1X29A

Crystal structure of e.coli aspat complexed with n-phosphopyridoxyl-2-methyl-l-glutamic acid
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Binding of C5-dicarboxylic substrate to aspartate aminotransferase: implications for the conformational change at the transaldimination step.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 135
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1x29A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1x29A01
2VIAA 2VMRA 2FQ6A 1I41A 2D61A 2X5DA 3VK2A 2VMYA 2AEVA 1BJ4A 3M5UA 2YKYA 3HQTA 4BA5A 5F9SA 2OKJA 4MKKA 1D7RA 3MBBA 3N75A 3G8MA 5M49A 1O61A 1SPAA 3F0HA 4IYOA 1T3IA 1PMOA 1M6SA 1S07A 1EG5A 2C44A 3B1DA 3EI5A 2GMUA 3JTXA 3NRAA 4PFNA 3PAAA 4L0OA 5G09A 4MQPA 2YKUA 4W91A 2ZP7A 4H51A 3ZRPA 1QITA 2AY7A 1JS3A 1IX6A 1MAPA 3TCMA 3USFA 3KGWA 5AX8A 4JE5D 3II0A 3W1JA 3NUIA 1V2EA 1M32A 1WYVA 2ZUKA 4F5MA 3B1CA 2QLRA 3GZDC 2BI5A 1ECXA 3EIAA 4K2IA 1W3UA 1ASDA 3G7QA 4OYTA 4NOGA 4A0HA 2VMZA 1QJ3A 1MDOA 4OCAA 5LH9A 3NTJA 3PDBB 4ADBA 1B8GA 1AY8A 3JZLA 2BKWA 1MDXA 3HLMA 3HT4A 3HVYA 3ASBA 5E4ZA 1LKCA 1OHWA 1UU0A 1SZUA 4XQ2A 4RJYA 5M4BA 1TOEA 1YIYA 2Q7WA 1WSTA 3EI6A 4ATPA 4LW4A 1ORDA 1ARIA 1AHYA 3COGA 4U2HA 2X3LA 2X5FA 1AHFA 3ECDA 2VGZA 2Z1YA 2W7MA 4ITXA 2W7FA 4M2KA 1TOIA 1B4XA 3TFTA 2FYFA 3B8XA 3IF2A 4A72A 3EIBA 4K2BA 2HORA 2W7IA 4AZKA 2ZSLA 3ZZKA 1WYVB 3TFUA 1TARA 5FT4A 4DBCA 1CJ0A 3PD6A 5HXXA 1G7XA 4M2MA 1SZKA 5FT6A 3WKRA 2GQNA 3DZZA 5HHYA 3DODA 1FC4A 2ZSMA 9AATA 2W8TA 2XBNA 3AEPA 8AATA 4W8IA 1DJUA 3PIUA 2PO3A 2EZ1A 3MC6A 1W7NA 1QIRA 2YCTA 4W1XA 2QA3A 4W1WA 3WCOA 1O62A 3WX9A 3FQ7A 1YJSA 3GJUA 1GEWA 1LS3A 1AHEA 2CTZA 5M46A 2EGYA 2W7HA 5DJ1A 3D6KA 4OBUA 1PMMA 3R9AA 3AV7A 4ZWVA 3LVJA 3DXWA 5G2PA 2W7JA 4ZM4A 1GC4A 1BT4A 1VJOA 4F5LA 1LK9A 2DGKA 3VP6A 1OXPA 2CY8A 3K7YA 2CSTA 1BW0A 3LWSA 3WKSA 2D5YA 2D63A 3AELA 4FL0A 4FFCA 2Z9XA 2Z61A 4PFFA 4E3QA 1I29A 1N2TA 3NDNA 1C4KA 1LC5A 3BV0A 3B1EA 4ZDOA 4IXOA 3PD6B 3GETA 4B98A 1TOKA 3KE3A 4A0RA 3FQAA 4JEYA 1AHXA 3GBXA 1AMRA 4PVFA 1MGVA 1PG8A 2ZY5A 2W8WA 2E54A 4M2JA 4AZJA 4CBSA 1ZOBA 2E7IA 3N0LA 2JGTA 3F6TA 4AO9A 1I48A 1MDZA 4Q31A 2HP2A 5EQCA 3AEMA 3ZRQA 1ASGA 4JEZA 3ISLA 1AICA 3GR9A 3JWAA 3FTBA 3DXVA 2NMPA 1CL1A 3CBFA 3MAFA 4K2MA 1M0PA 3MC6C 4WYEA 3B46A 3MAUA 4XJLA 5DJ9A 3DYDA 4CXRA 2WK7A 2YRIA 4WLHA 2W7LA 3CQ6A 2VGWA 3E77A 4OTLA 4ADEA 1CL2A 1YOOA 4ZLVA 2OQXA 4WYCA 2EH6A 3DR4A 4I8AA 4ATQA 1WYUA 2AY5A 4GE7A 2F8JA 1AHGA 2VMQA 4F5FA 2TPLA 3EI7A 1ASNA 2JJGA 1CZEA 1TOGA 3WGCA 2DGMA 1B9HA 4MKJA 4WLJA 3WY7A 4AO4A 1C7OA 1X2AA 1S08A 1W7MA 2CJDA 2EPJA 3A9XA 4PIWA 1ZODA 2BYLA 3N5MA 3PPLA 3FCRA 2BWPA 1AIBA 1CQ7A 3I16A 4R2NA 4ZDPA 4F5IA 4UHMA 2VMTA 1TPLA 1KKPA 3MAFB 3OP7A 2ZC0A 1E5EA 1ASCA 2VI9A 3LV2A 3EUCA 4KAMA 4DGTA 4F5GA 1JS6A 2PB2A 5G4JA 3E9KA 1Z7DA 3FZ8A 1P3WA 4IX8A 3AEMC 1IX8A 5EUNA 3HL2A 2OKKA 4XJPA 2GSAA 1CZCA 1OXOA 3BS8A 3AENA 4HF8A 1DGEA 1WYUB 2W8JA 2FN6A 1WKHA 4Q6RA 4IXZA 4W5KA 1ARGA 5EAAA 1AKCA 1M4NA 3FVXA 4WB0A 1CQ8A 1LC7A 4GRXA 4ZSYA 1DGDA 1GDEA 5G0AA 3RBFA 3T32A 5LHAA 3E2FA 1JF9A 3PA9A 4OC9A 2O0RA 2VMNA 4GE4A 4LW2A 3P1TA 1GC2A 1I43A 4LC3A 2BI2A 3AOWA 3FQ8A 3VK3A 2AY4A 4R5ZA 2DR1A 3HMUA 1TOJA 3KKIA 1ARSA 1DJ9A 1C7GA 2CJHA 4W1VA 1KKJA 2C0RA 4J5UA 2VGVA 1IBJA 2C81A 1X0MA 3QM2A 3A9YA 1M0OA 2BIGA 4N0BA 4GSAA 5I92A 3WLXA 3ELPA 5D95A 5EIGA 2QMAA 4EB5A 2VMWA 2VI8A 2V1PA 3AENB 4GEBA 1TASA 2Z9WA 2AY8A 3L8AA 1AIAA 2OATA 3TATA 1QGNA 1H0CA 2D64A 3FZ7A 3R4TA 4WB0B 4LNLA 3DU4A 3LVLB 4E1OA 2BI9A 1OHVA 1E5FA 4WYFA 4U1TA 5DB5A 2AY2A 2E7JA 1MAQA 1D7VA 3AATA 4BA4A 4IY7A 3VOMA 2VGTA 4KYOA 1GBNA 4AOAA 2CANA 4RKCA 1DKAA 4IXSA 3QN6A 4ADCA 1B5OA 1EQBA 2CH1A 4RLGA 4EMYA 1ELUA 4RM1A 1Z3ZA 3FVUA 1BS0A 3NYUA 1D7UA 1ASMA 3K28A 3LY1A 3VAXA 1AMSA 5G4IA 2YHKA 2YCNA 1OHYA 2QBTA 1WYTA 4A0GA 3AEOA 1XI9A 3BCAA 1YJZA 3FVSA 4RITA 1QJ5A 2DKJA 1MLYA 7AATA 2VMSA 1YIZA 5EIGB 2CINA 3GZCA 2D65A 3A8UX 4WYDA 1V2DA 2HUFA 1D7SA 4R5FA 2Z1ZA 5JAYA 4BQ0A 1WKGA 1IJIA 3H14A 3FD0A 3W1IA 4MQRA 5D5SA 1CS1A 1H1CA 4JEWA 1SF2A 2O1BA 1KL2A 1M0QA 2HUUA 2R5EA 3DRDA 3LVKA 4Y0HA 3UAKA 4UOYA 2WK9A 3NYSA 1ELQA 3E6GA 4P3MA 4A0FA 4JF1A 4F5HA 4HVKA 5IWQA 2VGSA 4A6TA 1UU2A 1YJYA 3TQXA 3EZSA 4ITGA 1KMKA 2WK8A 5F8VA 1GC0A 1AMAA 1X28A 4Y0IA 4CXQA 3NU8A 3FRKA 1Y4IA 2W8VA 3OKSA 3ACZA 2R0TA 2QB3A 3BCBA 3FFRA 1MLZA 2BIEA 3FKDA 3NU7A 2BI3A 4ISYA 1M7YA 4Y0DA 1AMQA 2BHXA 1W7LA 1B5PA 1IUGA 1WYTB 2Z20A 3NYTA 4WXFA 1U08A 4TMRA 3DR7A 3A2BA 5EAVA 1YAAA 2C7TA 3EI9A 3P6KA 3MADA 4A00A 4F4EA 1RV3A 1BQAA 2VYCA 5E5IA 2VLHA 1BJWA 3RBLA 2W7DA 1QISA 2WKAA 3ELEA 2OGAA 5EUEA 1RVYA 3WGBA 2AY9A 4MGRA 1B9IA 1GCKA 1UU1A 4RIZA 3NX3A 4UHOA 4XAUA 3GWPA 3QPGA 4DQ6A 1AY4A 1ASAA 1J32A 2AEUA 2BWOA 1CQ6A 3QGUA 3E2YA 1BKGA 3HDOA 3RQ1A 3QI6A 4XJOA 3WCNA 2Z9VA 1V72A 3PJ0A 3BCXA 3ZZJA 2YKVA 2XH1A 3LVMA 4JEVA 3ZRRA 3BB8A 4AH3A 1AJSA 3MKJA 3JU7A 2HP1A 2BI1A 1LW4A 2AATA 3EI8A 3RUYA 1AAMA 1BQDA 2EZ2A 1DTYA 1YNUA 1G4VA 3FSLA 1ASEA 3QHXA 4KXKA 2FM1A 1S0AA 1KMJA 1IVRA 4R8DA 1ZC9A 1W23A 2BIAA 4ZWMA 3DC1A 2RFVA 1PFFA 4RAEA 1SFFA 3BWNA 3NNKA 2W7EA 4B9BA 5BJ4A 3FZ6A 3RCHA 3JW9A 3GSBA 5BJ3A 1EJIA 3QBOA 3VK4A 2ORDA 2YKXA 1SVVA 4WYGA 3E2ZA 1S06A 4Q76A 1AX4A 1BJOA 2JG2A 5HDMA 1LW5A 3BC8A 2HOZA 3BWOA 1DJEA 4LNJA 4MSOA 4CBRA 1RV4A 3H7FA 4BMKA 1IAYA 2D7YA 2PB0A 1C0NA 1N31A 1N8PA 1J04A 1VEFA 5TF5A 2G6WA 4MQQA 1ASLA 5EUDA 2BYJA 5M4DA 1O4SA 2CFBA 2HOYA 1AJSB 4IYOB 2D7ZA 3I5TA 3MEBA 1AAWA 4UHNA 3PDXA 3F9TA 2AY3A 2ZJGA 2VMXA 4WXBA 2W7KA 1V2FA 3RI6A 2YRRA 4F5KA 1AY5A 3I4JA 3NUBA 5K8BA 1AKAA 2V0YA 3A9ZA 1UKJA 3FDDA 3Q8NA 2ZY3A 4CVQA 4A6RA 2OGEA 1M0NA 2R5CA 3CQ4A 3RCHB 1O69A 1JG8A 2JJHA 2DKBA 1GC3A 2O7CA 3E2ZB 3AEJA 4UQVA 5G2QA 1BJOB 3CQ5A 1AKBA 1ASBA 2HUIA 5E3KA 2E7UA 4ZDLA 4P7YA 2Z9UA 1QZ9A 2GMSA 2VLFA 1KL1A 4J8LA 3WZFA 3BWNC 4EFFA 4GDYA 1BJNA 1ARTA 2VIBA 2Z67A 4E3RA 1IAXA 1G7WA 2VGUA 2CJGA 3ASAA 3EZ1A 4LNMA 3L44A 4BHDA 4E77A 2YCPA 4WBTA 2GB3A 4N0WA 2FNIA 4O6ZA 4XEWA 2QB2A 2AY1A 1RVUA 3K40A 4EU1A 2D66A 1GD9A 2ZYJA 4QGRA 3UWCA 2W7GA 4A6UA 4WYAA 1ASFA 1FG3A 3BN1A 2ZY4A 2FNUA 1DFOA 4JF0A 2HOXA 2JJFA 1AJRA 4MY5A 5C6UA 2YOBA 4GE9A 5J8QA 1VP4A 3JWBA 4XJMA 4ADDA 2VMUA 3CAIA 4WP0A 4TN4A 2BWNA 3UE8A 2JJEA 2R5CB 1GEYA 1TATA 3W1HA 2HZPA 5FT8A 3IHJA 4JE5A 2X8UA 4WD2A 4ZASA 3FDBA 3AOVA 3ATHA 1OATA 1G4XA 1IX7A 1C9CA 4OT8A 3GZDA 4F5JA 2JISA 4ZAHA 3G0TA 1GEXA 3HBXA 4ZM3A 2R2NA 4XK1A 2CH2A 3FFHA 2CB1A 2DGLA 2VMVA 3PGYA 4EB7A 1FG7A 2W8UA 4RJ0A 5FT5A 1LC8A 2VMOA 2DOUA 4IW7A 3AEJC 2VMPA 4ZSWA 5DX5A 4JEXA 4RKDA 1D2FA 1S09A 1X29A 4OMAA 5EFSA 1ARHA 2EO5A 4OBVA 4WXGA 2AY6A 4Q75A 3KGXA 4TV7A 2ZY2A 1SZSA 3PDBA 1C7NA 3LG0A 1XEYA
