1X31C

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords Sarcosine oxidase alpha subunit
total genus 51
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1x31C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1x31C01
1VLOA 4PAAA 1PJ5A 3GSIA 3GEEA 3TFHA 3GEHA 1VRQC 1YX2A 2GAHC 3AD9C 1WSVA 4P9SA 3TFIA 3GIRA 3AD8C 1XZQA 3TFJA 1PJ7A 1XZQB 3A8IA 3GEIA 5L46A 1XZPB 3AD7C 3ADAC 4PABA 1WORA 2GAGC 1WSRA 1WOOA 1XZPA 3A8KA 1X31C 1V5VA 1WOSA 1WOPA 3TTGA 3A8JA 1PJ6A
chains in the Genus database with same CATH superfamily
2EI5A 2N82B 3GEEA 1O28A 3EXCX 4E0DA 5IV4A 3GTLA 5TMFA 1SC6A 1M5SA 1S0OA 1N6QB 1IR2A 3B4MA 2AEJA 2GJIA 3MR2A 1K83K 2YWEA 4KBIA 3SCIE 2LEAA 2J6SA 1JXVA 4Q2MA 3CNQP 3GIRA 5HANA 2EBEA 2XS7A 1H2UX 4PZVA 3OTDA 3G2XA 3K7AK 1JKHB 2AP6A 3I0RB 4NZ6A 4OMFG 3PO5A 2L41A 4IG3A 4I7FB 2VZ9A 4QWBA 2ZH5A 3QRPA 1N5QA 1FRLA 1JNRB 1F5CA 1RB0A 4ED4A 1QM9A 2WBRA 4ZVQB 1S9EB 5T7LB 4Q44A 1Q7YT 2CQCA 1ACMB 4KHMA 4U67Q 1RTDB 3NY0A 1VBZA 3D0IE 1VR6A 1SUQB 4A93K 1XZQA 2Y1JA 5F0UA 4DL6A 1R0BG 4KHPF 1H98A 3MPUB 3NCQA 1WKKA 1T9WA 1JLFA 1EH1A 2X3DA 2FHJA 2DRBA 3QAUA 1PILA 3M2UA 3O5TB 2Z4PA 2BE9B 4KR0B 4QWEA 1NZ8A 3M4XA 3ZZOA 1KSPA 2AGOA 2OUGA 1GXLA 4NLQA 5FJ4A 5HP1A 3J81j 1I3QC 5IOLA 4MYUA 3GTKK 2LA4A 4ITSA 5L9XA 2QG9B 4OI4A 5CA5A 1HW9A 3OL6A 2GQ2A 2OTLS 1UL3A 1X4FA 3CEDA 3RZOK 2IM1A 5IYDK 2HK3A 3DM2B 1G2EA 2VPWB 1YWXA 1USMA 3QGGA 3M2RA 4BY7C 4ILDA 3CJ3A 1BDFA 2Z8QA 4ED8A 2N7YA 4FYWB 3SV4A 3CSKA 4EMDA 4DR1F 2RF2A 4O2DA 1PYTA 5DLGA 2ZBPA 1RU2A 4WU3A 3KK1A 2CWKA 4K8RA 4WFNQ 4KKOA 2OJ3A 2MGZB 2VKZG 1T0TV 1JLGB 2B3TB 1VI7A 5KG2A 5I3UB 3M4OC 3H90A 1SXLA 3J7Z5 3PO3C 3SZ2A 3GTJA 3HOWC 1QTNB 2DJWA 2HVEA 4P75A 1HW8A 4GZYA 2HFSA 1AFJA 3SXLA 2IC3B 4NRUA 3KLVA 2RMLA 4ZHRB 2QT7A 5K20B 5KG6A 4U6PA 1J5OA 1RT5B 2ZZNA 1SJFA 2QE5A 2HFVA 4ZPDA 3HKZL 3DCAA 4IH6A 2YKNB 3ZZ0A 3DC2A 4TYAA 5KFJA 4IG0A 3US5A 3HSDA 4YS2A 1YTYA 3CJ0A 3BSNA 2PFDA 2OPSA 1CULA 1NEEA 1KFDA 4P7VA 3DLEA 3H3VL 1TL1B 3FSXA 5G0RA 1S1UB 5M2PA 3DRXA 1F93A 1F7UA 3K5NA 2WW8A 4DV0F 4YFXA 1MU2A 4WXOA 4MAKA 4A8SA 1EHWA 4DR6J 4M5IA 3MEKA 2F4VF 5A6WA 3G71S 1U2RA 3UN2A 1K9MT 2BXJA 4DHVA 2JX2A 4BWMA 2MZSA 4IG3B 4UY8T 4LREA 4JI2F 5CD4H 4MYTA 2J9DA 3LP2A 1NM2A 3O6QA 1L3VA 4C2MC 1ROFA 1S12A 4G1QA 1C0UB 1QUPA 2BM0A 3BKFA 1IBLJ 3R7BB 2CRLA 2XY5A 1RYRA 1Q78A 3ENVA 4I2PA 2UXBF 2HFZA 3TJAA 4A8MP 2E2HK 4CT9A 4KV8B 3SV3A 1WNEA 2X51A 3GWCA 5KFIA 2DNYA 2CNKB 4H4KC 3ZZUA 1F5AA 5A2QU 3RR7A 2BRLA 3JQKA 4F3MA 4OI6A 5I3PA 1NK7A 4Y34A 5A0YB 2V6SA 4EU0A 1JLFB 2GGPA 5CABA 2RHSB 2XHWA 3CE8A 2VICA 1W25A 4NLVA 3G4SS 1NLKL 3VVTA 3OHBA 4OX7A 1TUGB 3ISND 3PO2C 1BD6A 2QL7B 4GC7A 2H1YA 4GTLA 2OELA 4F36A 3M8WA 5KG7A 3TUPA 5LJ5Y 2VQFJ 4WIIA 3L95X 3O44A 1W7WA 3KK3B 5IOSA 3GTPA 4EWTA 2MQLA 4MFBB 4DQPA 4MT1A 3IRWP 3F73A 5H9EK 3M2VA 2H4YB 4DG1B 4ZVPB 4PYDA 4TYBA 3GIKA 2J0QD 2EFQA 2UUTA 1G4CA 2ZE2A 4EO8A 1I3QA 4ZVSB 5CHPA 2I1RA 2JL9A 4NA2A 4OHVA 3BQ0A 2YNHA 3D0GE 1I1GA 2V5HG 2POKA 1U1NA 1G51A 2OFHX 1T3NA 2KH9A 5CYMB 4NZ7A 2DR6A 1GX5A 4B9SA 1UFLA 1L3KA 3S0XA 3KFWX 4ZMMA 3V2UC 5DDPC 3D1OA 4JI0F 1TU0B 4K5RA 2XMJA 5C24A 1Y5LB 4FF4A 1NDLA 1WSVA 5DLFA 3W8PA 2FVCA 4TN2A 4HL9A 1TUVA 5M5YK 3S1QK 1WC0A 4GFQA 1S77D 1L3SA 4ZLLA 3KYLA 4DR3F 1ISEA 3EZUA 3MUTP 3JSYA 3M8PB 1YHQS 4C48A 5GADU 3KK1B 1G7CB 1FRJA 2AX0A 4IG0B 4C7QA 3KUHA 2DNHA 3CCMS 2ZH6A 3GTJC 3AA9A 1TWCC 5HJYA 2AJ1A 2GVZB 1L3TA 5F8HA 3MGJA 2LQ5A 1U6ZA 1MN9A 2PMZD 4DXLA 1NK0A 5IT9U 1KLMA 2HMIA 4PG7A 2BE5A 4JUZA 1HQUA 4OJ1A 1E6VB 1T9XA 3H5XA 2GHWA 4NPOA 3SZZA 4DPTA 2VDIA 4ZPAA 4LMZA 3TX8A 5KG3A 2OSQA 2B8QA 5KFMA 2PE8A 2YVSA 3NS6A 4PXDA 2RF2B 4ZPTR 3KJQB 2KJWA 4K50A 3RBDA 4RW9A 4DLGA 3DI6A 1OY6A 2A2DA 1FVQA 3A13A 2ZITA 1P27B 2OD6A 3M3YK 2JLFA 3H5SA 2E5IA 2IM2A 2IDEA 2YH0A 3WIVA 2LQ8A 1JLCB 3AT1B 2U1AA 3M1VB 4UY85 2JVOA 4FZVA 4H4MB 2PGCA 1WF2A 4BWJA 4BY7K 1RTHA 5CQGA 5ETOA 1AB4A 4YFNA 4FBUA 2HQ3A 4ECRA 4QIFA 3PX0A 2EC0A 2IHR1 4WP3A 1WIHA 2B63A 1KDNA 3GCWP 1IKXA 3GEHA 2ACMA 1QSLA 1NB2A 1TWGK 1URNA 1I6HC 5J1EB 5DQGA 2RU3A 2R8HA 1ZA1B 1T9YA 1RTJB 4OI0A 2Z2LA 2DGWA 1Y4ZB 3DRRA 4GT9A 4PPZA 1IKYB 1RU1A 1MROA 5D4NA 1D9DA 4Q7AA 1N56A 2F4FA 4DEZA 1FNXH 1QAXA 3GTJK 4I2PB 3ISNC 3G96A 4LOWA 4BCAA 5L46A 1FDNA 2VJVA 1EKSA 1HQEA 1UV7A 1F9FA 4QR2A 2W2PP 3CO0P 5BYSA 3PEJA 1L3UA 2FJWA 3R5AA 4QYZJ 3CCVS 1FNOA 2PA3A 1NUEA 1GTEA 1SC3B 3ZZYA 2HHXA 5D0EA 3WDOA 2EFNA 4A46A 3MR6A 2M8DB 3THVA 1CJTA 5DM6Q 3C16B 1H7XA 5TJ3A 4XTTA 5IORA 3NLCA 3DU6A 3S01A 1KC8T 2I9SA 4KJIA 4B3RJ 3L4KA 3W3SA 4WF9Q 2ZWPA 4P5BA 3I5BA 4WFZA 1AZSB 1RHKB 2KRBA 3M32B 3DYAA 1FEHA 5DETA 2N3LA 1S6UA 4F8RA 3BR8A 1JXEA 4BLBA 3HJVA 2WRMA 1GXTA 4A8XA 4GVBA 2CVIA 4CIOA 2W2MP 5BR8J 4YDDB 1XN9A 4DS4A 1IBKF 4DDQA 1ZAVA 3DRSB 1SC1B 1D09B 1LK5A 4ICLA 2NCKL 1FCAA 1VS3A 2VPYB 2HHTA 1RXOB 4A3JC 3TZYA 1NDCA 4K4WA 2DKOB 1XK8A 3M2RB 2BANB 3EGWB 3G8TA 3TZWA 5M2UA 2HS4A 4OJHA 3MMBB 3R9LA 2QC3A 3BH7B 2FD2A 1FESA 3MDFA 2R7TA 3MEGA 4O0NA 1HNIA 1FF2A 3MD1A 1N33J 1KBRA 2MTLA 4F2RA 4OZ1A 3D68A 3UR0A 1IKYA 1USOA 1XMQF 3O8WA 1FJGF 1IW7A 4R8UB 1P9QC 3ZFVA 2VPXB 2Q43A 3OW2R 2E5JA 3M30B 1TQLA 1VQ4S 2G0CA 2OH2A 1JJ2R 1J5OB 2RIJA 4QOTA 4N47A 3UR3C 4KAWX 3V6JA 1TVRA 2CPYA 1NHVA 1R6YA 3JTOA 4M5NA 4DV5F 2QO3A 5KOWA 1M5VC 2HQDA 5EGHA 4YB5A 3J81Y 2W9CA 3W2VB 1KRPA 3GTOK 2QRRA 5D77A 3VTIA 3TOQA 4YQWA 1HFEL 4LVNP 1RT6A 2PMHA 3I56S 1CQMA 3FBCA 3OL9A 1U7LA 2ZKUA 1DQ9A 4E8UA 4ZP7A 4QIEA 3CT9A 2M0GB 2B63K 1O6XA 2JEGA 1F9HA 2DCUB 4DL2A 1U2FA 1I5OB 2FDNA 4O0IA 2R7UA 3VV2B 4IH5A 2DHXA 4DZDA 3PKYA 1F2GA 1UPMB 4DI6A 2OLWA 2B5JB 4ZVUB 4F04B 4C8KA 4K5SA 2RRAA 4KMDA 1KEKA 5DM7Q 3WC2A 1T9TA 2CYYA 2L9NA 2YNGA 3V4MA 4C8NA 3P45B 2HGLA 1HBNA 2FUG9 5BXIA 3HHDA 2R4FA 1UW4A 1YRXA 3S16C 3MECB 1X4DA 5LXRA 1WDDA 3AD9C 2Y0SD 2OMOA 3GYNA 1FRXA 3FSYA 2RKIB 3C66A 1S48A 5U47A 2UXDJ 4LR2A 2X1FA 3WX4A 4I6WA 3GQCA 2C3PA 2NQPA 1C0TA 3BSAA 3NGSA 3PFEA 2C2OB 4AXJA 5IT0A 3IWLA 4USJC 2F8HA 2HZVA 2YX7A 5D8HB 1NH8A 4HLBA 4B3MJ 2E2JK 3LGMA 2RDIA 1DFDA 4WE1A 3OTCA 4KT0C 1FJEB 3G86A 3EZOA 2R7ZA 2RQKA 4KC5A 3M7VA 3BEGB 3H0PA 4AUKA 1VDHA 3KG0A 2GX8A 2XI2A 3G87A 3N0BA 4J9LA 2NSCA 3I96A 2MQMA 1HWIA 2FVSA 3H59A 5J2PB 1M90T 4NCAA 4LF6F 2DISA 3HX9A 2IA6A 2XYPB 3VALA 2LEPA 2BE2A 2QSFA 1BE4A 3K5LA 4P2MA 1SFOK 3BQ2A 2DPIA 1N0VC 4HEA9 3M2VB 2KVIA 1U09A 3QO9A 1RT4B 4RUHA 1WI6A 2E9TA 3W2VA 2FJBB 1SJ1A 4C8LA 2BW2A 2XMMA 1Y5NB 4OZNA 3P5BP 3BGLA 1WHVA 4V1Ak 3EMTA 5LXYA 1VBYA 3NAIA 1T95A 4B3SJ 3L09A 1OS5A 1MG7A 4ER8A 2JA7K 1RWOB 3A12A 2LXUA 3IR5B 1NKBA 2EG1A 4MMOA 4ZP8A 2XB2D 2GFFA 5C24B 5CAAA 1WG1A 4CLSA 4JI1J 4NYPA 4Q45A 2ZVSA 4G1IA 1TK0A 3RB0A 2DNPA 4CO2A 1U1LA 4LF4F 4NLOA 4WFYA 2B5JA 4C0BA 4DQSA 4FDFA 3HHKA 1U47A 4DSJA 3CQZA 1HNIB 1KHVA 5DDQC 1S10A 4FF1A 2ACYA 1M5OC 4LK0A 2AGPA 3BV8A 1U8SA 4DQRA 2J76E 1N36F 4J9RA 3BP3A 4DJBA 2HBRB 2B9WA 3PCOB 3DKDA 2GIFA 3WQPA 1FK9A 2WW4A 3R8YA 1INNA 4XAKA 4IFVB 3GIJA 4YB1P 4CYUA 4OYBA 4A8YA 3UVJA 5IT4A 3RR8A 2PMWA 4J9MA 3K7RA 3PKMA 1BGXT 3PW2A 2R7WA 3CWJA 1WI8A 2FJDB 5KFVA 4NLWA 4JP8A 1X4GA 5FDLB 1NNDA 2J5AA 3DXJA 4QU7A 3JYTA 1O27A 4M5KA 4PPDA 4UQTA 5A6PA 1H74A 3QYYA 3PR4A 4GO7X 4LJMA 1PYOB 4DR3J 4A3MK 4DCPB 2E2IC 5HAOA 4DFMA 2AYBA 5F8LA 5KFKA 5DQHA 1HI9A 1XIQA 3EPIA 1B4AA 3AQOA 1RKJA 4C3JC 3PRVA 1OQ6A 2VUMC 4CCHA 2A1BA 2XWXA 4G0VA 2KU7A 1NSKL 2PIIA 4P52A 4I6AA 5K8NA 2MEWA 2BE2B 4OYMA 4TY8B 2CDRB 2YNHB 2MKKA 2XSJA 2PA8D 3PV8A 1QLNA 1Q16B 2R8JA 2ZNYA 2CADA 2G2OA 3OEPA 4FNIA 2B9XA 3LAPA 4C6AA 4M63A 1TL4A 4Y2KA 1RLDA 4KH0B 4ELTA 3H20A 2AV5A 3L7UA 2RAQA 2IM3A 3W62A 2KYZA 3LP1B 3GSDA 3IWXA 4F7VA 3ZC4A 4K4SA 4KMHA 1T05A 1R8PA 1GNKA 1TMJA 4J9NA 4BBRK 3D0HE 4S0MA 2V94A 1EIYB 1UKUA 4DSFA 4KDDA 4LK1A 3RB6A 1B70B 2L9WA 1C2PA 5AE3A 3HOXK 1Q0NA 3JSMA 1O24A 3OFFA 4XSXA 1RAJA 3D6TB 2P5VA 2LQ9A 1PAEX 2XCQA 1X9MA 3CCJS 3ENWA 2FIUA 1PG5B 2VOOA 3PX6A 2V8DA 4P9SA 5DZ7A 2AQ4A 3H3VD 2JEJA 3I4PA 2NREA 2Y9HA 2GO8A 2PO4A 2QLWA 5KFUA 1R0AB 1H0HB 2XNRA 4QBUA 2M2BA 4X4OA 3W64A 1WTBA 2E2IK 1UAWA 3NP5A 3TZZA 1NDKA 1V9OA 4LF4J 1S99A 3UN5A 2RILA 3IS9B 3G82A 3J81U 3OVAA 1EB0A 4AQYJ 1LQ9A 2DIUA 2MB0B 2UVRA 4ZVGA 3Q3QA 1Q86T 1FWLA 3LF0A 1NK9A 1GMWA 3S8SA 4O3OA 1BC6A 4NMLA 5HK4A 5CYJA 4LRDA 2QMWA 3C14B 2FVPA 1CC7A 4AYBL 1XZPA 3MM8A 1XQIA 4ZPVR 1YJVA 3UD3P 4X2BA 3J7A1 1YIJS 3HHLD 4DV7F 3UCUP 5CCMA 2JA5C 2QA4S 3OREA 1XNQJ 3DLKB 2IRYA 1ZOTA 3HK2A 4IYQA 1FKAF 5J1EA 4FF2A 2F4VJ 3KMQA 4Y52C 4G3IA 2WVDA 1WWHA 1QTMA 4EO6A 4KGXB 2HHSA 3FMWA 2E2JC 2MY8A 3ZTQA 4HDGA 4ECQA 2KTQA 5C44C 2MKYA 2C2MB 5C44K 4FKXA 2HURA 1VQMS 1YRTA 1QSSA 2FHOB 5IM0A 1DTQB 1PJ5A 1TL1A 1Y7PA 3N0VA 1UEUA 2MKJA 3HPOA 1YJWS 4MQ9A 1VQ7S 5A0YA 2R9LA 4E98A 2JZ5A 3QT8A 2V4QA 1OJ4A 2CFAA 3JTPA 5A8RB 2BE7D 4NE9C 1UPPA 2J0WA 1T03B 2ZM6J 4EFAC 1SFOC 3HKZD 2E9RX 2VB6A 3MTJA 1U6BA 5KFLA 3K2YA 2VC1A 3GTLK 2C42A 5LMNJ 4AL7A 1LXJA 4IO9Q 2FZKB 3CJRA 2HSEB 4DV7J 5EWEA 7FD1A 2OPRA 4KTQA 3Q8UA 1KQKA 1RHJB 3QFWA 5F3ZA 2WZ1A 4DLEA 1XXCA 3C6UA 1VQSA 1HD1A 2A6MA 1QAYA 4C3LA 3TX0A 3WHIA 4RBUA 1T9VA 3HXAA 5J2QB 1WDTA 2JVRA 3TUJC 4LVOP 4B9VA 1ZS6A 5DRKA 2FY1A 4ZN1A 3GTYX 4J91A 2R2RA 4EYHB 1JQGA 3K8VA 2MJNA 4AQYF 