1X2AA

Crystal structure of e.coli aspat complexed with n-phosphopyridoxyl-d-glutamic acid
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Binding of C5-dicarboxylic substrate to aspartate aminotransferase: implications for the conformational change at the transaldimination step.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 142
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1x2aA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1x2aA01
2D7ZA 2VGUA 3NTJA 3PDXA 7AATA 2VMPA 3FFHA 2W7IA 2VI8A 3NYTA 1CQ8A 2WK9A 3GSBA 4W1WA 3UAKA 1DKAA 2D63A 1XEYA 1O69A 4ZASA 1CQ7A 3E9KA 3RI6A 1B9HA 3WZFA 4ZM4A 3ASBA 2D7YA 4TN4A 3M5UA 1S06A 3KE3A 2DKBA 1SPAA 4ZSYA 5E5IA 1Y4IA 3MC6C 1KKJA 2Z9VA 4MGRA 1FG7A 2ZY3A 1V2FA 4A72A 1KMKA 2JGTA 1ARHA 2AY6A 4ADEA 1X0MA 4JF0A 5HHYA 1RV4A 1T3IA 2BYLA 2F8JA 3PD6A 3WCNA 1OXPA 2JJGA 4BHDA 3RBFA 3BWOA 4J8LA 4ZM3A 4W5KA 2HUFA 1AKBA 2RFVA 2GQNA 3L44A 3W1IA 1AMSA 4JE5A 4F5IA 4WXBA 2DR1A 3ZZJA 4UHMA 3NX3A 4OYTA 1AAMA 1ASAA 3E2ZB 4ZLVA 1AJSB 3TATA 3FD0A 4R8DA 3RQ1A 2C44A 3I4JA 4LNLA 1QZ9A 2R0TA 5G4JA 1P3WA 3BN1A 2O0RA 3BWNA 4ITGA 2VI9A 1BW0A 4AZKA 5EUDA 1LC5A 4JEYA 2HP1A 3FVUA 2EZ2A 3TQXA 4E1OA 4ZDOA 3K28A 2CINA 3ZRPA 1W7NA 1H1CA 1AHXA 1AIBA 3GR9A 3N75A 3LVMA 4M2KA 4WYEA 3NDNA 1CS1A 1LW5A 3LVKA 3ZRRA 1AX4A 1H0CA 1DGEA 2CTZA 4XQ2A 1G4XA 1AKAA 2BKWA 2TPLA 1CL2A 3E2FA 1MLYA 1M4NA 2ORDA 1GEYA 3W1JA 1O62A 2ZYJA 2R5CB 4ZDLA 1CZEA 1JG8A 1D7RA 2VMNA 1BQDA 5M46A 4F4EA 5EIGB 1V2DA 1ZODA 4WXFA 1YNUA 4ISYA 1N8PA 5FT6A 2O7CA 2W7JA 4KAMA 1ASGA 5FT8A 3FQAA 3FZ8A 2Z9WA 1QGNA 2VGVA 2YCTA 3BS8A 1AICA 2Z61A 1CZCA 1M32A 4E3RA 1BJOA 2CANA 5K8BA 3FRKA 2G6WA 1SVVA 1ELQA 4ZWVA 2YOBA 4XJPA 3R4TA 4CBSA 1N31A 1OHWA 1D7SA 1DTYA 1X28A 3WKSA 1ARTA 2BI5A 2FM1A 2QBTA 1RV3A 2ZUKA 1EG5A 3QBOA 3EUCA 1LKCA 4RKDA 3ELEA 3LVLB 3LVJA 1LC7A 1TARA 1ZOBA 4K2MA 4Q6RA 4ADBA 4W91A 2Z1YA 5LHAA 1C9CA 3P6KA 2XH1A 2W7KA 3FSLA 4LNMA 2X5DA 4ZAHA 4Q76A 1WYUA 2BHXA 4RKCA 1YAAA 1D7UA 5EUNA 2VMTA 2BI3A 1GC0A 3H14A 4MQRA 3UWCA 1WYVB 2OKKA 2CSTA 1W3UA 4MKKA 2AEVA 2VMRA 3BB8A 3NU7A 4M2JA 4PFNA 4WB0B 2YRIA 5G0AA 3WGCA 2CJGA 4PVFA 2BYJA 4AO9A 4A6RA 2OGEA 3USFA 4RIZA 1N2TA 1IX8A 2E7JA 2VMVA 3ACZA 4IXZA 4RITA 3AOVA 4BA4A 1KL2A 3F6TA 4ATQA 1DJUA 1S08A 5D95A 2WK7A 4XEWA 5F9SA 3QGUA 4FL0A 3PDBB 4K2BA 1ARSA 2W7GA 1SZUA 2W7FA 2BIGA 3K40A 4N0BA 2AY1A 2R2NA 2VMXA 3OP7A 4IXOA 2VGTA 3ZZKA 1OXOA 3BCXA 3EIBA 2AATA 2W8VA 4J5UA 4XJMA 4EMYA 1G4VA 4RJYA 2GMSA 1FG3A 3TCMA 4WYFA 1AMQA 1BT4A 2BI1A 3AENB 4HF8A 2E7IA 1IVRA 4H51A 3MEBA 4F5JA 4PIWA 3QPGA 4NOGA 1E5FA 3CQ4A 3NUIA 2W7HA 4B98A 2VMZA 4EFFA 3GZCA 3GWPA 3HQTA 2DOUA 3AELA 4OBUA 2AEUA 3QHXA 3GZDC 4WYGA 2FQ6A 1CQ6A 2C0RA 1BJNA 3WX9A 4A6UA 3CBFA 4AZJA 2W8WA 1I29A 4UHNA 1B4XA 1YOOA 1V2EA 5M49A 1DJEA 1ORDA 2WKAA 2YCNA 1AMAA 2YHKA 1AHGA 1W7LA 3LV2A 1BJ4A 3AATA 4F5KA 2ZY2A 2Z9UA 1B5OA 3N0LA 1EQBA 3JZLA 1JS3A 4OC9A 1S07A 4A6TA 1C0NA 1X29A 1Z3ZA 2BWPA 4A0HA 4KXKA 3B1CA 3CAIA 2JG2A 1UU2A 4OCAA 5E3KA 3A9ZA 3VK3A 4KYOA 1AHEA 2AY4A 2VIBA 2D65A 3JTXA 4K2IA 4Y0IA 3MC6A 4JEWA 3RCHA 2HOXA 2AY9A 2AY2A 1ARIA 3BCBA 4AO4A 3A8UX 3AEOA 1AJRA 2YCPA 2ZY4A 3PAAA 2GSAA 3T32A 3NNKA 3PD6B 3TFTA 5G2PA 2C81A 1LC8A 3A2BA 1RVUA 2CJHA 1DJ9A 5E4ZA 3EZSA 3PGYA 3FZ6A 4FFCA 2OQXA 1SF2A 1B5PA 2AY5A 3FKDA 2ZY5A 2VGWA 4GE9A 3EI6A 1FC4A 1YIZA 1ASCA 2CH1A 3EZ1A 4UQVA 3ZRQA 4JEVA 2VLHA 1U08A 3G7QA 5EUEA 1OHYA 3DYDA 3WLXA 1DGDA 4MQPA 3QI6A 5EAAA 2R5EA 3E77A 2D61A 3FDBA 4RLGA 3HT4A 4TMRA 4JF1A 2OGAA 4RAEA 4IYOA 4UHOA 1J04A 3FTBA 2C7TA 3VK2A 1V72A 3EI8A 3LWSA 3AEJC 4Y0DA 2JJFA 3GJUA 1B8GA 3MKJA 2Q7WA 4CXQA 1GC3A 3KKIA 2HUIA 2PO3A 5D5SA 1WKGA 2X3LA 3MAFA 1VEFA 1QJ3A 3L8AA 4W1XA 1OHVA 2O1BA 2W8JA 2EZ1A 4R5FA 4BMKA 4WP0A 3MBBA 4OBVA 2X5FA 4R2NA 1S0AA 4F5FA 5LH9A 5BJ4A 4ATPA 1PMOA 2HORA 4OTLA 3B8XA 1BJOB 1Z7DA 1UKJA 3DXWA 1PMMA 1IX6A 5HXXA 3W1HA 1G7WA 5EQCA 3G8MA 3EI5A 2VLFA 3B46A 3F9TA 3JW9A 1C7OA 2QA3A 4RJ0A 4ADCA 4AH3A 4TV7A 4AOAA 3EI7A 3COGA 4LNJA 4XJOA 1E5EA 2EH6A 4L0OA 3A9YA 1AY8A 1X2AA 3TFUA 3PJ0A 9AATA 3B1EA 2ZC0A 2V0YA 3FVXA 1AIAA 4HVKA 4WLHA 1WYUB 4B9BA 1ZC9A 2AY3A 2ZSMA 4LW2A 1GEXA 1M0OA 3MAUA 3FQ8A 3WCOA 2Z9XA 3BCAA 2VMWA 2AY7A 5F8VA 1TOIA 3AEMC 3PA9A 2JJHA 4WYCA 4A0RA 3ISLA 4U2HA 1LK9A 3ELPA 1WYTA 2PB2A 1IJIA 1I41A 2VMYA 1UU1A 2WK8A 5I92A 1ECXA 4MY5A 2DGMA 1KL1A 4ZDPA 1AY4A 1IAXA 4MSOA 4WYDA 5EAVA 4W8IA 4O6ZA 4WXGA 3OKSA 3G0TA 4E77A 4U1TA 4ADDA 3P1TA 2FN6A 3DZZA 2Z67A 1GEWA 5AX8A 1YJZA 1UU0A 5EIGA 4CXRA 1MAPA 3I5TA 2YKVA 4UOYA 3I16A 3PIUA 4RM1A 3JWAA 1ASFA 1C7GA 1JF9A 2BIAA 3VK4A 2HZPA 3NYUA 4JE5D 2W8UA 2BWNA 3AEPA 4CVQA 4A0GA 1ASDA 3H7FA 1TPLA 1O61A 3ECDA 5C6UA 3HDOA 2EGYA 2QLRA 1W23A 1PFFA 3DR7A 4LW4A 4WLJA 4F5GA 5FT5A 1SZSA 5DJ9A 2CY8A 2FNIA 2VIAA 3HBXA 2EO5A 3WGBA 2E7UA 3GZDA 1ASBA 2ZP7A 1TOGA 2FYFA 3DR4A 3RUYA 3IHJA 2BI9A 4XJLA 1LS3A 2Z1ZA 5IWQA 1YJSA 3N5MA 1MDZA 1AMRA 1BKGA 1G7XA 3K7YA 3NUBA 5TF5A 2D66A 2W7MA 1MDOA 2AY8A 4M2MA 1PG8A 3VP6A 3NRAA 1AHFA 5DJ1A 4DBCA 3Q8NA 3CQ6A 3E2ZA 1AJSA 1KMJA 1MLZA 2DGLA 3NU8A 2QB2A 4P3MA 1JS6A 3MADA 4CBRA 3BWNC 2ZJGA 3QN6A 4IX8A 2HP2A 2VMSA 3RCHB 2CJDA 4ITXA 1MAQA 1MGVA 2VMUA 3EIAA 4IW7A 4PFFA 2CFBA 3KGXA 4WYAA 4XK1A 1ARGA 1OATA 1CJ0A 4GRXA 2YKUA 4LC3A 4Y0HA 4MQQA 4R5ZA 4E3QA 3FCRA 1QISA 3B1DA 5G2QA 5G4IA 1VP4A 2HUUA 2R5CA 2GMUA 3ATHA 3VOMA 4ZSWA 4GEBA 5JAYA 3A9XA 1ASMA 4W1VA 1MDXA 1CL1A 1C7NA 3LY1A 4OMAA 3UE8A 3FDDA 2YKXA 2XBNA 1IBJA 1C4KA 1QITA 2PB0A 1QJ5A 2W7EA 1LW4A 4GDYA 3HMUA 5DX5A 2X8UA 4EB7A 4N0WA 3BC8A 4WBTA 1BQAA 3GBXA 2VGSA 2HOYA 1ELUA 1O4SA 1M0NA 4IYOB 3E2YA 1KKPA 1TASA 4A00A 4EB5A 2JJEA 1M0PA 5HDMA 1VJOA 2ZSLA 3AEJA 2VMQA 3DODA 3JWBA 4Q31A 1TATA 2JISA 1ASNA 3BV0A 3FVSA 3MAFB 1J32A 3CQ5A 1YIYA 5DB5A 1SFFA 2OKJA 2DKJA 2BI2A 2NMPA 2CH2A 1D2FA 2OATA 2W7DA 3LG0A 1SZKA 4Q75A 1I43A 3FQ7A 3E6GA 2D5YA 3PPLA 5G09A 4P7YA 3IF2A 3II0A 4JEZA 4BQ0A 2W8TA 1GC4A 4DGTA 3JU7A 1IAYA 3ASAA 1WYVA 4I8AA 3DRDA 1GDEA 3FFRA 4EU1A 2HOZA 3HL2A 3D6KA 1AHYA 1IX7A 2VGZA 1M0QA 2BWOA 4A0FA 1BS0A 4WB0A 4GE7A 1EJIA 1QIRA 1M6SA 1WKHA 2CB1A 2FNUA 3DC1A 5EFSA 1DFOA 3QM2A 5J8QA 3HLMA 1AAWA 2QMAA 1IUGA 1RVYA 4F5LA 5M4BA 4ZWMA 1GCKA 3NYSA 4WD2A 2VYCA 2EPJA 1ASEA 1WSTA 3EI9A 1XI9A 2Z20A 5FT4A 3RBLA 3WY7A 3PDBA 5M4DA 3R9AA 3GETA 4IY7A 3AOWA 4BA5A 2GB3A 3KGWA 2YKYA 3VAXA 4F5MA 2DGKA 3AEMA 3HVYA 1BJWA 4OT8A 1TOJA 1GC2A 2E54A 1TOKA 1WYTB 1AKCA 4GSAA 4IXSA 4XAUA 3F0HA 8AATA 1AY5A 3DXVA 1D7VA 3DU4A 3AENA 2VMOA 1GBNA 1YJYA 1ASLA 2V1PA 1I48A 2D64A 2YRRA 4F5HA 1TOEA 3WKRA 4MKJA 1M7YA 3FZ7A 3AV7A 4DQ6A 5BJ3A 4GE4A 1B9IA 2BIEA 4JEXA 1GD9A 1S09A 2W7LA 1W7MA 4QGRA 2QB3A