chains in the Genus database with same CATH superfamily
2VIAA 2VMRA 2FQ6A 1I41A 2D61A 2X5DA 3VK2A 2VMYA 2AEVA 1BJ4A 3M5UA 2YKYA 3HQTA 4BA5A 5F9SA 2OKJA 4MKKA 1D7RA 3MBBA 3N75A 3G8MA 5M49A 1O61A 1SPAA 3F0HA 4IYOA 1T3IA 1PMOA 1M6SA 1S07A 1EG5A 2C44A 3B1DA 3EI5A 2GMUA 3JTXA 3NRAA 4PFNA 3PAAA 4L0OA 5G09A 4MQPA 2YKUA 4W91A 2ZP7A 4H51A 3ZRPA 1QITA 2AY7A 1JS3A 1IX6A 1MAPA 3TCMA 3USFA 3KGWA 5AX8A 4JE5D 3II0A 3W1JA 3NUIA 1V2EA 1M32A 1WYVA 2ZUKA 4F5MA 3B1CA 2QLRA 3GZDC 2BI5A 1ECXA 3EIAA 4K2IA 1W3UA 1ASDA 3G7QA 4OYTA 4NOGA 4A0HA 2VMZA 1QJ3A 1MDOA 4OCAA 5LH9A 3NTJA 3PDBB 4ADBA 1B8GA 1AY8A 3JZLA 2BKWA 1MDXA 3HLMA 3HT4A 3HVYA 3ASBA 5E4ZA 1LKCA 1OHWA 1UU0A 1SZUA 4XQ2A 4RJYA 5M4BA 1TOEA 1YIYA 2Q7WA 1WSTA 3EI6A 4ATPA 4LW4A 1ORDA 1ARIA 1AHYA 3COGA 4U2HA 2X3LA 2X5FA 1AHFA 2QSRA 3ECDA 2VGZA 2Z1YA 2W7MA 4ITXA 2W7FA 4M2KA 1TOIA 1B4XA 3TFTA 2FYFA 3B8XA 3IF2A 4A72A 3EIBA 4K2BA 2HORA 2W7IA 4AZKA 2ZSLA 3ZZKA 1WYVB 3TFUA 1TARA 5FT4A 4DBCA 1CJ0A 3PD6A 5HXXA 1G7XA 4M2MA 1SZKA 5FT6A 3WKRA 2GQNA 3DZZA 5HHYA 3DODA 1FC4A 2ZSMA 9AATA 2W8TA 2XBNA 3AEPA 8AATA 4W8IA 1DJUA 3PIUA 2PO3A 2EZ1A 3MC6A 1W7NA 1QIRA 2YCTA 4W1XA 2EYQA 2QA3A 4W1WA 3WCOA 1O62A 3WX9A 3FQ7A 1YJSA 3GJUA 1GEWA 1LS3A 1AHEA 2CTZA 5M46A 2EGYA 2W7HA 5DJ1A 3D6KA 4OBUA 1PMMA 3R9AA 3AV7A 4ZWVA 3LVJA 3DXWA 5G2PA 2W7JA 4ZM4A 1GC4A 1BT4A 1VJOA 4F5LA 1LK9A 2DGKA 3VP6A 1OXPA 2CY8A 2A1VA 3K7YA 2CSTA 1BW0A 3LWSA 3WKSA 2D5YA 2D63A 3AELA 4FL0A 4FFCA 2Z9XA 2Z61A 4PFFA 4E3QA 1I29A 1N2TA 3NDNA 1C4KA 1LC5A 3BV0A 3B1EA 4ZDOA 4IXOA 3PD6B 3GETA 4B98A 1TOKA 3KE3A 4A0RA 3FQAA 4JEYA 1AHXA 3GBXA 1AMRA 4PVFA 1MGVA 1PG8A 2ZY5A 2W8WA 2E54A 4M2JA 4AZJA 4CBSA 1ZOBA 2E7IA 3N0LA 2JGTA 3F6TA 4AO9A 4H63Q 1I48A 1MDZA 4Q31A 2HP2A 5EQCA 3AEMA 3ZRQA 1ASGA 4JEZA 3ISLA 1AICA 3GR9A 3JWAA 3FTBA 3DXVA 2NMPA 1CL1A 3CBFA 3MAFA 4K2MA 1M0PA 3MC6C 4WYEA 3B46A 3MAUA 4XJLA 5DJ9A 3DYDA 4CXRA 2WK7A 2YRIA 4WLHA 2W7LA 3CQ6A 2VGWA 3E77A 4OTLA 4ADEA 1CL2A 1YOOA 4ZLVA 2OQXA 4WYCA 2EH6A 3DR4A 4I8AA 4ATQA 1WYUA 2AY5A 4GE7A 2F8JA 1AHGA 2VMQA 4F5FA 2TPLA 3EI7A 1ASNA 2JJGA 1CZEA 1TOGA 2KFPA 3WGCA 2DGMA 1B9HA 4MKJA 4WLJA 3WY7A 4AO4A 1C7OA 1X2AA 1S08A 1W7MA 2CJDA 2EPJA 3A9XA 4PIWA 1ZODA 2BYLA 3N5MA 3PPLA 3FCRA 2BWPA 1AIBA 1CQ7A 3I16A 4R2NA 4ZDPA 4F5IA 4UHMA 2VMTA 1TPLA 1KKPA 3MAFB 3OP7A 2ZC0A 1E5EA 1ASCA 2VI9A 3LV2A 3EUCA 4KAMA 4DGTA 4F5GA 1JS6A 2PB2A 5G4JA 3E9KA 1Z7DA 3FZ8A 1P3WA 4IX8A 3AEMC 1IX8A 5EUNA 3HL2A 2OKKA 4XJPA 2GSAA 1CZCA 1OXOA 3BS8A 3AENA 4HF8A 1DGEA 1WYUB 2W8JA 2FN6A 1WKHA 4Q6RA 4IXZA 4W5KA 1ARGA 5EAAA 2FKIA 1AKCA 1M4NA 3FVXA 4WB0A 1CQ8A 1LC7A 4GRXA 4ZSYA 1DGDA 1GDEA 5G0AA 3RBFA 3T32A 5LHAA 3E2FA 1JF9A 3PA9A 4OC9A 2O0RA 2VMNA 4GE4A 4LW2A 3P1TA 1GC2A 1I43A 4LC3A 3N4SA 2BI2A 3AOWA 3FQ8A 3VK3A 2AY4A 4R5ZA 2DR1A 3HMUA 1TOJA 3KKIA 1ARSA 1DJ9A 1C7GA 2CJHA 3N4RA 4W1VA 1KKJA 2C0RA 4J5UA 2VGVA 1IBJA 2C81A 1X0MA 3QM2A 3A9YA 1M0OA 2BIGA 4N0BA 4GSAA 5I92A 3WLXA 3ELPA 5D95A 5EIGA 2QMAA 4EB5A 2VMWA 2VI8A 2V1PA 3AENB 4GEBA 1TASA 2Z9WA 2AY8A 3L8AA 1AIAA 2OATA 3TATA 1QGNA 1H0CA 2D64A 3FZ7A 3R4TA 4WB0B 4LNLA 3DU4A 3LVLB 4E1OA 2BI9A 1OHVA 1E5FA 4WYFA 4U1TA 5DB5A 2AY2A 2E7JA 1MAQA 1D7VA 3AATA 4BA4A 4IY7A 3VOMA 2VGTA 4KYOA 1GBNA 4AOAA 2CANA 4RKCA 1DKAA 4IXSA 3QN6A 4ADCA 1B5OA 1EQBA 2CH1A 4RLGA 4EMYA 1ELUA 4RM1A 1Z3ZA 3FVUA 1BS0A 3NYUA 1D7UA 1ASMA 3K28A 3LY1A 3VAXA 1AMSA 5G4IA 2YHKA 2YCNA 1OHYA 2QBTA 1WYTA 4A0GA 3AEOA 1XI9A 3BCAA 1YJZA 3FVSA 4RITA 1QJ5A 2DKJA 1MLYA 7AATA 2VMSA 1YIZA 5EIGB 2CINA 3GZCA 2D65A 3A8UX 4WYDA 1V2DA 2HUFA 1D7SA 4R5FA 2Z1ZA 5JAYA 4BQ0A 1WKGA 1IJIA 3H14A 3FD0A 3W1IA 4MQRA 5D5SA 1CS1A 1H1CA 4JEWA 1SF2A 2O1BA 1KL2A 1M0QA 2HUUA 2R5EA 3DRDA 3LVKA 4Y0HA 3UAKA 2WB6A 4UOYA 2WK9A 3NYSA 1ELQA 3E6GA 4P3MA 4A0FA 4JF1A 4F5HA 4HVKA 5IWQA 2VGSA 4A6TA 1UU2A 1YJYA 3TQXA 3EZSA 4ITGA 1KMKA 2WK8A 5F8VA 1GC0A 1AMAA 1X28A 4Y0IA 4CXQA 3NU8A 3FRKA 1Y4IA 2W8VA 3OKSA 3ACZA 2R0TA 2QB3A 3BCBA 3FFRA 1MLZA 2BIEA 3FKDA 3NU7A 2BI3A 4ISYA 1M7YA 4Y0DA 1AMQA 2BHXA 1W7LA 1B5PA 1IUGA 1WYTB 2Z20A 3NYTA 4WXFA 1U08A 4TMRA 3DR7A 3A2BA 5EAVA 1YAAA 2C7TA 3EI9A 3P6KA 3MADA 4A00A 4F4EA 1RV3A 1BQAA 2VYCA 5E5IA 2VLHA 1BJWA 3RBLA 2W7DA 1QISA 2WKAA 3ELEA 2OGAA 5EUEA 1RVYA 3WGBA 2AY9A 4MGRA 1B9IA 1GCKA 1UU1A 4RIZA 3NX3A 4UHOA 4XAUA 3GWPA 3QPGA 4DQ6A 1AY4A 1ASAA 1J32A 2AEUA 2BWOA 1CQ6A 3QGUA 3E2YA 1BKGA 3HDOA 3RQ1A 3QI6A 4XJOA 3WCNA 2Z9VA 1V72A 3PJ0A 3BCXA 3ZZJA 2YKVA 2XH1A 3LVMA 4JEVA 3ZRRA 3BB8A 4AH3A 1AJSA 3MKJA 3JU7A 2HP1A 2BI1A 1LW4A 2AATA 3EI8A 3RUYA 1AAMA 1BQDA 2EZ2A 1DTYA 1YNUA 1G4VA 3FSLA 1ASEA 3QHXA 4KXKA 2FM1A 1S0AA 1KMJA 1IVRA 4R8DA 1ZC9A 1W23A 2BIAA 4ZWMA 3DC1A 2RFVA 1PFFA 4RAEA 1SFFA 3BWNA 3NNKA 2W7EA 4B9BA 5BJ4A 3FZ6A 3RCHA 3JW9A 3GSBA 5BJ3A 1EJIA 3QBOA 3VK4A 2ORDA 2YKXA 1SVVA 4WYGA 3E2ZA 1S06A 4Q76A 1AX4A 1BJOA 2JG2A 5HDMA 1LW5A 3BC8A 2HOZA 3BWOA 5KTBA 1DJEA 3H9XA 4LNJA 4MSOA 4CBRA 1RV4A 3H7FA 4BMKA 1IAYA 2D7YA 2PB0A 1C0NA 1N31A 1N8PA 1J04A 1VEFA 5TF5A 2G6WA 4MQQA 1ASLA 5EUDA 2BYJA 5M4DA 1O4SA 2CFBA 2HOYA 1AJSB 4IYOB 2D7ZA 3I5TA 3MEBA 1AAWA 4UHNA 3PDXA 3F9TA 2AY3A 2ZJGA 2VMXA 4WXBA 2W7KA 3N7NA 1V2FA 3RI6A 2YRRA 4F5KA 1AY5A 3I4JA 3NUBA 5K8BA 1AKAA 2V0YA 3A9ZA 1UKJA 3FDDA 