5IYDC 1FO1A 2F63A 4NLXA 4Y7NK 1YCLA 3POTA 3UN3A 4J9VA 3I5AA 3FFIA 3LO3A 2GC8A 7FDRA 3G4AA 2OSRA 1FA0A 3QIPA 4TLRA 1TL3A 1PKUA 3MAQA 1VK8A 2UZAA 4URGA 3OBIA 3ET6B 2IAJB 2V8GA 1RTIA 2LCWA 1C4AA 2CPHA 4RW7B 3W61A 1TUWA 4K4YA 2M9KA 2WK4A 3TARA 3THPA 4CTAA 2AD9A 4ZP9A 2C22A 2V69A 3K7AC 3J7YU 2JRSA 3KDOA 1PC4A 3C6UB 2VA3A 1ZTTA 1PGZA 3I0SB 4FYVB 1IE0A 2LU1A 2OFGX 3HOZK 3FCVA 3EGNA 5SUHA 1NPPA 1YX2A 4C98A 4WE1B 1FRIA 2BQUA 2ZHOA 3IR6B 1FE0A 2EK6A 2IMOA 1VQ5S 2DNGA 4B3SF 2E2IA 1HBMB 3NNCA 2XCOA 2RU9A 3AY0A 3IO1A 2QX0A 1FRHA 3GTQA 3SCJE 1LWCB 5KT2A 4KY3A 5L8RC 4TQSA 3JQJA 2RSQA 3CQZK 3FEZA 4DPWA 4J3NA 2D3OR 3S17C 2RUSA 4P2SA 4R0JA 2CFAB 4KH1B 4DQIA 4ED5A 1BQMB 1AT1B 1XERA 3DMJA 2E5LJ 5FLXU 2X3GA 4K7QA 4B9MA 4KARA 3HSZA 3MM9B 8AT1B 2M8HA 3QPIA 3PM9A 2MYFA 2H9ZA 4C3IC 1FRKA 2WOMA 3UDEA 2ZNZA 2HHQA 2V8VA 1YJ9S 1RWWB 4F02A 5ETSA 2DXFA 2M7SA 4NLUA 2IPOB 4DFKA 3MWBA 1C0AA 2ZKTA 4KV8A 2K2PA 1B0VA 4LF7F 3DXBA 3GJSB 1TWGC 4KPCA 1FD2A 2DIVA 3Q2SC 1ZZNA 3ERED 2H54B 4DX7A 1HWLA 2YKAA 4GRSA 3MURP 2CPEA 3UDLA 2DK2A 2DTJA 1F6TA 1HQUB 4V19X 4IOAQ 3GTQK 3RB4A 4Q8EA 3NGDA 1JLBB 1JJCB 3QSIA 3OXFA 5EHHA 1JK9B 2W2QP 2YNFA 2WONA 3MM8B 4DR7F 1GQEA 2RGRA 1DTQA 2Z2MA 2LKZA 4DF4A 4DSIA 1R0CB 3Q8SB 2DVIA 4PG5A 3PHTA 5KT3A 2RHQB 2HFOA 2VOPA 2MPUA 1ZPVA 5KFXA 1IKWB 5D4DA 1UW9A 3S7RA 3GP9A 3IM9A 3AJ1A 4OYZA 3DGPB 4JOUA 4A3DK 8RUCA 4O23A 1FFGB 1EJ7L 5FDLA 2BJ9A 1D3WA 3OTBA 2FGOA 2CZVC 1MMDA 1FD8A 2JOQA 1HA1A 5M3FK 3KNGA 3AOBA 3GIMA 1NSQA 3FQKA 1HHTP 3I4NC 3EVMA 1DTTA 3UVJB 4RL1A 2ZUEA 3W9HA 2PEHA 3UWTA 3Q23A 2HKEA 4J9OA 1TAQA 4DX5A 3I6PA 3MOJB 5ETTA 1TWFA 4EK2A 4NA3A 4C2MK 5F9NA 4JI2J 2E1MC 1JWWA 2Y1RI 2ZHAA 2BZ2A 2WVEA 3HHLB 3WZ0A 3PR5B 4PQUB 3KLGB 3MEDB 2XI3A 4J9SA 2J8AA 2W1BA 3R6GB 4RNMA 1VRUB 1NK8A 2Y3YA 1UVIA 4FXVA 5C4XC 2DEIA 2FJAB 5HVGA 5KFAA 5I3UA 1GT8A 2YQ1A 1RBOB 5KT6A 3WODA 2XMVA 1RT3A 3HP6A 1AYEA 1GEHA 4NX9A 3CC2S 4DV2F 1S97A 4ZJLA 3NGTA 1JLQA 4QU6A 1AB8A 4RW7A 4FYDA 1M1KT 2M4MA 4CNZA 3AOAA 4P73A 3C15A 2XM3A 1H7WA 1AROP 5EDWA 1VQPS 2R3VA 4A3BK 2E5HA 2MQ8A 1Q79A 4YMEA 3QIDA 1LWFB 1AW0A 1VJEA 2N4CA 5L1IA 2QSWA 2BBEA 5GAGU 3GTMC 5HSPA 3CCQS 2P9GA 1IN0A 2FZCB 4MIBA 2MZQA 2DGTA 3R2CJ 2D3UA 3BDEA 1VRTB 3OR1B 2HW3A 1IBKJ 2AJ0A 4WJ4A 4CYUB 5GMEA 1FXRA 3IAS9 3DLBA 3QRRA 2MZTA 1WOOA 2CA9A 2JHEA 2ZFZA 4NXMF 1LWXA 3EJMA 1VQ6S 1WC5A 2GHPA 1WHYA 1G1XA 4Q2LA 2H5EA 4C3KA 3RTVA 2RDJA 3HD2A 3CAGA 2GNKA 3QGPA 4DN0A 5KFSA 1IWGA 1RAGB 2G4BA 5E2QA 1CJVB 3PFOA 5A2QY 1RT7B 2DH9A 2HS3A 1TWHA 3HDSA 1WUUA 4GO5X 1S4EA 2IVMA 3HD1A 1D1UA 4OYOA 5H9FJ 1OYEA 3C14A 4KATA 3PIOQ 2GSUA 1N5VA 2Y0SL 2B9EA 3N28A 4NLTA 2IYIA 3BPSP 2M3DA 3SFGA 5KFFA 4EEYA 4F26A 2ZFHA 3N6LA 4L74A 3I4MC 2K06A 1RTZA 1XC9A 1P9YA 3TAPA 4KHPJ 4I68A 3CDAA 3IN5A 3X1LB 2LXFA 3W65A 3MM6B 2Z2ZA 3BGRA 4I2QA 3CJ5A 5IP9K 3P5TL 3NWRA 1O5JA 4G65A 1XXBA 2O3DA 2WSFC 1PC5A 4YN3B 3BQ1A 4DMZA 4WK1A 1TP7A 4NCGA 2KVQE 1RWVB 4WFBQ 2VBWA 4DU7A 2CJQA 1JLAA 4QWAA 4IO1A 1RYSA 4DX8H 4UOCA 2LEBA 2FTRA 1Q8KA 1FJGJ 2B6AB 1UFWA 5KFWA 3DGVA 1I50K 4CLTA 5LT5A 1XR7A 2BOAA 3C19A 2V0NA 2MHEA 4KPYA 4FVMA 5HO4A 5AXKA 4F3OA 3VGTA 1X0PA 5M5XK 2HVIA 1R31A 1ZM9A 3PNIA 4TXSA 1CLFA 2W8KA 3BSCA 1TWAA 5FLXY 1IL2A 3CW2C 4LSNA 4NZ0A 4KYZA 1SPBP 3CDWA 5L38A 4X6AK 4DV4F 1N52B 1PBAA 4KGVB 3J7ZT 1RA7A 2XG8A 2CZ4A 4M5JA 3BGRB 1TVRB 4W90B 4UQGA 1RP5A 2V50A 2CJKA 1WC6A 1BMQB 4I4BA 2DR9A 1SI9A 3SQGA 5CZXA 3IPJA 3SEOA 2VHGA 4OYWA 1IKVB 2W4PA 2DPJA 1UJ6A 1IJEB 4WILA 1JLQB 4MKVA 4ZPWR 1H3DA 3MAAA 3TUIC 3OR1A 3FJ2A 4A3KC 3CIMA 2APOA 1HD0A 2ZUGA 3D54A 3E51A 3VR1A 4TVAB 3M4OK 3BBFA 3VAMA 1KN6A 3LPYA 3TI0A 3UO0A 4R25A 4UF4A 1TWAC 2AMCB 2ZBCA 3HHEA 4UUXA 2UUCF 1I50A 5IP9C 2OEMA 1CSJA 3CJ4A 2BRKA 1U25A 5JVGQ 4G0WA 2G1DA 2OEKA 3LANA 2AF6A 3H2VE 5DJBA 4A3GK 1S0NA 4DV1J 4WK3A 1M5PC 2CJBA 4B17A 4UOGA 2O66A 4ILLA 5AXNA 1F5BA 2G2ZA 1TKXB 5B0FA 5DG8A 3T1YJ 3CMQA 2RS2A 1Y00A 2YWHA 1IBCB 2LDYA 3T1YF 2WTFA 1N33F 1U48A 3VGVA 1U2CA 3CMES 1RCXB 3U1NA 1S79A 4RZRA 1S1TB 2FHJD 1U6FA 2RKIA 4QR1A 4YEAA 2W9CB 2UXCF 3CMAS 4L75A 2MLZA 4DU8A 4CWBA 1Y3KA 2EEYA 2KG1A 2HHUA 1NPRA 3MM6A 1Q82T 2YKPA 3I4NK 4NI2B 2DITA 2NZCA 2VFSA 4CH1A 4KB2A 2JLEA 3ISZA 1ZA2B 3RJMB 1IS1A 4DWIA 1WEYA 1VRQC 4H4MA 1XMBA 3S1NK 4X62F 1YLXA 4O4GA 4ECYA 1YNJA 3C2PA 3MMJA 3NMAA 1FJCA 4LF7J 5HQLA 2MLXA 1HNZF 2G0JA 1EZZB 4HYKA 2OPQB 1TWHC 1C0UA 1TAUA 1VC5A 2NZ4A 2A10A 1I94J 3S14C 1OY8A 2BJ7A 3E8OA 4HHJA 2CNOB 1FVSA 3GTOA 3BF4A 1HNVB 1X31C 4A4JA 3MZIA 1DCPA 3BREA 3TZXA 1DARA 3KXDA 2K1RB 4CM0A 2NVXA 4KN4A 1BQXA 4CLLA 2HNYB 1RKIA 4PXBA 3CD0A 1Q7LB 1FT8A 4DUYJ 2MKSA 1B0PA 4TU7A 4GVBB 3M9OB 3SYZA 1PIEA 1YVFA 1NHKL 2XY6A 1ELOA 2IVYA 2IJFA 1HQ2A 4IH7A 4USKA 3EPGA 2C2RA 4ERDA 1JQWA 4UTGA 4HT7A 3KK2A 5E3QA 3MR5A 4CLKA 3GTMK 4YB6A 5KFBA 4A3EK 4PWDB 2YH1A 1D8ZA 2QMXA 4CO1A 4AL5A 2NVTC 4DSEA 2UV8G 3QT7A 4BC7A 2EC2A 3SFUA 4OZ0A 4HR2A 1CVJA 2WHOA 2YWWA 3ENAA 1CS4B 2J0XA 3CVKA 3FEXB 4OIOA 2JEFA 4BXXK 3UDVA 3OVSA 1IBLF 1NCLA 5JMNA 1TELA 3PJXA 2DNOA 3CC7S 3HFZB 5DS7A 1LNQA 1IKWA 1AUDA 5D78A 1URRA 4LBIA 4DUTA 1SVDA 3LW5C 3MAAB 4FNHA 4OHXA 2ZBRA 2DO4A 3AHPA 3AFGA 3H4DA 4LSNB 1YGYA 2B63C 2DO0A 2G0IA 3ELHA 5IQ6A 4UZBA 4YP3A 1EARA 3DOKB 1N4LA 1L0WA 2D74B 3M9MB 2LQJA 3IBFB 2R8GA 4I1TA 2V6TA 3HVWA 3ONQA 4AH6A 2ZOMA 5HMYA 3CJKA 4EUVA 2KDOA 3E3XA 3MM9A 4EI2A 4K0KF 2VUMA 3PIPQ 1NO8A 2CQHA 2P9EA 4KMAA 5DDOC 1QDUB 3T9NA 1CS4A 3NRBA 1NSAA 2XYHB 1Q81T 2XZWA 3UCGA 2FJEB 3X3UA 1S1XB 4LF8J 2VA2A 4A3BC 5GVQA 1V6HA 2VG6A 2QN6B 3RAQA 3NL0A 1SIZA 1HKAA 4U7UK 1CULB 3PYDA 3ULHA 1RWUA 3PW5A 3FMBA 2BKOA 1VQ9S 1GXUA 1EQMA 2LA6A 4USVA 4GTCA 2ZE2B 3GLJA 5E3PA 1FK9B 2XEXA 2YNGB 3PG9A 1Y11A 1VH2A 4WZQA 4URQU 3GFXA 3S1MK 2HNDB 5EN1A 3GG0A 5HBMA 3JTNA 3SBMA 2FGCA 4DR1J 2XZTB 1Y3JA 4IRKA 2X1AA 2FHKA 4MK7A 5BYRA 2YTCA 1U45A 3I82A 5FLMK 4FVCA 3M6VA 1RWPB 2RD5C 5FLMC 2R2SA 5L39A 1V5VA 2KM8B 2F3JA 1DAXA 3CDEA 5J2MB 4NWBA 1NB7A 2MKHA 3CJKB 3NXZA 1QVFR 3KTQA 1K83A 3M8QA 3R7SB 1EETB 1JLCA 2W7AA 4LR7A 4OLOA 4Y2CA 3HXMA 3TTGA 1RLCL 2IVFB 4F4ZA 2VV5A 2OD4A 3KJFB 4A3FK 4A93C 4GKJJ 3DLJA 2EXUA 3UCZP 4PEOA 4ETXA 2DGSA 2UV8A 2J7KA 3S2DC 2HVDA 1NJWA 5IZHA 2NUHA 2AW0A 1X60A 4RNFA 1TKTA 4TY8A 3PRDA 2KM8C 1D8YA 5GAHU 4NASA 1C1BA 1AUSL 1D9AA 1VIOA 1PBUA 1LWFA 2YWGA 2LXIA 1RCOB 5AE2A 3R27A 1HIYA 2JWNA 5I42B 4USMA 2J7WA 2W7OA 4XDDA 1CQNA 1CJKB 3M6WA 1F3FA 2AHOB 4MJKA 1WOPA 3IFEA 3KDNA 2ZZMA 1RTDA 5EGYA 1SUQA 1YG0A 2K3KA 3KK3A 1S6QA 2GSOA 4NLSA 1RT3B 3A8EA 4DR7J 1KHWA 3VQSA 1TZ0A 4Q5SA 3MUVP 1K0VA 1VQNS 3KWMA 2YQ3A 4QWCA 4D3HA 4ECSA 1R8HA 3VWSA 4W92B 1S72S 2UVUA 2OEJA 4Q8FA 2VKRA 3MM5B 2D41A 2B6AA 3SZYA 3ILIA 4O44A 2AYEA 3BGFA 5AT1B 3FDSA 3GJQB 2E7WA 1BS2A 4LIRA 3I87A 4CQ1A 3G82B 1TMMA 5G0RB 3CCRS 5JVOA 2EW9A 1RAAB 3K5OA 1JIHA 3FKIK 4IDKA 1F1BB 3KLHB 3FKIC 1FKOB 2E7XA 3G9CA 3MMLB 3D3BJ 2R93A 3S14K 4FYYB 4A3KK 2JNJA 2MSSA 1HWUA 1NRKA 2GZOA 1NK4A 2NXNA 4A3LC 4RR5A 4AFFA 1HI1A 4GVLA 1TV6A 5IYCK 3PYEA 3CD5A 4USIA 4CLYA 4YFKA 3OSNA 2WB1L 2HNZA 2UXCJ 2V4JB 1R7IA 3CCES 1PCAA 3SCLE 2V34A 2NS1B 5HI7A 1KQFB 3CJQA 4DX6A 4DR2F 1BQNA 3S2HC 2W9BB 2BA9A 2YBVA 1RT5A 1ZH5A 3S2HK 1E6VA 5AXMA 1ZQ1C 1DQAA 3PO4A 2BVZA 2XLIA 3PZPA 2VBZA 2LP4A 2CQGA 4ZS6A 4OYXA 2V8HA 3GE9A 3NBPA 3IA0A 1R8BA 1IKVA 4JBCA 3QMQA 2K8GA 3BYRA 1JMTA 2CG8A 2FLOA 2E2HC 2HAIA 2MQNA 4RKUC 3LP0B 5HLFA 4CO3A 4I2QB 1SQGA 2GQCA 3IMQJ 2AX1A 4RLEA 4OJ3A 4H54A 1SL1A 1KOOA 3TNVA 3DOMA 5IP7C 3AAWB 2CPIA 3QAEA 3VQTA 5K8MA 2WCXA 5KFOA 4F2SA 2YPZA 1RAIB 2CW0A 5I4MA 2DRDA 1R43A 1V3ZA 2RS8A 4A3MC 1NZAA 1TWHK 1EKRA 4NLYA 4NI2A 2V6UA 2XMKA 4JV5F 3D6FB 3EQLA 2G2YA 2G1HA 1ZAWA 1CG2A 4WYWA 3QZ8A 5B0DA 2BQ3A 2YKMA 1SMYA 1O2AA 5B0CA 3TA2A 4MKAA 4A3DC 4E2FB 1GK8A 2BUNA 5J2QA 1IVZA 1VC6A 4LR8A 3V81A 2B56A 4J90A 2VBXA 3TR5A 2RQ4A 4C3HK 2B0GA 4NMXA 4QYRA 3VAGA 3PVXA 1H73A 3AJ2A 3G6XA 3N0CA 1IQZA 4HH0A 1YRUA 2LFVA 2HQGA 2CQ0A 1NMEB 2CJYB 4ZVRB 2XHCA 4TLQA 1FWPA 5D4OA 4NLPA 3IM8A 3KLIA 3W60A 2NLWA 1IR1A 2EFGA 5KFCA 1MWZA 3OFEA 4CM2A 1Q95G 5C42A 5LMNF 2JA5K 3ET6A 3DLEB 3BKUA 4M5LA 2JH3A 3QX3A 3KJVB 4LQ9A 1HBUA 3FGVA 1XPPA 1JNZB 4PXCA 1O2BA 2QEXS 3A8IA 1S1WB 1Y1VC 1GTHA 3W5ZA 2HLTA 4M8LA 4FYXB 3Q89A 3ZNJ1 2L48A 4G0UA 1KR4A 1BXNA 5DG9A 3HJFA 3NS5A 3FEYB 4DF8A 5KFNA 1UEKA 2W2NP 2RUGA 3FCHA 2CDQA 2HPUA 4DCOB 2Z0GA 3D5MA 5IYBK 2PD1A 3LP2B 2AJ2A 2LU2A 1N32F 2MQQA 3BR9A 1KONA 2BMBA 2Q66A 5F8GA 2ZBIA 4JI0J 2JEIA 3M8SA 1LWCA 4ECUA 3LP0A 4BDPA 2XCPA 1Y1VA 1J6WA 4M5GA 1VCTA 5D4PA 1IBMF 3ADAC 1TKDA 4RU2A 4LFBJ 1RU0A 1O2FB 3TA1A 1XNQF 3SQOP 5KTQA 4ED1A 4PAAA 4GTBA 2XSFA 2R7ZC 1HPZB 4YY3F 2BOPA 2VG7B 2VUGA 3D1QA 2JJ4D 4HACB 3B6BA 1NAQA 1NBEB 3K17A 4R5PA 1UVJA 1Y10A 2B4UA 2FC9A 4U7CA 1B64A 1H6KX 3Q83A 1HNXJ 1JJHA 1XTZA 2DGOA 2ZH7A 4NOIA 6AT1B 3D6HB 2V67A 2F1FA 1ZTWA 3DHXA 1EK8A 4WJ3M 1HWKA 4LSLB 3G8SA 2IAJA 1VFJA 1FDAA 3DHWC 4OIQA 1RTIB 1WEXA 2FJVA 4P5AA 2RRBA 3CJTA 1G3OA 1RTJA 2PA8L 3M6XA 1XNRJ 4X4SA 3MI7X 2FPHX 3T41A 3FZBA 3QJLA 3S1MC 3PRBA 3LGNA 4WZMA 1HMVB 2J9DE 2L08A 4LQYA 4C0OC 3RBEA 3EX7B 3TVYA 1SH3A 2B7BB 4ECZA 2VF3A 5C7PA 1SQEA 1NJZA 2PI5A 2VG5A 2MKIA 1ZAXA 3NGKA 4BS2A 3TFHA 1T3OA 5HMWA 4J9QA 