chains in the Genus database with same CATH superfamily
2D7ZA 2VGUA 3NTJA 3PDXA 7AATA 2VMPA 3FFHA 2W7IA 2VI8A 3NYTA 1CQ8A 2WK9A 3GSBA 4W1WA 3UAKA 1DKAA 2D63A 1XEYA 1O69A 4ZASA 1CQ7A 3E9KA 3RI6A 1B9HA 3WZFA 4ZM4A 3ASBA 2D7YA 4TN4A 3M5UA 1S06A 3KE3A 2DKBA 1SPAA 4ZSYA 5E5IA 1Y4IA 3MC6C 1KKJA 2Z9VA 4MGRA 1FG7A 2ZY3A 1V2FA 4A72A 1KMKA 2JGTA 1ARHA 2AY6A 4ADEA 1X0MA 4JF0A 5HHYA 1RV4A 1T3IA 2BYLA 2F8JA 3PD6A 3WCNA 1OXPA 2JJGA 4BHDA 3RBFA 3BWOA 4J8LA 4ZM3A 4W5KA 2HUFA 1AKBA 2RFVA 2GQNA 3L44A 3W1IA 1AMSA 4JE5A 4F5IA 4WXBA 2DR1A 3ZZJA 4UHMA 3NX3A 4OYTA 1AAMA 1ASAA 3E2ZB 4ZLVA 1AJSB 3TATA 3FD0A 4R8DA 3RQ1A 2C44A 3I4JA 4LNLA 1QZ9A 2R0TA 5G4JA 1P3WA 3BN1A 2O0RA 3BWNA 4ITGA 2VI9A 1BW0A 4AZKA 5EUDA 1LC5A 4JEYA 2HP1A 3FVUA 2EZ2A 3TQXA 4E1OA 4ZDOA 3K28A 2CINA 3ZRPA 1W7NA 1H1CA 1AHXA 1AIBA 3GR9A 3N75A 3LVMA 4M2KA 4WYEA 3NDNA 1CS1A 1LW5A 3LVKA 3ZRRA 2WB6A 1AX4A 1H0CA 1DGEA 2CTZA 4XQ2A 1G4XA 1AKAA 2BKWA 2TPLA 1CL2A 3E2FA 1MLYA 1M4NA 2ORDA 1GEYA 3W1JA 1O62A 2ZYJA 2R5CB 4ZDLA 1CZEA 1JG8A 1D7RA 2VMNA 1BQDA 5M46A 4F4EA 5EIGB 1V2DA 1ZODA 4WXFA 1YNUA 4ISYA 1N8PA 5FT6A 2O7CA 2W7JA 4KAMA 1ASGA 2KFPA 5FT8A 3FQAA 3FZ8A 2Z9WA 1QGNA 2VGVA 2YCTA 3BS8A 1AICA 2Z61A 1CZCA 1M32A 4E3RA 1BJOA 2CANA 5K8BA 3FRKA 2G6WA 1SVVA 1ELQA 4ZWVA 2YOBA 4XJPA 3R4TA 4CBSA 1N31A 1OHWA 1D7SA 1DTYA 1X28A 3WKSA 1ARTA 2BI5A 2FM1A 2QSRA 2QBTA 1RV3A 2ZUKA 1EG5A 3QBOA 3EUCA 1LKCA 4RKDA 3ELEA 3LVLB 3LVJA 1LC7A 1TARA 1ZOBA 4K2MA 4Q6RA 4ADBA 4W91A 2Z1YA 5LHAA 1C9CA 3P6KA 2XH1A 2W7KA 3FSLA 4LNMA 2X5DA 4ZAHA 4Q76A 1WYUA 2BHXA 4RKCA 1YAAA 1D7UA 5EUNA 2VMTA 2BI3A 1GC0A 3H14A 4MQRA 3UWCA 1WYVB 2OKKA 2CSTA 1W3UA 4MKKA 2AEVA 2VMRA 3BB8A 3NU7A 4M2JA 4PFNA 4WB0B 2YRIA 5G0AA 3WGCA 2CJGA 4PVFA 2BYJA 4AO9A 4A6RA 2OGEA 3USFA 4RIZA 1N2TA 5KTBA 1IX8A 2E7JA 2VMVA 3ACZA 4IXZA 4RITA 3AOVA 4BA4A 1KL2A 3F6TA 4ATQA 1DJUA 1S08A 5D95A 2WK7A 4XEWA 5F9SA 4H63Q 3QGUA 4FL0A 3PDBB 4K2BA 1ARSA 2W7GA 1SZUA 2W7FA 2BIGA 3K40A 4N0BA 2AY1A 2R2NA 2VMXA 3OP7A 4IXOA 2VGTA 3ZZKA 1OXOA 3BCXA 3EIBA 2AATA 2W8VA 4J5UA 4XJMA 4EMYA 1G4VA 4RJYA 2GMSA 1FG3A 3TCMA 4WYFA 1AMQA 1BT4A 2BI1A 3AENB 4HF8A 2E7IA 1IVRA 4H51A 3MEBA 4F5JA 4PIWA 3QPGA 4NOGA 1E5FA 3CQ4A 3NUIA 2W7HA 4B98A 2VMZA 4EFFA 3GZCA 3GWPA 3HQTA 2DOUA 3AELA 4OBUA 2AEUA 3QHXA 3GZDC 4WYGA 2FQ6A 1CQ6A 2C0RA 1BJNA 3WX9A 4A6UA 3CBFA 4AZJA 2W8WA 1I29A 4UHNA 1B4XA 1YOOA 1V2EA 5M49A 1DJEA 1ORDA 2WKAA 2YCNA 1AMAA 2YHKA 1AHGA 1W7LA 3LV2A 1BJ4A 3AATA 4F5KA 3N4SA 2ZY2A 2Z9UA 1B5OA 3N0LA 1EQBA 3JZLA 1JS3A 4OC9A 1S07A 4A6TA 1C0NA 1X29A 1Z3ZA 2BWPA 4A0HA 4KXKA 3B1CA 3CAIA 2JG2A 1UU2A 4OCAA 5E3KA 3A9ZA 3N4RA 3VK3A 4KYOA 1AHEA 2AY4A 2VIBA 2D65A 3JTXA 4K2IA 4Y0IA 3MC6A 4JEWA 3RCHA 2HOXA 2AY9A 2AY2A 1ARIA 3BCBA 4AO4A 3A8UX 3AEOA 1AJRA 2YCPA 2ZY4A 3PAAA 2GSAA 3T32A 3NNKA 3PD6B 3TFTA 5G2PA 2C81A 1LC8A 3A2BA 1RVUA 2CJHA 1DJ9A 5E4ZA 3EZSA 3PGYA 3FZ6A 4FFCA 2OQXA 1SF2A 1B5PA 2AY5A 3FKDA 2ZY5A 2VGWA 4GE9A 3EI6A 1FC4A 1YIZA 1ASCA 2CH1A 3EZ1A 4UQVA 3ZRQA 4JEVA 2VLHA 1U08A 3G7QA 5EUEA 3N7NA 1OHYA 3DYDA 3WLXA 1DGDA 4MQPA 3QI6A 5EAAA 2R5EA 3E77A 2D61A 3FDBA 4RLGA 2A1VA 3HT4A 4TMRA 4JF1A 2OGAA 4RAEA 4IYOA 4UHOA 1J04A 3FTBA 2C7TA 3VK2A 1V72A 3EI8A 3LWSA 3AEJC 4Y0DA 2JJFA 3GJUA 1B8GA 3MKJA 2Q7WA 4CXQA 1GC3A 3KKIA 2HUIA 2PO3A 5D5SA 1WKGA 2X3LA 3MAFA 1VEFA 1QJ3A 3L8AA 4W1XA 1OHVA 2O1BA 2W8JA 2EZ1A 4R5FA 4BMKA 4WP0A 3MBBA 4OBVA 2X5FA 4R2NA 1S0AA 4F5FA 5LH9A 5BJ4A 4ATPA 1PMOA 2HORA 4OTLA 3B8XA 1BJOB 1Z7DA 1UKJA 3DXWA 1PMMA 1IX6A 5HXXA 3W1HA 1G7WA 5EQCA 3G8MA 3EI5A 2VLFA 3B46A 3F9TA 3JW9A 1C7OA 2QA3A 4RJ0A 4ADCA 4AH3A 4TV7A 4AOAA 3EI7A 3COGA 4LNJA 4XJOA 1E5EA 2EH6A 4L0OA 3A9YA 1AY8A 1X2AA 3TFUA 3PJ0A 9AATA 3B1EA 2ZC0A 2V0YA 3FVXA 1AIAA 4HVKA 4WLHA 1WYUB 4B9BA 1ZC9A 2AY3A 2ZSMA 4LW2A 1GEXA 1M0OA 3MAUA 3FQ8A 3WCOA 2Z9XA 3BCAA 4K05A 2VMWA 2AY7A 5F8VA 1TOIA 3AEMC 3PA9A 2JJHA 4WYCA 4A0RA 3ISLA 4U2HA 1LK9A 3ELPA 1WYTA 2PB2A 1IJIA 1I41A 2VMYA 1UU1A 2WK8A 5I92A 1ECXA 4MY5A 2DGMA 1KL1A 4ZDPA 1AY4A 1IAXA 4MSOA 4WYDA 5EAVA 4W8IA 4O6ZA 4WXGA 3OKSA 3G0TA 4E77A 4U1TA 4ADDA 3P1TA 2FN6A 3DZZA 2Z67A 1GEWA 5AX8A 1YJZA 1UU0A 5EIGA 4CXRA 1MAPA 3I5TA 2YKVA 4UOYA 3I16A 3PIUA 4RM1A 3JWAA 1ASFA 1C7GA 1JF9A 2BIAA 3VK4A 2HZPA 3NYUA 4JE5D 2W8UA 2BWNA 3AEPA 4CVQA 4A0GA 1ASDA 3H7FA 1TPLA 1O61A 3ECDA 5C6UA 3HDOA 2EGYA 2QLRA 1W23A 1PFFA 3DR7A 4LW4A 4WLJA 4F5GA 5FT5A 1SZSA 5DJ9A 2CY8A 2FNIA 2VIAA 3HBXA 2EO5A 3WGBA 2E7UA 3GZDA 1ASBA 2ZP7A 1TOGA 2FYFA 3DR4A 3RUYA 3IHJA 2BI9A 4XJLA 1LS3A 2Z1ZA 5IWQA 1YJSA 3N5MA 1MDZA 1AMRA 1BKGA 1G7XA 3K7YA 3NUBA 5TF5A 2D66A 2W7MA 1MDOA 2AY8A 4M2MA 1PG8A 3VP6A 3NRAA 1AHFA 5DJ1A 4DBCA 3N4XA 3Q8NA 3CQ6A 3E2ZA 1AJSA 1KMJA 1MLZA 2DGLA 3NU8A 2QB2A 4P3MA 1JS6A 3MADA 4CBRA 3BWNC 2ZJGA 3QN6A 4IX8A 2HP2A 2VMSA 3RCHB 2CJDA 4ITXA 1MAQA 1MGVA 2VMUA 3EIAA 4IW7A 4PFFA 2CFBA 3KGXA 4WYAA 4XK1A 1ARGA 1OATA 1CJ0A 4GRXA 2YKUA 4LC3A 4Y0HA 4MQQA 4R5ZA 4E3QA 3FCRA 1QISA 3B1DA 3H9XA 5G2QA 5G4IA 1VP4A 2EYQA 2HUUA 2R5CA 2GMUA 3ATHA 3VOMA 4ZSWA 4GEBA 5JAYA 3A9XA 1ASMA 4W1VA 1MDXA 1CL1A 1C7NA 3LY1A 4OMAA 3UE8A 3FDDA 2YKXA 2XBNA 1IBJA 1C4KA 1QITA 2PB0A 1QJ5A 2W7EA 1LW4A 4GDYA 3HMUA 5DX5A 2X8UA 4EB7A 4N0WA 3BC8A 4WBTA 1BQAA 3GBXA 2VGSA 2HOYA 