3Q8NA 2ZY3A 4CVQA 4A6RA 2OGEA 1M0NA 2R5CA 3CQ4A 3RCHB 1O69A 1JG8A 2JJHA 2DKBA 1GC3A 2O7CA 3E2ZB 3AEJA 4UQVA 5G2QA 1BJOB 3CQ5A 1AKBA 1ASBA 2HUIA 5E3KA 2E7UA 4ZDLA 4P7YA 2Z9UA 1QZ9A 2GMSA 2VLFA 1KL1A 4J8LA 3WZFA 3BWNC 4EFFA 1KAFA 4GDYA 1BJNA 1ARTA 2VIBA 2Z67A 4E3RA 1IAXA 1G7WA 2VGUA 2CJGA 3ASAA 3EZ1A 4LNMA 3L44A 4BHDA 4E77A 2YCPA 4WBTA 2GB3A 4N0WA 2FNIA 4O6ZA 4XEWA 2QB2A 2AY1A 1RVUA 3K40A 4EU1A 2D66A 1GD9A 2ZYJA 4QGRA 3UWCA 2W7GA 4A6UA 4WYAA 1ASFA 1FG3A 3BN1A 2ZY4A 2FNUA 1DFOA 4JF0A 2HOXA 2JJFA 1AJRA 4MY5A 5C6UA 2YOBA 4GE9A 5J8QA 1VP4A 3JWBA 4XJMA 4ADDA 4K05A 2VMUA 3CAIA 4WP0A 4TN4A 2BWNA 3UE8A 2JJEA 2R5CB 1GEYA 1TATA 3N4XA 3W1HA 2HZPA 5FT8A 3IHJA 4JE5A 2X8UA 4WD2A 4ZASA 3FDBA 3AOVA 3ATHA 1OATA 1G4XA 1IX7A 1C9CA 4OT8A 3GZDA 4F5JA 2JISA 4ZAHA 3G0TA 1GEXA 3HBXA 4ZM3A 2R2NA 4XK1A 2CH2A 3FFHA 2CB1A 2DGLA 2VMVA 3PGYA 4EB7A 1FG7A 2W8UA 4RJ0A 5FT5A 1LC8A 2VMOA 2DOUA 4IW7A 3AEJC 2VMPA 4ZSWA 5DX5A 2G7JA 4JEXA 4RKDA 1D2FA 1S09A 1X29A 4OMAA 5EFSA 1ARHA 2EO5A 4OBVA 4WXGA 2AY6A 4Q75A 3KGXA 4TV7A 2ZY2A 1SZSA 3PDBA 1C7NA 3LG0A 1XEYA
chains in the Genus database with same CATH topology
2VIAA 2VMRA 2FQ6A 1I41A 2D61A 2X5DA 3VK2A 2VMYA 2AEVA 1BJ4A 3M5UA 2YKYA 3HQTA 4BA5A 5F9SA 2OKJA 4MKKA 1D7RA 3MBBA 3N75A 3G8MA 5M49A 1O61A 1SPAA 3F0HA 4IYOA 1T3IA 1PMOA 1M6SA 1S07A 1EG5A 2C44A 3B1DA 3EI5A 2GMUA 3JTXA 3NRAA 4PFNA 3PAAA 4L0OA 5G09A 4MQPA 2YKUA 4W91A 2ZP7A 4H51A 3ZRPA 1QITA 2AY7A 1JS3A 1IX6A 1MAPA 3TCMA 3USFA 3KGWA 5AX8A 4JE5D 3II0A 3W1JA 3NUIA 1V2EA 1M32A 1WYVA 2ZUKA 4F5MA 3B1CA 2QLRA 3GZDC 2BI5A 1ECXA 3EIAA 4K2IA 1W3UA 1ASDA 3G7QA 4OYTA 4NOGA 4A0HA 2VMZA 1QJ3A 1MDOA 4OCAA 5LH9A 3NTJA 3PDBB 4ADBA 1B8GA 1AY8A 3JZLA 2BKWA 1MDXA 3HLMA 3HT4A 3HVYA 3ASBA 5E4ZA 1LKCA 1OHWA 1UU0A 1SZUA 4XQ2A 4RJYA 5M4BA 1TOEA 1YIYA 2Q7WA 1WSTA 3EI6A 4ATPA 4LW4A 1ORDA 1ARIA 1AHYA 3COGA 4U2HA 2X3LA 2X5FA 1AHFA 2QSRA 3ECDA 2VGZA 2Z1YA 2W7MA 4ITXA 2W7FA 4M2KA 1TOIA 1B4XA 3TFTA 2FYFA 3B8XA 3IF2A 4A72A 3EIBA 4K2BA 2HORA 2W7IA 4AZKA 2ZSLA 3ZZKA 1WYVB 3TFUA 1TARA 5FT4A 4DBCA 1CJ0A 3PD6A 5HXXA 1G7XA 4M2MA 1SZKA 5FT6A 3WKRA 2GQNA 3DZZA 5HHYA 3DODA 1FC4A 2ZSMA 9AATA 2W8TA 2XBNA 3AEPA 8AATA 4W8IA 1DJUA 3PIUA 2PO3A 2EZ1A 3MC6A 1W7NA 1QIRA 2YCTA 4W1XA 2EYQA 2QA3A 4W1WA 3WCOA 1O62A 3WX9A 3FQ7A 1YJSA 3GJUA 1GEWA 1LS3A 1AHEA 2CTZA 5M46A 2EGYA 2W7HA 5DJ1A 3D6KA 4OBUA 1PMMA 3R9AA 3AV7A 4ZWVA 3LVJA 3DXWA 5G2PA 2W7JA 4ZM4A 1GC4A 1BT4A 1VJOA 4F5LA 1LK9A 2DGKA 3VP6A 1OXPA 2CY8A 2A1VA 3K7YA 2CSTA 1BW0A 3LWSA 3WKSA 2D5YA 2D63A 3AELA 4FL0A 4FFCA 2Z9XA 2Z61A 4PFFA 4E3QA 1I29A 1N2TA 3NDNA 1C4KA 1LC5A 3BV0A 3B1EA 4ZDOA 4IXOA 3PD6B 3GETA 4B98A 1TOKA 3KE3A 4A0RA 3FQAA 4JEYA 1AHXA 3GBXA 1AMRA 4PVFA 1MGVA 1PG8A 2ZY5A 2W8WA 2E54A 4M2JA 4AZJA 4CBSA 1ZOBA 2E7IA 3N0LA 2JGTA 3F6TA 4AO9A 4H63Q 1I48A 1MDZA 4Q31A 2HP2A 5EQCA 3AEMA 3ZRQA 1ASGA 4JEZA 3ISLA 1AICA 3GR9A 3JWAA 3FTBA 3DXVA 2NMPA 1CL1A 3CBFA 3MAFA 4K2MA 1M0PA 3MC6C 4WYEA 3B46A 3MAUA 4XJLA 5DJ9A 3DYDA 4CXRA 2WK7A 2YRIA 4WLHA 2W7LA 3CQ6A 2VGWA 3E77A 4OTLA 4ADEA 1CL2A 1YOOA 4ZLVA 2OQXA 4WYCA 2EH6A 3DR4A 4I8AA 4ATQA 1WYUA 2AY5A 4GE7A 2F8JA 1AHGA 2VMQA 4F5FA 2TPLA 3EI7A 1ASNA 2JJGA 1CZEA 1TOGA 2KFPA 3WGCA 2DGMA 1B9HA 4MKJA 4WLJA 3WY7A 4AO4A 1C7OA 1X2AA 1S08A 1W7MA 2CJDA 2EPJA 3A9XA 4PIWA 1ZODA 2BYLA 3N5MA 3PPLA 3FCRA 2BWPA 1AIBA 1CQ7A 3I16A 4R2NA 4ZDPA 4F5IA 4UHMA 2VMTA 1TPLA 1KKPA 3MAFB 3OP7A 2ZC0A 1E5EA 1ASCA 2VI9A 3LV2A 3EUCA 4KAMA 4DGTA 4F5GA 1JS6A 2PB2A 5G4JA 3E9KA 1Z7DA 3FZ8A 1P3WA 4IX8A 3AEMC 1IX8A 5EUNA 3HL2A 2OKKA 4XJPA 2GSAA 1CZCA 1OXOA 3BS8A 3AENA 4HF8A 1DGEA 1WYUB 2W8JA 2FN6A 1WKHA 4Q6RA 4IXZA 4W5KA 1ARGA 5EAAA 2FKIA 1AKCA 1M4NA 3FVXA 4WB0A 1CQ8A 1LC7A 4GRXA 4ZSYA 1DGDA 1GDEA 5G0AA 3RBFA 3T32A 5LHAA 3E2FA 1JF9A 3PA9A 4OC9A 2O0RA 2VMNA 4GE4A 4LW2A 3P1TA 1GC2A 1I43A 4LC3A 3N4SA 2BI2A 3AOWA 3FQ8A 3VK3A 2AY4A 4R5ZA 2DR1A 3HMUA 1TOJA 3KKIA 1ARSA 1DJ9A 1C7GA 2CJHA 3N4RA 4W1VA 1KKJA 2C0RA 4J5UA 2VGVA 1IBJA 2C81A 1X0MA 3QM2A 3A9YA 1M0OA 2BIGA 4N0BA 4GSAA 5I92A 3WLXA 3ELPA 5D95A 5EIGA 2QMAA 4EB5A 2VMWA 2VI8A 2V1PA 3AENB 4GEBA 1TASA 2Z9WA 2AY8A 3L8AA 1AIAA 2OATA 3TATA 1QGNA 1H0CA 2D64A 3FZ7A 3R4TA 4WB0B 4LNLA 3DU4A 3LVLB 4E1OA 2BI9A 1OHVA 1E5FA 4WYFA 4U1TA 5DB5A 2AY2A 2E7JA 1MAQA 1D7VA 3AATA 4BA4A 4IY7A 3VOMA 2VGTA 4KYOA 1GBNA 4AOAA 2CANA 4RKCA 1DKAA 4IXSA 3QN6A 4ADCA 1B5OA 1EQBA 2CH1A 4RLGA 4EMYA 1ELUA 4RM1A 1Z3ZA 3FVUA 1BS0A 3NYUA 1D7UA 1ASMA 3K28A 3LY1A 3VAXA 1AMSA 5G4IA 2YHKA 2YCNA 1OHYA 2QBTA 1WYTA 4A0GA 3AEOA 1XI9A 3BCAA 1YJZA 3FVSA 4RITA 1QJ5A 2DKJA 1MLYA 7AATA 2VMSA 1YIZA 5EIGB 2CINA 3GZCA 2D65A 3A8UX 4WYDA 1V2DA 2HUFA 1D7SA 4R5FA 2Z1ZA 5JAYA 4BQ0A 1WKGA 1IJIA 3H14A 3FD0A 3W1IA 4MQRA 5D5SA 1CS1A 1H1CA 4JEWA 1SF2A 2O1BA 1KL2A 1M0QA 2HUUA 2R5EA 3DRDA 3LVKA 4Y0HA 3UAKA 2WB6A 4UOYA 2WK9A 3NYSA 1ELQA 3E6GA 4P3MA 4A0FA 4JF1A 4F5HA 4HVKA 5IWQA 2VGSA 4A6TA 1UU2A 1YJYA 3TQXA 3EZSA 4ITGA 1KMKA 2WK8A 5F8VA 1GC0A 1AMAA 1X28A 4Y0IA 4CXQA 3NU8A 3FRKA 1Y4IA 2W8VA 3OKSA 3ACZA 2R0TA 2QB3A 3BCBA 3FFRA 1MLZA 2BIEA 3FKDA 3NU7A 2BI3A 4ISYA 1M7YA 4Y0DA 1AMQA 2BHXA 1W7LA 1B5PA 1IUGA 1WYTB 2Z20A 3NYTA 4WXFA 1U08A 4TMRA 3DR7A 3A2BA 5EAVA 1YAAA 2C7TA 3EI9A 3P6KA 3MADA 4A00A 4F4EA 1RV3A 1BQAA 2VYCA 5E5IA 2VLHA 1BJWA 3RBLA 2W7DA 1QISA 2WKAA 3ELEA 2OGAA 5EUEA 1RVYA 3WGBA 2AY9A 4MGRA 1B9IA 1GCKA 1UU1A 4RIZA 3NX3A 4UHOA 4XAUA 3GWPA 3QPGA 4DQ6A 1AY4A 1ASAA 1J32A 2AEUA 2BWOA 1CQ6A 3QGUA 3E2YA 1BKGA 3HDOA 3RQ1A 3QI6A 4XJOA 3WCNA 2Z9VA 1V72A 3PJ0A 3BCXA 3ZZJA 2YKVA 2XH1A 3LVMA 4JEVA 3ZRRA 3BB8A 4AH3A 1AJSA 3MKJA 3JU7A 2HP1A 2BI1A 1LW4A 2AATA 3EI8A 3RUYA 1AAMA 1BQDA 2EZ2A 1DTYA 1YNUA 1G4VA 3FSLA 1ASEA 3QHXA 4KXKA 2FM1A 1S0AA 1KMJA 1IVRA 4R8DA 1ZC9A 1W23A 2BIAA 4ZWMA 3DC1A 2RFVA 1PFFA 4RAEA 1SFFA 3BWNA 3NNKA 2W7EA 4B9BA 5BJ4A 3FZ6A 3RCHA 3JW9A 3GSBA 5BJ3A 1EJIA 3QBOA 3VK4A 2ORDA 2YKXA 1SVVA 4WYGA 3E2ZA 1S06A 4Q76A 1AX4A 1BJOA 2JG2A 5HDMA 