4RW4A 1RT2B 3OHAA 3GTKA 3L4JA 3TO8A 1NSPA 3EVWA 4MIAA 4EZ6A 5L9NA 4JI5J 1IUJA 3CCLS 3HOZC 1EFWA 4NA1A 3VGUA 2JA6C 1VHFA 1EP4B 4ZIVA 1JKHA 4DQQA 1LEOA 2XS5A 3AD7C 3MOZA 3H0GC 2GQQA 1CJVA 1A9NB 2OPRB 5JJBA 3S17K 1GMUA 3N79A 2DHAA 2IA0A 3MCOA 4YOEA 4WTOB 1LWEB 2CPJA 1JVIA 1XNRF 2JA7C 1XR6A 3DXSX 4LF5F 1U1PA 4OI2A 2GO9A 5F0WA 2WAQD 5GAEI 3RZDK 1N34F 3AXMA 2BABA 5B0BA 1P1TA 1UJ5A 4KB7A 4JI6J 1S1WA 1REVA 2IJNA 4KMUA 2CG4A 5IC4B 5HBMB 3H4BA 3H40A 2GJFA 2X1GA 4YUDA 1WKJA 3CPWR 2HQCA 3JSBA 2KG0A 1TK5A 3LH2S 2QA4G 3SQGB 1WACA 3TUZC 3H0GA 2I38A 2HGNA 2PT0A 2ATLA 3M6UA 1Z2ZA 3H42A 2E66A 5ETLA 4ZLPA 1YJ7A 4Y2MA 2QGFB 1R8CA 5ETVA 2HIYA 1RZMA 1Z2LA 1N54B 2PPBA 2FLLA 2W24A 3SI8A 1WC3A 4RW8A 4KC6A 5J1NA 2ERRA 2KXFA 2Y0BB 2JFKA 4XPCA 1RAEB 3E01A 1RDRA 4LF1A 2BEFA 4JK1A 3IGVA 4RJVA 2G9OA 4EBEA 1K1QA 3TFJA 1RSCA 3FZ2A 3E2EA 4RMFA 4KO0A 2GCFA 1YBAA 1UP1A 4U7UD 3JSRA 1V5IB 2W01A 3M32A 5D0GA 5DGAA 2BKPA 3D1HA 4J7CA 4F3QA 2QMUB 4M94A 3IWNC 2HEKA 2WSEC 5L1KA 2EFVA 1D0EA 5E7OB 4W4MA 4CP5A 4DL3A 1OPZA 4R0EA 3ENQA 4B3OA 3HF5A 2V2VA 5KFRA 3CDUA 1R9TC 2P8TA 1SKSA 3N01A 5I42A 2NVQK 3SSQA 4RNNA 4X4UA 2IDLA 4JI1F 4ZK7M 3QWPA 2NVQC 3NGUA 1FTRA 4L72B 2HRTA 1ZM2A 5LJ3Y 3DMJB 4AT1B 3IRXB 1RBLA 4ED3A 4A8OA 3R1LA 2VONA 2VQEF 4P2XA 2IC3A 2OGUA 3MFIA 3GEIA 3MMBA 2R42A 3MMCA 1YJTA 1SV5A 3LP1A 3JSMB 4ED2A 4Z7CA 3JSTA 3W1YC 3LQVA 3R2DJ 4KO0B 2V4RA 5E0OA 1S9FA 1PO6A 1IR0A 4MH8A 4ZHRA 3GDZA 2BR0A 5EUHA 2HVHA 4USTA 4ED6A 3UFCX 3GONA 4TQRA 5B7WA 4KRWA 3MEEA 2XLKA 2IIHA 2ZJQQ 5A8WB 1C1BB 3FK4A 4Z7YA 4A3IK 4I69A 5LMUF 1K0TA 4PUOA 1N48A 2C1EB 4CNYA 5KFHA 1VQOS 3HSGA 2HBQB 5IYBC 1EQ0A 1VYAA 6FDRA 3CIZA 4C11A 1T05B 3J80U 5LSOA 3SIPB 4NCGB 4ALZA 1LKZA 1X5PA 1X5SA 1REVB 4LJZA 3NEKA 1WHXA 3D7SB 1OMSA 4IFYA 2ILYA 1L5UA 1SC4B 2ROPA 5E5NA 4JI3J 3CCZA 3BO2A 3OTOF 3RBXA 2RQCA 1Q5VA 3DDNA 2XBPA 2CQDA 3KLFB 3R97A 2KKHA 2ASDA 2CZ9A 2BACA 2IM0A 3MHYA 3Q8PB 1KNZA 3TA0A 2OP5A 1FI4A 4PWUA 1NDPA 2K7JA 1J6VA 5GADI 1DCHA 5H1SV 2LLZA 5C3EC 4PQAA 2UUAJ 5C3EK 3HZGA 1S4FA 2ZD1A 3IC1A 5IOQA 3LWMA 3QFHA 2BDPA 3M3YC 2MZJA 4DR2J 1SB6A 4LFCJ 3OTEA 3BS9A 2DH8A 1S6PA 4JV1A 2FQTA 3ZTOA 1HL6A 3GMGA 3OFGA 3T1HF 3CD7A 3QT6A 1TL5A 3EE3A 2MXYA 1Y1WC 2HQIA 3HHLA 2ZH1A 3OXLA 2NSBA 1MWYA 2MDAA 5C4XK 1C0TB 3WBZA 3VF0B 3GR1A 1E6YB 3CUNA 1FXLA 5FD1A 4A8KA 2Y3PA 3FQLA 4DR5F 1BJTA 4RUBA 1RTHB 3ICLA 2NVXC 3FRZA 1LW0A 4DV6F 5LM7E 1DZ5A 4QWDA 3JYTB 1J5EJ 4LRAA 1GAOA 5HVHA 1RGVA 5D0RA 5F8MA 3AB4B 3H5YA 2HWHA 2GMHA 5ETQA 2Z58B 2CXEA 3F44A 3HVAA 4HVZA 3JS9A 1TFYA 3CDBA 3QO9B 4OL8A 3MPYA 2XTJP 3PJWA 4DS5A 4C9DA 1Y9OA 5CYMA 2PN6A 3HOYK 2WVCA 3R5JB 1U0HA 1PSDA 2UUBJ 5E33A 1UZHA 1S0MA 5IOTA 2XSJB 2MKCA 3Q8YA 3R5BA 4ZCMA 4DFPA 1U1RA 2PEBA 4RW8B 1FFWB 1RA6A 1VMBA 4B9NA 4X4QA 6FD1A 2GHVC 1FJ7A 4O4RA 2JA8C 3D9BA 1O51A 3IP0A 2UXBJ 2HHHJ 2JA8K 3EICA 5DGBA 3OFHA 3KKFA 4ZLJA 4Y65A 3LOUA 3NGRA 5H9EJ 1O25A 4NEZA 2ASYA 3L7OA 1EAYC 4OZ5A 1MROB 2GAGC 3JAMY 4LBPA 3GYGA 3CO9A 2AEMA 4A3FC 1PJ6A 4KB4A 2QJ3A 2M70A 3LA0A 4C8OA 1X4BA 2Z57B 3DRPB 2HZCA 3T1AA 3T02A 2ZBQA 2AT1B 2HBYB 1N6QA 3N6MA 4CT8A 5DDRC 2VG6B 3ILJA 1UZDA 4WJBA 2YQ0A 4IFYB 4OI1A 3BBCA 2NVXK 2DNZA 5AJ3F 4C3JK 4HHUA 4N77A 2JA7A 1VBKA 4K4ZA 4DPXA 4X64F 1CJUB 5ETRA 2I2YA 1K44A 4C3MA 4CLZA 5IYCC 5EX0A 2RJZA 4CI0B 4XLNA 5K8PA 3V6KA 1W26A 2E1CA 4OFZA 2H4WB 3D28A 4M1XA 3EUNA 2A6EA 1V3RA 3DI6B 3C8YA 3HCXA 4HACA 1SL0A 1TWGA 1X0FA 3C6TB 1XMQJ 1WSRA 3GILA 2WB1D 1JLAB 4XIUA 3HOVK 1NHUA 1I50C 2DXDA 3AB2B 4KKOB 4FKYA 2CQ3A 1R9TK 4X4NA 1OSDA 1JLGA 2MGZA 4KASA 4J9UE 3MCMA 1QE1B 3Q8VA 5D3GB 3IG1A 4OJGA 2NYIA 1ZM3A 2BW7A 4PG6A 3DRPA 4ED7A 4WWSA 1R3NA 2QTWA 4X6AC 4ZIWA 3G6YA 3BGOP 3S6EA 2JA6A 1V3SA 1SH2A 3R5CA 3AJDA 5BR8F 1AA1B 2Z30B 1HR0J 3LPXA 4N41A 2QLJB 3O1LA 3KHLA 2PMZL 5IWAJ 1SIWB 5LSRA 2D7SA 3W2WA 1UMJA 1BQMA 3OD2A 1I51B 3AQPA 4YR3A 3HHLC 2QLFB 2ZDPA 5HATA 2VG7A 2O01C 3GFYA 2CKWA 2CQ2A 1MU2B 2VBYA 3AXKA 2NUUG 4WP8A 3B78A 2WSCC 3NNHA 4L3NA 5EX3A 2P9CA 1IBMJ 2YNFB 1GX6A 4HH1A 4JB8B 3JAMU 4DFJA 4KFBA 4MTPA 1WC1A 2X1BA 4QQBA 3W7BA 1JX4A 4A3JK 4TY9A 5SZTA 4O3NA 3GR0A 3TYTA 3VVUA 1I6JA 4QW8A 3AH6A 1S1XA 4LUBA 1T7PA 5IQQA 4JV0A 4C8ZA 4NOHA 3DRSA 3SCKE 5A8RA 4RX6A 3TQ1A 1Q8LA 1RJJA 4FF3A 2P5MA 2FZGB 2PC6A 5C2CA 1DD5A 4X4VA 1N32J 4G1QB 3ILLA 3ZZPA 2VD3A 2MHNA 4ZDNA 3MM7B 1WELA 1JJ4A 3OQ2A 1HNVA 1HBOA 2O1PA 3R5GA 1AZSA 2K1RA 3P6YC 5D4LA 4FP9A 1S1TA 1Q8IA 4IOBA 4JI8J 3BGUA 5DG7A 1KOHA 4JI8F 3J7AN 1RT1A 3ITHA 2Q3PA 2E7VA 3S15C 3CB4A 2W8LA 4C0HA 2QLBB 2AKWB 1DURA 2Z2YB 1H72C 5KFZA 1RADB 3OLBA 3I9V9 1QD1A 3ZXWA 2P8IA 3HFVA 4LRFA 3KOAA 1EP4A 4O4GB 5J2NA 2A18A 2ZVIA 4DPOA 2E44A 2R7SA 3CCTA 4B9TA 2BJ1A 4N76A 2H48B 4G7HA 1KQGB 2V9WA 2VU5A 3A1YG 4ZCIA 3GYXB 4KIAA 2R7VA 4BLGA 2Y1IA 1HI8A 1O29A 4BBSK 3UD4P 4M5MA 4TNOA 1S7IA 2R93C 2E5GA 1SCJB 1RWNB 2DY1A 3IG1B 3M8YA 4H4OB 1I94F 3KLEB 3T00A 4ID8A 2DD8S 4LF9F 1SBRA 3NNAA 1T9UA 3GB0A 2R92A 3GFHA 4ZLNA 3Q2TC 2ROGA 4WTYA 1KTQA 5EWGA 1XJWB 3OXGA 5ETNA 1SQFA 3I31A 3R7NB 5JXSA 2CFXA 1GMVA 4DV3J 5K14A 2I6WA 5IC6B 5KG0A 3HLUA 1Y1WA 4U8YA 3RW7A 3T19A 4PWWA 3KK2B 5KAKA 2R7QA 2E9ZA 2FHMA 4YR2A 1D9FA 3DRYA 2XYGB 3TFIA 2UP1A 1S49A 1Y1VK 1RI7A 4V19J 4PABA 1VOMA 3RRKA 5F8JA 5IS2A 3V4IB 3C15B 3QWUA 1KKHA 3DLGA 1J98A 2NR0A 4FXWA 1N5SA 2MZRA 2VDHA 4NXNF 2BM1A 3MM7A 4O44B 4DBQA 2Y8YA 2HYIB 2E1PA 3OLAA 5AXLA 4XDCA 3EVOA 3KLEA 2AGQA 3NAHA 4WFXA 1P6TA 2HBZB 1M1GA 2IBOA 3QNWB 4USHA 3TJ8A 1IWAA 1HBMA 4RBVA 4FS2A 5HJXA 1PJ7A 4GTAA 1CJUA 3ITHB 4BBYA 2HNDA 1VC0A 4OX9F 1U1OA 5GAEU 2YX4A 4CH7A 3DOKA 3T6BA 1DQ8A 1FWKA 5J1PA 3HZEA 5KT5A 3FVYA 2R93K 4WCEQ 5KFTA 1TL3B 4X84A 3GTPK 2XMWA 1DHMA 2CWXA 2XY7A 1KD1T 1WEZA 2A0FB 1F7VA 2DNRA 1S9EA 5ETPA 5T7LA 5HMXA 3JQMA 3M05A 2D1CA 1TWAK 2FVQA 1FXDA 4I0WA 2A3JA 3MXHP 4DV5J 5GMDA 2ZH3A 4MFBA 1CJTB 2KB2A 4ZCKA 4UT4A 2KI2A 1CBKA 4ZVOB 2V2ZA 1UJ4A 3BO3A 4X66F 2VC0A 1RBAA 1S9GB 3PTWA 5K5MA 4OZ2A 4FXDA 1UA0A 4WPAA 1S6PB 1KVKA 4LIWA 1TL7A 1SL2A 3KG4A 2OPPB 1SKRA 5L1LA 4J37A 5IV3A 1UCNA 2K3IA 3VAKA 5F41A 3HVRA 1S7HA 3HOVC 4IFVA 2J8SA 2ZHBA 3T01A 2HAFA 3I9ZA 2B4OA 1NKEA 2ZJPQ 2UUBF 8ATCB 3P8BB 4DL0C 2FJXA 2FVRA 3GCXP 2ZUAA 1GMWD 5C42B 1YSJA 3J7YI 4C11B 1Q8BA 4I64A 4K4VA 2VH7A 4JI7F 3MD3A 5RUBA 1N5YB 3W5YA 3DNCA 1UA1A 1TWFC 4RUAA 4CO5A 5CD4A 3KHGA 1NK6A 3AH5A 1FFSB 2D9PA 2V6AA 4G6VB 2WOMB 1J5EF 4YFUA 2W7PA 3HM9A 3T5KA 3GV7B 3FBFA 1J6XA 2VODA 4GTFA 1I6VA 3NUHA 1VQ8S 3MMAB 1VQYA 4PRFA 3KJNB 3FOEA 4ZVEA 2VIHA 1R8AA 4LF9J 2YWFA 4R8UA 3P96A 1LOUA 3VHQA 4K2XA 2DGQA 4NYZA 5JFEA 1KWMA 4RO0A 3CQZC 1S76D 4PG4A 1WKLA 1OWXA 2EKYA 3TW0A 5D6GA 2QZ8A 2R2TA 4QPXA 1Q1KA 2R92K 1SKWA 2I5JA 2QYGA 4QIWD 3KHRA 4P72A 4H4OA 2FLPA 1K47A 2YPYA 2MQOA 3TP2A 4B3TF 4Y0FA 4F25A 4ZKAA 2HHVA 4Q0BA 4C3IK 1TKZB 3BYPA 2QA2A 2AJFE 2FC8A 3B4DA 2ZWOA 2WONB 3R6LB 3RRHA 3EWGA 5ETMA 4M5DB 1RWXB 4DUZF 4B9UA 4QYZK 4GKKJ 3HOXC 2NVTK 4J5OA 3VAJA 3MTKA 3QSYB 3W63A 3ZTSA 4BC9A 5B0GA 5CYQB 3DOMB 3EXYA 2MY7A 5T14A 1WQHA 1KS2A 3DLHA 1R89A 3I32A 2Y1LB 4LRBA 3K57A 5LSLA 3UNYA 2R2UA 1P1LA 1MNEA 4ZH4A 4DSKA 2OPQA 4ZVHA 1XR5A 2AEFA 1DTTB 2BJ8A 3C16A 3HT0A 4X65J 3S1RC 4F4AA 4ECTA 3TJ9A 3PW7A 1HBNB 1LWEA 1UWAA 1X5OA 1JOEA 2YKMB 5LOQA 2HZAA 4JI4F 1N8RT 3MPWA 2E2HA 3F41A 2E1RA 4IDKB 3TANA 3D4JA 2W2OP 2GVDA 2Q1LA 2V8PA 3SDEA 1KFSA 2MMYA 2J6TA 4A3LK 2A2CA 2DB1A 1VRUA 2BJEA 1FDDA 3HT3A 4JV5J 5F3TA 3IAM9 3T9ZA 1CPZA 1LV5A 3QGIA 4RBTA 1S9GA 4Z2XA 4HKQA 1VJWA 4A3CC 1NXIA 4BKWA 2KO1A 3TQEA 1TV6B 1RE1B 1M5HA 4IKAA 5EGEA 1LW2A 2UU9J 2B51A 4DG1A 3B54A 2V4JA 1TR0A 1QAJA 4L6V3 4RW6A 5JUMA 1RT6B 3MFHA 1F3VA 1HHSA 4K59A 5IT9Y 1TKXA 3HSJA 3R3TA 1HLWA 2VQEJ 3TEGA 4DSLA 2DNLA 1N0UA 1SH0A 1DRZA 1B7FA 3J80Y 3PYGA 4ZJOA 1S59A 3I55S 3Q8QB 2ZH4A 3RW6A 2I5JB 1G6BA 2YWKA 3W66A 5M2RA 5GAGI 3H2UB 3P49B 5HQMA 3OR2B 5CXTA 4AD6A 1TK8A 1S0VA 3M30A 5I3QA 2EVZA 3ZZZA 1QVGR 2HMIB 5KFEA 1YKWA 3EZ5A 3NOCA 3NCRA 4X4TA 4MK8A 4FM9A 4KSEB 2P6SA 3RUBL 1FX4A 2EWHA 1HHQA 2UUWA 1U02A 3VAFA 3CXCR 3L4BC 4OX8A 2B8PA 4DV1F 2GA7A 4YR0A 1B7YB 1WCMA 1WG4A 2KWAA 3POTB 3DOLA 3D6MB 3QATA 2HWIA 2LQBA 1C1CA 4KE5A 4K4XA 3T3FA 2UUCJ 2LDIA 4OV1A 1ZXOA 5AJ3J 3WX8A 5CHCB 2RT3A 3U1MA 5T41A 3NCPA 3ZNUA 2COLA 2VFVA 1TL7B 2R7ZK 3PACA 1TKZA 1WTFA 4A3CK 4A48A 1DBDA 2J7UA 2C3UA 2O5IA 4RW9B 1HR0F 3K59A 3CTRA 3D66A 2GJ2A 3GTKC 4WXWA 2HK2A 2BYCA 2JC0A 2CVEA 3RB3A 2NYHA 4KGZB 3TRGA 3MUMP 3RZOC 3W5XA 1U49A 1TWCA 2DNQA 2XO7A 3V6DA 2RH3A 1IQ0A 2SXLA 2C28A 1BLUA 3W9IA 4C2MA 3GIIA 1RAHB 3FSIA 1QSYA 4ZPBA 2U2FA 4RWWA 1UVLA 1PAUB 2B9YA 3AODA 4WFAQ 3FOFA 1WQFA 3EGZA 2VG5B 1IKXB 3JB9k 1ZETA 1JLEA 2PDAA 4PCQA 2KL8A 1IM6A 2XLJA 4Y6IA 4C97A 4PKDB 1JB0C 1B99A 4OZ3A 2RVJA 3FFIB 2FY8A 2D9OA 1XZQB 4AYBD 1YBUA 2OI2A 3LAJA 1U24A 1XMOJ 4KN7A 2OHDA 3GFZA 4ZP6A 3CCUS 2FQQB 2MLYA 3PDNA 2HGMA 1MWQA 1OPIA 4X4PA 3HOWK 4XK8C 3QJPA 3DDIA 3V5RA 2DXEA 1RACB 5KG5A 4NLDA 4X66J 4JI5F 1TWCK 1BHNA 1O8BA 3IXQA 4OZLA 3VAHA 2N7CA 2EK1A 5AE1A 1FE4A 2DGVA 4LQ3A 1IQTA 1TKTB 4F4XA 4X64J 4F4WA 1HMVA 4HI2A 5KFPA 1GE9A 4ES3A 2IJRA 4WKYA 1DCOA 4XPEA 3PHEA 1U1MA 4PXEA 4DUZJ 4HDHA 5CZVA 2XCAA 3L7PA 5J2MA 5CJ9A 3BJYA 2ZDOA 3K8WA 5LL6d 4KGKA 3H0GK 3O2IA 