1ELUA 1O4SA 1M0NA 4IYOB 3E2YA 1KKPA 1TASA 4A00A 4EB5A 2JJEA 1M0PA 5HDMA 1VJOA 2ZSLA 3AEJA 2VMQA 3DODA 3JWBA 4Q31A 1TATA 2FKIA 2JISA 1ASNA 3BV0A 3FVSA 3MAFB 1J32A 3CQ5A 1YIYA 5DB5A 1SFFA 2OKJA 2DKJA 2BI2A 2NMPA 2CH2A 1D2FA 2OATA 2W7DA 3LG0A 1SZKA 4Q75A 1I43A 3FQ7A 3E6GA 2D5YA 3PPLA 5G09A 4P7YA 3IF2A 3II0A 4JEZA 4BQ0A 2W8TA 1GC4A 4DGTA 3JU7A 1IAYA 3ASAA 1WYVA 4I8AA 3DRDA 1GDEA 3FFRA 4EU1A 2HOZA 3HL2A 3D6KA 1AHYA 1IX7A 2VGZA 1M0QA 2BWOA 4A0FA 1BS0A 4WB0A 4GE7A 1EJIA 1QIRA 1M6SA 2G7JA 1WKHA 2CB1A 2FNUA 3DC1A 5EFSA 1DFOA 3QM2A 5J8QA 3HLMA 1AAWA 2QMAA 1IUGA 1RVYA 4F5LA 1KAFA 5M4BA 4ZWMA 1GCKA 3NYSA 4WD2A 2VYCA 2EPJA 1ASEA 1WSTA 3EI9A 1XI9A 2Z20A 5FT4A 3RBLA 3WY7A 3PDBA 5M4DA 3R9AA 3GETA 4IY7A 3AOWA 4BA5A 2GB3A 3KGWA 2YKYA 3VAXA 4F5MA 2DGKA 3AEMA 3HVYA 1BJWA 4OT8A 1TOJA 1GC2A 2E54A 1TOKA 1WYTB 1AKCA 4GSAA 4IXSA 4XAUA 3F0HA 8AATA 1AY5A 3DXVA 1D7VA 3DU4A 3AENA 2VMOA 1GBNA 1YJYA 1ASLA 2V1PA 1I48A 2D64A 2YRRA 4F5HA 1TOEA 3WKRA 4MKJA 1M7YA 3FZ7A 3AV7A 4DQ6A 5BJ3A 4GE4A 1B9IA 2BIEA 4JEXA 1GD9A 1S09A 2W7LA 1W7MA 4QGRA 2QB3A
chains in the Genus database with same CATH topology
2D7ZA 2VGUA 3NTJA 3PDXA 7AATA 2VMPA 3FFHA 2W7IA 2VI8A 3NYTA 1CQ8A 2WK9A 3GSBA 4W1WA 3UAKA 1DKAA 2D63A 1XEYA 1O69A 4ZASA 1CQ7A 3E9KA 3RI6A 1B9HA 3WZFA 4ZM4A 3ASBA 2D7YA 4TN4A 3M5UA 1S06A 3KE3A 2DKBA 1SPAA 4ZSYA 5E5IA 1Y4IA 3MC6C 1KKJA 2Z9VA 4MGRA 1FG7A 2ZY3A 1V2FA 4A72A 1KMKA 2JGTA 1ARHA 2AY6A 4ADEA 1X0MA 4JF0A 5HHYA 1RV4A 1T3IA 2BYLA 2F8JA 3PD6A 3WCNA 1OXPA 2JJGA 4BHDA 3RBFA 3BWOA 4J8LA 4ZM3A 4W5KA 2HUFA 1AKBA 2RFVA 2GQNA 3L44A 3W1IA 1AMSA 4JE5A 4F5IA 4WXBA 2DR1A 3ZZJA 4UHMA 3NX3A 4OYTA 1AAMA 1ASAA 3E2ZB 4ZLVA 1AJSB 3TATA 3FD0A 4R8DA 3RQ1A 2C44A 3I4JA 4LNLA 1QZ9A 2R0TA 5G4JA 1P3WA 3BN1A 2O0RA 3BWNA 4ITGA 2VI9A 1BW0A 4AZKA 5EUDA 1LC5A 4JEYA 2HP1A 3FVUA 2EZ2A 3TQXA 4E1OA 4ZDOA 3K28A 2CINA 3ZRPA 1W7NA 1H1CA 1AHXA 1AIBA 3GR9A 3N75A 3LVMA 4M2KA 4WYEA 3NDNA 1CS1A 1LW5A 3LVKA 3ZRRA 2WB6A 1AX4A 1H0CA 1DGEA 2CTZA 4XQ2A 1G4XA 1AKAA 2BKWA 2TPLA 1CL2A 3E2FA 1MLYA 1M4NA 2ORDA 1GEYA 3W1JA 1O62A 2ZYJA 2R5CB 4ZDLA 1CZEA 1JG8A 1D7RA 2VMNA 1BQDA 5M46A 4F4EA 5EIGB 1V2DA 1ZODA 4WXFA 1YNUA 4ISYA 1N8PA 5FT6A 2O7CA 2W7JA 4KAMA 1ASGA 2KFPA 5FT8A 3FQAA 3FZ8A 2Z9WA 1QGNA 2VGVA 2YCTA 3BS8A 1AICA 2Z61A 1CZCA 1M32A 4E3RA 1BJOA 2CANA 5K8BA 3FRKA 2G6WA 1SVVA 1ELQA 4ZWVA 2YOBA 4XJPA 3R4TA 4CBSA 1N31A 1OHWA 1D7SA 1DTYA 1X28A 3WKSA 1ARTA 2BI5A 2FM1A 2QSRA 2QBTA 1RV3A 2ZUKA 1EG5A 3QBOA 3EUCA 1LKCA 4RKDA 3ELEA 3LVLB 3LVJA 1LC7A 1TARA 1ZOBA 4K2MA 4Q6RA 4ADBA 4W91A 2Z1YA 5LHAA 1C9CA 3P6KA 2XH1A 2W7KA 3FSLA 4LNMA 2X5DA 4ZAHA 4Q76A 1WYUA 2BHXA 4RKCA 1YAAA 1D7UA 5EUNA 2VMTA 2BI3A 1GC0A 3H14A 4MQRA 3UWCA 1WYVB 2OKKA 2CSTA 1W3UA 4MKKA 2AEVA 2VMRA 3BB8A 3NU7A 4M2JA 4PFNA 4WB0B 2YRIA 5G0AA 3WGCA 2CJGA 4PVFA 2BYJA 4AO9A 4A6RA 2OGEA 3USFA 4RIZA 1N2TA 5KTBA 1IX8A 2E7JA 2VMVA 3ACZA 4IXZA 4RITA 3AOVA 4BA4A 1KL2A 3F6TA 4ATQA 1DJUA 1S08A 5D95A 2WK7A 4XEWA 5F9SA 4H63Q 3QGUA 4FL0A 3PDBB 4K2BA 1ARSA 2W7GA 1SZUA 2W7FA 2BIGA 3K40A 4N0BA 2AY1A 2R2NA 2VMXA 3OP7A 4IXOA 2VGTA 3ZZKA 1OXOA 3BCXA 3EIBA 2AATA 2W8VA 4J5UA 4XJMA 4EMYA 1G4VA 4RJYA 2GMSA 1FG3A 3TCMA 4WYFA 1AMQA 1BT4A 2BI1A 3AENB 4HF8A 2E7IA 1IVRA 4H51A 3MEBA 4F5JA 4PIWA 3QPGA 4NOGA 1E5FA 3CQ4A 3NUIA 2W7HA 4B98A 2VMZA 4EFFA 3GZCA 3GWPA 3HQTA 2DOUA 3AELA 4OBUA 2AEUA 3QHXA 3GZDC 4WYGA 2FQ6A 1CQ6A 2C0RA 1BJNA 3WX9A 4A6UA 3CBFA 4AZJA 2W8WA 1I29A 4UHNA 1B4XA 1YOOA 1V2EA 5M49A 1DJEA 1ORDA 2WKAA 2YCNA 1AMAA 2YHKA 1AHGA 1W7LA 3LV2A 1BJ4A 3AATA 4F5KA 3N4SA 2ZY2A 2Z9UA 1B5OA 3N0LA 1EQBA 3JZLA 1JS3A 4OC9A 1S07A 4A6TA 1C0NA 1X29A 1Z3ZA 2BWPA 4A0HA 4KXKA 3B1CA 3CAIA 2JG2A 1UU2A 4OCAA 5E3KA 3A9ZA 3N4RA 3VK3A 4KYOA 1AHEA 2AY4A 2VIBA 2D65A 3JTXA 4K2IA 4Y0IA 3MC6A 4JEWA 3RCHA 2HOXA 2AY9A 2AY2A 1ARIA 3BCBA 4AO4A 3A8UX 3AEOA 1AJRA 2YCPA 2ZY4A 3PAAA 2GSAA 3T32A 3NNKA 3PD6B 3TFTA 5G2PA 2C81A 1LC8A 3A2BA 1RVUA 2CJHA 1DJ9A 5E4ZA 3EZSA 3PGYA 3FZ6A 4FFCA 2OQXA 1SF2A 1B5PA 2AY5A 3FKDA 2ZY5A 2VGWA 4GE9A 3EI6A 1FC4A 1YIZA 1ASCA 2CH1A 3EZ1A 4UQVA 3ZRQA 4JEVA 2VLHA 1U08A 3G7QA 5EUEA 3N7NA 1OHYA 3DYDA 3WLXA 1DGDA 4MQPA 3QI6A 5EAAA 2R5EA 3E77A 2D61A 3FDBA 4RLGA 2A1VA 3HT4A 4TMRA 4JF1A 2OGAA 4RAEA 4IYOA 4UHOA 1J04A 3FTBA 2C7TA 3VK2A 1V72A 3EI8A 3LWSA 3AEJC 4Y0DA 2JJFA 3GJUA 1B8GA 3MKJA 2Q7WA 4CXQA 1GC3A 3KKIA 2HUIA 2PO3A 5D5SA 1WKGA 2X3LA 3MAFA 1VEFA 1QJ3A 3L8AA 4W1XA 1OHVA 2O1BA 2W8JA 2EZ1A 4R5FA 4BMKA 4WP0A 3MBBA 4OBVA 2X5FA 4R2NA 1S0AA 4F5FA 5LH9A 5BJ4A 4ATPA 1PMOA 2HORA 4OTLA 3B8XA 1BJOB 1Z7DA 1UKJA 3DXWA 1PMMA 1IX6A 5HXXA 3W1HA 1G7WA 5EQCA 3G8MA 3EI5A 2VLFA 3B46A 3F9TA 3JW9A 1C7OA 2QA3A 4RJ0A 4ADCA 4AH3A 4TV7A 4AOAA 3EI7A 3COGA 4LNJA 4XJOA 1E5EA 2EH6A 4L0OA 3A9YA 1AY8A 1X2AA 3TFUA 3PJ0A 9AATA 3B1EA 2ZC0A 2V0YA 3FVXA 1AIAA 4HVKA 4WLHA 1WYUB 4B9BA 1ZC9A 2AY3A 2ZSMA 4LW2A 1GEXA 1M0OA 3MAUA 3FQ8A 3WCOA 2Z9XA 3BCAA 4K05A 2VMWA 2AY7A 5F8VA 1TOIA 3AEMC 3PA9A 2JJHA 4WYCA 4A0RA 3ISLA 4U2HA 1LK9A 3ELPA 1WYTA 2PB2A 1IJIA 1I41A 2VMYA 1UU1A 2WK8A 5I92A 1ECXA 4MY5A 2DGMA 1KL1A 4ZDPA 1AY4A 1IAXA 4MSOA 4WYDA 5EAVA 4W8IA 4O6ZA 4WXGA 3OKSA 3G0TA 4E77A 4U1TA 4ADDA 3P1TA 2FN6A 3DZZA 2Z67A 1GEWA 5AX8A 1YJZA 1UU0A 5EIGA 4CXRA 1MAPA 3I5TA 2YKVA 4UOYA 3I16A 3PIUA 4RM1A 3JWAA 1ASFA 1C7GA 1JF9A 2BIAA 3VK4A 2HZPA 3NYUA 4JE5D 2W8UA 2BWNA 3AEPA 4CVQA 4A0GA 1ASDA 3H7FA 1TPLA 1O61A 3ECDA 5C6UA 3HDOA 2EGYA 2QLRA 1W23A 1PFFA 3DR7A 4LW4A 4WLJA 4F5GA 5FT5A 1SZSA 5DJ9A 2CY8A 2FNIA 2VIAA 3HBXA 2EO5A 3WGBA 2E7UA 3GZDA 1ASBA 2ZP7A 1TOGA 2FYFA 3DR4A 3RUYA 3IHJA 2BI9A 4XJLA 1LS3A 2Z1ZA 5IWQA 1YJSA 3N5MA 1MDZA 1AMRA 1BKGA 1G7XA 3K7YA 3NUBA 5TF5A 2D66A 2W7MA 1MDOA 2AY8A 4M2MA 1PG8A 3VP6A 3NRAA 1AHFA 5DJ1A 4DBCA 3N4XA 3Q8NA 3CQ6A 3E2ZA 1AJSA 1KMJA 1MLZA 2DGLA 3NU8A 2QB2A 4P3MA 1JS6A 3MADA 4CBRA 3BWNC 2ZJGA 3QN6A 4IX8A 2HP2A 2VMSA 3RCHB 2CJDA 4ITXA 1MAQA 1MGVA 2VMUA 3EIAA 4IW7A 4PFFA 2CFBA 3KGXA 