1LW5A 3BC8A 2HOZA 3BWOA 5KTBA 1DJEA 3H9XA 4LNJA 4MSOA 4CBRA 1RV4A 3H7FA 4BMKA 1IAYA 2D7YA 2PB0A 1C0NA 1N31A 1N8PA 1J04A 1VEFA 5TF5A 2G6WA 4MQQA 1ASLA 5EUDA 2BYJA 5M4DA 1O4SA 2CFBA 2HOYA 1AJSB 4IYOB 2D7ZA 3I5TA 3MEBA 1AAWA 4UHNA 3PDXA 3F9TA 2AY3A 2ZJGA 2VMXA 4WXBA 2W7KA 3N7NA 1V2FA 3RI6A 2YRRA 4F5KA 1AY5A 3I4JA 3NUBA 5K8BA 1AKAA 2V0YA 3A9ZA 1UKJA 3FDDA 3Q8NA 2ZY3A 4CVQA 4A6RA 2OGEA 1M0NA 2R5CA 3CQ4A 3RCHB 1O69A 1JG8A 2JJHA 2DKBA 1GC3A 2O7CA 3E2ZB 3AEJA 4UQVA 5G2QA 1BJOB 3CQ5A 1AKBA 1ASBA 2HUIA 5E3KA 2E7UA 4ZDLA 4P7YA 2Z9UA 1QZ9A 2GMSA 2VLFA 1KL1A 4J8LA 3WZFA 3BWNC 4EFFA 4GDYA 1BJNA 1ARTA 2VIBA 2Z67A 4E3RA 1IAXA 1G7WA 2VGUA 2CJGA 3ASAA 3EZ1A 4LNMA 3L44A 4BHDA 4E77A 2YCPA 4WBTA 2GB3A 4N0WA 2FNIA 4O6ZA 4XEWA 2QB2A 2AY1A 1RVUA 3K40A 4EU1A 2D66A 1GD9A 2ZYJA 4QGRA 3UWCA 2W7GA 4A6UA 4WYAA 1ASFA 1FG3A 3BN1A 2ZY4A 2FNUA 1DFOA 4JF0A 2HOXA 2JJFA 1AJRA 4MY5A 5C6UA 2YOBA 4GE9A 5J8QA 1VP4A 3JWBA 4XJMA 4ADDA 4K05A 2VMUA 3CAIA 4WP0A 4TN4A 2BWNA 3UE8A 2JJEA 2R5CB 1GEYA 1TATA 3N4XA 3W1HA 2HZPA 5FT8A 3IHJA 4JE5A 2X8UA 4WD2A 4ZASA 3FDBA 3AOVA 3ATHA 1OATA 1G4XA 1IX7A 1C9CA 4OT8A 3GZDA 4F5JA 2JISA 4ZAHA 3G0TA 1GEXA 3HBXA 4ZM3A 2R2NA 4XK1A 2CH2A 3FFHA 2CB1A 2DGLA 2VMVA 3PGYA 4EB7A 1FG7A 2W8UA 4RJ0A 5FT5A 1LC8A 2VMOA 2DOUA 4IW7A 3AEJC 2VMPA 4ZSWA 5DX5A 2G7JA 4JEXA 4RKDA 1D2FA 1S09A 1X29A 4OMAA 5EFSA 1ARHA 2EO5A 4OBVA 4WXGA 2AY6A 4Q75A 3KGXA 4TV7A 2ZY2A 1SZSA 3PDBA 1C7NA 3LG0A 1XEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VIA A;  2VMR A;  2FQ6 A;  1I41 A;  2D61 A;  2X5D A;  3VK2 A;  2VMY A;  2AEV A;  1BJ4 A;  3M5U A;  2YKY A;  3HQT A;  4BA5 A;  5F9S A;  2OKJ A;  4MKK A;  1D7R A;  3MBB A;  3N75 A;  3G8M A;  5M49 A;  1O61 A;  1SPA A;  3F0H A;  4IYO A;  1T3I A;  1PMO A;  1M6S A;  1S07 A;  1EG5 A;  2C44 A;  3B1D A;  3EI5 A;  2GMU A;  3JTX A;  3NRA A;  4PFN A;  3PAA A;  4L0O A;  5G09 A;  4MQP A;  2YKU A;  4W91 A;  2ZP7 A;  4H51 A;  3ZRP A;  1QIT A;  2AY7 A;  1JS3 A;  1IX6 A;  1MAP A;  3TCM A;  3USF A;  3KGW A;  5AX8 A;  4JE5 D;  3II0 A;  3W1J A;  3NUI A;  1V2E A;  1M32 A;  1WYV A;  2ZUK A;  4F5M A;  3B1C A;  2QLR A;  3GZD C;  2BI5 A;  1ECX A;  3EIA A;  4K2I A;  1W3U A;  1ASD A;  3G7Q A;  4OYT A;  4NOG A;  4A0H A;  2VMZ A;  1QJ3 A;  1MDO A;  4OCA A;  5LH9 A;  3NTJ A;  3PDB B;  4ADB A;  1B8G A;  1AY8 A;  3JZL A;  2BKW A;  1MDX A;  3HLM A;  3HT4 A;  3HVY A;  3ASB A;  5E4Z A;  1LKC A;  1OHW A;  1UU0 A;  1SZU A;  4XQ2 A;  4RJY A;  5M4B A;  1TOE A;  1YIY A;  2Q7W A;  1WST A;  3EI6 A;  4ATP A;  4LW4 A;  1ORD A;  1ARI A;  1AHY A;  3COG A;  4U2H A;  2X3L A;  2X5F A;  1AHF A;  3ECD A;  2VGZ A;  2Z1Y A;  2W7M A;  4ITX A;  2W7F A;  4M2K A;  1TOI A;  1B4X A;  3TFT A;  2FYF A;  3B8X A;  3IF2 A;  4A72 A;  3EIB A;  4K2B A;  2HOR A;  2W7I A;  4AZK A;  2ZSL A;  3ZZK A;  1WYV B;  3TFU A;  1TAR A;  5FT4 A;  4DBC A;  1CJ0 A;  3PD6 A;  5HXX A;  1G7X A;  4M2M A;  1SZK A;  5FT6 A;  3WKR A;  2GQN A;  3DZZ A;  5HHY A;  3DOD A;  1FC4 A;  2ZSM A;  9AAT A;  2W8T A;  2XBN A;  3AEP A;  8AAT A;  4W8I A;  1DJU A;  3PIU A;  2PO3 A;  2EZ1 A;  3MC6 A;  1W7N A;  1QIR A;  2YCT A;  4W1X A;  2QA3 A;  4W1W A;  3WCO A;  1O62 A;  3WX9 A;  3FQ7 A;  1YJS A;  3GJU A;  1GEW A;  1LS3 A;  1AHE A;  2CTZ A;  5M46 A;  2EGY A;  2W7H A;  5DJ1 A;  3D6K A;  4OBU A;  1PMM A;  3R9A A;  3AV7 A;  4ZWV A;  3LVJ A;  3DXW A;  5G2P A;  2W7J A;  4ZM4 A;  1GC4 A;  1BT4 A;  1VJO A;  4F5L A;  1LK9 A;  2DGK A;  3VP6 A;  1OXP A;  2CY8 A;  3K7Y A;  2CST A;  1BW0 A;  3LWS A;  3WKS A;  2D5Y A;  2D63 A;  3AEL A;  4FL0 A;  4FFC A;  2Z9X A;  2Z61 A;  4PFF A;  4E3Q A;  1I29 A;  1N2T A;  3NDN A;  1C4K A;  1LC5 A;  3BV0 A;  3B1E A;  4ZDO A;  4IXO A;  3PD6 B;  3GET A;  4B98 A;  1TOK A;  3KE3 A;  4A0R A;  3FQA A;  4JEY A;  1AHX A;  3GBX A;  1AMR A;  4PVF A;  1MGV A;  1PG8 A;  2ZY5 A;  2W8W A;  2E54 A;  4M2J A;  4AZJ A;  4CBS A;  1ZOB A;  2E7I A;  3N0L A;  2JGT A;  3F6T A;  4AO9 A;  1I48 A;  1MDZ A;  4Q31 A;  2HP2 A;  5EQC A;  3AEM A;  3ZRQ A;  1ASG A;  4JEZ A;  3ISL A;  1AIC A;  3GR9 A;  3JWA A;  3FTB A;  3DXV A;  2NMP A;  1CL1 A;  3CBF A;  3MAF A;  4K2M A;  1M0P A;  3MC6 C;  4WYE A;  3B46 A;  3MAU A;  4XJL A;  5DJ9 A;  3DYD A;  4CXR A;  2WK7 A;  2YRI A;  4WLH A;  2W7L A;  3CQ6 A;  2VGW A;  3E77 A;  4OTL A;  4ADE A;  1CL2 A;  1YOO A;  4ZLV A;  2OQX A;  4WYC A;  2EH6 A;  3DR4 A;  4I8A A;  4ATQ A;  1WYU A;  2AY5 A;  4GE7 A;  2F8J A;  1AHG A;  2VMQ A;  4F5F A;  2TPL A;  3EI7 A;  1ASN A;  2JJG A;  1CZE A;  1TOG A;  3WGC A;  2DGM A;  1B9H A;  4MKJ A;  4WLJ A;  3WY7 A;  4AO4 A;  1C7O A;  1X2A A;  1S08 A;  1W7M A;  2CJD A;  2EPJ A;  3A9X A;  4PIW A;  1ZOD A;  2BYL A;  3N5M A;  3PPL A;  3FCR A;  2BWP A;  1AIB A;  1CQ7 A;  3I16 A;  4R2N A;  4ZDP A;  4F5I A;  4UHM A;  2VMT A;  1TPL A;  1KKP A;  3MAF B;  3OP7 A;  2ZC0 A;  1E5E A;  1ASC A;  2VI9 A;  3LV2 A;  3EUC A;  4KAM A;  4DGT A;  4F5G A;  1JS6 A;  2PB2 A;  5G4J A;  3E9K A;  1Z7D A;  3FZ8 A;  1P3W A;  4IX8 A;  3AEM C;  1IX8 A;  5EUN A;  3HL2 A;  2OKK A;  4XJP A;  2GSA A;  1CZC A;  1OXO A;  3BS8 A;  3AEN A;  4HF8 A;  1DGE A;  1WYU B;  2W8J A;  2FN6 A;  1WKH A;  4Q6R A;  4IXZ A;  4W5K A;  1ARG A;  5EAA A;  1AKC A;  1M4N A;  3FVX A;  4WB0 A;  1CQ8 A;  1LC7 A;  4GRX A;  4ZSY A;  1DGD A;  1GDE A;  5G0A A;  3RBF A;  3T32 A;  5LHA A;  3E2F A;  1JF9 A;  3PA9 A;  4OC9 A;  2O0R A;  2VMN A;  4GE4 A;  4LW2 A;  3P1T A;  1GC2 A;  1I43 A;  4LC3 A;  2BI2 A;  3AOW A;  3FQ8 A;  3VK3 A;  2AY4 A;  4R5Z A;  2DR1 A;  3HMU A;  1TOJ A;  3KKI A;  1ARS A;  1DJ9 A;  1C7G A;  2CJH A;  4W1V A;  1KKJ A;  2C0R A;  4J5U A;  2VGV A;  1IBJ A;  2C81 A;  1X0M A;  3QM2 A;  3A9Y A;  1M0O A;  2BIG A;  4N0B A;  4GSA A;  5I92 A;  3WLX A;  3ELP A;  5D95 A;  5EIG A;  2QMA A;  4EB5 A;  2VMW A;  2VI8 A;  2V1P A;  3AEN B;  4GEB A;  1TAS A;  2Z9W A;  2AY8 A;  3L8A A;  1AIA A;  2OAT