3HOUK 1GFWB 1WQGA 3HKWA 4N5SA 2KHCA 1YJRA 3F56A 3V4IA 4UW2A 3L3CA 3N3YA 3DLGB 3TAQA 4OX9J 2QA1A 2XGQA 3N5BA 3C46A 1SJ4P 3MMCB 2W4CA 2IMWP 4DR6F 4U8VA 1U1KA 1BGWA 2QLXA 1FNMA 2VFUA 1VGYA 3DFEA 1S5ZA 3AD8C 1X4CA 4DV4J 4DV0J 2C2NA 3BDPA 5E41A 1X9SA 2CQ4A 5B08A 2CJ9A 2LVWA 2XMAA 3GV5B 3KNAA 1MW7A 5HN0A 3EGVA 4C8MA 4ENOA 3CGIA 2DGUA 1H38A 3H8YA 1W2BR 1KQSR 3RRGA 4P6QA 5THWA 4DOZA 4NL5A 4F4YA 2D69A 4DPYA 1LFWA 1K1SA 3WIUA 1AXQA 1WF1A 4OYIA 5F9LA 4OIRA 2V63A 4LFAF 2V2QA 4ANDA 1JLBA 2P6TA 4BLAA 4LLGA 2IYGA 3V6HA 1CEZA 3NKYA 2O5JA 2IRXA 2WVBA 5E3RA 3K89A 3PO3K 4C4WA 2OPPA 1B4SA 3QZ7A 3B82A 2OTJS 4CLUA 1FKOA 3KLGA 5IP7K 1RT2A 4M95A 1XZPB 1W2IA 4GKKF 3EM1A 2NXCA 3A4TA 5KT7A 2AJQA 4ANCA 2JA6K 3I0RA 2IRUA 2KRRA 4RW6B 4WU2A 4G7ZA 2NXUA 1VK3A 2LMIA 1RK8A 4PQUA 1VHIA 4YDXA 2ZC3A 1NJYA 1N5YA 1Q53A 3M8ZA 1RQ0A 4F50A 1CC8A 3VZHA 5C4JK 3UI3A 4GTEA 4EBDA 2H65B 5D3GA 2RDDA 2AJ4A 3W9JA 4AL6A 1FERA 2O5DA 1ZVUA 4BXXC 1BWEA 2EKNA 1K73T 4QJVA 2A6HA 3T1HJ 2JLGA 4MIWA 4P2FA 2F65A 2ZUFA 3GU0A 4LFCF 4C8YA 3N6NA 3WC0A 2VPZB 4Y3CA 3GTMA 3FRYA 4Q4ZA 3AOCA 3S1NC 4IOCQ 1U26A 4OLPA 3LAKA 3FBEA 4NXMJ 1XEZA 5D15A 3W2WB 1UEVA 4QIGA 2W4DA 3GPAA 4L76A 4ICLB 3R5DA 2CPFA 4WBFA 2CQ1A 4NYOA 2OIHA 1BQNB 1VISA 3UQSA 3SMZA 3OPFA 5KFGA 4IUFA 3DN9A 3EYZA 4M5HA 3A8JA 3KUGA 3C3LA 3MEGB 4LF2A 3CULA 4ES1A 5B0EA 2GMLA 2KYXA 2XWYA 4EGLA 4P71A 3PX4A 4GC6A 1NJXA 2CQBA 2XS2A 4HT5A 3PEHA 1LXNA 3ZTPA 4IRDA 4DUYF 3PJ9A 2J6UA 2D3ZA 2DCLA 1KLNA 2CNNB 5CCLA 3D3CJ 4UOFA 2YY3A 1OYDA 2CPDA 2VFTA 3QRQA 3CCSS 3BSOA 5DZ6A 2CJAA 2F9DA 2OAUA 4B3OB 5MLCV 1NU4A 3ETOA 4CZCA 1K8AT 5IFMA 1VQLS 3QIPB 4L73A 3ETMA 1A6LA 2V9KA 3UDCA 4XO0A 5A76A 5CYQA 1RT7A 4O3RA 2V68A 1ZYRA 1O0PA 1FEEA 3Q8RB 3DU5A 1SJ3P 4QR0A 1Q4RA 2ZH8A 3M1VA 1U1QA 1S6OA 1WJ9A 4WYLA 4CDIA 1HQMA 5DO2A 3AA8A 3M9NB 2R7RA 2IBKA 2IFXA 2ALYB 3G6VA 1E6YA 1RHQB 4KM8A 3IGNA 2E5LF 1YK9A 3H25A 4OV6A 1O26A 4M1KA 4WKRA 5E3CA 1KLMB 4DR4J 2DBBA 5HQ8A 7AT1B 2G13A 4QZVB 3S2DK 1YQHA 1T11A 5GAHI 4EZ9A 1IBAA 3KLIB 4OX6A 4RWXA 2GW8A 3LUYA 3S1QC 3A3PB 4PYAA 4JYAF 3OT9A 3MPVA 4ZITA 4A47A 4DCJB 5ITHA 1NPKA 2C3MA 3MECA 4UOHA 2D3O1 4Q0BB 2JFDA 4X4RA 4YG2A 1X4HA 1MMNA 1LW2B 1QUVA 3S16K 5G4DA 1RT1B 3ZZTA 1T8EA 3OVBA 4OHYA 2F40A 4A3GC 3RU0A 3HHNB 3FKBA 3UD5A 1MN7A 1U0HB 4ECXA 3RZAA 3CCWA 3RYLA 2WAQL 1SKUB 1OO0B 1R9TA 2DHHA 3M2UB 4NEYA 3DLKA 4A8WA 2DNKA 4KM9A 5TMCA 2RB7A 1EX8A 2KT2A 2FQOA 2ADBA 3HOUC 2EFPA 5HMZA 2NPFA 1S1VB 4TKTA 1IXKA 4CTAB 3MCSA 2YNIB 5A8KB 2UU9F 2Q79A 2AYGA 2AZ3A 1QAIA 2HRYA 3GG1A 3Q86A 2KFNA 2KN4A 5J2PA 5FJ8K 1PYSB 3A3NB 1REGX 4HHHA 1UWBB 2W9BA 3H5UA 4DDFA 2R7XA 2B4VA 2DGXA 3UPFA 3I0SA 4CLPA 1WCMC 2C3YA 4NLGA 2CAJA 2KFYA 1M1HA 2I0XA 3PXGa 2AYMA 2ZH9A 4RUCA 2Z56B 2KXHA 3OUYA 1SJQA 3FNNA 1N34J 2HVZA 3TVKA 4F4KA 3G6ES 3KJVA 4RNOA 2AZ1A 3OR2A 3HULA 1CJKA 2KT5A 4NRTA 4GMKA 2P2CB 5HL7Q 1I6HK 3PW4A 5KFYA 5IXUA 5F8IA 3K5PA 4IQXA 3PYFA 2E1AA 4LRCA 4LBHA 1HI0P 1ULRA 4OYPA 1DLOA 1HYSB 3PY8A 2KT3A 1VBXA 1NH7A 1EQRA 2YX1A 1VQKS 4XLPA 3V6DB 2J9EA 4QIVA 4GKJF 5K8OA 4DL7A 3T6JA 2DNNA 5HL8A 3VGSA 4YHHF 3OSPA 3LPEA 1M0SA 3LAMA 3GTGC 3TEHB 4OHWA 4P7TA 1EETA 2YNIA 1FDBA 2FLNA 4QJVB 4LF6J 2NVYC 3RAMA 2H5JB 3QJJA 2AIRB 2NVYK 3NBPB 1LFPA 2XULA 4MKBA 5FIIA 4DR5J 4QIWL 4MEYA 3FUYA 1XBWA 3QT5A 2M5YA 3TAMA 2B4PA 1HPZA 4PR6A 3D67A 1S1UA 3RAXA 1F0XA 5KG4A 3LWLA 2N4DA 4B3MF 4RW4B 2I8EA 5L1JA 3BH6B 4EBCA 4ZVTB 1R0AA 1YNNA 3G8QA 2BV3A 4D3GA 2GV1A 2E29A 3QBCA 3L9ZA 2QFJA 3RZDC 5J2NB 2UXDF 1OY9A 1UETA 2XC9A 1BWVA 1FTCA 1HYSA 1WC4A 5GMKa 4I6YA 3BN7A 2UVVA 4BY1C 3K5MA 4OQJA 2NVYA 3CJSA 3IRXA 2V2KA 2HWTA 2F9JA 2ZEJA 3IBWA 4ECVA 2EPIA 3CF5Q 4UUWA 3K58A 2ABYA 1HNXF 3GV8B 2OO4A 3MR3A 1QE1A 2Q6CA 3OPKA 2UUAF 2PSZA 3FCWA 1I3OB 3A8KA 4MKYA 2NPIA 1U8WA 1FHTA 3V81B 1RABB 1VLYA 4ZPCA 5MAOA 2JSXA 2ROEA 3ZTRA 3UNGC 4FS1A 1JXLA 3HO1A 1VLOA 4ID5A 1YITS 3GTQC 4I67A 4JI7J 3MM5A 4ES2A 5C25A 2GAHC 2ZM6F 4P10A 3OTOJ 3GTGK 5A8WA 2QYCA 2BX6A 4LF5J 4ELUA 2GIQA 2ADCA 3V4GA 4LT6A 2RE1A 1VIXA 3MCNA 3O3LA 2HLUA 4F0HA 2VL1A 4I7FA 4F0MA 1X9WA 2HS0A 2CPXA 2YU9A 2DH7A 1A7GE 2HQFA 3TVZA 1HNWJ 1Y5IB 4DPUA 4KAIA 1RISA 1F9NA 2YXLA 5LMUJ 2VFRA 2B43A 2CJXB 1YDLA 1WHWA 1XWLA 2R8IA 1M5KC 3EDQB 1UVKA 1DLOB 2XMUA 3VZIA 4LR9A 2BJDA 2MQPA 5E68A 2F8MA 2VASA 3S15K 1YJUA 4AXIA 2CQPA 4DV6J 4BY1K 1F60B 4XSZA 2W7VA 3GTOC 3H2LA 2HFNA 3S1RK 3HFKA 1VJQA 3MEEB 4RPFA 4P74A 2A68A 3LTOA 1ZBTA 4PUOB 4ELVA 1MMLA 2XZDB 2LYVA 1NK5A 3GJRB 3TAMB 1B4BA 1X8DA 1C4CA 2HHHF 2PFFB 3KG1A 2DT9A 4R5PB 3NG8A 2EBBA 1H2TZ 2JDJA 3SSSA 5K9FA 4N7TA 2NXEA 5D0HA 4A3IC 3U1LA 3MEDA 1H2VZ 2QL5B 4M5DA 4KFBB 3ZZRA 2XCRB 1HQEB 1YZ7A 4IQMA 1P8GA 2R8KA 1FRMA 1N88A 5KFDA 5C5JA 2GVZA 4HI1A 4MEXA 2MZ1A 3HMJG 5E3AA 4KHRA 3NMRA 4X62J 2R7OA 2GMJA 1RUSA 3M8RA 2HHPA 2MSTA 4NLRA 4QPTA 1UWBA 3DRRB 3VCDA 4RNHA 1YBTA 4ZA1A 4A3EC 1RWMB 4HTJA 5HVFA 1X5TA 1R27B 4DV3F 5DQIA 2ZOFA 5KFQA 3BB5A 5M3MK 1SFOA 3HOYC 2AU0A 1F9EB 4N8NA 4TU9A 3M8QB 1ZPWX 2Y8WA 1X4EA 3DYAB 2C3OA 4JYAJ 3U7JA 2ZD1B 2XQCA 4O3QA 3MR7A 4Y28C 2FB0A 4ECWA 3BN4A 4ZN3A 2DEJA 3MPDA 3GSIA 2CIMA 3QLHA 4IR1A 4O3SA 2ILZA 3U02A 3RG6A 2RH6A 1S6QB 5ADZA 3K0JA 1U0SA 3UW1A 3OL8A 3N5FA 5CH7B 4XCHA 2H3EB 2BANA 2Q6BA 1A0OB 3Q0AA 2L9DA 1C1CB 2GIRA 1BUXA 3OL7A 1UVNA 3BO4A 1WORA 1KVJA 2DR8A 3CJ2A 1FKPA 4YB7A 4U95A 3GTPC 3BPDA 2ALZA 5EWFA 2FYXA 1DY3A 2MJUA 4ZOSA 1R6VA 1J27A 2C2DA 2DRAA 3HVTB 1GH8A 9ATCB 2VUMK 2F5GA 2CPZA 4DZ6A 3MF5A 4A8FA 5C25B 3FKIA 1SJRA 2HRUA 3FBBA 1TFWA 5K14B 4RU9A 4Q5VA 3G4CA 3OJUA 2WB4A 3T5LA 2OPSB 2JA5A 4G1PA 4CO0A 4DL4A 3N4WA 4JI3F 4U96A 2W9AA 1HNWF 2YU9C 5B0AA 1ZYQA 3KUEA 1RHUB 4FZBA 4JI4J 2YKQA 1B0TA 1N36J 1KVIA 1K83C 4OINA 2YKOA 3ILOA 4Y00A 2OMLA 5KT4A 4ZJQA 3T5JA 2DYAA 2XGPA 1LK7A 5BJRA 4X65F 4GTDA 1UFKA 4L3KA 3DOLB 3BBBA 5ETKA 4FPRA 4ED0A 4CLWA 2IY5B 1Q5YA 4ID5B 3R1HA 2GSNA 2OKQA 3H98A 4CRJA 3PW0A 1NKCA 1AFIA 1ZBSA 2CNLB 2KZZA 4N8OA 3TWZA 4LFAJ 2ASLA 4Y2IA 1ITPA 4CO4A 3H7HB 1S1VA 2GVDB 1T94A 4ILRA 4CLFA 2KXNB 5IWAF 2H5IB 4OYAA 2JC1A 3FHZA 1T02A 2ZJRQ 1BY9A 2DR7A 3OUYB 2HG4A 5HROB 4WIQA 3DGPA 4B3TJ 1VRTA 4JI6F 2BKNA 3KLHA 2DR5A 2R92C 1ZZFA 4B08A 1RWKB 2ZOGA 3I4HX 2B7CB 2GGPB 4ZVFA 1SV5B 4DN9A 3THTA 1WG5A 2HHWA 2RRNA 3BKTA 1MSWD 3BM7A 3NOGA 4EYIB 1WF0A 4URSA 2C2KB 2DNMA 2YU9K 2M88A 1QJHA 2KHDA 3KLFA 3DDKA 1S57A 4KGMA 1RHRB 4OIPA 4K2JA 2RNEA 1B3TA 4BBRC 4FBTA 2DHGA 4F67A 3EDRB 1ICEB 3OV7A 1N5TA 5KOXA 4OI3A 3UE2A 2H51B 3QLHB 1YI2S 2KFZA 4ATNA 4FPIA 1TTHB 1KP6A 2LECA 2VQFF 3GTGA 3NS7B 4YHHJ 2ATCB 2O67A 1MLAA 3I5CA 2HNYA 3NWGA 1ZM4A 2PI4A 1TWFK 3IS9A 3CJ8A 2EFOA 5IM0B 3LGHA 2HNZB 1XXAA 3MAHA 1XMOF 4LF8F 4PG8A 2F7VA 3VAIA 3F0NA 3GZ7A 1KQ4A 1RAOA 3A3OB 4Q43A 4I56A 3T5HA 2RQMA 3HI9A 4USUA 3QGHA 1FKPB 2CQIA 4C45A 4ETZA 4IR9A 2KZMA 1WD6A 3KMSA 4J9PA 5B09A 3Q24A 4K0KJ 3M8PA 4U9RA 9RUBA 1UTAA 5JVHQ 4OZJA 4DV2J 1RAFB 1IM4A 3MMAA 3PO2K 2AWZA 5M5WK 2C2EA 4IRCA 2N3OA 2ZZTA 2HIQA 1WOSA 3IBCB 3RBZA 3VA7A 2WVFA 4K4UA 4DL5A 4WP9A 5A8KA 1F2HA 3Q22A 5C4JC 3E01B 4TU8A 2ZH2A 2DHSA 1QY7A 3FC9A 2EG2A 1X4AA 4HTIA 2M52A 2GS8A 3BUEA 2XNQA 4C3HC 2K7KA 4J9KA 2X7IA 1EI6A 1HNZJ 2UVWA 2CUYA 3QQCD 4W98A 1HARA 3W8GA 4Z37A 5HLFB 3B8HA 2QV6A 3C6TA 3HVTA 4YY3J 4N56A 3SDEB 4FN5A 2A69A 1RHMB 2D6FC 4B3RF 1DJ0A 4LFBF 1JLEB 4ZCLA 1Y0HA 1Y1WK 3IR7B 1U4BA 4Y7NC 4Y2AA 4A8QA 1X7VA 2F8EX 4QCLA 4Y52K 2QFIA 3S1TA 3U27A 1VGXA 4ANEA 2QIFA 5F8NA 4B02A 3I4MK 4PWDA 4QW9A 3RGIA 1FX2A 4OIXA 3JXOA 4LSLA 1Z1ZA 5H9FK 3P4UB 2WBMA 1HBOB 2VJUA 4LSZB 3ZO7A 1HWJA 4NXNJ 2YKNA 4H4KA 4ILMA 1UVMA 3KHHA 4B9LA 3P3DA 4DR4F 1APSA 2C2ZB 3DLLQ 4NCBA 3SSRA 2NXJA 3DM2A 5KG1A 4OHZA 3D2WA 2ASJA 4MK9A 5HP1B 4F0KA 1NJIT 4CH0S 4BBSC 1J2VA 1OQ3A 2DY9A 1HBUB 4JV2A 1RT4A 3N9UC 3BP8C 3LALA 3GTLC 1OSCA 1Z4UA 4UZCA 4AE5A 2BQRA 2PHCB 2KJVA 3CC4S 3BZQA 1T03A 2J0SD 3OJSA 4K4TA 2W25A 4O3PA 3CD6S 2HFUA 1YJNS 2XO6A 4USWA 1KTVA 1I3QK 4G7OA 2A6OA 2ZC4A 5BYQA 5HROA 2QL9B 1LW0B 1WCMK 2EBGA 2BJ3A 1IJFB 2L3MA 1OIAA 4KQZA 5C2GA 3GJTB 2XMTA 1YZ6A 2J9CA 4BHQA
chains in the Genus database with same CATH topology
1VLOA 4PAAA 1PJ5A 3GSIA 3GEEA 3TFHA 3GEHA 1VRQC 1YX2A 2GAHC 3AD9C 1WSVA 4P9SA 3TFIA 3GIRA 3AD8C 1XZQA 3TFJA 1PJ7A 1XZQB 3A8IA 3GEIA 5L46A 1XZPB 3AD7C 3ADAC 4PABA 1WORA 2GAGC 1WSRA 1WOOA 1XZPA 3A8KA 1X31C 1V5VA 1WOSA 1WOPA 3TTGA 3A8JA 1PJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLO A;  4PAA A;  1PJ5 A;  3GSI A;  3GEE A;  3TFH A;  3GEH A;  1VRQ C;  1YX2 A;  2GAH C;  3AD9 C;  1WSV A;  4P9S A;  3TFI A;  3GIR A;  3AD8 C;  1XZQ A;  3TFJ A;  1PJ7 A;  1XZQ B;  3A8I A;  3GEI A;  5L46 A;  1XZP B;  3AD7 C;  3ADA C;  4PAB A;  1WOR A;  2GAG C;  1WSR A;  1WOO A;  1XZP A;  3A8K A;  1X31 C;  1V5V A;  1WOS A;  1WOP A;  3TTG A;  3A8J A;  1PJ6 A; 
#chains in the Genus database with same CATH topology