4WYAA 4XK1A 1ARGA 1OATA 1CJ0A 4GRXA 2YKUA 4LC3A 4Y0HA 4MQQA 4R5ZA 4E3QA 3FCRA 1QISA 3B1DA 3H9XA 5G2QA 5G4IA 1VP4A 2EYQA 2HUUA 2R5CA 2GMUA 3ATHA 3VOMA 4ZSWA 4GEBA 5JAYA 3A9XA 1ASMA 4W1VA 1MDXA 1CL1A 1C7NA 3LY1A 4OMAA 3UE8A 3FDDA 2YKXA 2XBNA 1IBJA 1C4KA 1QITA 2PB0A 1QJ5A 2W7EA 1LW4A 4GDYA 3HMUA 5DX5A 2X8UA 4EB7A 4N0WA 3BC8A 4WBTA 1BQAA 3GBXA 2VGSA 2HOYA 1ELUA 1O4SA 1M0NA 4IYOB 3E2YA 1KKPA 1TASA 4A00A 4EB5A 2JJEA 1M0PA 5HDMA 1VJOA 2ZSLA 3AEJA 2VMQA 3DODA 3JWBA 4Q31A 1TATA 2FKIA 2JISA 1ASNA 3BV0A 3FVSA 3MAFB 1J32A 3CQ5A 1YIYA 5DB5A 1SFFA 2OKJA 2DKJA 2BI2A 2NMPA 2CH2A 1D2FA 2OATA 2W7DA 3LG0A 1SZKA 4Q75A 1I43A 3FQ7A 3E6GA 2D5YA 3PPLA 5G09A 4P7YA 3IF2A 3II0A 4JEZA 4BQ0A 2W8TA 1GC4A 4DGTA 3JU7A 1IAYA 3ASAA 1WYVA 4I8AA 3DRDA 1GDEA 3FFRA 4EU1A 2HOZA 3HL2A 3D6KA 1AHYA 1IX7A 2VGZA 1M0QA 2BWOA 4A0FA 1BS0A 4WB0A 4GE7A 1EJIA 1QIRA 1M6SA 2G7JA 1WKHA 2CB1A 2FNUA 3DC1A 5EFSA 1DFOA 3QM2A 5J8QA 3HLMA 1AAWA 2QMAA 1IUGA 1RVYA 4F5LA 5M4BA 4ZWMA 1GCKA 3NYSA 4WD2A 2VYCA 2EPJA 1ASEA 1WSTA 3EI9A 1XI9A 2Z20A 5FT4A 3RBLA 3WY7A 3PDBA 5M4DA 3R9AA 3GETA 4IY7A 3AOWA 4BA5A 2GB3A 3KGWA 2YKYA 3VAXA 4F5MA 2DGKA 3AEMA 3HVYA 1BJWA 4OT8A 1TOJA 1GC2A 2E54A 1TOKA 1WYTB 1AKCA 4GSAA 4IXSA 4XAUA 3F0HA 8AATA 1AY5A 3DXVA 1D7VA 3DU4A 3AENA 2VMOA 1GBNA 1YJYA 1ASLA 2V1PA 1I48A 2D64A 2YRRA 4F5HA 1TOEA 3WKRA 4MKJA 1M7YA 3FZ7A 3AV7A 4DQ6A 5BJ3A 4GE4A 1B9IA 2BIEA 4JEXA 1GD9A 1S09A 2W7LA 1W7MA 4QGRA 2QB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7Z A;  2VGU A;  3NTJ A;  3PDX A;  7AAT A;  2VMP A;  3FFH A;  2W7I A;  2VI8 A;  3NYT A;  1CQ8 A;  2WK9 A;  3GSB A;  4W1W A;  3UAK A;  1DKA A;  2D63 A;  1XEY A;  1O69 A;  4ZAS A;  1CQ7 A;  3E9K A;  3RI6 A;  1B9H A;  3WZF A;  4ZM4 A;  3ASB A;  2D7Y A;  4TN4 A;  3M5U A;  1S06 A;  3KE3 A;  2DKB A;  1SPA A;  4ZSY A;  5E5I A;  1Y4I A;  3MC6 C;  1KKJ A;  2Z9V A;  4MGR A;  1FG7 A;  2ZY3 A;  1V2F A;  4A72 A;  1KMK A;  2JGT A;  1ARH A;  2AY6 A;  4ADE A;  1X0M A;  4JF0 A;  5HHY A;  1RV4 A;  1T3I A;  2BYL A;  2F8J A;  3PD6 A;  3WCN A;  1OXP A;  2JJG A;  4BHD A;  3RBF A;  3BWO A;  4J8L A;  4ZM3 A;  4W5K A;  2HUF A;  1AKB A;  2RFV A;  2GQN A;  3L44 A;  3W1I A;  1AMS A;  4JE5 A;  4F5I A;  4WXB A;  2DR1 A;  3ZZJ A;  4UHM A;  3NX3 A;  4OYT A;  1AAM A;  1ASA A;  3E2Z B;  4ZLV A;  1AJS B;  3TAT A;  3FD0 A;  4R8D A;  3RQ1 A;  2C44 A;  3I4J A;  4LNL A;  1QZ9 A;  2R0T A;  5G4J A;  1P3W A;  3BN1 A;  2O0R A;  3BWN A;  4ITG A;  2VI9 A;  1BW0 A;  4AZK A;  5EUD A;  1LC5 A;  4JEY A;  2HP1 A;  3FVU A;  2EZ2 A;  3TQX A;  4E1O A;  4ZDO A;  3K28 A;  2CIN A;  3ZRP A;  1W7N A;  1H1C A;  1AHX A;  1AIB A;  3GR9 A;  3N75 A;  3LVM A;  4M2K A;  4WYE A;  3NDN A;  1CS1 A;  1LW5 A;  3LVK A;  3ZRR A;  1AX4 A;  1H0C A;  1DGE A;  2CTZ A;  4XQ2 A;  1G4X A;  1AKA A;  2BKW A;  2TPL A;  1CL2 A;  3E2F A;  1MLY A;  1M4N A;  2ORD A;  1GEY A;  3W1J A;  1O62 A;  2ZYJ A;  2R5C B;  4ZDL A;  1CZE A;  1JG8 A;  1D7R A;  2VMN A;  1BQD A;  5M46 A;  4F4E A;  5EIG B;  1V2D A;  1ZOD A;  4WXF A;  1YNU A;  4ISY A;  1N8P A;  5FT6 A;  2O7C A;  2W7J A;  4KAM A;  1ASG A;  5FT8 A;  3FQA A;  3FZ8 A;  2Z9W A;  1QGN A;  2VGV A;  2YCT A;  3BS8 A;  1AIC A;  2Z61 A;  1CZC A;  1M32 A;  4E3R A;  1BJO A;  2CAN A;  5K8B A;  3FRK A;  2G6W A;  1SVV A;  1ELQ A;  4ZWV A;  2YOB A;  4XJP A;  3R4T A;  4CBS A;  1N31 A;  1OHW A;  1D7S A;  1DTY A;  1X28 A;  3WKS A;  1ART A;  2BI5 A;  2FM1 A;  2QBT A;  1RV3 A;  2ZUK A;  1EG5 A;  3QBO A;  3EUC A;  1LKC A;  4RKD A;  3ELE A;  3LVL B;  3LVJ A;  1LC7 A;  1TAR A;  1ZOB A;  4K2M A;  4Q6R A;  4ADB A;  4W91 A;  2Z1Y A;  5LHA A;  1C9C A;  3P6K A;  2XH1 A;  2W7K A;  3FSL A;  4LNM A;  2X5D A;  4ZAH A;  4Q76 A;  1WYU A;  2BHX A;  4RKC A;  1YAA A;  1D7U A;  5EUN A;  2VMT A;  2BI3 A;  1GC0 A;  3H14 A;  4MQR A;  3UWC A;  1WYV B;  2OKK A;  2CST A;  1W3U A;  4MKK A;  2AEV A;  2VMR A;  3BB8 A;  3NU7 A;  4M2J A;  4PFN A;  4WB0 B;  2YRI A;  5G0A A;  3WGC A;  2CJG A;  4PVF A;  2BYJ A;  4AO9 A;  4A6R A;  2OGE A;  3USF A;  4RIZ A;  1N2T A;  1IX8 A;  2E7J A;  2VMV A;  3ACZ A;  4IXZ A;  4RIT A;  3AOV A;  4BA4 A;  1KL2 A;  3F6T A;  4ATQ A;  1DJU A;  1S08 A;  5D95 A;  2WK7 A;  4XEW A;  5F9S A;  3QGU A;  4FL0 A;  3PDB B;  4K2B A;  1ARS A;  2W7G A;  1SZU A;  2W7F A;  2BIG A;  3K40 A;  4N0B A;  2AY1 A;  2R2N A;  2VMX A;  3OP7 A;  4IXO A;  2VGT A;  3ZZK A;  1OXO A;  3BCX A;  3EIB A;  2AAT A;  2W8V A;  4J5U A;  4XJM A;  4EMY A;  1G4V A;  4RJY A;  2GMS A;  1FG3 A;  3TCM A;  4WYF A;  1AMQ A;  1BT4 A;  2BI1 A;  3AEN B;  4HF8 A;  2E7I A;  1IVR A;  4H51 A;  3MEB A;  4F5J A;  4PIW A;  3QPG A;  4NOG A;  1E5F A;  3CQ4 A;  3NUI A;  2W7H A;  4B98 A;  2VMZ A;  4EFF A;  3GZC A;  3GWP A;  3HQT A;  2DOU A;  3AEL A;  4OBU A;  2AEU A;  3QHX A;  3GZD C;  4WYG A;  2FQ6 A;  1CQ6 A;  2C0R A;  1BJN A;  3WX9 A;  4A6U A;  3CBF A;  4AZJ A;  2W8W A;  1I29 A;  4UHN A;  1B4X A;  1YOO A;  1V2E A;  5M49 A;  1DJE A;  1ORD A;  2WKA A;  2YCN A;  1AMA A;  2YHK A;  1AHG A;  1W7L A;  3LV2 A;  1BJ4 A;  3AAT A;  4F5K A;  2ZY2 A;  2Z9U A;  1B5O A;  3N0L A;  1EQB A;  3JZL A;  1JS3 A;  4OC9 A;  1S07 A;  4A6T A;  1C0N A;  1X29 A;  1Z3Z A;  2BWP A;  4A0H A;  4KXK A;  3B1C A;  3CAI A;  2JG2 A;  1UU2 A;  4OCA A;  5E3K A;  3A9Z A;  3VK3 A;  4KYO A;  1AHE A;  2AY4 A;  2VIB A;  2D65 A;  3JTX A;  4K2I A;  4Y0I A;  3MC6 A;  4JEW A;  3RCH A;  2HOX A;  2AY9 A;  2AY2 A;  1ARI A;  3BCB A;  4AO4 A;  3A8U X;  3AEO A;  1AJR A;  2YCP A;  2ZY4 A;  3PAA A;  2GSA A;  3T32 A;  3NNK A;  3PD6 B;  3TFT A;  5G2P A;  2C81 A;  1LC8 A;  3A2B A;  1RVU A;  2CJH A;  1DJ9 A;  5E4Z A;  3EZS A;  3PGY A;  3FZ6 A;  4FFC A;  2OQX A;  1SF2 A;  1B5P A;  2AY5 A;  3FKD A;  2ZY5 A;  2VGW A;  4GE9 A;  3EI6 A;  1FC4 A;  1YIZ A;  1ASC A;  2CH1 A;  3EZ1 A;  4UQV A;  3ZRQ A;  4JEV A;  2VLH A;  1U08 A;  3G7Q A;  5EUE A;  1OHY A;  3DYD A;  