A;  3TAT A;  1QGN A;  1H0C A;  2D64 A;  3FZ7 A;  3R4T A;  4WB0 B;  4LNL A;  3DU4 A;  3LVL B;  4E1O A;  2BI9 A;  1OHV A;  1E5F A;  4WYF A;  4U1T A;  5DB5 A;  2AY2 A;  2E7J A;  1MAQ A;  1D7V A;  3AAT A;  4BA4 A;  4IY7 A;  3VOM A;  2VGT A;  4KYO A;  1GBN A;  4AOA A;  2CAN A;  4RKC A;  1DKA A;  4IXS A;  3QN6 A;  4ADC A;  1B5O A;  1EQB A;  2CH1 A;  4RLG A;  4EMY A;  1ELU A;  4RM1 A;  1Z3Z A;  3FVU A;  1BS0 A;  3NYU A;  1D7U A;  1ASM A;  3K28 A;  3LY1 A;  3VAX A;  1AMS A;  5G4I A;  2YHK A;  2YCN A;  1OHY A;  2QBT A;  1WYT A;  4A0G A;  3AEO A;  1XI9 A;  3BCA A;  1YJZ A;  3FVS A;  4RIT A;  1QJ5 A;  2DKJ A;  1MLY A;  7AAT A;  2VMS A;  1YIZ A;  5EIG B;  2CIN A;  3GZC A;  2D65 A;  3A8U X;  4WYD A;  1V2D A;  2HUF A;  1D7S A;  4R5F A;  2Z1Z A;  5JAY A;  4BQ0 A;  1WKG A;  1IJI A;  3H14 A;  3FD0 A;  3W1I A;  4MQR A;  5D5S A;  1CS1 A;  1H1C A;  4JEW A;  1SF2 A;  2O1B A;  1KL2 A;  1M0Q A;  2HUU A;  2R5E A;  3DRD A;  3LVK A;  4Y0H A;  3UAK A;  4UOY A;  2WK9 A;  3NYS A;  1ELQ A;  3E6G A;  4P3M A;  4A0F A;  4JF1 A;  4F5H A;  4HVK A;  5IWQ A;  2VGS A;  4A6T A;  1UU2 A;  1YJY A;  3TQX A;  3EZS A;  4ITG A;  1KMK A;  2WK8 A;  5F8V A;  1GC0 A;  1AMA A;  1X28 A;  4Y0I A;  4CXQ A;  3NU8 A;  3FRK A;  1Y4I A;  2W8V A;  3OKS A;  3ACZ A;  2R0T A;  2QB3 A;  3BCB A;  3FFR A;  1MLZ A;  2BIE A;  3FKD A;  3NU7 A;  2BI3 A;  4ISY A;  1M7Y A;  4Y0D A;  1AMQ A;  2BHX A;  1W7L A;  1B5P A;  1IUG A;  1WYT B;  2Z20 A;  3NYT A;  4WXF A;  1U08 A;  4TMR A;  3DR7 A;  3A2B A;  5EAV A;  1YAA A;  2C7T A;  3EI9 A;  3P6K A;  3MAD A;  4A00 A;  4F4E A;  1RV3 A;  1BQA A;  2VYC A;  5E5I A;  2VLH A;  1BJW A;  3RBL A;  2W7D A;  1QIS A;  2WKA A;  3ELE A;  2OGA A;  5EUE A;  1RVY A;  3WGB A;  2AY9 A;  4MGR A;  1B9I A;  1GCK A;  1UU1 A;  4RIZ A;  3NX3 A;  4UHO A;  4XAU A;  3GWP A;  3QPG A;  4DQ6 A;  1AY4 A;  1ASA A;  1J32 A;  2AEU A;  2BWO A;  1CQ6 A;  3QGU A;  3E2Y A;  1BKG A;  3HDO A;  3RQ1 A;  3QI6 A;  4XJO A;  3WCN A;  2Z9V A;  1V72 A;  3PJ0 A;  3BCX A;  3ZZJ A;  2YKV A;  2XH1 A;  3LVM A;  4JEV A;  3ZRR A;  3BB8 A;  4AH3 A;  1AJS A;  3MKJ A;  3JU7 A;  2HP1 A;  2BI1 A;  1LW4 A;  2AAT A;  3EI8 A;  3RUY A;  1AAM A;  1BQD A;  2EZ2 A;  1DTY A;  1YNU A;  1G4V A;  3FSL A;  1ASE A;  3QHX A;  4KXK A;  2FM1 A;  1S0A A;  1KMJ A;  1IVR A;  4R8D A;  1ZC9 A;  1W23 A;  2BIA A;  4ZWM A;  3DC1 A;  2RFV A;  1PFF A;  4RAE A;  1SFF A;  3BWN A;  3NNK A;  2W7E A;  4B9B A;  5BJ4 A;  3FZ6 A;  3RCH A;  3JW9 A;  3GSB A;  5BJ3 A;  1EJI A;  3QBO A;  3VK4 A;  2ORD A;  2YKX A;  1SVV A;  4WYG A;  3E2Z A;  1S06 A;  4Q76 A;  1AX4 A;  1BJO A;  2JG2 A;  5HDM A;  1LW5 A;  3BC8 A;  2HOZ A;  3BWO A;  1DJE A;  4LNJ A;  4MSO A;  4CBR A;  1RV4 A;  3H7F A;  4BMK A;  1IAY A;  2D7Y A;  2PB0 A;  1C0N A;  1N31 A;  1N8P A;  1J04 A;  1VEF A;  5TF5 A;  2G6W A;  4MQQ A;  1ASL A;  5EUD A;  2BYJ A;  5M4D A;  1O4S A;  2CFB A;  2HOY A;  1AJS B;  4IYO B;  2D7Z A;  3I5T A;  3MEB A;  1AAW A;  4UHN A;  3PDX A;  3F9T A;  2AY3 A;  2ZJG A;  2VMX A;  4WXB A;  2W7K A;  1V2F A;  3RI6 A;  2YRR A;  4F5K A;  1AY5 A;  3I4J A;  3NUB A;  5K8B A;  1AKA A;  2V0Y A;  3A9Z A;  1UKJ A;  3FDD A;  3Q8N A;  2ZY3 A;  4CVQ A;  4A6R A;  2OGE A;  1M0N A;  2R5C A;  3CQ4 A;  3RCH B;  1O69 A;  1JG8 A;  2JJH A;  2DKB A;  1GC3 A;  2O7C A;  3E2Z B;  3AEJ A;  4UQV A;  5G2Q A;  1BJO B;  3CQ5 A;  1AKB A;  1ASB A;  2HUI A;  5E3K A;  2E7U A;  4ZDL A;  4P7Y A;  2Z9U A;  1QZ9 A;  2GMS A;  2VLF A;  1KL1 A;  4J8L A;  3WZF A;  3BWN C;  4EFF A;  4GDY A;  1BJN A;  1ART A;  2VIB A;  2Z67 A;  4E3R A;  1IAX A;  1G7W A;  2VGU A;  2CJG A;  3ASA A;  3EZ1 A;  4LNM A;  3L44 A;  4BHD A;  4E77 A;  2YCP A;  4WBT A;  2GB3 A;  4N0W A;  2FNI A;  4O6Z A;  4XEW A;  2QB2 A;  2AY1 A;  1RVU A;  3K40 A;  4EU1 A;  2D66 A;  1GD9 A;  2ZYJ A;  4QGR A;  3UWC A;  2W7G A;  4A6U A;  4WYA A;  1ASF A;  1FG3 A;  3BN1 A;  2ZY4 A;  2FNU A;  1DFO A;  4JF0 A;  2HOX A;  2JJF A;  1AJR A;  4MY5 A;  5C6U A;  2YOB A;  4GE9 A;  5J8Q A;  1VP4 A;  3JWB A;  4XJM A;  4ADD A;  2VMU A;  3CAI A;  4WP0 A;  4TN4 A;  2BWN A;  3UE8 A;  2JJE A;  2R5C B;  1GEY A;  1TAT A;  3W1H A;  2HZP A;  5FT8 A;  3IHJ A;  4JE5 A;  2X8U A;  4WD2 A;  4ZAS A;  3FDB A;  3AOV A;  3ATH A;  1OAT A;  1G4X A;  1IX7 A;  1C9C A;  4OT8 A;  3GZD A;  4F5J A;  2JIS A;  4ZAH A;  3G0T A;  1GEX A;  3HBX A;  4ZM3 A;  2R2N A;  4XK1 A;  2CH2 A;  3FFH A;  2CB1 A;  2DGL A;  2VMV A;  3PGY A;  4EB7 A;  1FG7 A;  2W8U A;  4RJ0 A;  5FT5 A;  1LC8 A;  2VMO A;  2DOU A;  4IW7 A;  3AEJ C;  2VMP A;  4ZSW A;  5DX5 A;  4JEX A;  4RKD A;  1D2F A;  1S09 A;  1X29 A;  4OMA A;  5EFS A;  1ARH A;  2EO5 A;  4OBV A;  4WXG A;  2AY6 A;  4Q75 A;  3KGX A;  4TV7 A;  2ZY2 A;  1SZS A;  3PDB A;  1C7N A;  3LG0 A;  1XEY A; 
#chains in the Genus database with same CATH topology
 2VIA A;  2VMR A;  2FQ6 A;  1I41 A;  2D61 A;  2X5D A;  3VK2 A;  2VMY A;  2AEV A;  1BJ4 A;  3M5U A;  2YKY A;  3HQT A;  4BA5 A;  5F9S A;  2OKJ A;  4MKK A;  1D7R A;  3MBB A;  3N75 A;  3G8M A;  5M49 A;  1O61 A;  1SPA A;  3F0H A;  4IYO A;  1T3I A;  1PMO A;  1M6S A;  1S07 A;  1EG5 A;  2C44 A;  3B1D A;  3EI5 A;  2GMU A;  3JTX A;  3NRA A;  4PFN A;  3PAA A;  4L0O A;  5G09 A;  4MQP A;  2YKU A;  4W91 A;  2ZP7 A;  4H51 A;  3ZRP A;  1QIT A;  2AY7 A;  1JS3 A;  1IX6 A;  1MAP A;  3TCM A;  3USF A;  3KGW A;  5AX8 A;  4JE5 D;  3II0 A;  3W1J A;  3NUI A;  1V2E A;  1M32 A;  1WYV A;  2ZUK A;  4F5M A;  3B1C A;  2QLR A;  3GZD C;  2BI5 A;  1ECX A;  3EIA A;  4K2I A;  1W3U A;  1ASD A;  3G7Q A;  4OYT A;  4NOG A;  4A0H A;  2VMZ A;  1QJ3 A;  1MDO A;  4OCA A;  5LH9 A;  3NTJ A;  3PDB B;  4ADB A;  1B8G A;  1AY8 A;  3JZL A;  2BKW A;  1MDX A;  3HLM A;  3HT4 A;  3HVY A;  3ASB A;  5E4Z A;  1LKC A;  1OHW A;  1UU0 A;  1SZU A;  4XQ2 A;  4RJY A;  5M4B A;  1TOE A;  1YIY A;  2Q7W A;  1WST A;  3EI6 A;  4ATP A;  4LW4 A;  1ORD A;  