 2EI5 A;  2N82 B;  3GEE A;  1O28 A;  3EXC X;  4E0D A;  5IV4 A;  3GTL A;  5TMF A;  1SC6 A;  1M5S A;  1S0O A;  1N6Q B;  1IR2 A;  3B4M A;  2AEJ A;  2GJI A;  3MR2 A;  1K83 K;  2YWE A;  4KBI A;  3SCI E;  2LEA A;  2J6S A;  1JXV A;  4Q2M A;  3CNQ P;  3GIR A;  5HAN A;  2EBE A;  2XS7 A;  1H2U X;  4PZV A;  3OTD A;  3G2X A;  3K7A K;  1JKH B;  2AP6 A;  3I0R B;  4NZ6 A;  4OMF G;  3PO5 A;  2L41 A;  4IG3 A;  4I7F B;  2VZ9 A;  4QWB A;  2ZH5 A;  3QRP A;  1N5Q A;  1FRL A;  1JNR B;  1F5C A;  1RB0 A;  4ED4 A;  1QM9 A;  2WBR A;  4ZVQ B;  1S9E B;  5T7L B;  4Q44 A;  1Q7Y T;  2CQC A;  1ACM B;  4KHM A;  4U67 Q;  1RTD B;  3NY0 A;  1VBZ A;  3D0I E;  1VR6 A;  1SUQ B;  4A93 K;  1XZQ A;  2Y1J A;  5F0U A;  4DL6 A;  1R0B G;  4KHP F;  1H98 A;  3MPU B;  3NCQ A;  1WKK A;  1T9W A;  1JLF A;  1EH1 A;  2X3D A;  2FHJ A;  2DRB A;  3QAU A;  1PIL A;  3M2U A;  3O5T B;  2Z4P A;  2BE9 B;  4KR0 B;  4QWE A;  1NZ8 A;  3M4X A;  3ZZO A;  1KSP A;  2AGO A;  2OUG A;  1GXL A;  4NLQ A;  5FJ4 A;  5HP1 A;  3J81 j;  1I3Q C;  5IOL A;  4MYU A;  3GTK K;  2LA4 A;  4ITS A;  5L9X A;  2QG9 B;  4OI4 A;  5CA5 A;  1HW9 A;  3OL6 A;  2GQ2 A;  2OTL S;  1UL3 A;  1X4F A;  3CED A;  3RZO K;  2IM1 A;  5IYD K;  2HK3 A;  3DM2 B;  1G2E A;  2VPW B;  1YWX A;  1USM A;  3QGG A;  3M2R A;  4BY7 C;  4ILD A;  3CJ3 A;  1BDF A;  2Z8Q A;  4ED8 A;  2N7Y A;  4FYW B;  3SV4 A;  3CSK A;  4EMD A;  4DR1 F;  2RF2 A;  4O2D A;  1PYT A;  5DLG A;  2ZBP A;  1RU2 A;  4WU3 A;  3KK1 A;  2CWK A;  4K8R A;  4WFN Q;  4KKO A;  2OJ3 A;  2MGZ B;  2VKZ G;  1T0T V;  1JLG B;  2B3T B;  1VI7 A;  5KG2 A;  5I3U B;  3M4O C;  3H90 A;  1SXL A;  3J7Z 5;  3PO3 C;  3SZ2 A;  3GTJ A;  3HOW C;  1QTN B;  2DJW A;  2HVE A;  4P75 A;  1HW8 A;  4GZY A;  2HFS A;  1AFJ A;  3SXL A;  2IC3 B;  4NRU A;  3KLV A;  2RML A;  4ZHR B;  2QT7 A;  5K20 B;  5KG6 A;  4U6P A;  1J5O A;  1RT5 B;  2ZZN A;  1SJF A;  2QE5 A;  2HFV A;  4ZPD A;  3HKZ L;  3DCA A;  4IH6 A;  2YKN B;  3ZZ0 A;  3DC2 A;  4TYA A;  5KFJ A;  4IG0 A;  3US5 A;  3HSD A;  4YS2 A;  1YTY A;  3CJ0 A;  3BSN A;  2PFD A;  2OPS A;  1CUL A;  1NEE A;  1KFD A;  4P7V A;  3DLE A;  3H3V L;  1TL1 B;  3FSX A;  5G0R A;  1S1U B;  5M2P A;  3DRX A;  1F93 A;  1F7U A;  3K5N A;  2WW8 A;  4DV0 F;  4YFX A;  1MU2 A;  4WXO A;  4MAK A;  4A8S A;  1EHW A;  4DR6 J;  4M5I A;  3MEK A;  2F4V F;  5A6W A;  3G71 S;  1U2R A;  3UN2 A;  1K9M T;  2BXJ A;  4DHV A;  2JX2 A;  4BWM A;  2MZS A;  4IG3 B;  4UY8 T;  4LRE A;  4JI2 F;  5CD4 H;  4MYT A;  2J9D A;  3LP2 A;  1NM2 A;  3O6Q A;  1L3V A;  4C2M C;  1ROF A;  1S12 A;  4G1Q A;  1C0U B;  1QUP A;  2BM0 A;  3BKF A;  1IBL J;  3R7B B;  2CRL A;  2XY5 A;  1RYR A;  1Q78 A;  3ENV A;  4I2P A;  2UXB F;  2HFZ A;  3TJA A;  4A8M P;  2E2H K;  4CT9 A;  4KV8 B;  3SV3 A;  1WNE A;  2X51 A;  3GWC A;  5KFI A;  2DNY A;  2CNK B;  4H4K C;  3ZZU A;  1F5A A;  5A2Q U;  3RR7 A;  2BRL A;  3JQK A;  4F3M A;  4OI6 A;  5I3P A;  1NK7 A;  4Y34 A;  5A0Y B;  2V6S A;  4EU0 A;  1JLF B;  2GGP A;  5CAB A;  2RHS B;  2XHW A;  3CE8 A;  2VIC A;  1W25 A;  4NLV A;  3G4S S;  1NLK L;  3VVT A;  3OHB A;  4OX7 A;  1TUG B;  3ISN D;  3PO2 C;  1BD6 A;  2QL7 B;  4GC7 A;  2H1Y A;  4GTL A;  2OEL A;  4F36 A;  3M8W A;  5KG7 A;  3TUP A;  5LJ5 Y;  2VQF J;  4WII A;  3L95 X;  3O44 A;  1W7W A;  3KK3 B;  5IOS A;  3GTP A;  4EWT A;  2MQL A;  4MFB B;  4DQP A;  4MT1 A;  3IRW P;  3F73 A;  5H9E K;  3M2V A;  2H4Y B;  4DG1 B;  4ZVP B;  4PYD A;  4TYB A;  3GIK A;  2J0Q D;  2EFQ A;  2UUT A;  1G4C A;  2ZE2 A;  4EO8 A;  1I3Q A;  4ZVS B;  5CHP A;  2I1R A;  2JL9 A;  4NA2 A;  4OHV A;  3BQ0 A;  2YNH A;  3D0G E;  1I1G A;  2V5H G;  2POK A;  1U1N A;  1G51 A;  2OFH X;  1T3N A;  2KH9 A;  5CYM B;  4NZ7 A;  2DR6 A;  1GX5 A;  4B9S A;  1UFL A;  1L3K A;  3S0X A;  3KFW X;  4ZMM A;  3V2U C;  5DDP C;  3D1O A;  4JI0 F;  1TU0 B;  4K5R A;  2XMJ A;  5C24 A;  1Y5L B;  4FF4 A;  1NDL A;  1WSV A;  5DLF A;  3W8P A;  2FVC A;  4TN2 A;  4HL9 A;  1TUV A;  5M5Y K;  3S1Q K;  1WC0 A;  4GFQ A;  1S77 D;  1L3S A;  4ZLL A;  3KYL A;  4DR3 F;  1ISE A;  3EZU A;  3MUT P;  3JSY A;  3M8P B;  1YHQ S;  4C48 A;  5GAD U;  3KK1 B;  1G7C B;  1FRJ A;  2AX0 A;  4IG0 B;  4C7Q A;  3KUH A;  2DNH A;  3CCM S;  2ZH6 A;  3GTJ C;  3AA9 A;  1TWC C;  5HJY A;  2AJ1 A;  2GVZ B;  1L3T A;  5F8H A;  3MGJ A;  2LQ5 A;  1U6Z A;  1MN9 A;  2PMZ D;  4DXL A;  1NK0 A;  5IT9 U;  1KLM A;  2HMI A;  4PG7 A;  2BE5 A;  4JUZ A;  1HQU A;  4OJ1 A;  1E6V B;  1T9X A;  3H5X A;  2GHW A;  4NPO A;  3SZZ A;  4DPT A;  2VDI A;  4ZPA A;  4LMZ A;  3TX8 A;  5KG3 A;  2OSQ A;  2B8Q A;  5KFM A;  2PE8 A;  2YVS A;  3NS6 A;  4PXD A;  2RF2 B;  4ZPT R;  3KJQ B;  2KJW A;  4K50 A;  3RBD A;  4RW9 A;  4DLG A;  3DI6 A;  1OY6 A;  2A2D A;  1FVQ A;  3A13 A;  2ZIT A;  1P27 B;  2OD6 A;  3M3Y K;  2JLF A;  3H5S A;  2E5I A;  2IM2 A;  2IDE A;  2YH0 A;  3WIV A;  2LQ8 A;  1JLC B;  3AT1 B;  2U1A A;  3M1V B;  4UY8 5;  2JVO A;  4FZV A;  4H4M B;  2PGC A;  1WF2 A;  4BWJ A;  4BY7 K;  1RTH A;  5CQG A;  5ETO A;  1AB4 A;  4YFN A;  4FBU A;  2HQ3 A;  4ECR A;  4QIF A;  3PX0 A;  2EC0 A;  2IHR 1;  4WP3 A;  1WIH A;  2B63 A;  1KDN A;  3GCW P;  1IKX A;  3GEH A;  2ACM A;  1QSL A;  1NB2 A;  1TWG K;  1URN A;  1I6H C;  5J1E B;  5DQG A;  2RU3 A;  2R8H A;  1ZA1 B;  1T9Y A;  1RTJ B;  4OI0 A;  2Z2L A;  2DGW A;  1Y4Z B;  3DRR A;  4GT9 A;  4PPZ A;  1IKY B;  1RU1 A;  1MRO A;  5D4N A;  1D9D A;  4Q7A A;  1N56 A;  2F4F A;  4DEZ A;  1FNX H;  1QAX A;  3GTJ K;  4I2P B;  3ISN C;  3G96 A;  4LOW A;  4BCA A;  5L46 A;  1FDN A;  2VJV A;  1EKS A;  1HQE A;  1UV7 A;  1F9F A;  4QR2 A;  2W2P P;  3CO0 P;  5BYS A;  3PEJ A;  1L3U A;  2FJW A;  3R5A A;  4QYZ J;  3CCV S;  1FNO A;  2PA3 A;  1NUE A;  1GTE A;  1SC3 B;  3ZZY A;  2HHX A;  5D0E A;  3WDO A;  2EFN A;  4A46 A;  3MR6 A;  2M8D B;  3THV A;  1CJT A;  5DM6 Q;  3C16 B;  1H7X A;  5TJ3 A;  4XTT A;  5IOR A;  3NLC A;  3DU6 A;  3S01 A;  1KC8 T;  2I9S A;  4KJI A;  4B3R J;  3L4K A;  3W3S A;  4WF9 Q;  2ZWP A;  4P5B A;  3I5B A;  4WFZ A;  1AZS B;  1RHK B;  2KRB A;  3M32 B;  3DYA A;  1FEH A;  5DET A;  2N3L A;  1S6U A;  4F8R A;  3BR8 A;  1JXE A;  4BLB A;  3HJV A;  2WRM A;  1GXT A;  4A8X A;  4GVB A;  2CVI A;  4CIO A;  2W2M P;  5BR8 J;  4YDD B;  1XN9 A;  4DS4 A;  1IBK F;  4DDQ A;  1ZAV A;  3DRS B;  1SC1 B;  1D09 B;  1LK5 A;  4ICL A;  2NCK L;  1FCA A;  1VS3 A;  2VPY B;  2HHT A;  1RXO B;  4A3J C;  3TZY A;  1NDC A;  4K4W A;  2DKO B;  1XK8 A;  3M2R B;  2BAN B;  3EGW B;  3G8T A;  3TZW A;  5M2U A;  2HS4 A;  4OJH A;  3MMB B;  3R9L A;  2QC3 A;  3BH7 B;  2FD2 A;  1FES A;  3MDF A;  2R7T A;  3MEG A;  4O0N A;  1HNI A;  1FF2 A;  3MD1 A;  1N33 J;  1KBR A;  2MTL A;  4F2R A;  4OZ1 A;  3D68 A;  3UR0 A;  1IKY A;  1USO A;  1XMQ F;  3O8W A;  1FJG F;  1IW7 A;  4R8U B;  1P9Q C;  3ZFV A;  2VPX B;  2Q43 A;  3OW2 R;  2E5J A;  3M30 B;  1TQL A;  1VQ4 S;  2G0C A;  2OH2 A;  1JJ2 R;  1J5O B;  2RIJ A;  4QOT A;  4N47 A;  3UR3 C;  4KAW X;  3V6J A;  1TVR A;  2CPY A;  1NHV A;  1R6Y A;  3JTO A;  4M5N A;  4DV5 F;  2QO3 A;  5KOW A;  1M5V C;  2HQD A;  5EGH A;  4YB5 A;  3J81 Y;  2W9C A;  3W2V B;  1KRP A;  3GTO K;  2QRR A;  5D77 A;  3VTI A;  3TOQ A;  4YQW A;  1HFE L;  4LVN P;  1RT6 A;  2PMH A;  3I56 S;  1CQM A;  3FBC A;  3OL9 A;  1U7L A;  2ZKU A;  1DQ9 A;  4E8U A;  4ZP7 A;  4QIE A;  3CT9 A;  2M0G B;  2B63 K;  1O6X A;  2JEG A;  1F9H A;  2DCU B;  4DL2 A;  1U2F A;  1I5O B;  2FDN A;  4O0I A;  2R7U A;  3VV2 B;  4IH5 A;  2DHX A;  4DZD A;  3PKY A;  1F2G A;  1UPM B;  4DI6 A;  2OLW A;  2B5J B;  4ZVU B;  4F04 B;  4C8K A;  4K5S A;  2RRA A;  4KMD A;  1KEK A;  5DM7 Q;  3WC2 A;  1T9T A;  2CYY A;  2L9N A;  2YNG A;  3V4M A;  4C8N A;  3P45 B;  2HGL A;  1HBN A;  2FUG 9;  5BXI A;  3HHD A;  2R4F A;  1UW4 A;  1YRX A;  3S16 C;  3MEC B;  1X4D A;  5LXR A;  1WDD A;  3AD9 C;  2Y0S D;  2OMO A;  3GYN A;  1FRX A;  3FSY A;  2RKI B;  3C66 A;  1S48 A;  5U47 A;  2UXD J;  4LR2 A;  2X1F A;  3WX4 A;  4I6W A;  3GQC A;  2C3P A;  2NQP A;  1C0T A;  3BSA A;  3NGS A;  3PFE A;  2C2O B;  4AXJ A;  5IT0 A;  3IWL A;  4USJ C;  2F8H A;  2HZV A;  2YX7 A;  5D8H B;  1NH8 A;  4HLB A;  4B3M J;  2E2J K;  3LGM A;  2RDI A;  1DFD A;  4WE1 A;  3OTC A;  4KT0 C;  1FJE B;  3G86 A;  3EZO A;  2R7Z A;  2RQK A;  4KC5 A;  3M7V A;  3BEG B;  3H0P A;  4AUK A;  1VDH A;  3KG0 A;  2GX8 A;  2XI2 A;  3G87 A;  3N0B A;  4J9L A;  2NSC A;  3I96 A;  2MQM A;  1HWI A;  2FVS A;  3H59 A;  5J2P B;  1M90 T;  4NCA A;  4LF6 F;  2DIS A;  3HX9 A;  2IA6 A;  2XYP B;  3VAL A;  2LEP A;  2BE2 A;  2QSF A;  1BE4 A;  3K5L A;  4P2M A;  1SFO K;  3BQ2 A;  2DPI A;  1N0V C;  4HEA 9;  3M2V B;  2KVI A;  1U09 A;  3QO9 A;  1RT4 B;  4RUH A;  1WI6 A;  2E9T A;  3W2V A;  2FJB B;  1SJ1 A;  4C8L A;  2BW2 A;  2XMM A;  1Y5N B;  4OZN A;  3P5B P;  3BGL A;  1WHV A;  4V1A k;  3EMT A;  5LXY A;  1VBY A;  3NAI A;  1T95 A;  4B3S J;  3L09 A;  1OS5 A;  1MG7 A;  4ER8 A;  2JA7 K;  1RWO B;  3A12 A;  2LXU A;  3IR5 B;  1NKB A;  2EG1 A;  4MMO A;  4ZP8 A;  2XB2 D;  2GFF A;  5C24 B;  5CAA A;  1WG1 A;  4CLS A;  4JI1 J;  4NYP A;  4Q45 A;  2ZVS A;  4G1I A;  1TK0 A;  3RB0 A;  2DNP A;  4CO2 A;  1U1L A;  4LF4 F;  4NLO A;  4WFY A;  2B5J A;  4C0B A;  4DQS A;  4FDF A;  3HHK A;  1U47 A;  4DSJ A;  3CQZ A;  1HNI B;  1KHV A;  5DDQ C;  1S10 A;  4FF1 A;  2ACY A;  1M5O C;  4LK0 A;  2AGP A;  3BV8 A;  1U8S A;  4DQR A;  2J76 E;  1N36 F;  4J9R A;  3BP3 A;  4DJB A;  2HBR B;  2B9W A;  3PCO B;  3DKD A;  2GIF A;  3WQP A;  1FK9 A;  2WW4 