3WLX A;  1DGD A;  4MQP A;  3QI6 A;  5EAA A;  2R5E A;  3E77 A;  2D61 A;  3FDB A;  4RLG A;  3HT4 A;  4TMR A;  4JF1 A;  2OGA A;  4RAE A;  4IYO A;  4UHO A;  1J04 A;  3FTB A;  2C7T A;  3VK2 A;  1V72 A;  3EI8 A;  3LWS A;  3AEJ C;  4Y0D A;  2JJF A;  3GJU A;  1B8G A;  3MKJ A;  2Q7W A;  4CXQ A;  1GC3 A;  3KKI A;  2HUI A;  2PO3 A;  5D5S A;  1WKG A;  2X3L A;  3MAF A;  1VEF A;  1QJ3 A;  3L8A A;  4W1X A;  1OHV A;  2O1B A;  2W8J A;  2EZ1 A;  4R5F A;  4BMK A;  4WP0 A;  3MBB A;  4OBV A;  2X5F A;  4R2N A;  1S0A A;  4F5F A;  5LH9 A;  5BJ4 A;  4ATP A;  1PMO A;  2HOR A;  4OTL A;  3B8X A;  1BJO B;  1Z7D A;  1UKJ A;  3DXW A;  1PMM A;  1IX6 A;  5HXX A;  3W1H A;  1G7W A;  5EQC A;  3G8M A;  3EI5 A;  2VLF A;  3B46 A;  3F9T A;  3JW9 A;  1C7O A;  2QA3 A;  4RJ0 A;  4ADC A;  4AH3 A;  4TV7 A;  4AOA A;  3EI7 A;  3COG A;  4LNJ A;  4XJO A;  1E5E A;  2EH6 A;  4L0O A;  3A9Y A;  1AY8 A;  1X2A A;  3TFU A;  3PJ0 A;  9AAT A;  3B1E A;  2ZC0 A;  2V0Y A;  3FVX A;  1AIA A;  4HVK A;  4WLH A;  1WYU B;  4B9B A;  1ZC9 A;  2AY3 A;  2ZSM A;  4LW2 A;  1GEX A;  1M0O A;  3MAU A;  3FQ8 A;  3WCO A;  2Z9X A;  3BCA A;  2VMW A;  2AY7 A;  5F8V A;  1TOI A;  3AEM C;  3PA9 A;  2JJH A;  4WYC A;  4A0R A;  3ISL A;  4U2H A;  1LK9 A;  3ELP A;  1WYT A;  2PB2 A;  1IJI A;  1I41 A;  2VMY A;  1UU1 A;  2WK8 A;  5I92 A;  1ECX A;  4MY5 A;  2DGM A;  1KL1 A;  4ZDP A;  1AY4 A;  1IAX A;  4MSO A;  4WYD A;  5EAV A;  4W8I A;  4O6Z A;  4WXG A;  3OKS A;  3G0T A;  4E77 A;  4U1T A;  4ADD A;  3P1T A;  2FN6 A;  3DZZ A;  2Z67 A;  1GEW A;  5AX8 A;  1YJZ A;  1UU0 A;  5EIG A;  4CXR A;  1MAP A;  3I5T A;  2YKV A;  4UOY A;  3I16 A;  3PIU A;  4RM1 A;  3JWA A;  1ASF A;  1C7G A;  1JF9 A;  2BIA A;  3VK4 A;  2HZP A;  3NYU A;  4JE5 D;  2W8U A;  2BWN A;  3AEP A;  4CVQ A;  4A0G A;  1ASD A;  3H7F A;  1TPL A;  1O61 A;  3ECD A;  5C6U A;  3HDO A;  2EGY A;  2QLR A;  1W23 A;  1PFF A;  3DR7 A;  4LW4 A;  4WLJ A;  4F5G A;  5FT5 A;  1SZS A;  5DJ9 A;  2CY8 A;  2FNI A;  2VIA A;  3HBX A;  2EO5 A;  3WGB A;  2E7U A;  3GZD A;  1ASB A;  2ZP7 A;  1TOG A;  2FYF A;  3DR4 A;  3RUY A;  3IHJ A;  2BI9 A;  4XJL A;  1LS3 A;  2Z1Z A;  5IWQ A;  1YJS A;  3N5M A;  1MDZ A;  1AMR A;  1BKG A;  1G7X A;  3K7Y A;  3NUB A;  5TF5 A;  2D66 A;  2W7M A;  1MDO A;  2AY8 A;  4M2M A;  1PG8 A;  3VP6 A;  3NRA A;  1AHF A;  5DJ1 A;  4DBC A;  3Q8N A;  3CQ6 A;  3E2Z A;  1AJS A;  1KMJ A;  1MLZ A;  2DGL A;  3NU8 A;  2QB2 A;  4P3M A;  1JS6 A;  3MAD A;  4CBR A;  3BWN C;  2ZJG A;  3QN6 A;  4IX8 A;  2HP2 A;  2VMS A;  3RCH B;  2CJD A;  4ITX A;  1MAQ A;  1MGV A;  2VMU A;  3EIA A;  4IW7 A;  4PFF A;  2CFB A;  3KGX A;  4WYA A;  4XK1 A;  1ARG A;  1OAT A;  1CJ0 A;  4GRX A;  2YKU A;  4LC3 A;  4Y0H A;  4MQQ A;  4R5Z A;  4E3Q A;  3FCR A;  1QIS A;  3B1D A;  5G2Q A;  5G4I A;  1VP4 A;  2HUU A;  2R5C A;  2GMU A;  3ATH A;  3VOM A;  4ZSW A;  4GEB A;  5JAY A;  3A9X A;  1ASM A;  4W1V A;  1MDX A;  1CL1 A;  1C7N A;  3LY1 A;  4OMA A;  3UE8 A;  3FDD A;  2YKX A;  2XBN A;  1IBJ A;  1C4K A;  1QIT A;  2PB0 A;  1QJ5 A;  2W7E A;  1LW4 A;  4GDY A;  3HMU A;  5DX5 A;  2X8U A;  4EB7 A;  4N0W A;  3BC8 A;  4WBT A;  1BQA A;  3GBX A;  2VGS A;  2HOY A;  1ELU A;  1O4S A;  1M0N A;  4IYO B;  3E2Y A;  1KKP A;  1TAS A;  4A00 A;  4EB5 A;  2JJE A;  1M0P A;  5HDM A;  1VJO A;  2ZSL A;  3AEJ A;  2VMQ A;  3DOD A;  3JWB A;  4Q31 A;  1TAT A;  2JIS A;  1ASN A;  3BV0 A;  3FVS A;  3MAF B;  1J32 A;  3CQ5 A;  1YIY A;  5DB5 A;  1SFF A;  2OKJ A;  2DKJ A;  2BI2 A;  2NMP A;  2CH2 A;  1D2F A;  2OAT A;  2W7D A;  3LG0 A;  1SZK A;  4Q75 A;  1I43 A;  3FQ7 A;  3E6G A;  2D5Y A;  3PPL A;  5G09 A;  4P7Y A;  3IF2 A;  3II0 A;  4JEZ A;  4BQ0 A;  2W8T A;  1GC4 A;  4DGT A;  3JU7 A;  1IAY A;  3ASA A;  1WYV A;  4I8A A;  3DRD A;  1GDE A;  3FFR A;  4EU1 A;  2HOZ A;  3HL2 A;  3D6K A;  1AHY A;  1IX7 A;  2VGZ A;  1M0Q A;  2BWO A;  4A0F A;  1BS0 A;  4WB0 A;  4GE7 A;  1EJI A;  1QIR A;  1M6S A;  1WKH A;  2CB1 A;  2FNU A;  3DC1 A;  5EFS A;  1DFO A;  3QM2 A;  5J8Q A;  3HLM A;  1AAW A;  2QMA A;  1IUG A;  1RVY A;  4F5L A;  5M4B A;  4ZWM A;  1GCK A;  3NYS A;  4WD2 A;  2VYC A;  2EPJ A;  1ASE A;  1WST A;  3EI9 A;  1XI9 A;  2Z20 A;  5FT4 A;  3RBL A;  3WY7 A;  3PDB A;  5M4D A;  3R9A A;  3GET A;  4IY7 A;  3AOW A;  4BA5 A;  2GB3 A;  3KGW A;  2YKY A;  3VAX A;  4F5M A;  2DGK A;  3AEM A;  3HVY A;  1BJW A;  4OT8 A;  1TOJ A;  1GC2 A;  2E54 A;  1TOK A;  1WYT B;  1AKC A;  4GSA A;  4IXS A;  4XAU A;  3F0H A;  8AAT A;  1AY5 A;  3DXV A;  1D7V A;  3DU4 A;  3AEN A;  2VMO A;  1GBN A;  1YJY A;  1ASL A;  2V1P A;  1I48 A;  2D64 A;  2YRR A;  4F5H A;  1TOE A;  3WKR A;  4MKJ A;  1M7Y A;  3FZ7 A;  3AV7 A;  4DQ6 A;  5BJ3 A;  4GE4 A;  1B9I A;  2BIE A;  4JEX A;  1GD9 A;  1S09 A;  2W7L A;  1W7M A;  4QGR A;  2QB3 A; 
#chains in the Genus database with same CATH topology
 2D7Z A;  2VGU A;  3NTJ A;  3PDX A;  7AAT A;  2VMP A;  3FFH A;  2W7I A;  2VI8 A;  3NYT A;  1CQ8 A;  2WK9 A;  3GSB A;  4W1W A;  3UAK A;  1DKA A;  2D63 A;  1XEY A;  1O69 A;  4ZAS A;  1CQ7 A;  3E9K A;  3RI6 A;  1B9H A;  3WZF A;  4ZM4 A;  3ASB A;  2D7Y A;  4TN4 A;  3M5U A;  1S06 A;  3KE3 A;  2DKB A;  1SPA A;  4ZSY A;  5E5I A;  1Y4I A;  3MC6 C;  1KKJ A;  2Z9V A;  4MGR A;  1FG7 A;  2ZY3 A;  1V2F A;  4A72 A;  1KMK A;  2JGT A;  1ARH A;  2AY6 A;  4ADE A;  1X0M A;  4JF0 A;  5HHY A;  1RV4 A;  1T3I A;  2BYL A;  2F8J A;  3PD6 A;  3WCN A;  1OXP A;  2JJG A;  4BHD A;  3RBF A;  3BWO A;  4J8L A;  4ZM3 A;  4W5K A;  2HUF A;  1AKB A;  2RFV A;  2GQN A;  3L44 A;  3W1I A;  1AMS A;  4JE5 A;  4F5I A;  4WXB A;  2DR1 A;  3ZZJ A;  4UHM A;  3NX3 A;  4OYT A;  1AAM A;  1ASA A;  3E2Z B;  4ZLV A;  1AJS B;  3TAT A;  3FD0 A;  4R8D A;  3RQ1 A;  2C44 A;  3I4J A;  4LNL A;  1QZ9 A;  2R0T A;  5G4J A;  1P3W A;  3BN1 A;  2O0R A;  3BWN A;  4ITG A;  2VI9 A;  1BW0 A;  4AZK A;  5EUD A;  1LC5 A;  4JEY A;  2HP1 A;  3FVU A;  2EZ2 A;  3TQX