1ARI A;  1AHY A;  3COG A;  4U2H A;  2X3L A;  2X5F A;  1AHF A;  2QSR A;  3ECD A;  2VGZ A;  2Z1Y A;  2W7M A;  4ITX A;  2W7F A;  4M2K A;  1TOI A;  1B4X A;  3TFT A;  2FYF A;  3B8X A;  3IF2 A;  4A72 A;  3EIB A;  4K2B A;  2HOR A;  2W7I A;  4AZK A;  2ZSL A;  3ZZK A;  1WYV B;  3TFU A;  1TAR A;  5FT4 A;  4DBC A;  1CJ0 A;  3PD6 A;  5HXX A;  1G7X A;  4M2M A;  1SZK A;  5FT6 A;  3WKR A;  2GQN A;  3DZZ A;  5HHY A;  3DOD A;  1FC4 A;  2ZSM A;  9AAT A;  2W8T A;  2XBN A;  3AEP A;  8AAT A;  4W8I A;  1DJU A;  3PIU A;  2PO3 A;  2EZ1 A;  3MC6 A;  1W7N A;  1QIR A;  2YCT A;  4W1X A;  2EYQ A;  2QA3 A;  4W1W A;  3WCO A;  1O62 A;  3WX9 A;  3FQ7 A;  1YJS A;  3GJU A;  1GEW A;  1LS3 A;  1AHE A;  2CTZ A;  5M46 A;  2EGY A;  2W7H A;  5DJ1 A;  3D6K A;  4OBU A;  1PMM A;  3R9A A;  3AV7 A;  4ZWV A;  3LVJ A;  3DXW A;  5G2P A;  2W7J A;  4ZM4 A;  1GC4 A;  1BT4 A;  1VJO A;  4F5L A;  1LK9 A;  2DGK A;  3VP6 A;  1OXP A;  2CY8 A;  2A1V A;  3K7Y A;  2CST A;  1BW0 A;  3LWS A;  3WKS A;  2D5Y A;  2D63 A;  3AEL A;  4FL0 A;  4FFC A;  2Z9X A;  2Z61 A;  4PFF A;  4E3Q A;  1I29 A;  1N2T A;  3NDN A;  1C4K A;  1LC5 A;  3BV0 A;  3B1E A;  4ZDO A;  4IXO A;  3PD6 B;  3GET A;  4B98 A;  1TOK A;  3KE3 A;  4A0R A;  3FQA A;  4JEY A;  1AHX A;  3GBX A;  1AMR A;  4PVF A;  1MGV A;  1PG8 A;  2ZY5 A;  2W8W A;  2E54 A;  4M2J A;  4AZJ A;  4CBS A;  1ZOB A;  2E7I A;  3N0L A;  2JGT A;  3F6T A;  4AO9 A;  4H63 Q;  1I48 A;  1MDZ A;  4Q31 A;  2HP2 A;  5EQC A;  3AEM A;  3ZRQ A;  1ASG A;  4JEZ A;  3ISL A;  1AIC A;  3GR9 A;  3JWA A;  3FTB A;  3DXV A;  2NMP A;  1CL1 A;  3CBF A;  3MAF A;  4K2M A;  1M0P A;  3MC6 C;  4WYE A;  3B46 A;  3MAU A;  4XJL A;  5DJ9 A;  3DYD A;  4CXR A;  2WK7 A;  2YRI A;  4WLH A;  2W7L A;  3CQ6 A;  2VGW A;  3E77 A;  4OTL A;  4ADE A;  1CL2 A;  1YOO A;  4ZLV A;  2OQX A;  4WYC A;  2EH6 A;  3DR4 A;  4I8A A;  4ATQ A;  1WYU A;  2AY5 A;  4GE7 A;  2F8J A;  1AHG A;  2VMQ A;  4F5F A;  2TPL A;  3EI7 A;  1ASN A;  2JJG A;  1CZE A;  1TOG A;  2KFP A;  3WGC A;  2DGM A;  1B9H A;  4MKJ A;  4WLJ A;  3WY7 A;  4AO4 A;  1C7O A;  1X2A A;  1S08 A;  1W7M A;  2CJD A;  2EPJ A;  3A9X A;  4PIW A;  1ZOD A;  2BYL A;  3N5M A;  3PPL A;  3FCR A;  2BWP A;  1AIB A;  1CQ7 A;  3I16 A;  4R2N A;  4ZDP A;  4F5I A;  4UHM A;  2VMT A;  1TPL A;  1KKP A;  3MAF B;  3OP7 A;  2ZC0 A;  1E5E A;  1ASC A;  2VI9 A;  3LV2 A;  3EUC A;  4KAM A;  4DGT A;  4F5G A;  1JS6 A;  2PB2 A;  5G4J A;  3E9K A;  1Z7D A;  3FZ8 A;  1P3W A;  4IX8 A;  3AEM C;  1IX8 A;  5EUN A;  3HL2 A;  2OKK A;  4XJP A;  2GSA A;  1CZC A;  1OXO A;  3BS8 A;  3AEN A;  4HF8 A;  1DGE A;  1WYU B;  2W8J A;  2FN6 A;  1WKH A;  4Q6R A;  4IXZ A;  4W5K A;  1ARG A;  5EAA A;  2FKI A;  1AKC A;  1M4N A;  3FVX A;  4WB0 A;  1CQ8 A;  1LC7 A;  4GRX A;  4ZSY A;  1DGD A;  1GDE A;  5G0A A;  3RBF A;  3T32 A;  5LHA A;  3E2F A;  1JF9 A;  3PA9 A;  4OC9 A;  2O0R A;  2VMN A;  4GE4 A;  4LW2 A;  3P1T A;  1GC2 A;  1I43 A;  4LC3 A;  3N4S A;  2BI2 A;  3AOW A;  3FQ8 A;  3VK3 A;  2AY4 A;  4R5Z A;  2DR1 A;  3HMU A;  1TOJ A;  3KKI A;  1ARS A;  1DJ9 A;  1C7G A;  2CJH A;  3N4R A;  4W1V A;  1KKJ A;  2C0R A;  4J5U A;  2VGV A;  1IBJ A;  2C81 A;  1X0M A;  3QM2 A;  3A9Y A;  1M0O A;  2BIG A;  4N0B A;  4GSA A;  5I92 A;  3WLX A;  3ELP A;  5D95 A;  5EIG A;  2QMA A;  4EB5 A;  2VMW A;  2VI8 A;  2V1P A;  3AEN B;  4GEB A;  1TAS A;  2Z9W A;  2AY8 A;  3L8A A;  1AIA A;  2OAT A;  3TAT A;  1QGN A;  1H0C A;  2D64 A;  3FZ7 A;  3R4T A;  4WB0 B;  4LNL A;  3DU4 A;  3LVL B;  4E1O A;  2BI9 A;  1OHV A;  1E5F A;  4WYF A;  4U1T A;  5DB5 A;  2AY2 A;  2E7J A;  1MAQ A;  1D7V A;  3AAT A;  4BA4 A;  4IY7 A;  3VOM A;  2VGT A;  4KYO A;  1GBN A;  4AOA A;  2CAN A;  4RKC A;  1DKA A;  4IXS A;  3QN6 A;  4ADC A;  1B5O A;  1EQB A;  2CH1 A;  4RLG A;  4EMY A;  1ELU A;  4RM1 A;  1Z3Z A;  3FVU A;  1BS0 A;  3NYU A;  1D7U A;  1ASM A;  3K28 A;  3LY1 A;  3VAX A;  1AMS A;  5G4I A;  2YHK A;  2YCN A;  1OHY A;  2QBT A;  1WYT A;  4A0G A;  3AEO A;  1XI9 A;  3BCA A;  1YJZ A;  3FVS A;  4RIT A;  1QJ5 A;  2DKJ A;  1MLY A;  7AAT A;  2VMS A;  1YIZ A;  5EIG B;  2CIN A;  3GZC A;  2D65 A;  3A8U X;  4WYD A;  1V2D A;  2HUF A;  1D7S A;  4R5F A;  2Z1Z A;  5JAY A;  4BQ0 A;  1WKG A;  1IJI A;  3H14 A;  3FD0 A;  3W1I A;  4MQR A;  5D5S A;  1CS1 A;  1H1C A;  4JEW A;  1SF2 A;  2O1B A;  1KL2 A;  1M0Q A;  2HUU A;  2R5E A;  3DRD A;  3LVK A;  4Y0H A;  3UAK A;  2WB6 A;  4UOY A;  2WK9 A;  3NYS A;  1ELQ A;  3E6G A;  4P3M A;  4A0F A;  4JF1 A;  4F5H A;  4HVK A;  5IWQ A;  2VGS A;  4A6T A;  1UU2 A;  1YJY A;  3TQX A;  3EZS A;  4ITG A;  1KMK A;  2WK8 A;  5F8V A;  1GC0 A;  1AMA A;  1X28 A;  4Y0I A;  4CXQ A;  3NU8 A;  3FRK A;  1Y4I A;  2W8V A;  3OKS A;  3ACZ A;  2R0T A;  2QB3 A;  3BCB A;  3FFR A;  1MLZ A;  2BIE A;  3FKD A;  3NU7 A;  2BI3 A;  4ISY A;  1M7Y A;  4Y0D A;  1AMQ A;  2BHX A;  1W7L A;  1B5P A;  1IUG A;  1WYT B;  2Z20 A;  3NYT A;  4WXF A;  1U08 A;  4TMR A;  3DR7 A;  3A2B A;  5EAV A;  1YAA A;  2C7T A;  3EI9 A;  3P6K A;  3MAD A;  4A00 A;  4F4E A;  1RV3 A;  1BQA A;  2VYC A;  5E5I A;  2VLH A;  1BJW A;  3RBL A;  2W7D A;  1QIS A;  2WKA A;  3ELE A;  2OGA A;  5EUE A;  1RVY A;  3WGB A;  2AY9 A;  4MGR A;  1B9I A;  1GCK A;  1UU1 A;  4RIZ A;  3NX3 A;  4UHO A;  4XAU A;  3GWP A;  3QPG A;  4DQ6 A;  1AY4 A;  1ASA A;  1J32 A;  2AEU A;  2BWO A;  1CQ6 A;  3QGU A;  3E2Y A;  1BKG A;  3HDO A;  3RQ1 A;  3QI6 A;  4XJO A;  3WCN A;  2Z9V A;  1V72 A;  3PJ0 A;  3BCX A;  3ZZJ A;  2YKV A;  2XH1 A;  3LVM A;  4JEV A;  3ZRR A;  3BB8 A;  4AH3 A;  1AJS A;  3MKJ A;  3JU7 A;  2HP1 A;  2BI1 A;  1LW4 A;  2AAT A;  3EI8 A;  3RUY A;  1AAM A;  1BQD A;  2EZ2 A;  1DTY A;  1YNU A;  1G4V A;  3FSL A;  1ASE A;  3QHX A;  4KXK A;  2FM1 A;  1S0A A;  1KMJ A;  1IVR A;  4R8D A;  1ZC9 A;  1W23 A;  2BIA A;  4ZWM A;  3DC1 A;  2RFV A;  1PFF A;  4RAE A;  1SFF A;  3BWN A;  3NNK A;  2W7E A;  4B9B A;  5BJ4 A;  3FZ6 