A;  3R8Y A;  1INN A;  4XAK A;  4IFV B;  3GIJ A;  4YB1 P;  4CYU A;  4OYB A;  4A8Y A;  3UVJ A;  5IT4 A;  3RR8 A;  2PMW A;  4J9M A;  3K7R A;  3PKM A;  1BGX T;  3PW2 A;  2R7W A;  3CWJ A;  1WI8 A;  2FJD B;  5KFV A;  4NLW A;  4JP8 A;  1X4G A;  5FDL B;  1NND A;  2J5A A;  3DXJ A;  4QU7 A;  3JYT A;  1O27 A;  4M5K A;  4PPD A;  4UQT A;  5A6P A;  1H74 A;  3QYY A;  3PR4 A;  4GO7 X;  4LJM A;  1PYO B;  4DR3 J;  4A3M K;  4DCP B;  2E2I C;  5HAO A;  4DFM A;  2AYB A;  5F8L A;  5KFK A;  5DQH A;  1HI9 A;  1XIQ A;  3EPI A;  1B4A A;  3AQO A;  1RKJ A;  4C3J C;  3PRV A;  1OQ6 A;  2VUM C;  4CCH A;  2A1B A;  2XWX A;  4G0V A;  2KU7 A;  1NSK L;  2PII A;  4P52 A;  4I6A A;  5K8N A;  2MEW A;  2BE2 B;  4OYM A;  4TY8 B;  2CDR B;  2YNH B;  2MKK A;  2XSJ A;  2PA8 D;  3PV8 A;  1QLN A;  1Q16 B;  2R8J A;  2ZNY A;  2CAD A;  2G2O A;  3OEP A;  4FNI A;  2B9X A;  3LAP A;  4C6A A;  4M63 A;  1TL4 A;  4Y2K A;  1RLD A;  4KH0 B;  4ELT A;  3H20 A;  2AV5 A;  3L7U A;  2RAQ A;  2IM3 A;  3W62 A;  2KYZ A;  3LP1 B;  3GSD A;  3IWX A;  4F7V A;  3ZC4 A;  4K4S A;  4KMH A;  1T05 A;  1R8P A;  1GNK A;  1TMJ A;  4J9N A;  4BBR K;  3D0H E;  4S0M A;  2V94 A;  1EIY B;  1UKU A;  4DSF A;  4KDD A;  4LK1 A;  3RB6 A;  1B70 B;  2L9W A;  1C2P A;  5AE3 A;  3HOX K;  1Q0N A;  3JSM A;  1O24 A;  3OFF A;  4XSX A;  1RAJ A;  3D6T B;  2P5V A;  2LQ9 A;  1PAE X;  2XCQ A;  1X9M A;  3CCJ S;  3ENW A;  2FIU A;  1PG5 B;  2VOO A;  3PX6 A;  2V8D A;  4P9S A;  5DZ7 A;  2AQ4 A;  3H3V D;  2JEJ A;  3I4P A;  2NRE A;  2Y9H A;  2GO8 A;  2PO4 A;  2QLW A;  5KFU A;  1R0A B;  1H0H B;  2XNR A;  4QBU A;  2M2B A;  4X4O A;  3W64 A;  1WTB A;  2E2I K;  1UAW A;  3NP5 A;  3TZZ A;  1NDK A;  1V9O A;  4LF4 J;  1S99 A;  3UN5 A;  2RIL A;  3IS9 B;  3G82 A;  3J81 U;  3OVA A;  1EB0 A;  4AQY J;  1LQ9 A;  2DIU A;  2MB0 B;  2UVR A;  4ZVG A;  3Q3Q A;  1Q86 T;  1FWL A;  3LF0 A;  1NK9 A;  1GMW A;  3S8S A;  4O3O A;  1BC6 A;  4NML A;  5HK4 A;  5CYJ A;  4LRD A;  2QMW A;  3C14 B;  2FVP A;  1CC7 A;  4AYB L;  1XZP A;  3MM8 A;  1XQI A;  4ZPV R;  1YJV A;  3UD3 P;  4X2B A;  3J7A 1;  1YIJ S;  3HHL D;  4DV7 F;  3UCU P;  5CCM A;  2JA5 C;  2QA4 S;  3ORE A;  1XNQ J;  3DLK B;  2IRY A;  1ZOT A;  3HK2 A;  4IYQ A;  1FKA F;  5J1E A;  4FF2 A;  2F4V J;  3KMQ A;  4Y52 C;  4G3I A;  2WVD A;  1WWH A;  1QTM A;  4EO6 A;  4KGX B;  2HHS A;  3FMW A;  2E2J C;  2MY8 A;  3ZTQ A;  4HDG A;  4ECQ A;  2KTQ A;  5C44 C;  2MKY A;  2C2M B;  5C44 K;  4FKX A;  2HUR A;  1VQM S;  1YRT A;  1QSS A;  2FHO B;  5IM0 A;  1DTQ B;  1PJ5 A;  1TL1 A;  1Y7P A;  3N0V A;  1UEU A;  2MKJ A;  3HPO A;  1YJW S;  4MQ9 A;  1VQ7 S;  5A0Y A;  2R9L A;  4E98 A;  2JZ5 A;  3QT8 A;  2V4Q A;  1OJ4 A;  2CFA A;  3JTP A;  5A8R B;  2BE7 D;  4NE9 C;  1UPP A;  2J0W A;  1T03 B;  2ZM6 J;  4EFA C;  1SFO C;  3HKZ D;  2E9R X;  2VB6 A;  3MTJ A;  1U6B A;  5KFL A;  3K2Y A;  2VC1 A;  3GTL K;  2C42 A;  5LMN J;  4AL7 A;  1LXJ A;  4IO9 Q;  2FZK B;  3CJR A;  2HSE B;  4DV7 J;  5EWE A;  7FD1 A;  2OPR A;  4KTQ A;  3Q8U A;  1KQK A;  1RHJ B;  3QFW A;  5F3Z A;  2WZ1 A;  4DLE A;  1XXC A;  3C6U A;  1VQS A;  1HD1 A;  2A6M A;  1QAY A;  4C3L A;  3TX0 A;  3WHI A;  4RBU A;  1T9V A;  3HXA A;  5J2Q B;  1WDT A;  2JVR A;  3TUJ C;  4LVO P;  4B9V A;  1ZS6 A;  5DRK A;  2FY1 A;  4ZN1 A;  3GTY X;  4J91 A;  2R2R A;  4EYH B;  1JQG A;  3K8V A;  2MJN A;  4AQY F;  5IYD C;  1FO1 A;  2F63 A;  4NLX A;  4Y7N K;  1YCL A;  3POT A;  3UN3 A;  4J9V A;  3I5A A;  3FFI A;  3LO3 A;  2GC8 A;  7FDR A;  3G4A A;  2OSR A;  1FA0 A;  3QIP A;  4TLR A;  1TL3 A;  1PKU A;  3MAQ A;  1VK8 A;  2UZA A;  4URG A;  3OBI A;  3ET6 B;  2IAJ B;  2V8G A;  1RTI A;  2LCW A;  1C4A A;  2CPH A;  4RW7 B;  3W61 A;  1TUW A;  4K4Y A;  2M9K A;  2WK4 A;  3TAR A;  3THP A;  4CTA A;  2AD9 A;  4ZP9 A;  2C22 A;  2V69 A;  3K7A C;  3J7Y U;  2JRS A;  3KDO A;  1PC4 A;  3C6U B;  2VA3 A;  1ZTT A;  1PGZ A;  3I0S B;  4FYV B;  1IE0 A;  2LU1 A;  2OFG X;  3HOZ K;  3FCV A;  3EGN A;  5SUH A;  1NPP A;  1YX2 A;  4C98 A;  4WE1 B;  1FRI A;  2BQU A;  2ZHO A;  3IR6 B;  1FE0 A;  2EK6 A;  2IMO A;  1VQ5 S;  2DNG A;  4B3S F;  2E2I A;  1HBM B;  3NNC A;  2XCO A;  2RU9 A;  3AY0 A;  3IO1 A;  2QX0 A;  1FRH A;  3GTQ A;  3SCJ E;  1LWC B;  5KT2 A;  4KY3 A;  5L8R C;  4TQS A;  3JQJ A;  2RSQ A;  3CQZ K;  3FEZ A;  4DPW A;  4J3N A;  2D3O R;  3S17 C;  2RUS A;  4P2S A;  4R0J A;  2CFA B;  4KH1 B;  4DQI A;  4ED5 A;  1BQM B;  1AT1 B;  1XER A;  3DMJ A;  2E5L J;  5FLX U;  2X3G A;  4K7Q A;  4B9M A;  4KAR A;  3HSZ A;  3MM9 B;  8AT1 B;  2M8H A;  3QPI A;  3PM9 A;  2MYF A;  2H9Z A;  4C3I C;  1FRK A;  2WOM A;  3UDE A;  2ZNZ A;  2HHQ A;  2V8V A;  1YJ9 S;  1RWW B;  4F02 A;  5ETS A;  2DXF A;  2M7S A;  4NLU A;  2IPO B;  4DFK A;  3MWB A;  1C0A A;  2ZKT A;  4KV8 A;  2K2P A;  1B0V A;  4LF7 F;  3DXB A;  3GJS B;  1TWG C;  4KPC A;  1FD2 A;  2DIV A;  3Q2S C;  1ZZN A;  3ERE D;  2H54 B;  4DX7 A;  1HWL A;  2YKA A;  4GRS A;  3MUR P;  2CPE A;  3UDL A;  2DK2 A;  2DTJ A;  1F6T A;  1HQU B;  4V19 X;  4IOA Q;  3GTQ K;  3RB4 A;  4Q8E A;  3NGD A;  1JLB B;  1JJC B;  3QSI A;  3OXF A;  5EHH A;  1JK9 B;  2W2Q P;  2YNF A;  2WON A;  3MM8 B;  4DR7 F;  1GQE A;  2RGR A;  1DTQ A;  2Z2M A;  2LKZ A;  4DF4 A;  4DSI A;  1R0C B;  3Q8S B;  2DVI A;  4PG5 A;  3PHT A;  5KT3 A;  2RHQ B;  2HFO A;  2VOP A;  2MPU A;  1ZPV A;  5KFX A;  1IKW B;  5D4D A;  1UW9 A;  3S7R A;  3GP9 A;  3IM9 A;  3AJ1 A;  4OYZ A;  3DGP B;  4JOU A;  4A3D K;  8RUC A;  4O23 A;  1FFG B;  1EJ7 L;  5FDL A;  2BJ9 A;  1D3W A;  3OTB A;  2FGO A;  2CZV C;  1MMD A;  1FD8 A;  2JOQ A;  1HA1 A;  5M3F K;  3KNG A;  3AOB A;  3GIM A;  1NSQ A;  3FQK A;  1HHT P;  3I4N C;  3EVM A;  1DTT A;  3UVJ B;  4RL1 A;  2ZUE A;  3W9H A;  2PEH A;  3UWT A;  3Q23 A;  2HKE A;  4J9O A;  1TAQ A;  4DX5 A;  3I6P A;  3MOJ B;  5ETT A;  1TWF A;  4EK2 A;  4NA3 A;  4C2M K;  5F9N A;  4JI2 J;  2E1M C;  1JWW A;  2Y1R I;  2ZHA A;  2BZ2 A;  2WVE A;  3HHL B;  3WZ0 A;  3PR5 B;  4PQU B;  3KLG B;  3MED B;  2XI3 A;  4J9S A;  2J8A A;  2W1B A;  3R6G B;  4RNM A;  1VRU B;  1NK8 A;  2Y3Y A;  1UVI A;  4FXV A;  5C4X C;  2DEI A;  2FJA B;  5HVG A;  5KFA A;  5I3U A;  1GT8 A;  2YQ1 A;  1RBO B;  5KT6 A;  3WOD A;  2XMV A;  1RT3 A;  3HP6 A;  1AYE A;  1GEH A;  4NX9 A;  3CC2 S;  4DV2 F;  1S97 A;  4ZJL A;  3NGT A;  1JLQ A;  4QU6 A;  1AB8 A;  4RW7 A;  4FYD A;  1M1K T;  2M4M A;  4CNZ A;  3AOA A;  4P73 A;  3C15 A;  2XM3 A;  1H7W A;  1ARO P;  5EDW A;  1VQP S;  2R3V A;  4A3B K;  2E5H A;  2MQ8 A;  1Q79 A;  4YME A;  3QID A;  1LWF B;  1AW0 A;  1VJE A;  2N4C A;  5L1I A;  2QSW A;  2BBE A;  5GAG U;  3GTM C;  5HSP A;  3CCQ S;  2P9G A;  1IN0 A;  2FZC B;  4MIB A;  2MZQ A;  2DGT A;  3R2C J;  2D3U A;  3BDE A;  1VRT B;  3OR1 B;  2HW3 A;  1IBK J;  2AJ0 A;  4WJ4 A;  4CYU B;  5GME A;  1FXR A;  3IAS 9;  3DLB A;  3QRR A;  2MZT A;  1WOO A;  2CA9 A;  2JHE A;  2ZFZ A;  4NXM F;  1LWX A;  3EJM A;  1VQ6 S;  1WC5 A;  2GHP A;  1WHY A;  1G1X A;  4Q2L A;  2H5E A;  4C3K A;  3RTV A;  2RDJ A;  3HD2 A;  3CAG A;  2GNK A;  3QGP A;  4DN0 A;  5KFS A;  1IWG A;  1RAG B;  2G4B A;  5E2Q A;  1CJV B;  3PFO A;  5A2Q Y;  1RT7 B;  2DH9 A;  2HS3 A;  1TWH A;  3HDS A;  1WUU A;  4GO5 X;  1S4E A;  2IVM A;  3HD1 A;  1D1U A;  4OYO A;  5H9F J;  1OYE A;  3C14 A;  4KAT A;  3PIO Q;  2GSU A;  1N5V A;  2Y0S L;  2B9E A;  3N28 A;  4NLT A;  2IYI A;  3BPS P;  2M3D A;  3SFG A;  5KFF A;  4EEY A;  4F26 A;  2ZFH A;  3N6L A;  4L74 A;  3I4M C;  2K06 A;  1RTZ A;  1XC9 A;  1P9Y A;  3TAP A;  4KHP J;  4I68 A;  3CDA A;  3IN5 A;  3X1L B;  2LXF A;  3W65 A;  3MM6 B;  2Z2Z A;  3BGR A;  4I2Q A;  3CJ5 A;  5IP9 K;  3P5T L;  3NWR A;  1O5J A;  4G65 A;  1XXB A;  2O3D A;  2WSF C;  1PC5 A;  4YN3 B;  3BQ1 A;  4DMZ A;  4WK1 A;  1TP7 A;  4NCG A;  2KVQ E;  1RWV B;  4WFB Q;  2VBW A;  4DU7 A;  2CJQ A;  1JLA A;  4QWA A;  4IO1 A;  1RYS A;  4DX8 H;  4UOC A;  2LEB A;  2FTR A;  1Q8K A;  1FJG J;  2B6A B;  1UFW A;  5KFW A;  3DGV A;  1I50 K;  4CLT A;  5LT5 A;  1XR7 A;  2BOA A;  3C19 A;  2V0N A;  2MHE A;  4KPY A;  4FVM A;  5HO4 A;  5AXK A;  4F3O A;  3VGT A;  1X0P A;  5M5X K;  2HVI A;  1R31 A;  1ZM9 A;  3PNI A;  4TXS A;  1CLF A;  2W8K A;  3BSC A;  1TWA A;  5FLX Y;  1IL2 A;  3CW2 C;  4LSN A;  4NZ0 A;  4KYZ A;  1SPB P;  3CDW A;  5L38 A;  4X6A K;  4DV4 F;  1N52 B;  1PBA A;  4KGV B;  3J7Z T;  1RA7 A;  2XG8 A;  2CZ4 A;  4M5J A;  3BGR B;  1TVR B;  4W90 B;  4UQG A;  1RP5 A;  2V50 A;  2CJK A;  1WC6 A;  1BMQ B;  4I4B A;  2DR9 A;  1SI9 A;  3SQG A;  5CZX A;  3IPJ A;  3SEO A;  2VHG A;  4OYW A;  1IKV B;  2W4P A;  2DPJ A;  1UJ6 A;  1IJE B;  4WIL A;  1JLQ B;  4MKV A;  4ZPW R;  1H3D A;  3MAA A;  3TUI C;  3OR1 A;  3FJ2 A;  4A3K C;  3CIM A;  2APO A;  1HD0 A;  2ZUG A;  3D54 A;  3E51 A;  3VR1 A;  4TVA B;  3M4O K;  3BBF A;  3VAM A;  1KN6 A;  3LPY A;  3TI0 A;  3UO0 A;  4R25 A;  4UF4 A;  1TWA C;  2AMC B;  2ZBC A;  3HHE A;  4UUX A;  2UUC F;  1I50 A;  5IP9 C;  2OEM A;  1CSJ A;  3CJ4 A;  2BRK A;  1U25 A;  5JVG Q;  4G0W A;  2G1D A;  2OEK A;  3LAN A;  2AF6 A;  3H2V E;  5DJB A;  4A3G K;  1S0N A;  4DV1 J;  4WK3 A;  1M5P C;  2CJB A;  4B17 A;  4UOG A;  