A;  4E1O A;  4ZDO A;  3K28 A;  2CIN A;  3ZRP A;  1W7N A;  1H1C A;  1AHX A;  1AIB A;  3GR9 A;  3N75 A;  3LVM A;  4M2K A;  4WYE A;  3NDN A;  1CS1 A;  1LW5 A;  3LVK A;  3ZRR A;  2WB6 A;  1AX4 A;  1H0C A;  1DGE A;  2CTZ A;  4XQ2 A;  1G4X A;  1AKA A;  2BKW A;  2TPL A;  1CL2 A;  3E2F A;  1MLY A;  1M4N A;  2ORD A;  1GEY A;  3W1J A;  1O62 A;  2ZYJ A;  2R5C B;  4ZDL A;  1CZE A;  1JG8 A;  1D7R A;  2VMN A;  1BQD A;  5M46 A;  4F4E A;  5EIG B;  1V2D A;  1ZOD A;  4WXF A;  1YNU A;  4ISY A;  1N8P A;  5FT6 A;  2O7C A;  2W7J A;  4KAM A;  1ASG A;  2KFP A;  5FT8 A;  3FQA A;  3FZ8 A;  2Z9W A;  1QGN A;  2VGV A;  2YCT A;  3BS8 A;  1AIC A;  2Z61 A;  1CZC A;  1M32 A;  4E3R A;  1BJO A;  2CAN A;  5K8B A;  3FRK A;  2G6W A;  1SVV A;  1ELQ A;  4ZWV A;  2YOB A;  4XJP A;  3R4T A;  4CBS A;  1N31 A;  1OHW A;  1D7S A;  1DTY A;  1X28 A;  3WKS A;  1ART A;  2BI5 A;  2FM1 A;  2QSR A;  2QBT A;  1RV3 A;  2ZUK A;  1EG5 A;  3QBO A;  3EUC A;  1LKC A;  4RKD A;  3ELE A;  3LVL B;  3LVJ A;  1LC7 A;  1TAR A;  1ZOB A;  4K2M A;  4Q6R A;  4ADB A;  4W91 A;  2Z1Y A;  5LHA A;  1C9C A;  3P6K A;  2XH1 A;  2W7K A;  3FSL A;  4LNM A;  2X5D A;  4ZAH A;  4Q76 A;  1WYU A;  2BHX A;  4RKC A;  1YAA A;  1D7U A;  5EUN A;  2VMT A;  2BI3 A;  1GC0 A;  3H14 A;  4MQR A;  3UWC A;  1WYV B;  2OKK A;  2CST A;  1W3U A;  4MKK A;  2AEV A;  2VMR A;  3BB8 A;  3NU7 A;  4M2J A;  4PFN A;  4WB0 B;  2YRI A;  5G0A A;  3WGC A;  2CJG A;  4PVF A;  2BYJ A;  4AO9 A;  4A6R A;  2OGE A;  3USF A;  4RIZ A;  1N2T A;  5KTB A;  1IX8 A;  2E7J A;  2VMV A;  3ACZ A;  4IXZ A;  4RIT A;  3AOV A;  4BA4 A;  1KL2 A;  3F6T A;  4ATQ A;  1DJU A;  1S08 A;  5D95 A;  2WK7 A;  4XEW A;  5F9S A;  4H63 Q;  3QGU A;  4FL0 A;  3PDB B;  4K2B A;  1ARS A;  2W7G A;  1SZU A;  2W7F A;  2BIG A;  3K40 A;  4N0B A;  2AY1 A;  2R2N A;  2VMX A;  3OP7 A;  4IXO A;  2VGT A;  3ZZK A;  1OXO A;  3BCX A;  3EIB A;  2AAT A;  2W8V A;  4J5U A;  4XJM A;  4EMY A;  1G4V A;  4RJY A;  2GMS A;  1FG3 A;  3TCM A;  4WYF A;  1AMQ A;  1BT4 A;  2BI1 A;  3AEN B;  4HF8 A;  2E7I A;  1IVR A;  4H51 A;  3MEB A;  4F5J A;  4PIW A;  3QPG A;  4NOG A;  1E5F A;  3CQ4 A;  3NUI A;  2W7H A;  4B98 A;  2VMZ A;  4EFF A;  3GZC A;  3GWP A;  3HQT A;  2DOU A;  3AEL A;  4OBU A;  2AEU A;  3QHX A;  3GZD C;  4WYG A;  2FQ6 A;  1CQ6 A;  2C0R A;  1BJN A;  3WX9 A;  4A6U A;  3CBF A;  4AZJ A;  2W8W A;  1I29 A;  4UHN A;  1B4X A;  1YOO A;  1V2E A;  5M49 A;  1DJE A;  1ORD A;  2WKA A;  2YCN A;  1AMA A;  2YHK A;  1AHG A;  1W7L A;  3LV2 A;  1BJ4 A;  3AAT A;  4F5K A;  3N4S A;  2ZY2 A;  2Z9U A;  1B5O A;  3N0L A;  1EQB A;  3JZL A;  1JS3 A;  4OC9 A;  1S07 A;  4A6T A;  1C0N A;  1X29 A;  1Z3Z A;  2BWP A;  4A0H A;  4KXK A;  3B1C A;  3CAI A;  2JG2 A;  1UU2 A;  4OCA A;  5E3K A;  3A9Z A;  3N4R A;  3VK3 A;  4KYO A;  1AHE A;  2AY4 A;  2VIB A;  2D65 A;  3JTX A;  4K2I A;  4Y0I A;  3MC6 A;  4JEW A;  3RCH A;  2HOX A;  2AY9 A;  2AY2 A;  1ARI A;  3BCB A;  4AO4 A;  3A8U X;  3AEO A;  1AJR A;  2YCP A;  2ZY4 A;  3PAA A;  2GSA A;  3T32 A;  3NNK A;  3PD6 B;  3TFT A;  5G2P A;  2C81 A;  1LC8 A;  3A2B A;  1RVU A;  2CJH A;  1DJ9 A;  5E4Z A;  3EZS A;  3PGY A;  3FZ6 A;  4FFC A;  2OQX A;  1SF2 A;  1B5P A;  2AY5 A;  3FKD A;  2ZY5 A;  2VGW A;  4GE9 A;  3EI6 A;  1FC4 A;  1YIZ A;  1ASC A;  2CH1 A;  3EZ1 A;  4UQV A;  3ZRQ A;  4JEV A;  2VLH A;  1U08 A;  3G7Q A;  5EUE A;  3N7N A;  1OHY A;  3DYD A;  3WLX A;  1DGD A;  4MQP A;  3QI6 A;  5EAA A;  2R5E A;  3E77 A;  2D61 A;  3FDB A;  4RLG A;  2A1V A;  3HT4 A;  4TMR A;  4JF1 A;  2OGA A;  4RAE A;  4IYO A;  4UHO A;  1J04 A;  3FTB A;  2C7T A;  3VK2 A;  1V72 A;  3EI8 A;  3LWS A;  3AEJ C;  4Y0D A;  2JJF A;  3GJU A;  1B8G A;  3MKJ A;  2Q7W A;  4CXQ A;  1GC3 A;  3KKI A;  2HUI A;  2PO3 A;  5D5S A;  1WKG A;  2X3L A;  3MAF A;  1VEF A;  1QJ3 A;  3L8A A;  4W1X A;  1OHV A;  2O1B A;  2W8J A;  2EZ1 A;  4R5F A;  4BMK A;  4WP0 A;  3MBB A;  4OBV A;  2X5F A;  4R2N A;  1S0A A;  4F5F A;  5LH9 A;  5BJ4 A;  4ATP A;  1PMO A;  2HOR A;  4OTL A;  3B8X A;  1BJO B;  1Z7D A;  1UKJ A;  3DXW A;  1PMM A;  1IX6 A;  5HXX A;  3W1H A;  1G7W A;  5EQC A;  3G8M A;  3EI5 A;  2VLF A;  3B46 A;  3F9T A;  3JW9 A;  1C7O A;  2QA3 A;  4RJ0 A;  4ADC A;  4AH3 A;  4TV7 A;  4AOA A;  3EI7 A;  3COG A;  4LNJ A;  4XJO A;  1E5E A;  2EH6 A;  4L0O A;  3A9Y A;  1AY8 A;  1X2A A;  3TFU A;  3PJ0 A;  9AAT A;  3B1E A;  2ZC0 A;  2V0Y A;  3FVX A;  1AIA A;  4HVK A;  4WLH A;  1WYU B;  4B9B A;  1ZC9 A;  2AY3 A;  2ZSM A;  4LW2 A;  1GEX A;  1M0O A;  3MAU A;  3FQ8 A;  3WCO A;  2Z9X A;  3BCA A;  4K05 A;  2VMW A;  2AY7 A;  5F8V A;  1TOI A;  3AEM C;  3PA9 A;  2JJH A;  4WYC A;  4A0R A;  3ISL A;  4U2H A;  1LK9 A;  3ELP A;  1WYT A;  2PB2 A;  1IJI A;  1I41 A;  2VMY A;  1UU1 A;  2WK8 A;  5I92 A;  1ECX A;  4MY5 A;  2DGM A;  1KL1 A;  4ZDP A;  1AY4 A;  1IAX A;  4MSO A;  4WYD A;  5EAV A;  4W8I A;  4O6Z A;  4WXG A;  3OKS A;  3G0T A;  4E77 A;  4U1T A;  4ADD A;  3P1T A;  2FN6 A;  3DZZ A;  2Z67 A;  1GEW A;  5AX8 A;  1YJZ A;  1UU0 A;  5EIG A;  4CXR A;  1MAP A;  3I5T A;  2YKV A;  4UOY A;  3I16 A;  3PIU A;  4RM1 A;  3JWA A;  1ASF A;  1C7G A;  1JF9 A;  2BIA A;  3VK4 A;  2HZP A;  3NYU A;  4JE5 D;  2W8U A;  2BWN A;  3AEP A;  4CVQ A;  4A0G A;  1ASD A;  3H7F A;  1TPL A;  1O61 A;  3ECD A;  5C6U A;  3HDO A;  2EGY A;  2QLR A;  1W23 A;  1PFF A;  3DR7 A;  4LW4 A;  4WLJ A;  4F5G A;  5FT5 A;  1SZS A;  5DJ9 A;  2CY8 A;  2FNI A;  2VIA A;  3HBX A;  2EO5 A;  3WGB A;  2E7U A;  3GZD A;  1ASB A;  2ZP7 A;  1TOG A;  2FYF A;  3DR4 A;  3RUY A;  3IHJ A;  2BI9 A;  4XJL A;  1LS3 A;  2Z1Z A;  5IWQ A;  1YJS A;  3N5M A;  1MDZ A;  1AMR A;  1BKG A;  1G7X A;  3K7Y A;  3NUB A;  5TF5 A;  2D66 A;  2W7M A;  1MDO A;  2AY8 A;  4M2M A;  1PG8 A;  3VP6 A;  3NRA A;  1AHF A;  5DJ1 A;  4DBC A;  3N4X A;  3Q8N A;  3CQ6 A;  3E2Z A;  1AJS A;  1KMJ A;  1MLZ A;  2DGL A;  3NU8 A;  2QB2 A;  4P3M A;  1JS6 A;  