 A;  4U2H A;  5D95 A;  4WYG A;  1SZS A;  4A6U A;  3N7N A;  2YKU A;  2W7I A;  4JF1 A;  1W7N A;  4RAE A;  3F6T A;  4F5K A;  3GZD A;  2VMR A;  4GRX A;  3KGW A;  3WY7 A;  1B9I A;  1Z7D A;  2BI5 A;  1M6S A;  3PJ0 A;  4QGR A;  4Y0D A;  3EIB A;  5FT8 A;  5G09 A;  1OHW A;  1Y4I A;  2C0R A;  1M0P A;  1RVU A;  4CBS A;  4ZWM A;  1OHY A;  2BWN A;  4WBT A;  1AMR A;  2QB2 A;  3BWN C;  4J8L A;  1W23 A;  3AOV A;  1XEY A;  2ORD A;  1O69 A;  2JIS A;  1M32 A;  2D65 A;  2D63 A;  4EFF A;  1WYT B;  1IVR A;  2HOR A;  3PDB A;  4JEX A;  4KAM A;  4OBV A;  4ZSW A;  2Z9V A;  2CJG A;  2EZ2 A;  3FVU A;  2QMA A;  1MAQ A;  4E1O A;  2BIE A;  1AJS B;  3A9Z A;  4LNM A;  4N0W A;  1DJE A;  4BHD A;  1WKH A;  1X2A A;  2F8J A;  3DOD A;  3N0L A;  1EQB A;  3UE8 A;  1S0A A;  3A9X A;  3PDB B;  4PIW A;  2XBN A;  2O7C A;  1ASC A;  2YCP A;  1AX4 A;  1SPA A;  1C9C A;  4A6R A;  3NNK A;  4KYO A;  7AAT A;  1CQ6 A;  4TMR A;  3H7F A;  4XEW A;  1D7U A;  2X8U A;  3EZ1 A;  3IF2 A;  1B4X A;  3E9K A;  2HP2 A;  1KMK A;  2HOY A;  1LKC A;  4AZK A;  1MAP A;  4ADB A;  1AHE A;  3EI6 A;  3GJU A;  3ASB A;  2W7M A;  1DJ9 A;  2Z1Z A;  1YJS A;  3NYU A;  1O4S A;  4MQR A;  4R2N A;  3A9Y A;  2W7F A;  1IJI A;  1LK9 A;  4GE9 A;  3WGB A;  2BI1 A;  3DU4 A;  3MAD A;  4Q75 A;  2OAT A;  3FD0 A;  2CY8 A;  1G7X A;  3FFH A;  5F9S A;  4W91 A;  2VMQ A;  3T32 A;  1V2E A;  3TFT A;  3N4X A;  3EI9 A;  1C7O A;  2DKJ A;  2X3L A;  4DGT A;  2BYL A;  2VMW A;  4WYC A;  2C44 A;  1ART A;  1J32 A;  3QGU A;  3F0H A;  4WXB A;  5LHA A;  3HBX A;  1ASF A;  1UU1 A;  2VMZ A;  5C6U A;  2D5Y A;  3PDX A;  3L44 A;  2HOX A;  3HT4 A;  1JF9 A;  2BKW A;  1XI9 A;  3JWA A;  3MC6 C;  2PB0 A;  4WYF A;  1IX8 A;  1G7W A;  2JG2 A;  2Z61 A;  3FCR A;  4E77 A;  2W7K A;  1D7S A;  2JJE A;  2W8U A;  4XK1 A;  2W8V A;  2CIN A;  2ZSM A;  4ZWV A;  3UAK A;  4J5U A;  3N5M A;  2ZY2 A;  3QPG A;  5E4Z A;  4BA4 A;  1RVY A;  4IXZ A;  1UU2 A;  2YOB A;  1KAF A;  4XJL A;  3PA9 A;  4IX8 A;  4Y0H A;  3TCM A;  4EMY A;  4CXQ A;  4F5F A;  9AAT A;  1ELQ A;  4PVF A;  4AO4 A;  2ZY3 A;  3MC6 A;  