A;  3RCH A;  3JW9 A;  3GSB A;  5BJ3 A;  1EJI A;  3QBO A;  3VK4 A;  2ORD A;  2YKX A;  1SVV A;  4WYG A;  3E2Z A;  1S06 A;  4Q76 A;  1AX4 A;  1BJO A;  2JG2 A;  5HDM A;  1LW5 A;  3BC8 A;  2HOZ A;  3BWO A;  5KTB A;  1DJE A;  3H9X A;  4LNJ A;  4MSO A;  4CBR A;  1RV4 A;  3H7F A;  4BMK A;  1IAY A;  2D7Y A;  2PB0 A;  1C0N A;  1N31 A;  1N8P A;  1J04 A;  1VEF A;  5TF5 A;  2G6W A;  4MQQ A;  1ASL A;  5EUD A;  2BYJ A;  5M4D A;  1O4S A;  2CFB A;  2HOY A;  1AJS B;  4IYO B;  2D7Z A;  3I5T A;  3MEB A;  1AAW A;  4UHN A;  3PDX A;  3F9T A;  2AY3 A;  2ZJG A;  2VMX A;  4WXB A;  2W7K A;  3N7N A;  1V2F A;  3RI6 A;  2YRR A;  4F5K A;  1AY5 A;  3I4J A;  3NUB A;  5K8B A;  1AKA A;  2V0Y A;  3A9Z A;  1UKJ A;  3FDD A;  3Q8N A;  2ZY3 A;  4CVQ A;  4A6R A;  2OGE A;  1M0N A;  2R5C A;  3CQ4 A;  3RCH B;  1O69 A;  1JG8 A;  2JJH A;  2DKB A;  1GC3 A;  2O7C A;  3E2Z B;  3AEJ A;  4UQV A;  5G2Q A;  1BJO B;  3CQ5 A;  1AKB A;  1ASB A;  2HUI A;  5E3K A;  2E7U A;  4ZDL A;  4P7Y A;  2Z9U A;  1QZ9 A;  2GMS A;  2VLF A;  1KL1 A;  4J8L A;  3WZF A;  3BWN C;  4EFF A;  1KAF A;  4GDY A;  1BJN A;  1ART A;  2VIB A;  2Z67 A;  4E3R A;  1IAX A;  1G7W A;  2VGU A;  2CJG A;  3ASA A;  3EZ1 A;  4LNM A;  3L44 A;  4BHD A;  4E77 A;  2YCP A;  4WBT A;  2GB3 A;  4N0W A;  2FNI A;  4O6Z A;  4XEW A;  2QB2 A;  2AY1 A;  1RVU A;  3K40 A;  4EU1 A;  2D66 A;  1GD9 A;  2ZYJ A;  4QGR A;  3UWC A;  2W7G A;  4A6U A;  4WYA A;  1ASF A;  1FG3 A;  3BN1 A;  2ZY4 A;  2FNU A;  1DFO A;  4JF0 A;  2HOX A;  2JJF A;  1AJR A;  4MY5 A;  5C6U A;  2YOB A;  4GE9 A;  5J8Q A;  1VP4 A;  3JWB A;  4XJM A;  4ADD A;  4K05 A;  2VMU A;  3CAI A;  4WP0 A;  4TN4 A;  2BWN A;  3UE8 A;  2JJE A;  2R5C B;  1GEY A;  1TAT A;  3N4X A;  3W1H A;  2HZP A;  5FT8 A;  3IHJ A;  4JE5 A;  2X8U A;  4WD2 A;  4ZAS A;  3FDB A;  3AOV A;  3ATH A;  1OAT A;  1G4X A;  1IX7 A;  1C9C A;  4OT8 A;  3GZD A;  4F5J A;  2JIS A;  4ZAH A;  3G0T A;  1GEX A;  3HBX A;  4ZM3 A;  2R2N A;  4XK1 A;  2CH2 A;  3FFH A;  2CB1 A;  2DGL A;  2VMV A;  3PGY A;  4EB7 A;  1FG7 A;  2W8U A;  4RJ0 A;  5FT5 A;  1LC8 A;  2VMO A;  2DOU A;  4IW7 A;  3AEJ C;  2VMP A;  4ZSW A;  5DX5 A;  2G7J A;  4JEX A;  4RKD A;  1D2F A;  1S09 A;  1X29 A;  4OMA A;  5EFS A;  1ARH A;  2EO5 A;  4OBV A;  4WXG A;  2AY6 A;  4Q75 A;  3KGX A;  4TV7 A;  2ZY2 A;  1SZS A;  3PDB A;  1C7N A;  3LG0 A;  1XEY A; 
#chains in the Genus database with same CATH homology
 2VIA A;  2VMR A;  2FQ6 A;  1I41 A;  2D61 A;  2X5D A;  3VK2 A;  2VMY A;  2AEV A;  1BJ4 A;  3M5U A;  2YKY A;  3HQT A;  4BA5 A;  5F9S A;  2OKJ A;  4MKK A;  1D7R A;  3MBB A;  3N75 A;  3G8M A;  5M49 A;  1O61 A;  1SPA A;  3F0H A;  4IYO A;  1T3I A;  1PMO A;  1M6S A;  1S07 A;  1EG5 A;  2C44 A;  3B1D A;  3EI5 A;  2GMU A;  3JTX A;  3NRA A;  4PFN A;  3PAA A;  4L0O A;  5G09 A;  4MQP A;  2YKU A;  4W91 A;  2ZP7 A;  4H51 A;  3ZRP A;  1QIT A;  2AY7 A;  1JS3 A;  1IX6 A;  1MAP A;  3TCM A;  3USF A;  3KGW A;  5AX8 A;  4JE5 D;  3II0 A;  3W1J A;  3NUI A;  1V2E A;  1M32 A;  1WYV A;  2ZUK A;  4F5M A;  3B1C A;  2QLR A;  3GZD C;  2BI5 A;  1ECX A;  3EIA A;  4K2I A;  1W3U A;  1ASD A;  3G7Q A;  4OYT A;  4NOG A;  4A0H A;  2VMZ A;  1QJ3 A;  1MDO A;  4OCA A;  5LH9 A;  3NTJ A;  3PDB B;  4ADB A;  1B8G A;  1AY8 A;  3JZL A;  2BKW A;  1MDX A;  3HLM A;  3HT4 A;  3HVY A;  3ASB A;  5E4Z A;  1LKC A;  1OHW A;  1UU0 A;  1SZU A;  4XQ2 A;  4RJY A;  5M4B A;  1TOE A;  1YIY A;  2Q7W A;  1WST A;  3EI6 A;  4ATP A;  4LW4 A;  1ORD A;  1ARI A;  1AHY A;  3COG A;  4U2H A;  2X3L A;  2X5F A;  1AHF A;  2QSR A;  3ECD A;  2VGZ A;  2Z1Y A;  2W7M A;  4ITX A;  2W7F A;  4M2K A;  1TOI A;  1B4X A;  3TFT A;  2FYF A;  3B8X A;  3IF2 A;  4A72 A;  3EIB A;  4K2B A;  2HOR A;  2W7I A;  4AZK A;  2ZSL A;  3ZZK A;  1WYV B;  3TFU A;  1TAR A;  5FT4 A;  4DBC A;  1CJ0 A;  3PD6 A;  5HXX A;  1G7X A;  4M2M A;  1SZK A;  5FT6 A;  3WKR A;  2GQN A;  3DZZ A;  5HHY A;  3DOD A;  1FC4 A;  2ZSM A;  9AAT A;  2W8T A;  2XBN A;  3AEP A;  8AAT A;  4W8I A;  1DJU A;  3PIU A;  2PO3 A;  2EZ1 A;  3MC6 A;  1W7N A;  1QIR A;  2YCT A;  4W1X A;  2EYQ A;  2QA3 A;  4W1W A;  3WCO A;  1O62 A;  3WX9 A;  3FQ7 A;  1YJS A;  3GJU A;  1GEW A;  1LS3 A;  1AHE A;  2CTZ A;  5M46 A;  2EGY A;  2W7H A;  5DJ1 A;  3D6K A;  4OBU A;  1PMM A;  3R9A A;  3AV7 A;  4ZWV A;  3LVJ A;  3DXW A;  5G2P A;  2W7J A;  4ZM4 A;  1GC4 A;  1BT4 A;  1VJO A;  4F5L A;  1LK9 A;  2DGK A;  3VP6 A;  1OXP A;  2CY8 A;  2A1V A;  3K7Y A;  2CST A;  1BW0 A;  3LWS A;  3WKS A;  2D5Y A;  2D63 A;  3AEL A;  4FL0 A;  4FFC A;  2Z9X A;  2Z61 A;  4PFF A;  4E3Q A;  1I29 A;  1N2T A;  3NDN A;  1C4K A;  1LC5 A;  3BV0 A;  3B1E A;  4ZDO A;  4IXO A;  3PD6 B;  3GET A;  4B98 A;  1TOK A;  3KE3 A;  4A0R A;  3FQA A;  4JEY A;  1AHX A;  3GBX A;  1AMR A;  4PVF A;  1MGV A;  1PG8 A;  2ZY5 A;  2W8W A;  2E54 A;  4M2J A;  4AZJ A;  4CBS A;  1ZOB A;  2E7I A;  3N0L A;  2JGT A;  3F6T A;  4AO9 A;  4H63 Q;  1I48 A;  1MDZ A;  4Q31 A;  2HP2 A;  5EQC A;  3AEM A;  3ZRQ A;  1ASG A;  4JEZ A;  3ISL A;  1AIC A;  3GR9 A;  3JWA A;  3FTB A;  3DXV A;  2NMP A;  1CL1 A;  3CBF A;  3MAF A;  4K2M A;  1M0P A;  3MC6 C;  4WYE A;  3B46 A;  3MAU A;  4XJL A;  5DJ9 A;  3DYD A;  4CXR A;  2WK7 A;  2YRI A;  4WLH A;  2W7L A;  3CQ6 A;  2VGW A;  3E77 A;  4OTL A;  4ADE A;  1CL2 A;  1YOO A;  4ZLV A;  2OQX A;  4WYC A;  2EH6 A;  3DR4 A;  4I8A A;  4ATQ A;  1WYU A;  2AY5 A;  4GE7 A;  2F8J A;  1AHG A;  2VMQ A;  4F5F A;  2TPL A;  3EI7 A;  1ASN A;  2JJG A;  1CZE A;  1TOG A;  2KFP A;  3WGC A;  2DGM A;  1B9H A;  4MKJ A;  4WLJ A;  3WY7 A;  4AO4 A;  1C7O A;  1X2A A;  1S08 A;  1W7M A;  2CJD A;  2EPJ A;  3A9X A;  4PIW A;  1ZOD A;  2BYL A;  3N5M A;  3PPL A;  3FCR A;  2BWP A;  1AIB A;  1CQ7 A;  3I16 A;  4R2N A;  4ZDP A;  4F5I A;  4UHM A;  2VMT A;  1TPL A;  1KKP A;  3MAF B;  3OP7 A;  2ZC0 A;  1E5E A;  1ASC A;  2VI9 A;  3LV2 A;  3EUC A;  4KAM A;  4DGT A;  4F5G A;  