2O66 A;  4ILL A;  5AXN A;  1F5B A;  2G2Z A;  1TKX B;  5B0F A;  5DG8 A;  3T1Y J;  3CMQ A;  2RS2 A;  1Y00 A;  2YWH A;  1IBC B;  2LDY A;  3T1Y F;  2WTF A;  1N33 F;  1U48 A;  3VGV A;  1U2C A;  3CME S;  1RCX B;  3U1N A;  1S79 A;  4RZR A;  1S1T B;  2FHJ D;  1U6F A;  2RKI A;  4QR1 A;  4YEA A;  2W9C B;  2UXC F;  3CMA S;  4L75 A;  2MLZ A;  4DU8 A;  4CWB A;  1Y3K A;  2EEY A;  2KG1 A;  2HHU A;  1NPR A;  3MM6 A;  1Q82 T;  2YKP A;  3I4N K;  4NI2 B;  2DIT A;  2NZC A;  2VFS A;  4CH1 A;  4KB2 A;  2JLE A;  3ISZ A;  1ZA2 B;  3RJM B;  1IS1 A;  4DWI A;  1WEY A;  1VRQ C;  4H4M A;  1XMB A;  3S1N K;  4X62 F;  1YLX A;  4O4G A;  4ECY A;  1YNJ A;  3C2P A;  3MMJ A;  3NMA A;  1FJC A;  4LF7 J;  5HQL A;  2MLX A;  1HNZ F;  2G0J A;  1EZZ B;  4HYK A;  2OPQ B;  1TWH C;  1C0U A;  1TAU A;  1VC5 A;  2NZ4 A;  2A10 A;  1I94 J;  3S14 C;  1OY8 A;  2BJ7 A;  3E8O A;  4HHJ A;  2CNO B;  1FVS A;  3GTO A;  3BF4 A;  1HNV B;  1X31 C;  4A4J A;  3MZI A;  1DCP A;  3BRE A;  3TZX A;  1DAR A;  3KXD A;  2K1R B;  4CM0 A;  2NVX A;  4KN4 A;  1BQX A;  4CLL A;  2HNY B;  1RKI A;  4PXB A;  3CD0 A;  1Q7L B;  1FT8 A;  4DUY J;  2MKS A;  1B0P A;  4TU7 A;  4GVB B;  3M9O B;  3SYZ A;  1PIE A;  1YVF A;  1NHK L;  2XY6 A;  1ELO A;  2IVY A;  2IJF A;  1HQ2 A;  4IH7 A;  4USK A;  3EPG A;  2C2R A;  4ERD A;  1JQW A;  4UTG A;  4HT7 A;  3KK2 A;  5E3Q A;  3MR5 A;  4CLK A;  3GTM K;  4YB6 A;  5KFB A;  4A3E K;  4PWD B;  2YH1 A;  1D8Z A;  2QMX A;  4CO1 A;  4AL5 A;  2NVT C;  4DSE A;  2UV8 G;  3QT7 A;  4BC7 A;  2EC2 A;  3SFU A;  4OZ0 A;  4HR2 A;  1CVJ A;  2WHO A;  2YWW A;  3ENA A;  1CS4 B;  2J0X A;  3CVK A;  3FEX B;  4OIO A;  2JEF A;  4BXX K;  3UDV A;  3OVS A;  1IBL F;  1NCL A;  5JMN A;  1TEL A;  3PJX A;  2DNO A;  3CC7 S;  3HFZ B;  5DS7 A;  1LNQ A;  1IKW A;  1AUD A;  5D78 A;  1URR A;  4LBI A;  4DUT A;  1SVD A;  3LW5 C;  3MAA B;  4FNH A;  4OHX A;  2ZBR A;  2DO4 A;  3AHP A;  3AFG A;  3H4D A;  4LSN B;  1YGY A;  2B63 C;  2DO0 A;  2G0I A;  3ELH A;  5IQ6 A;  4UZB A;  4YP3 A;  1EAR A;  3DOK B;  1N4L A;  1L0W A;  2D74 B;  3M9M B;  2LQJ A;  3IBF B;  2R8G A;  4I1T A;  2V6T A;  3HVW A;  3ONQ A;  4AH6 A;  2ZOM A;  5HMY A;  3CJK A;  4EUV A;  2KDO A;  3E3X A;  3MM9 A;  4EI2 A;  4K0K F;  2VUM A;  3PIP Q;  1NO8 A;  2CQH A;  2P9E A;  4KMA A;  5DDO C;  1QDU B;  3T9N A;  1CS4 A;  3NRB A;  1NSA A;  2XYH B;  1Q81 T;  2XZW A;  3UCG A;  2FJE B;  3X3U A;  1S1X B;  4LF8 J;  2VA2 A;  4A3B C;  5GVQ A;  1V6H A;  2VG6 A;  2QN6 B;  3RAQ A;  3NL0 A;  1SIZ A;  1HKA A;  4U7U K;  1CUL B;  3PYD A;  3ULH A;  1RWU A;  3PW5 A;  3FMB A;  2BKO A;  1VQ9 S;  1GXU A;  1EQM A;  2LA6 A;  4USV A;  4GTC A;  2ZE2 B;  3GLJ A;  5E3P A;  1FK9 B;  2XEX A;  2YNG B;  3PG9 A;  1Y11 A;  1VH2 A;  4WZQ A;  4URQ U;  3GFX A;  3S1M K;  2HND B;  5EN1 A;  3GG0 A;  5HBM A;  3JTN A;  3SBM A;  2FGC A;  4DR1 J;  2XZT B;  1Y3J A;  4IRK A;  2X1A A;  2FHK A;  4MK7 A;  5BYR A;  2YTC A;  1U45 A;  3I82 A;  5FLM K;  4FVC A;  3M6V A;  1RWP B;  2RD5 C;  5FLM C;  2R2S A;  5L39 A;  1V5V A;  2KM8 B;  2F3J A;  1DAX A;  3CDE A;  5J2M B;  4NWB A;  1NB7 A;  2MKH A;  3CJK B;  3NXZ A;  1QVF R;  3KTQ A;  1K83 A;  3M8Q A;  3R7S B;  1EET B;  1JLC A;  2W7A A;  4LR7 A;  4OLO A;  4Y2C A;  3HXM A;  3TTG A;  1RLC L;  2IVF B;  4F4Z A;  2VV5 A;  2OD4 A;  3KJF B;  4A3F K;  4A93 C;  4GKJ J;  3DLJ A;  2EXU A;  3UCZ P;  4PEO A;  4ETX A;  2DGS A;  2UV8 A;  2J7K A;  3S2D C;  2HVD A;  1NJW A;  5IZH A;  2NUH A;  2AW0 A;  1X60 A;  4RNF A;  1TKT A;  4TY8 A;  3PRD A;  2KM8 C;  1D8Y A;  5GAH U;  4NAS A;  1C1B A;  1AUS L;  1D9A A;  1VIO A;  1PBU A;  1LWF A;  2YWG A;  2LXI A;  1RCO B;  5AE2 A;  3R27 A;  1HIY A;  2JWN A;  5I42 B;  4USM A;  2J7W A;  2W7O A;  4XDD A;  1CQN A;  1CJK B;  3M6W A;  1F3F A;  2AHO B;  4MJK A;  1WOP A;  3IFE A;  3KDN A;  2ZZM A;  1RTD A;  5EGY A;  1SUQ A;  1YG0 A;  2K3K A;  3KK3 A;  1S6Q A;  2GSO A;  4NLS A;  1RT3 B;  3A8E A;  4DR7 J;  1KHW A;  3VQS A;  1TZ0 A;  4Q5S A;  3MUV P;  1K0V A;  1VQN S;  3KWM A;  2YQ3 A;  4QWC A;  4D3H A;  4ECS A;  1R8H A;  3VWS A;  4W92 B;  1S72 S;  2UVU A;  2OEJ A;  4Q8F A;  2VKR A;  3MM5 B;  2D41 A;  2B6A A;  3SZY A;  3ILI A;  4O44 A;  2AYE A;  3BGF A;  5AT1 B;  3FDS A;  3GJQ B;  2E7W A;  1BS2 A;  4LIR A;  3I87 A;  4CQ1 A;  3G82 B;  1TMM A;  5G0R B;  3CCR S;  5JVO A;  2EW9 A;  1RAA B;  3K5O A;  1JIH A;  3FKI K;  4IDK A;  1F1B B;  3KLH B;  3FKI C;  1FKO B;  2E7X A;  3G9C A;  3MML B;  3D3B J;  2R93 A;  3S14 K;  4FYY B;  4A3K K;  2JNJ A;  2MSS A;  1HWU A;  1NRK A;  2GZO A;  1NK4 A;  2NXN A;  4A3L C;  4RR5 A;  4AFF A;  1HI1 A;  4GVL A;  1TV6 A;  5IYC K;  3PYE A;  3CD5 A;  4USI A;  4CLY A;  4YFK A;  3OSN A;  2WB1 L;  2HNZ A;  2UXC J;  2V4J B;  1R7I A;  3CCE S;  1PCA A;  3SCL E;  2V34 A;  2NS1 B;  5HI7 A;  1KQF B;  3CJQ A;  4DX6 A;  4DR2 F;  1BQN A;  3S2H C;  2W9B B;  2BA9 A;  2YBV A;  1RT5 A;  1ZH5 A;  3S2H K;  1E6V A;  5AXM A;  1ZQ1 C;  1DQA A;  3PO4 A;  2BVZ A;  2XLI A;  3PZP A;  2VBZ A;  2LP4 A;  2CQG A;  4ZS6 A;  4OYX A;  2V8H A;  3GE9 A;  3NBP A;  3IA0 A;  1R8B A;  1IKV A;  4JBC A;  3QMQ A;  2K8G A;  3BYR A;  1JMT A;  2CG8 A;  2FLO A;  2E2H C;  2HAI A;  2MQN A;  4RKU C;  3LP0 B;  5HLF A;  4CO3 A;  4I2Q B;  1SQG A;  2GQC A;  3IMQ J;  2AX1 A;  4RLE A;  4OJ3 A;  4H54 A;  1SL1 A;  1KOO A;  3TNV A;  3DOM A;  5IP7 C;  3AAW B;  2CPI A;  3QAE A;  3VQT A;  5K8M A;  2WCX A;  5KFO A;  4F2S A;  2YPZ A;  1RAI B;  2CW0 A;  5I4M A;  2DRD A;  1R43 A;  1V3Z A;  2RS8 A;  4A3M C;  1NZA A;  1TWH K;  1EKR A;  4NLY A;  4NI2 A;  2V6U A;  2XMK A;  4JV5 F;  3D6F B;  3EQL A;  2G2Y A;  2G1H A;  1ZAW A;  1CG2 A;  4WYW A;  3QZ8 A;  5B0D A;  2BQ3 A;  2YKM A;  1SMY A;  1O2A A;  5B0C A;  3TA2 A;  4MKA A;  4A3D C;  4E2F B;  1GK8 A;  2BUN A;  5J2Q A;  1IVZ A;  1VC6 A;  4LR8 A;  3V81 A;  2B56 A;  4J90 A;  2VBX A;  3TR5 A;  2RQ4 A;  4C3H K;  2B0G A;  4NMX A;  4QYR A;  3VAG A;  3PVX A;  1H73 A;  3AJ2 A;  3G6X A;  3N0C A;  1IQZ A;  4HH0 A;  1YRU A;  2LFV A;  2HQG A;  2CQ0 A;  1NME B;  2CJY B;  4ZVR B;  2XHC A;  4TLQ A;  1FWP A;  5D4O A;  4NLP A;  3IM8 A;  3KLI A;  3W60 A;  2NLW A;  1IR1 A;  2EFG A;  5KFC A;  1MWZ A;  3OFE A;  4CM2 A;  1Q95 G;  5C42 A;  5LMN F;  2JA5 K;  3ET6 A;  3DLE B;  3BKU A;  4M5L A;  2JH3 A;  3QX3 A;  3KJV B;  4LQ9 A;  1HBU A;  3FGV A;  1XPP A;  1JNZ B;  4PXC A;  1O2B A;  2QEX S;  3A8I A;  1S1W B;  1Y1V C;  1GTH A;  3W5Z A;  2HLT A;  4M8L A;  4FYX B;  3Q89 A;  3ZNJ 1;  2L48 A;  4G0U A;  1KR4 A;  1BXN A;  5DG9 A;  3HJF A;  3NS5 A;  3FEY B;  4DF8 A;  5KFN A;  1UEK A;  2W2N P;  2RUG A;  3FCH A;  2CDQ A;  2HPU A;  4DCO B;  2Z0G A;  3D5M A;  5IYB K;  2PD1 A;  3LP2 B;  2AJ2 A;  2LU2 A;  1N32 F;  2MQQ A;  3BR9 A;  1KON A;  2BMB A;  2Q66 A;  5F8G A;  2ZBI A;  4JI0 J;  2JEI A;  3M8S A;  1LWC A;  4ECU A;  3LP0 A;  4BDP A;  2XCP A;  1Y1V A;  1J6W A;  4M5G A;  1VCT A;  5D4P A;  1IBM F;  3ADA C;  1TKD A;  4RU2 A;  4LFB J;  1RU0 A;  1O2F B;  3TA1 A;  1XNQ F;  3SQO P;  5KTQ A;  4ED1 A;  4PAA A;  4GTB A;  2XSF A;  2R7Z C;  1HPZ B;  4YY3 F;  2BOP A;  2VG7 B;  2VUG A;  3D1Q A;  2JJ4 D;  4HAC B;  3B6B A;  1NAQ A;  1NBE B;  3K17 A;  4R5P A;  1UVJ A;  1Y10 A;  2B4U A;  2FC9 A;  4U7C A;  1B64 A;  1H6K X;  3Q83 A;  1HNX J;  1JJH A;  1XTZ A;  2DGO A;  2ZH7 A;  4NOI A;  6AT1 B;  3D6H B;  2V67 A;  2F1F A;  1ZTW A;  3DHX A;  1EK8 A;  4WJ3 M;  1HWK A;  4LSL B;  3G8S A;  2IAJ A;  1VFJ A;  1FDA A;  3DHW C;  4OIQ A;  1RTI B;  1WEX A;  2FJV A;  4P5A A;  2RRB A;  3CJT A;  1G3O A;  1RTJ A;  2PA8 L;  3M6X A;  1XNR J;  4X4S A;  3MI7 X;  2FPH X;  3T41 A;  3FZB A;  3QJL A;  3S1M C;  3PRB A;  3LGN A;  4WZM A;  1HMV B;  2J9D E;  2L08 A;  4LQY A;  4C0O C;  3RBE A;  3EX7 B;  3TVY A;  1SH3 A;  2B7B B;  4ECZ A;  2VF3 A;  5C7P A;  1SQE A;  1NJZ A;  2PI5 A;  2VG5 A;  2MKI A;  1ZAX A;  3NGK A;  4BS2 A;  3TFH A;  1T3O A;  5HMW A;  4J9Q A;  4RW4 A;  1RT2 B;  3OHA A;  3GTK A;  3L4J A;  3TO8 A;  1NSP A;  3EVW A;  4MIA A;  4EZ6 A;  5L9N A;  4JI5 J;  1IUJ A;  3CCL S;  3HOZ C;  1EFW A;  4NA1 A;  3VGU A;  2JA6 C;  1VHF A;  1EP4 B;  4ZIV A;  1JKH A;  4DQQ A;  1LEO A;  2XS5 A;  3AD7 C;  3MOZ A;  3H0G C;  2GQQ A;  1CJV A;  1A9N B;  2OPR B;  5JJB A;  3S17 K;  1GMU A;  3N79 A;  2DHA A;  2IA0 A;  3MCO A;  4YOE A;  4WTO B;  1LWE B;  2CPJ A;  1JVI A;  1XNR F;  2JA7 C;  1XR6 A;  3DXS X;  4LF5 F;  1U1P A;  4OI2 A;  2GO9 A;  5F0W A;  2WAQ D;  5GAE I;  3RZD K;  1N34 F;  3AXM A;  2BAB A;  5B0B A;  1P1T A;  1UJ5 A;  4KB7 A;  4JI6 J;  1S1W A;  1REV A;  2IJN A;  4KMU A;  2CG4 A;  5IC4 B;  5HBM B;  3H4B A;  3H40 A;  2GJF A;  2X1G A;  4YUD A;  1WKJ A;  3CPW R;  2HQC A;  3JSB A;  2KG0 A;  1TK5 A;  3LH2 S;  2QA4 G;  3SQG B;  1WAC A;  3TUZ C;  3H0G A;  2I38 A;  2HGN A;  2PT0 A;  2ATL A;  3M6U A;  1Z2Z A;  3H42 A;  2E66 A;  5ETL A;  4ZLP A;  1YJ7 A;  4Y2M A;  2QGF B;  1R8C A;  5ETV A;  2HIY A;  1RZM A;  1Z2L A;  1N54 B;  2PPB A;  2FLL A;  2W24 A;  3SI8 A;  1WC3 A;  4RW8 A;  4KC6 A;  5J1N A;  2ERR A;  2KXF A;  2Y0B B;  2JFK A;  4XPC A;  1RAE B;  3E01 A;  1RDR A;  4LF1 