2BIG A;  1AKC A;  5J8Q A;  1M7Y A;  1V2D A;  1DTY A;  1ZC9 A;  3FQ7 A;  2BI2 A;  3QM2 A;  4PFN A;  4WB0 A;  3ISL A;  3L8A A;  4F5M A;  1BJ4 A;  1AIC A;  1B9H A;  1ASA A;  1YIZ A;  5E5I A;  1AY5 A;  5DJ1 A;  2AY7 A;  3FDD A;  3DR7 A;  3MEB A;  3IHJ A;  1TAR A;  3I4J A;  3N75 A;  4GE4 A;  3AV7 A;  3OKS A;  2VMV A;  3PIU A;  1FG7 A;  2R2N A;  3EI8 A;  4JF0 A;  5KTB A;  1BT4 A;  3A8U X;  3JW9 A;  3DXV A;  3I5T A;  1P3W A;  1ASB A;  3NYT A;  3TFU A;  3ZRR A;  1ARH A;  3ZZJ A;  2EYQ A;  2YKV A;  3MAF A;  3HVY A;  1WYU A;  2GSA A;  3NYS A;  1CZC A;  5AX8 A;  3TQX A;  3BV0 A;  3BC8 A;  3M5U A;  3LVL B;  3NUB A;  4XJM A;  1IAX A;  1QGN A;  3HL2 A;  1TOI A;  3GR9 A;  2WB6 A;  3MAF B;  5IWQ A;  1VP4 A;  5G0A A;  4H63 Q;  1B5O A;  2JJG A;  3P6K A;  1CL2 A;  1WYU B;  5EUE A;  3VK4 A;  2QA3 A;  2PB2 A;  2HUF A;  2HOZ A;  3QI6 A;  4IYO B;  1CL1 A;  4HF8 A;  2FKI A;  4ZLV A;  3HDO A;  2CJH A;  3H9X A;  4JEW A;  2E54 A;  4K2I A;  4RKD A;  4BMK A;  2GMS A;  2YKX A;  1LW4 A;  3FKD A;  1RV4 A;  4ATQ A;  1TOG A; 
#chains in the Genus database with same CATH homology
 1BJN A;  3NU8 A;  1S06 A;  2VIB A;  4FFC A;  1GCK A;  2ZSL A;  4WYD A;  1CS1 A;  1SZK A;  2GMU A;  4R5F A;  3B8X A;  3LVK A;  4TN4 A;  2AAT A;  1JS6 A;  2AY6 A;  1YNU A;  1WYT A;  4WLH A;  1JS3 A;  1I48 A;  2WK9 A;  2OKJ A;  4JEY A;  3R9A A;  4UOY A;  3WKR A;  2AY9 A;  4W1X A;  3CQ5 A;  1X28 A;  4MKK A;  2Z9W A;  3B46 A;  1DGE A;  4U1T A;  4JE5 A;  3WZF A;  3MAU A;  1MLY A;  1UU0 A;  2ZUK A;  4GSA A;  3PD6 A;  4JE5 D;  1YAA A;  1GDE A;  3P1T A;  1AKA A;  1BQD A;  3CBF A;  3GZD C;  5FT4 A;  2R5E A;  1MGV A;  2VMX A;  2W7L A;  2W8T A;  3EUC A;  2G7J A;  1I43 A;  1MDZ A;  2VMN A;  2HZP A;  3R4T A;  5EAA A;  1Z3Z A;  4AOA A;  4ATP A;  4E3Q A;  4XAU A;  2AY1 A;  3E77 A;  1SF2 A;  3KE3 A;  2VGV A;  4CVQ A;  1AHX A;  2W8W A;  4H51 A;  3NU7 A;  4WXF A;  1GEY A;  5FT6 A;  2BHX A;  4JEV A;  4BQ0 A;  5DJ9 A;  4GE7 A;  4IXO A;  4I8A A;  4OCA A;  1AIA A;  1D2F A;  2FNI A;  2YRR A;  4A0G A;  1IUG A;  4DQ6 A;  1OXP A;  3FRK