1JS6 A;  2PB2 A;  5G4J A;  3E9K A;  1Z7D A;  3FZ8 A;  1P3W A;  4IX8 A;  3AEM C;  1IX8 A;  5EUN A;  3HL2 A;  2OKK A;  4XJP A;  2GSA A;  1CZC A;  1OXO A;  3BS8 A;  3AEN A;  4HF8 A;  1DGE A;  1WYU B;  2W8J A;  2FN6 A;  1WKH A;  4Q6R A;  4IXZ A;  4W5K A;  1ARG A;  5EAA A;  2FKI A;  1AKC A;  1M4N A;  3FVX A;  4WB0 A;  1CQ8 A;  1LC7 A;  4GRX A;  4ZSY A;  1DGD A;  1GDE A;  5G0A A;  3RBF A;  3T32 A;  5LHA A;  3E2F A;  1JF9 A;  3PA9 A;  4OC9 A;  2O0R A;  2VMN A;  4GE4 A;  4LW2 A;  3P1T A;  1GC2 A;  1I43 A;  4LC3 A;  3N4S A;  2BI2 A;  3AOW A;  3FQ8 A;  3VK3 A;  2AY4 A;  4R5Z A;  2DR1 A;  3HMU A;  1TOJ A;  3KKI A;  1ARS A;  1DJ9 A;  1C7G A;  2CJH A;  3N4R A;  4W1V A;  1KKJ A;  2C0R A;  4J5U A;  2VGV A;  1IBJ A;  2C81 A;  1X0M A;  3QM2 A;  3A9Y A;  1M0O A;  2BIG A;  4N0B A;  4GSA A;  5I92 A;  3WLX A;  3ELP A;  5D95 A;  5EIG A;  2QMA A;  4EB5 A;  2VMW A;  2VI8 A;  2V1P A;  3AEN B;  4GEB A;  1TAS A;  2Z9W A;  2AY8 A;  3L8A A;  1AIA A;  2OAT A;  3TAT A;  1QGN A;  1H0C A;  2D64 A;  3FZ7 A;  3R4T A;  4WB0 B;  4LNL A;  3DU4 A;  3LVL B;  4E1O A;  2BI9 A;  1OHV A;  1E5F A;  4WYF A;  4U1T A;  5DB5 A;  2AY2 A;  2E7J A;  1MAQ A;  1D7V A;  3AAT A;  4BA4 A;  4IY7 A;  3VOM A;  2VGT A;  4KYO A;  1GBN A;  4AOA A;  2CAN A;  4RKC A;  1DKA A;  4IXS A;  3QN6 A;  4ADC A;  1B5O A;  1EQB A;  2CH1 A;  4RLG A;  4EMY A;  1ELU A;  4RM1 A;  1Z3Z A;  3FVU A;  1BS0 A;  3NYU A;  1D7U A;  1ASM A;  3K28 A;  3LY1 A;  3VAX A;  1AMS A;  5G4I A;  2YHK A;  2YCN A;  1OHY A;  2QBT A;  1WYT A;  4A0G A;  3AEO A;  1XI9 A;  3BCA A;  1YJZ A;  3FVS A;  4RIT A;  1QJ5 A;  2DKJ A;  1MLY A;  7AAT A;  2VMS A;  1YIZ A;  5EIG B;  2CIN A;  3GZC A;  2D65 A;  3A8U X;  4WYD A;  1V2D A;  2HUF A;  1D7S A;  4R5F A;  2Z1Z A;  5JAY A;  4BQ0 A;  1WKG A;  1IJI A;  3H14 A;  3FD0 A;  3W1I A;  4MQR A;  5D5S A;  1CS1 A;  1H1C A;  4JEW A;  1SF2 A;  2O1B A;  1KL2 A;  1M0Q A;  2HUU A;  2R5E A;  3DRD A;  3LVK A;  4Y0H A;  3UAK A;  2WB6 A;  4UOY A;  2WK9 A;  3NYS A;  1ELQ A;  3E6G A;  4P3M A;  4A0F A;  4JF1 A;  4F5H A;  4HVK A;  5IWQ A;  2VGS A;  4A6T A;  1UU2 A;  1YJY A;  3TQX A;  3EZS A;  4ITG A;  1KMK A;  2WK8 A;  5F8V A;  1GC0 A;  1AMA A;  1X28 A;  4Y0I A;  4CXQ A;  3NU8 A;  3FRK A;  1Y4I A;  2W8V A;  3OKS A;  3ACZ A;  2R0T A;  2QB3 A;  3BCB A;  3FFR A;  1MLZ A;  2BIE A;  3FKD A;  3NU7 A;  2BI3 A;  4ISY A;  1M7Y A;  4Y0D A;  1AMQ A;  2BHX A;  1W7L A;  1B5P A;  1IUG A;  1WYT B;  2Z20 A;  3NYT A;  4WXF A;  1U08 A;  4TMR A;  3DR7 A;  3A2B A;  5EAV A;  1YAA A;  2C7T A;  3EI9 A;  3P6K A;  3MAD A;  4A00 A;  4F4E A;  1RV3 A;  1BQA A;  2VYC A;  5E5I A;  2VLH A;  1BJW A;  3RBL A;  2W7D A;  1QIS A;  2WKA A;  3ELE A;  2OGA A;  5EUE A;  1RVY A;  3WGB A;  2AY9 A;  4MGR A;  1B9I A;  1GCK A;  1UU1 A;  4RIZ A;  3NX3 A;  4UHO A;  4XAU A;  3GWP A;  3QPG A;  4DQ6 A;  1AY4 A;  1ASA A;  1J32 A;  2AEU A;  2BWO A;  1CQ6 A;  3QGU A;  3E2Y A;  1BKG A;  3HDO A;  3RQ1 A;  3QI6 A;  4XJO A;  3WCN A;  2Z9V A;  1V72 A;  3PJ0 A;  3BCX A;  3ZZJ A;  2YKV A;  2XH1 A;  3LVM A;  4JEV A;  3ZRR A;  3BB8 A;  4AH3 A;  1AJS A;  3MKJ A;  3JU7 A;  2HP1 A;  2BI1 A;  1LW4 A;  2AAT A;  3EI8 A;  3RUY A;  1AAM A;  1BQD A;  2EZ2 A;  1DTY A;  1YNU A;  1G4V A;  3FSL A;  1ASE A;  3QHX A;  4KXK A;  2FM1 A;  1S0A A;  1KMJ A;  1IVR A;  4R8D A;  1ZC9 A;  1W23 A;  2BIA A;  4ZWM A;  3DC1 A;  2RFV A;  1PFF A;  4RAE A;  1SFF A;  3BWN A;  3NNK A;  2W7E A;  4B9B A;  5BJ4 A;  3FZ6 A;  3RCH A;  3JW9 A;  3GSB A;  5BJ3 A;  1EJI A;  3QBO A;  3VK4 A;  2ORD A;  2YKX A;  1SVV A;  4WYG A;  3E2Z A;  1S06 A;  4Q76 A;  1AX4 A;  1BJO A;  2JG2 A;  5HDM A;  1LW5 A;  3BC8 A;  2HOZ A;  3BWO A;  5KTB A;  1DJE A;  3H9X A;  4LNJ A;  4MSO A;  4CBR A;  1RV4 A;  3H7F A;  4BMK A;  1IAY A;  2D7Y A;  2PB0 A;  1C0N A;  1N31 A;  1N8P A;  1J04 A;  1VEF A;  5TF5 A;  2G6W A;  4MQQ A;  1ASL A;  5EUD A;  2BYJ A;  5M4D A;  1O4S A;  2CFB A;  2HOY A;  1AJS B;  4IYO B;  2D7Z A;  3I5T A;  3MEB A;  1AAW A;  4UHN A;  3PDX A;  3F9T A;  2AY3 A;  2ZJG A;  2VMX A;  4WXB A;  2W7K A;  3N7N A;  1V2F A;  3RI6 A;  2YRR A;  4F5K A;  1AY5 A;  3I4J A;  3NUB A;  5K8B A;  1AKA A;  2V0Y A;  3A9Z A;  1UKJ A;  3FDD A;  3Q8N A;  2ZY3 A;  4CVQ A;  4A6R A;  2OGE A;  1M0N A;  2R5C A;  3CQ4 A;  3RCH B;  1O69 A;  1JG8 A;  2JJH A;  2DKB A;  1GC3 A;  2O7C A;  3E2Z B;  3AEJ A;  4UQV A;  5G2Q A;  1BJO B;  3CQ5 A;  1AKB A;  1ASB A;  2HUI A;  5E3K A;  2E7U A;  4ZDL A;  4P7Y A;  2Z9U A;  1QZ9 A;  2GMS A;  2VLF A;  1KL1 A;  4J8L A;  3WZF A;  3BWN C;  4EFF A;  4GDY A;  1BJN A;  1ART A;  2VIB A;  2Z67 A;  4E3R A;  1IAX A;  1G7W A;  2VGU A;  2CJG A;  3ASA A;  3EZ1 A;  4LNM A;  3L44 A;  4BHD A;  4E77 A;  2YCP A;  4WBT A;  2GB3 A;  4N0W A;  2FNI A;  4O6Z A;  4XEW A;  2QB2 A;  2AY1 A;  1RVU A;  3K40 A;  4EU1 A;  2D66 A;  1GD9 A;  2ZYJ A;  4QGR A;  3UWC A;  2W7G A;  4A6U A;  4WYA A;  1ASF A;  1FG3 A;  3BN1 A;  2ZY4 A;  2FNU A;  1DFO A;  4JF0 A;  2HOX A;  2JJF A;  1AJR A;  4MY5 A;  5C6U A;  2YOB A;  4GE9 A;  5J8Q A;  1VP4 A;  3JWB A;  4XJM A;  4ADD A;  4K05 A;  2VMU A;  3CAI A;  4WP0 A;  4TN4 A;  2BWN A;  3UE8 A;  2JJE A;  2R5C B;  1GEY A;  1TAT A;  3N4X A;  3W1H A;  2HZP A;  5FT8 A;  3IHJ A;  4JE5 A;  2X8U A;  4WD2 A;  4ZAS A;  3FDB A;  3AOV A;  3ATH A;  1OAT A;  1G4X A;  1IX7 A;  1C9C A;  4OT8 A;  3GZD A;  4F5J A;  2JIS A;  4ZAH A;  3G0T A;  1GEX A;  3HBX A;  4ZM3 A;  2R2N A;  4XK1 A;  2CH2 A;  3FFH A;  2CB1 A;  2DGL A;  2VMV A;  3PGY A;  4EB7 A;  1FG7 A;  2W8U A;  4RJ0 A;  5FT5 A;  1LC8 A;  2VMO A;  2DOU A;  4IW7 A;  3AEJ C;  2VMP A;  4ZSW A;  5DX5 A;  2G7J A;  4JEX A;  4RKD A;  1D2F A;  1S09 A;  1X29 A;  4OMA A;  5EFS A;  1ARH A;  2EO5 A;  4OBV A;  4WXG A;  2AY6 A;  4Q75 A;  3KGX A;  4TV7 A;  2ZY2 A;  1SZS A;  3PDB A;  1C7N A;  3LG0 A;  1XEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...