3MAD A;  4CBR A;  3BWN C;  2ZJG A;  3QN6 A;  4IX8 A;  2HP2 A;  2VMS A;  3RCH B;  2CJD A;  4ITX A;  1MAQ A;  1MGV A;  2VMU A;  3EIA A;  4IW7 A;  4PFF A;  2CFB A;  3KGX A;  4WYA A;  4XK1 A;  1ARG A;  1OAT A;  1CJ0 A;  4GRX A;  2YKU A;  4LC3 A;  4Y0H A;  4MQQ A;  4R5Z A;  4E3Q A;  3FCR A;  1QIS A;  3B1D A;  3H9X A;  5G2Q A;  5G4I A;  1VP4 A;  2EYQ A;  2HUU A;  2R5C A;  2GMU A;  3ATH A;  3VOM A;  4ZSW A;  4GEB A;  5JAY A;  3A9X A;  1ASM A;  4W1V A;  1MDX A;  1CL1 A;  1C7N A;  3LY1 A;  4OMA A;  3UE8 A;  3FDD A;  2YKX A;  2XBN A;  1IBJ A;  1C4K A;  1QIT A;  2PB0 A;  1QJ5 A;  2W7E A;  1LW4 A;  4GDY A;  3HMU A;  5DX5 A;  2X8U A;  4EB7 A;  4N0W A;  3BC8 A;  4WBT A;  1BQA A;  3GBX A;  2VGS A;  2HOY A;  1ELU A;  1O4S A;  1M0N A;  4IYO B;  3E2Y A;  1KKP A;  1TAS A;  4A00 A;  4EB5 A;  2JJE A;  1M0P A;  5HDM A;  1VJO A;  2ZSL A;  3AEJ A;  2VMQ A;  3DOD A;  3JWB A;  4Q31 A;  1TAT A;  2FKI A;  2JIS A;  1ASN A;  3BV0 A;  3FVS A;  3MAF B;  1J32 A;  3CQ5 A;  1YIY A;  5DB5 A;  1SFF A;  2OKJ A;  2DKJ A;  2BI2 A;  2NMP A;  2CH2 A;  1D2F A;  2OAT A;  2W7D A;  3LG0 A;  1SZK A;  4Q75 A;  1I43 A;  3FQ7 A;  3E6G A;  2D5Y A;  3PPL A;  5G09 A;  4P7Y A;  3IF2 A;  3II0 A;  4JEZ A;  4BQ0 A;  2W8T A;  1GC4 A;  4DGT A;  3JU7 A;  1IAY A;  3ASA A;  1WYV A;  4I8A A;  3DRD A;  1GDE A;  3FFR A;  4EU1 A;  2HOZ A;  3HL2 A;  3D6K A;  1AHY A;  1IX7 A;  2VGZ A;  1M0Q A;  2BWO A;  4A0F A;  1BS0 A;  4WB0 A;  4GE7 A;  1EJI A;  1QIR A;  1M6S A;  2G7J A;  1WKH A;  2CB1 A;  2FNU A;  3DC1 A;  5EFS A;  1DFO A;  3QM2 A;  5J8Q A;  3HLM A;  1AAW A;  2QMA A;  1IUG A;  1RVY A;  4F5L A;  1KAF A;  5M4B A;  4ZWM A;  1GCK A;  3NYS A;  4WD2 A;  2VYC A;  2EPJ A;  1ASE A;  1WST A;  3EI9 A;  1XI9 A;  2Z20 A;  5FT4 A;  3RBL A;  3WY7 A;  3PDB A;  5M4D A;  3R9A A;  3GET A;  4IY7 A;  3AOW A;  4BA5 A;  2GB3 A;  3KGW A;  2YKY A;  3VAX A;  4F5M A;  2DGK A;  3AEM A;  3HVY A;  1BJW A;  4OT8 A;  1TOJ A;  1GC2 A;  2E54 A;  1TOK A;  1WYT B;  1AKC A;  4GSA A;  4IXS A;  4XAU A;  3F0H A;  8AAT A;  1AY5 A;  3DXV A;  1D7V A;  3DU4 A;  3AEN A;  2VMO A;  1GBN A;  1YJY A;  1ASL A;  2V1P A;  1I48 A;  2D64 A;  2YRR A;  4F5H A;  1TOE A;  3WKR A;  4MKJ A;  1M7Y A;  3FZ7 A;  3AV7 A;  4DQ6 A;  5BJ3 A;  4GE4 A;  1B9I A;  2BIE A;  4JEX A;  1GD9 A;  1S09 A;  2W7L A;  1W7M A;  4QGR A;  2QB3 A; 
#chains in the Genus database with same CATH homology
 2D7Z A;  2VGU A;  3NTJ A;  3PDX A;  7AAT A;  2VMP A;  3FFH A;  2W7I A;  2VI8 A;  3NYT A;  1CQ8 A;  2WK9 A;  3GSB A;  4W1W A;  3UAK A;  1DKA A;  2D63 A;  1XEY A;  1O69 A;  4ZAS A;  1CQ7 A;  3E9K A;  3RI6 A;  1B9H A;  3WZF A;  4ZM4 A;  3ASB A;  2D7Y A;  4TN4 A;  3M5U A;  1S06 A;  3KE3 A;  2DKB A;  1SPA A;  4ZSY A;  5E5I A;  1Y4I A;  3MC6 C;  1KKJ A;  2Z9V A;  4MGR A;  1FG7 A;  2ZY3 A;  1V2F A;  4A72 A;  1KMK A;  2JGT A;  1ARH A;  2AY6 A;  4ADE A;  1X0M A;  4JF0 A;  5HHY A;  1RV4 A;  1T3I A;  2BYL A;  2F8J A;  3PD6 A;  3WCN A;  1OXP A;  2JJG A;  4BHD A;  3RBF A;  3BWO A;  4J8L A;  4ZM3 A;  4W5K A;  2HUF A;  1AKB A;  2RFV A;  2GQN A;  3L44 A;  3W1I A;  1AMS A;  4JE5 A;  4F5I A;  4WXB A;  2DR1 A;  3ZZJ A;  4UHM A;  3NX3 A;  4OYT A;  1AAM A;  1ASA A;  3E2Z B;  4ZLV A;  1AJS B;  3TAT A;  3FD0 A;  4R8D A;  3RQ1 A;  2C44 A;  3I4J A;  4LNL A;  1QZ9 A;  2R0T A;  5G4J A;  1P3W A;  3BN1 A;  2O0R A;  3BWN A;  4ITG A;  2VI9 A;  1BW0 A;  4AZK A;  5EUD A;  1LC5 A;  4JEY A;  2HP1 A;  3FVU A;  2EZ2 A;  3TQX A;  4E1O A;  4ZDO A;  3K28 A;  2CIN A;  3ZRP A;  1W7N A;  1H1C A;  1AHX A;  1AIB A;  3GR9 A;  3N75 A;  3LVM A;  4M2K A;  4WYE A;  3NDN A;  1CS1 A;  1LW5 A;  3LVK A;  3ZRR A;  2WB6 A;  1AX4 A;  1H0C A;  1DGE A;  2CTZ A;  4XQ2 A;  1G4X A;  1AKA A;  2BKW A;  2TPL A;  1CL2 A;  3E2F A;  1MLY A;  1M4N A;  2ORD A;  1GEY A;  3W1J A;  1O62 A;  2ZYJ A;  2R5C B;  4ZDL A;  1CZE A;  1JG8 A;  1D7R A;  2VMN A;  1BQD A;  5M46 A;  4F4E A;  5EIG B;  1V2D A;  1ZOD A;  4WXF A;  1YNU A;  4ISY A;  1N8P A;  5FT6 A;  2O7C A;  2W7J A;  4KAM A;  1ASG A;  2KFP A;  5FT8 A;  3FQA A;  3FZ8 A;  2Z9W A;  1QGN A;  2VGV A;  2YCT A;  3BS8 A;  1AIC A;  2Z61 A;  1CZC A;  1M32 A;  4E3R A;  1BJO A;  2CAN A;  5K8B A;  3FRK A;  2G6W A;  1SVV A;  1ELQ A;  4ZWV A;  2YOB A;  4XJP A;  3R4T A;  4CBS A;  1N31 A;  1OHW A;  1D7S A;  1DTY A;  1X28 A;  3WKS A;  1ART A;  2BI5 A;  2FM1 A;  2QSR A;  2QBT A;  1RV3 A;  2ZUK A;  1EG5 A;  3QBO A;  3EUC A;  1LKC A;  4RKD A;  3ELE A;  3LVL B;  3LVJ A;  1LC7 A;  1TAR A;  1ZOB A;  4K2M A;  4Q6R A;  4ADB A;  4W91 A;  2Z1Y A;  5LHA A;  1C9C A;  3P6K A;  2XH1 A;  2W7K A;  3FSL A;  4LNM A;  2X5D A;  4ZAH A;  4Q76 A;  1WYU A;  2BHX A;  4RKC A;  1YAA A;  1D7U A;  5EUN A;  2VMT A;  2BI3 A;  1GC0 A;  3H14 A;  4MQR A;  3UWC A;  1WYV B;  2OKK A;  2CST A;  1W3U A;  4MKK A;  2AEV A;  2VMR A;  3BB8 A;  3NU7 A;  4M2J A;  4PFN A;  4WB0 B;  2YRI A;  5G0A A;  3WGC A;  2CJG A;  4PVF A;  2BYJ A;  4AO9 A;  4A6R A;  2OGE A;  3USF A;  4RIZ A;  1N2T A;  5KTB A;  1IX8 A;  2E7J A;  2VMV A;  3ACZ A;  4IXZ A;  4RIT A;  3AOV A;  4BA4 A;  1KL2 A;  3F6T A;  4ATQ A;  1DJU A;  1S08 A;  5D95 A;  2WK7 A;  4XEW A;  5F9S A;  4H63 Q;  3QGU A;  4FL0 A;  3PDB B;  4K2B A;  1ARS A;  2W7G A;  1SZU A;  2W7F A;  2BIG A;  3K40 A;  4N0B A;  2AY1 A;  2R2N A;  2VMX A;  3OP7 A;  4IXO A;  2VGT A;  3ZZK A;  1OXO A;  3BCX A;  3EIB A;  2AAT A;  2W8V A;  4J5U A;  4XJM A;  4EMY A;  1G4V A;  4RJY A;  2GMS A;  1FG3 A;  3TCM A;  4WYF A;  1AMQ A;  1BT4 A;  2BI1 A;  3AEN B;  4HF8 A;  2E7I A;  1IVR A;  4H51 A;  3MEB A;  4F5J A;  4PIW A;  3QPG A;  4NOG A;  1E5F A;  3CQ4 A;  3NUI A;  2W7H A;  4B98 A;  2VMZ A;  4EFF A;  3GZC A;  3GWP A;  3HQT A;  2DOU A;  3AEL A;  4OBU A;  2AEU A;  3QHX A;  3GZD C;  4WYG A;  2FQ6 A;  1CQ6 A;  2C0R A;  1BJN A;  3WX9 A;  4A6U A;  3CBF A;  4AZJ A;  2W8W A;  1I29 A;  4UHN A;  1B4X A;  