A;  1H1C A;  4ADC A;  2HUI A;  2BI9 A;  1GEX A;  3FSL A;  5G2P A;  3DR4 A;  2V0Y A;  5LH9 A;  1UKJ A;  4ISY A;  3OP7 A;  4W1V A;  2AY3 A;  5JAY A;  1WYV A;  2VI8 A;  1YJZ A;  2CFB A;  4ZSY A;  1C7G A;  1S08 A;  4NOG A;  3WGC A;  1LS3 A;  2VMT A;  3BWO A;  1N2T A;  3B1D A;  3ECD A;  4WXG A;  1C7N A;  1BJO B;  1M0N A;  5D5S A;  2GQN A;  1KMJ A;  2D7Y A;  3GBX A;  2GB3 A;  3JZL A;  4B98 A;  4EB5 A;  2V1P A;  3RCH B;  1I29 A;  1SVV A;  1BS0 A;  4WYE A;  4F5G A;  1X0M A;  3AEJ C;  3VK3 A;  2VIA A;  2E7I A;  2AY8 A;  5M4D A;  2QB3 A;  1TOK A;  3FQ8 A;  4OC9 A;  4P7Y A;  3RI6 A;  2Z9U A;  1GD9 A;  1GC4 A;  2E7U A;  1AIB A;  2BI3 A;  2VGZ A;  1G4X A;  4WB0 B;  1SFF A;  4ZAS A;  3DYD A;  4R8D A;  1QJ3 A;  3RCH A;  3FQA A;  4ZDO A;  4K05 A;  1ASE A;  1B8G A;  4OYT A;  3QHX A;  4GDY A;  5HHY A;  4B9B A;  1LC5 A;  3DZZ A;  4UHO A;  3AOW A;  5HXX A;  1H0C A;  1W7L A;  3BCB A;  3G8M A;  4A0F A;  1ASM A;  1CQ8 A;  1ARS A;  3CQ6 A;  4F5J A;  3W1H A;  1I41 A;  4F4E A;  1QZ9 A;  3BB8 A;  2OQX A;  4PFF A;  2AEU A;  1GEW A;  2WKA A;  3K28 A;  2HP1 A;  2VGT A;  1PMO A;  4OMA A;  1FG3 A;  1AHF A;  4ADE A;  1B5P A;  4MQQ A;  4F5H A;  1PFF A;  4ZM3 A;  4LNJ A;  4W5K A;  2X5D A;  4RIZ A;  3ATH A;  2YKY A;  3A2B A;  2AY5 A;  1W7M A;  1SZU A;  2YRI A;  3NTJ A;  4IXS A;  4A72 A;  2CH2 A;  5G2Q A;  1ZOD A;  1LC7 A;  2JGT A;  3ELE A;  4TV7 A;  3UWC A;  4RM1 A;  2ZP7 A;  4IYO A;  1WKG A;  4A6T A;  1C4K A;  5EIG A;  1ASG A;  8AAT A;  1BW0 A;  2Z1Y A;  3D6K A;  3WCN A;  1OAT A;  2BWO A;  3W1I A;  2OGE A;  1M0O A;  4F5I A;  5M46 A;  2FQ6 A;  2NMP A;  2E7J A;  2R5C B;  1ORD A;  3RBF A;  1M0Q A;  2Z9X A;  2DR1 A;  4IY7 A;  4KXK A;  1TOJ A;  2VMP A;  1E5E A;  2W7G A;  3FVX A;  5EIG B;  2HUU A;  2EH6 A;  4A0H A;  2QBT A;  1U08 A;  1TAT A;  3HLM A;  2VYC A;  4ZAH A;  3BCA A;  3MBB A;  3AEO A;  2ZY4 A;  3TAT A;  3GET A;  3QBO A;  4RLG A;  2CJD A;  2W7E A;  2VI9 A;  3PD6 B;  1GBN A;  4K2M A;  1O61 A;  2FM1 A;  3LG0 A;  3GWP A;  2D64 A;  2YCT A;  3E2Z A;  5EUD A;  4DBC A;  1AMQ A;  3COG A;  3I16 A;  4M2K A;  4M2M A;  4ADD A;  3ASA A;  4IW7 A;  3DRD A;  4RJY A;  1E5F A;  2PO3 A;  3ZRQ A;  2X5F A;  3NX3 A;  2R0T A;  4OBU A;  5DX5 A;  5EUN A;  1ELU A;  2VMO A;  4MQP A;  3RUY A;  3DXW A;  2VMY A;  4F5L A;  5BJ3 A;  1FC4 A;  3AEM C;  2VGW A;  1JG8 A;  3F9T A;  4ITX A;  5EFS A;  5F8V A;  4BA5 A;  3VP6 A;  2CH1 A;  4Q6R A;  3WKS A;  2C81 A;  3DC1 A;  4LNL A;  3EIA A;  5DB5 A;  1BQA A;  1M4N A;  2EGY A;  2Z67 A;  2W7D A;  3JTX A;  1AAM A;  3W1J A;  1V2F A;  2Z20 A;  2ZYJ A;  2RFV A;  4WP0 A;  1DKA A;  2D61 A;  2AY4 A;  4UHM A;  4XJP A;  1KKJ A;  3Q8N A;  1TAS A;  1YIY A;  3PAA A;  1WYV B;  1G4V A;  2EO5 A;  3EI7 A;  1QIT A;  5HDM A;  3WCO A;  3E2F A;  3AEN A;  2VLF A;  1IBJ A;  1AJR A;  2WK7 A;  1N31 A;  1BJO A;  4AH3 A;  4ZM4 A;  1AHG A;  3ZRP A;  2BIA A;  1GC3 A;  3N4R A;  1BKG A;  3WX9 A;  1MLZ A;  5G4J A;  5BJ4 A;  2VGS A;  3GZC A;  4AZJ A;  4RIT A;  4XJO A;  1EG5 A;  2DGL A;  3AEN B;  2D7Z A;  4W8I A;  1ARG A;  4N0B A;  1AY8 A;  1PG8 A;  2AEV A;  3GSB A;  1IAY A;  1VEF A;  1DJU A;  3EZS A;  4ZDL A;  1IX7 A;  1LC8 A;  1VJO A;  2G6W A;  1C0N A;  3FTB A;  1ECX A;  1OXO A;  3USF A;  2W7H A;  1QIR A;  3VOM A;  3HMU A;  1IX6 A;  1KL1 A;  1S07 A;  4K2B A;  2DKB A;  1GC0 A;  5I92 A;  1AJS A;  2JJH A;  5FT5 A;  2XH1 A;  3PGY A;  1X29 A;  3H14 A;  1N8P A;  4ITG A;  4OTL A;  5EAV A;  1YOO A;  3G7Q A;  3QN6 A;  4WD2 A;  1CZE A;  2VMS A;  3E6G A;  2QLR A;  4JEZ A;  4XQ2 A;  4O6Z A;  4MGR A;  3AEJ A;  4WLJ A;  1YJY A;  3JU7 A;  3HQT A;  3B1C A;  1AMA A;  2A1V A;  2DGM A;  2AY2 A;  2EPJ A;  1AMS A;  2DGK A;  2ZY5 A;  2VGU A;  3JWB A;  3AEM A;  2BYJ A;  1ASD A;  3LVJ A;  5EQC A;  1ARI A;  3LVM A;  4RJ0 A;  2CAN A;  4CXR A;  1ASN A;  4MSO A;  1PMM A;  2FYF A;  1GC2 A;  2JJF A;  3FFR A;  3CQ4 A;  1QJ5 A;  1MDX A;  3WLX A;  1TPL A;  3K40 A;  3AEL A;  4M2J A;  1AHY A;  2C7T A;  3PPL A;  4W1W A;  4AO9 A;  3AEP A;  4Q31 A;  1CJ0 A;  5G4I A;  3NRA A;  3G0T A;  2R5C A;  2D66 A;  4OT8 A;  5K8B A;  1KKP A;  4ZDP A;  2CB1 A;  3EI5 A;  3CAI A;  1D7V A;  2TPL A;  3NDN A;  