1YOO A;  1V2E A;  5M49 A;  1DJE A;  1ORD A;  2WKA A;  2YCN A;  1AMA A;  2YHK A;  1AHG A;  1W7L A;  3LV2 A;  1BJ4 A;  3AAT A;  4F5K A;  3N4S A;  2ZY2 A;  2Z9U A;  1B5O A;  3N0L A;  1EQB A;  3JZL A;  1JS3 A;  4OC9 A;  1S07 A;  4A6T A;  1C0N A;  1X29 A;  1Z3Z A;  2BWP A;  4A0H A;  4KXK A;  3B1C A;  3CAI A;  2JG2 A;  1UU2 A;  4OCA A;  5E3K A;  3A9Z A;  3N4R A;  3VK3 A;  4KYO A;  1AHE A;  2AY4 A;  2VIB A;  2D65 A;  3JTX A;  4K2I A;  4Y0I A;  3MC6 A;  4JEW A;  3RCH A;  2HOX A;  2AY9 A;  2AY2 A;  1ARI A;  3BCB A;  4AO4 A;  3A8U X;  3AEO A;  1AJR A;  2YCP A;  2ZY4 A;  3PAA A;  2GSA A;  3T32 A;  3NNK A;  3PD6 B;  3TFT A;  5G2P A;  2C81 A;  1LC8 A;  3A2B A;  1RVU A;  2CJH A;  1DJ9 A;  5E4Z A;  3EZS A;  3PGY A;  3FZ6 A;  4FFC A;  2OQX A;  1SF2 A;  1B5P A;  2AY5 A;  3FKD A;  2ZY5 A;  2VGW A;  4GE9 A;  3EI6 A;  1FC4 A;  1YIZ A;  1ASC A;  2CH1 A;  3EZ1 A;  4UQV A;  3ZRQ A;  4JEV A;  2VLH A;  1U08 A;  3G7Q A;  5EUE A;  3N7N A;  1OHY A;  3DYD A;  3WLX A;  1DGD A;  4MQP A;  3QI6 A;  5EAA A;  2R5E A;  3E77 A;  2D61 A;  3FDB A;  4RLG A;  2A1V A;  3HT4 A;  4TMR A;  4JF1 A;  2OGA A;  4RAE A;  4IYO A;  4UHO A;  1J04 A;  3FTB A;  2C7T A;  3VK2 A;  1V72 A;  3EI8 A;  3LWS A;  3AEJ C;  4Y0D A;  2JJF A;  3GJU A;  1B8G A;  3MKJ A;  2Q7W A;  4CXQ A;  1GC3 A;  3KKI A;  2HUI A;  2PO3 A;  5D5S A;  1WKG A;  2X3L A;  3MAF A;  1VEF A;  1QJ3 A;  3L8A A;  4W1X A;  1OHV A;  2O1B A;  2W8J A;  2EZ1 A;  4R5F A;  4BMK A;  4WP0 A;  3MBB A;  4OBV A;  2X5F A;  4R2N A;  1S0A A;  4F5F A;  5LH9 A;  5BJ4 A;  4ATP A;  1PMO A;  2HOR A;  4OTL A;  3B8X A;  1BJO B;  1Z7D A;  1UKJ A;  3DXW A;  1PMM A;  1IX6 A;  5HXX A;  3W1H A;  1G7W A;  5EQC A;  3G8M A;  3EI5 A;  2VLF A;  3B46 A;  3F9T A;  3JW9 A;  1C7O A;  2QA3 A;  4RJ0 A;  4ADC A;  4AH3 A;  4TV7 A;  4AOA A;  3EI7 A;  3COG A;  4LNJ A;  4XJO A;  1E5E A;  2EH6 A;  4L0O A;  3A9Y A;  1AY8 A;  1X2A A;  3TFU A;  3PJ0 A;  9AAT A;  3B1E A;  2ZC0 A;  2V0Y A;  3FVX A;  1AIA A;  4HVK A;  4WLH A;  1WYU B;  4B9B A;  1ZC9 A;  2AY3 A;  2ZSM A;  4LW2 A;  1GEX A;  1M0O A;  3MAU A;  3FQ8 A;  3WCO A;  2Z9X A;  3BCA A;  4K05 A;  2VMW A;  2AY7 A;  5F8V A;  1TOI A;  3AEM C;  3PA9 A;  2JJH A;  4WYC A;  4A0R A;  3ISL A;  4U2H A;  1LK9 A;  3ELP A;  1WYT A;  2PB2 A;  1IJI A;  1I41 A;  2VMY A;  1UU1 A;  2WK8 A;  5I92 A;  1ECX A;  4MY5 A;  2DGM A;  1KL1 A;  4ZDP A;  1AY4 A;  1IAX A;  4MSO A;  4WYD A;  5EAV A;  4W8I A;  4O6Z A;  4WXG A;  3OKS A;  3G0T A;  4E77 A;  4U1T A;  4ADD A;  3P1T A;  2FN6 A;  3DZZ A;  2Z67 A;  1GEW A;  5AX8 A;  1YJZ A;  1UU0 A;  5EIG A;  4CXR A;  1MAP A;  3I5T A;  2YKV A;  4UOY A;  3I16 A;  3PIU A;  4RM1 A;  3JWA A;  1ASF A;  1C7G A;  1JF9 A;  2BIA A;  3VK4 A;  2HZP A;  3NYU A;  4JE5 D;  2W8U A;  2BWN A;  3AEP A;  4CVQ A;  4A0G A;  1ASD A;  3H7F A;  1TPL A;  1O61 A;  3ECD A;  5C6U A;  3HDO A;  2EGY A;  2QLR A;  1W23 A;  1PFF A;  3DR7 A;  4LW4 A;  4WLJ A;  4F5G A;  5FT5 A;  1SZS A;  5DJ9 A;  2CY8 A;  2FNI A;  2VIA A;  3HBX A;  2EO5 A;  3WGB A;  2E7U A;  3GZD A;  1ASB A;  2ZP7 A;  1TOG A;  2FYF A;  3DR4 A;  3RUY A;  3IHJ A;  2BI9 A;  4XJL A;  1LS3 A;  2Z1Z A;  5IWQ A;  1YJS A;  3N5M A;  1MDZ A;  1AMR A;  1BKG A;  1G7X A;  3K7Y A;  3NUB A;  5TF5 A;  2D66 A;  2W7M A;  1MDO A;  2AY8 A;  4M2M A;  1PG8 A;  3VP6 A;  3NRA A;  1AHF A;  5DJ1 A;  4DBC A;  3N4X A;  3Q8N A;  3CQ6 A;  3E2Z A;  1AJS A;  1KMJ A;  1MLZ A;  2DGL A;  3NU8 A;  2QB2 A;  4P3M A;  1JS6 A;  3MAD A;  4CBR A;  3BWN C;  2ZJG A;  3QN6 A;  4IX8 A;  2HP2 A;  2VMS A;  3RCH B;  2CJD A;  4ITX A;  1MAQ A;  1MGV A;  2VMU A;  3EIA A;  4IW7 A;  4PFF A;  2CFB A;  3KGX A;  4WYA A;  4XK1 A;  1ARG A;  1OAT A;  1CJ0 A;  4GRX A;  2YKU A;  4LC3 A;  4Y0H A;  4MQQ A;  4R5Z A;  4E3Q A;  3FCR A;  1QIS A;  3B1D A;  3H9X A;  5G2Q A;  5G4I A;  1VP4 A;  2EYQ A;  2HUU A;  2R5C A;  2GMU A;  3ATH A;  3VOM A;  4ZSW A;  4GEB A;  5JAY A;  3A9X A;  1ASM A;  4W1V A;  1MDX A;  1CL1 A;  1C7N A;  3LY1 A;  4OMA A;  3UE8 A;  3FDD A;  2YKX A;  2XBN A;  1IBJ A;  1C4K A;  1QIT A;  2PB0 A;  1QJ5 A;  2W7E A;  1LW4 A;  4GDY A;  3HMU A;  5DX5 A;  2X8U A;  4EB7 A;  4N0W A;  3BC8 A;  4WBT A;  1BQA A;  3GBX A;  2VGS A;  2HOY A;  1ELU A;  1O4S A;  1M0N A;  4IYO B;  3E2Y A;  1KKP A;  1TAS A;  4A00 A;  4EB5 A;  2JJE A;  1M0P A;  5HDM A;  1VJO A;  2ZSL A;  3AEJ A;  2VMQ A;  3DOD A;  3JWB A;  4Q31 A;  1TAT A;  2FKI A;  2JIS A;  1ASN A;  3BV0 A;  3FVS A;  3MAF B;  1J32 A;  3CQ5 A;  1YIY A;  5DB5 A;  1SFF A;  2OKJ A;  2DKJ A;  2BI2 A;  2NMP A;  2CH2 A;  1D2F A;  2OAT A;  2W7D A;  3LG0 A;  1SZK A;  4Q75 A;  1I43 A;  3FQ7 A;  3E6G A;  2D5Y A;  3PPL A;  5G09 A;  4P7Y A;  3IF2 A;  3II0 A;  4JEZ A;  4BQ0 A;  2W8T A;  1GC4 A;  4DGT A;  3JU7 A;  1IAY A;  3ASA A;  1WYV A;  4I8A A;  3DRD A;  1GDE A;  3FFR A;  4EU1 A;  2HOZ A;  3HL2 A;  3D6K A;  1AHY A;  1IX7 A;  2VGZ A;  1M0Q A;  2BWO A;  4A0F A;  1BS0 A;  4WB0 A;  4GE7 A;  1EJI A;  1QIR A;  1M6S A;  2G7J A;  1WKH A;  2CB1 A;  2FNU A;  3DC1 A;  5EFS A;  1DFO A;  3QM2 A;  5J8Q A;  3HLM A;  1AAW A;  2QMA A;  1IUG A;  1RVY A;  4F5L A;  5M4B A;  4ZWM A;  1GCK A;  3NYS A;  4WD2 A;  2VYC A;  2EPJ A;  1ASE A;  1WST A;  3EI9 A;  1XI9 A;  2Z20 A;  5FT4 A;  3RBL A;  3WY7 A;  3PDB A;  5M4D A;  3R9A A;  3GET A;  4IY7 A;  3AOW A;  4BA5 A;  2GB3 A;  3KGW A;  2YKY A;  3VAX A;  4F5M A;  2DGK A;  3AEM A;  3HVY A;  1BJW A;  4OT8 A;  1TOJ A;  1GC2 A;  2E54 A;  1TOK A;  1WYT B;  1AKC A;  4GSA A;  4IXS A;  4XAU A;  3F0H A;  8AAT A;  1AY5 A;  3DXV A;  1D7V A;  3DU4 A;  3AEN A;  2VMO A;  1GBN A;  1YJY A;  1ASL A;  2V1P A;  1I48 A;  2D64 A;  2YRR A;  4F5H A;  1TOE A;  3WKR A;  4MKJ A;  1M7Y A;  3FZ7 A;  3AV7 A;  4DQ6 A;  5BJ3 A;  4GE4 A;  1B9I A;  2BIE A;  4JEX A;  1GD9 A;  1S09 A;  2W7L A;  1W7M A;  4QGR A;  2QB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...