3BWN A;  1D7R A;  3FVS A;  4LW4 A;  2EZ1 A;  1BJW A;  1OHV A;  2VMU A;  1W3U A;  2YHK A;  1DFO A;  4Y0I A;  5E3K A;  1AY4 A;  3N4S A;  4LC3 A;  2FNU A;  2WK8 A;  1KL2 A;  2CTZ A;  3ACZ A;  4Q76 A;  2FN6 A;  3KGX A;  3ZZK A;  1ASL A;  4L0O A;  4MY5 A;  3II0 A;  2BWP A;  1WST A;  3FZ7 A;  3LV2 A;  4R5Z A;  4A00 A;  2W7J A;  3E2Z B;  3FZ6 A;  2KFP A;  4LW2 A;  1CQ7 A;  3FDB A;  3KKI A;  3VK2 A;  4EB7 A;  4A0R A;  2O1B A;  3FZ8 A;  2OGA A;  4MKJ A;  3BN1 A;  4EU1 A;  3BCX A;  4RKC A;  1RV3 A;  4WYA A;  1DGD A;  2Q7W A;  2YCN A;  1TOE A;  3LWS A;  3E2Y A;  1EJI A;  1J04 A;  1O62 A;  2VLH A;  1QIS A;  4CBR A;  5M49 A;  5M4B A;  4FL0 A;  3RBL A;  3K7Y A;  5TF5 A;  2QSR A;  3NUI A;  3AAT A;  3MKJ A;  1ZOB A;  2ZC0 A;  1MDO A;  3VAX A;  1S09 A;  1T3I A;  2W8J A;  3ELP A;  4HVK A;  1LW5 A;  4GEB A;  3BS8 A;  1V72 A;  4E3R A;  2DOU A;  2OKK A;  3B1E A;  1AKB A;  4UQV A;  4UHN A;  1AAW A;  2O0R A;  2CST A;  4P3M A;  3LY1 A;  2ZJG A;  3RQ1 A;  4U2H A;  5D95 A;  4WYG A;  1SZS A;  4A6U A;  3N7N A;  2YKU A;  2W7I A;  4JF1 A;  1W7N A;  4RAE A;  3F6T A;  4F5K A;  3GZD A;  2VMR A;  4GRX A;  3KGW A;  3WY7 A;  1B9I A;  1Z7D A;  2BI5 A;  1M6S A;  3PJ0 A;  4QGR A;  4Y0D A;  3EIB A;  5FT8 A;  5G09 A;  1OHW A;  1Y4I A;  2C0R A;  1M0P A;  1RVU A;  4CBS A;  4ZWM A;  1OHY A;  2BWN A;  4WBT A;  1AMR A;  2QB2 A;  3BWN C;  4J8L A;  1W23 A;  3AOV A;  1XEY A;  2ORD A;  1O69 A;  2JIS A;  1M32 A;  2D65 A;  2D63 A;  4EFF A;  1WYT B;  1IVR A;  2HOR A;  3PDB A;  4JEX A;  4KAM A;  4OBV A;  4ZSW A;  2Z9V A;  2CJG A;  2EZ2 A;  3FVU A;  2QMA A;  1MAQ A;  4E1O A;  2BIE A;  1AJS B;  3A9Z A;  4LNM A;  4N0W A;  1DJE A;  4BHD A;  1WKH A;  1X2A A;  2F8J A;  3DOD A;  3N0L A;  1EQB A;  3UE8 A;  1S0A A;  3A9X A;  3PDB B;  4PIW A;  2XBN A;  2O7C A;  1ASC A;  2YCP A;  1AX4 A;  1SPA A;  1C9C A;  4A6R A;  3NNK A;  4KYO A;  7AAT A;  1CQ6 A;  4TMR A;  3H7F A;  4XEW A;  1D7U A;  2X8U A;  3EZ1 A;  3IF2 A;  1B4X A;  3E9K A;  2HP2 A;  1KMK A;  2HOY A;  1LKC A;  4AZK A;  1MAP A;  4ADB A;  1AHE A;  3EI6 A;  3GJU A;  3ASB A;  2W7M A;  1DJ9 A;  2Z1Z A;  1YJS A;  3NYU A;  1O4S A;  4MQR A;  4R2N A;  3A9Y A;  2W7F A;  1IJI A;  1LK9 A;  4GE9 A;  3WGB A;  2BI1 A;  3DU4 A;  3MAD A;  4Q75 A;  2OAT A;  3FD0 A;  2CY8 A;  1G7X A;  3FFH A;  5F9S A;  4W91 A;  2VMQ A;  3T32 A;  1V2E A;  3TFT A;  3N4X A;  3EI9 A;  1C7O A;  2DKJ A;  2X3L A;  4DGT A;  2BYL A;  2VMW A;  4WYC A;  2C44 A;  1ART A;  1J32 A;  3QGU A;  3F0H A;  4WXB A;  5LHA A;  3HBX A;  1ASF A;  1UU1 A;  2VMZ A;  5C6U A;  2D5Y A;  3PDX A;  3L44 A;  2HOX A;  3HT4 A;  1JF9 A;  2BKW A;  1XI9 A;  3JWA A;  3MC6 C;  2PB0 A;  4WYF A;  1IX8 A;  1G7W A;  2JG2 A;  2Z61 A;  3FCR A;  4E77 A;  2W7K A;  1D7S A;  2JJE A;  2W8U A;  4XK1 A;  2W8V A;  2CIN A;  2ZSM A;  4ZWV A;  3UAK A;  4J5U A;  3N5M A;  2ZY2 A;  3QPG A;  5E4Z A;  4BA4 A;  1RVY A;  4IXZ A;  1UU2 A;  2YOB A;  4XJL A;  3PA9 A;  4IX8 A;  4Y0H A;  3TCM A;  4EMY A;  4CXQ A;  4F5F A;  9AAT A;  1ELQ A;  4PVF A;  4AO4 A;  2ZY3 A;  3MC6 A;  2BIG A;  1AKC A;  5J8Q A;  1M7Y A;  1V2D A;  1DTY A;  1ZC9 A;  3FQ7 A;  2BI2 A;  3QM2 A;  4PFN A;  4WB0 A;  3ISL A;  3L8A A;  4F5M A;  1BJ4 A;  1AIC A;  1B9H A;  1ASA A;  1YIZ A;  5E5I A;  1AY5 A;  5DJ1 A;  2AY7 A;  3FDD A;  3DR7 A;  3MEB A;  3IHJ A;  1TAR A;  3I4J A;  3N75 A;  4GE4 A;  3AV7 A;  3OKS A;  2VMV A;  3PIU A;  1FG7 A;  2R2N A;  3EI8 A;  4JF0 A;  5KTB A;  1BT4 A;  3A8U X;  3JW9 A;  3DXV A;  3I5T A;  1P3W A;  1ASB A;  3NYT A;  3TFU A;  3ZRR A;  1ARH A;  3ZZJ A;  2EYQ A;  2YKV A;  3MAF A;  3HVY A;  1WYU A;  2GSA A;  3NYS A;  1CZC A;  5AX8 A;  3TQX A;  3BV0 A;  3BC8 A;  3M5U A;  3LVL B;  3NUB A;  4XJM A;  1IAX A;  1QGN A;  3HL2 A;  1TOI A;  3GR9 A;  2WB6 A;  3MAF B;  5IWQ A;  1VP4 A;  5G0A A;  4H63 Q;  1B5O A;  2JJG A;  3P6K A;  1CL2 A;  1WYU B;  5EUE A;  3VK4 A;  2QA3 A;  2PB2 A;  2HUF A;  2HOZ A;  3QI6 A;  4IYO B;  1CL1 A;  4HF8 A;  2FKI A;  4ZLV A;  3HDO A;  2CJH A;  3H9X A;  4JEW A;  2E54 A;  4K2I A;  4RKD A;  4BMK A;  2GMS A;  2YKX A;  1LW4 A;  3FKD A;  1RV4 A;  4ATQ A;  1TOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...