A;  2BEF A;  4JK1 A;  3IGV A;  4RJV A;  2G9O A;  4EBE A;  1K1Q A;  3TFJ A;  1RSC A;  3FZ2 A;  3E2E A;  4RMF A;  4KO0 A;  2GCF A;  1YBA A;  1UP1 A;  4U7U D;  3JSR A;  1V5I B;  2W01 A;  3M32 A;  5D0G A;  5DGA A;  2BKP A;  3D1H A;  4J7C A;  4F3Q A;  2QMU B;  4M94 A;  3IWN C;  2HEK A;  2WSE C;  5L1K A;  2EFV A;  1D0E A;  5E7O B;  4W4M A;  4CP5 A;  4DL3 A;  1OPZ A;  4R0E A;  3ENQ A;  4B3O A;  3HF5 A;  2V2V A;  5KFR A;  3CDU A;  1R9T C;  2P8T A;  1SKS A;  3N01 A;  5I42 A;  2NVQ K;  3SSQ A;  4RNN A;  4X4U A;  2IDL A;  4JI1 F;  4ZK7 M;  3QWP A;  2NVQ C;  3NGU A;  1FTR A;  4L72 B;  2HRT A;  1ZM2 A;  5LJ3 Y;  3DMJ B;  4AT1 B;  3IRX B;  1RBL A;  4ED3 A;  4A8O A;  3R1L A;  2VON A;  2VQE F;  4P2X A;  2IC3 A;  2OGU A;  3MFI A;  3GEI A;  3MMB A;  2R42 A;  3MMC A;  1YJT A;  1SV5 A;  3LP1 A;  3JSM B;  4ED2 A;  4Z7C A;  3JST A;  3W1Y C;  3LQV A;  3R2D J;  4KO0 B;  2V4R A;  5E0O A;  1S9F A;  1PO6 A;  1IR0 A;  4MH8 A;  4ZHR A;  3GDZ A;  2BR0 A;  5EUH A;  2HVH A;  4UST A;  4ED6 A;  3UFC X;  3GON A;  4TQR A;  5B7W A;  4KRW A;  3MEE A;  2XLK A;  2IIH A;  2ZJQ Q;  5A8W B;  1C1B B;  3FK4 A;  4Z7Y A;  4A3I K;  4I69 A;  5LMU F;  1K0T A;  4PUO A;  1N48 A;  2C1E B;  4CNY A;  5KFH A;  1VQO S;  3HSG A;  2HBQ B;  5IYB C;  1EQ0 A;  1VYA A;  6FDR A;  3CIZ A;  4C11 A;  1T05 B;  3J80 U;  5LSO A;  3SIP B;  4NCG B;  4ALZ A;  1LKZ A;  1X5P A;  1X5S A;  1REV B;  4LJZ A;  3NEK A;  1WHX A;  3D7S B;  1OMS A;  4IFY A;  2ILY A;  1L5U A;  1SC4 B;  2ROP A;  5E5N A;  4JI3 J;  3CCZ A;  3BO2 A;  3OTO F;  3RBX A;  2RQC A;  1Q5V A;  3DDN A;  2XBP A;  2CQD A;  3KLF B;  3R97 A;  2KKH A;  2ASD A;  2CZ9 A;  2BAC A;  2IM0 A;  3MHY A;  3Q8P B;  1KNZ A;  3TA0 A;  2OP5 A;  1FI4 A;  4PWU A;  1NDP A;  2K7J A;  1J6V A;  5GAD I;  1DCH A;  5H1S V;  2LLZ A;  5C3E C;  4PQA A;  2UUA J;  5C3E K;  3HZG A;  1S4F A;  2ZD1 A;  3IC1 A;  5IOQ A;  3LWM A;  3QFH A;  2BDP A;  3M3Y C;  2MZJ A;  4DR2 J;  1SB6 A;  4LFC J;  3OTE A;  3BS9 A;  2DH8 A;  1S6P A;  4JV1 A;  2FQT A;  3ZTO A;  1HL6 A;  3GMG A;  3OFG A;  3T1H F;  3CD7 A;  3QT6 A;  1TL5 A;  3EE3 A;  2MXY A;  1Y1W C;  2HQI A;  3HHL A;  2ZH1 A;  3OXL A;  2NSB A;  1MWY A;  2MDA A;  5C4X K;  1C0T B;  3WBZ A;  3VF0 B;  3GR1 A;  1E6Y B;  3CUN A;  1FXL A;  5FD1 A;  4A8K A;  2Y3P A;  3FQL A;  4DR5 F;  1BJT A;  4RUB A;  1RTH B;  3ICL A;  2NVX C;  3FRZ A;  1LW0 A;  4DV6 F;  5LM7 E;  1DZ5 A;  4QWD A;  3JYT B;  1J5E J;  4LRA A;  1GAO A;  5HVH A;  1RGV A;  5D0R A;  5F8M A;  3AB4 B;  3H5Y A;  2HWH A;  2GMH A;  5ETQ A;  2Z58 B;  2CXE A;  3F44 A;  3HVA A;  4HVZ A;  3JS9 A;  1TFY A;  3CDB A;  3QO9 B;  4OL8 A;  3MPY A;  2XTJ P;  3PJW A;  4DS5 A;  4C9D A;  1Y9O A;  5CYM A;  2PN6 A;  3HOY K;  2WVC A;  3R5J B;  1U0H A;  1PSD A;  2UUB J;  5E33 A;  1UZH A;  1S0M A;  5IOT A;  2XSJ B;  2MKC A;  3Q8Y A;  3R5B A;  4ZCM A;  4DFP A;  1U1R A;  2PEB A;  4RW8 B;  1FFW B;  1RA6 A;  1VMB A;  4B9N A;  4X4Q A;  6FD1 A;  2GHV C;  1FJ7 A;  4O4R A;  2JA8 C;  3D9B A;  1O51 A;  3IP0 A;  2UXB J;  2HHH J;  2JA8 K;  3EIC A;  5DGB A;  3OFH A;  3KKF A;  4ZLJ A;  4Y65 A;  3LOU A;  3NGR A;  5H9E J;  1O25 A;  4NEZ A;  2ASY A;  3L7O A;  1EAY C;  4OZ5 A;  1MRO B;  2GAG C;  3JAM Y;  4LBP A;  3GYG A;  3CO9 A;  2AEM A;  4A3F C;  1PJ6 A;  4KB4 A;  2QJ3 A;  2M70 A;  3LA0 A;  4C8O A;  1X4B A;  2Z57 B;  3DRP B;  2HZC A;  3T1A A;  3T02 A;  2ZBQ A;  2AT1 B;  2HBY B;  1N6Q A;  3N6M A;  4CT8 A;  5DDR C;  2VG6 B;  3ILJ A;  1UZD A;  4WJB A;  2YQ0 A;  4IFY B;  4OI1 A;  3BBC A;  2NVX K;  2DNZ A;  5AJ3 F;  4C3J K;  4HHU A;  4N77 A;  2JA7 A;  1VBK A;  4K4Z A;  4DPX A;  4X64 F;  1CJU B;  5ETR A;  2I2Y A;  1K44 A;  4C3M A;  4CLZ A;  5IYC C;  5EX0 A;  2RJZ A;  4CI0 B;  4XLN A;  5K8P A;  3V6K A;  1W26 A;  2E1C A;  4OFZ A;  2H4W B;  3D28 A;  4M1X A;  3EUN A;  2A6E A;  1V3R A;  3DI6 B;  3C8Y A;  3HCX A;  4HAC A;  1SL0 A;  1TWG A;  1X0F A;  3C6T B;  1XMQ J;  1WSR A;  3GIL A;  2WB1 D;  1JLA B;  4XIU A;  3HOV K;  1NHU A;  1I50 C;  2DXD A;  3AB2 B;  4KKO B;  4FKY A;  2CQ3 A;  1R9T K;  4X4N A;  1OSD A;  1JLG A;  2MGZ A;  4KAS A;  4J9U E;  3MCM A;  1QE1 B;  3Q8V A;  5D3G B;  3IG1 A;  4OJG A;  2NYI A;  1ZM3 A;  2BW7 A;  4PG6 A;  3DRP A;  4ED7 A;  4WWS A;  1R3N A;  2QTW A;  4X6A C;  4ZIW A;  3G6Y A;  3BGO P;  3S6E A;  2JA6 A;  1V3S A;  1SH2 A;  3R5C A;  3AJD A;  5BR8 F;  1AA1 B;  2Z30 B;  1HR0 J;  3LPX A;  4N41 A;  2QLJ B;  3O1L A;  3KHL A;  2PMZ L;  5IWA J;  1SIW B;  5LSR A;  2D7S A;  3W2W A;  1UMJ A;  1BQM A;  3OD2 A;  1I51 B;  3AQP A;  4YR3 A;  3HHL C;  2QLF B;  2ZDP A;  5HAT A;  2VG7 A;  2O01 C;  3GFY A;  2CKW A;  2CQ2 A;  1MU2 B;  2VBY A;  3AXK A;  2NUU G;  4WP8 A;  3B78 A;  2WSC C;  3NNH A;  4L3N A;  5EX3 A;  2P9C A;  1IBM J;  2YNF B;  1GX6 A;  4HH1 A;  4JB8 B;  3JAM U;  4DFJ A;  4KFB A;  4MTP A;  1WC1 A;  2X1B A;  4QQB A;  3W7B A;  1JX4 A;  4A3J K;  4TY9 A;  5SZT A;  4O3N A;  3GR0 A;  3TYT A;  3VVU A;  1I6J A;  4QW8 A;  3AH6 A;  1S1X A;  4LUB A;  1T7P A;  5IQQ A;  4JV0 A;  4C8Z A;  4NOH A;  3DRS A;  3SCK E;  5A8R A;  4RX6 A;  3TQ1 A;  1Q8L A;  1RJJ A;  4FF3 A;  2P5M A;  2FZG B;  2PC6 A;  5C2C A;  1DD5 A;  4X4V A;  1N32 J;  4G1Q B;  3ILL A;  3ZZP A;  2VD3 A;  2MHN A;  4ZDN A;  3MM7 B;  1WEL A;  1JJ4 A;  3OQ2 A;  1HNV A;  1HBO A;  2O1P A;  3R5G A;  1AZS A;  2K1R A;  3P6Y C;  5D4L A;  4FP9 A;  1S1T A;  1Q8I A;  4IOB A;  4JI8 J;  3BGU A;  5DG7 A;  1KOH A;  4JI8 F;  3J7A N;  1RT1 A;  3ITH A;  2Q3P A;  2E7V A;  3S15 C;  3CB4 A;  2W8L A;  4C0H A;  2QLB B;  2AKW B;  1DUR A;  2Z2Y B;  1H72 C;  5KFZ A;  1RAD B;  3OLB A;  3I9V 9;  1QD1 A;  3ZXW A;  2P8I A;  3HFV A;  4LRF A;  3KOA A;  1EP4 A;  4O4G B;  5J2N A;  2A18 A;  2ZVI A;  4DPO A;  2E44 A;  2R7S A;  3CCT A;  4B9T A;  2BJ1 A;  4N76 A;  2H48 B;  4G7H A;  1KQG B;  2V9W A;  2VU5 A;  3A1Y G;  4ZCI A;  3GYX B;  4KIA A;  2R7V A;  4BLG A;  2Y1I A;  1HI8 A;  1O29 A;  4BBS K;  3UD4 P;  4M5M A;  4TNO A;  1S7I A;  2R93 C;  2E5G A;  1SCJ B;  1RWN B;  2DY1 A;  3IG1 B;  3M8Y A;  4H4O B;  1I94 F;  3KLE B;  3T00 A;  4ID8 A;  2DD8 S;  4LF9 F;  1SBR A;  3NNA A;  1T9U A;  3GB0 A;  2R92 A;  3GFH A;  4ZLN A;  3Q2T C;  2ROG A;  4WTY A;  1KTQ A;  5EWG A;  1XJW B;  3OXG A;  5ETN A;  1SQF A;  3I31 A;  3R7N B;  5JXS A;  2CFX A;  1GMV A;  4DV3 J;  5K14 A;  2I6W A;  5IC6 B;  5KG0 A;  3HLU A;  1Y1W A;  4U8Y A;  3RW7 A;  3T19 A;  4PWW A;  3KK2 B;  5KAK A;  2R7Q A;  2E9Z A;  2FHM A;  4YR2 A;  1D9F A;  3DRY A;  2XYG B;  3TFI A;  2UP1 A;  1S49 A;  1Y1V K;  1RI7 A;  4V19 J;  4PAB A;  1VOM A;  3RRK A;  5F8J A;  5IS2 A;  3V4I B;  3C15 B;  3QWU A;  1KKH A;  3DLG A;  1J98 A;  2NR0 A;  4FXW A;  1N5S A;  2MZR A;  2VDH A;  4NXN F;  2BM1 A;  3MM7 A;  4O44 B;  4DBQ A;  2Y8Y A;  2HYI B;  2E1P A;  3OLA A;  5AXL A;  4XDC A;  3EVO A;  3KLE A;  2AGQ A;  3NAH A;  4WFX A;  1P6T A;  2HBZ B;  1M1G A;  2IBO A;  3QNW B;  4USH A;  3TJ8 A;  1IWA A;  1HBM A;  4RBV A;  4FS2 A;  5HJX A;  1PJ7 A;  4GTA A;  1CJU A;  3ITH B;  4BBY A;  2HND A;  1VC0 A;  4OX9 F;  1U1O A;  5GAE U;  2YX4 A;  4CH7 A;  3DOK A;  3T6B A;  1DQ8 A;  1FWK A;  5J1P A;  3HZE A;  5KT5 A;  3FVY A;  2R93 K;  4WCE Q;  5KFT A;  1TL3 B;  4X84 A;  3GTP K;  2XMW A;  1DHM A;  2CWX A;  2XY7 A;  1KD1 T;  1WEZ A;  2A0F B;  1F7V A;  2DNR A;  1S9E A;  5ETP A;  5T7L A;  5HMX A;  3JQM A;  3M05 A;  2D1C A;  1TWA K;  2FVQ A;  1FXD A;  4I0W A;  2A3J A;  3MXH P;  4DV5 J;  5GMD A;  2ZH3 A;  4MFB A;  1CJT B;  2KB2 A;  4ZCK A;  4UT4 A;  2KI2 A;  1CBK A;  4ZVO B;  2V2Z A;  1UJ4 A;  3BO3 A;  4X66 F;  2VC0 A;  1RBA A;  1S9G B;  3PTW A;  5K5M A;  4OZ2 A;  4FXD A;  1UA0 A;  4WPA A;  1S6P B;  1KVK A;  4LIW A;  1TL7 A;  1SL2 A;  3KG4 A;  2OPP B;  1SKR A;  5L1L A;  4J37 A;  5IV3 A;  1UCN A;  2K3I A;  3VAK A;  5F41 A;  3HVR A;  1S7H A;  3HOV C;  4IFV A;  2J8S A;  2ZHB A;  3T01 A;  2HAF A;  3I9Z A;  2B4O A;  1NKE A;  2ZJP Q;  2UUB F;  8ATC B;  3P8B B;  4DL0 C;  2FJX A;  2FVR A;  3GCX P;  2ZUA A;  1GMW D;  5C42 B;  1YSJ A;  3J7Y I;  4C11 B;  1Q8B A;  4I64 A;  4K4V A;  2VH7 A;  4JI7 F;  3MD3 A;  5RUB A;  1N5Y B;  3W5Y A;  3DNC A;  1UA1 A;  1TWF C;  4RUA A;  4CO5 A;  5CD4 A;  3KHG A;  1NK6 A;  3AH5 A;  1FFS B;  2D9P A;  2V6A A;  4G6V B;  2WOM B;  1J5E F;  4YFU A;  2W7P A;  3HM9 A;  3T5K A;  3GV7 B;  3FBF A;  1J6X A;  2VOD A;  4GTF A;  1I6V A;  3NUH A;  1VQ8 S;  3MMA B;  1VQY A;  4PRF A;  3KJN B;  3FOE A;  4ZVE A;  2VIH A;  1R8A A;  4LF9 J;  2YWF A;  4R8U A;  3P96 A;  1LOU A;  3VHQ A;  4K2X A;  2DGQ A;  4NYZ A;  5JFE A;  1KWM A;  4RO0 A;  3CQZ C;  1S76 D;  4PG4 A;  1WKL A;  1OWX A;  2EKY A;  3TW0 A;  5D6G A;  2QZ8 A;  2R2T A;  4QPX A;  1Q1K A;  2R92 K;  1SKW A;  2I5J A;  2QYG A;  4QIW D;  3KHR A;  4P72 A;  4H4O A;  2FLP A;  1K47 A;  2YPY A;  2MQO A;  3TP2 A;  4B3T F;  4Y0F A;  4F25 A;  4ZKA A;  2HHV A;  4Q0B A;  4C3I K;  1TKZ B;  3BYP A;  2QA2 A;  2AJF E;  2FC8 A;  3B4D A;  2ZWO A;  2WON B;  3R6L B;  3RRH A;  3EWG A;  5ETM A;  4M5D B;  1RWX B;  4DUZ F;  4B9U A;  4QYZ K;  4GKK J;  3HOX C;  2NVT K;  4J5O A;  3VAJ A;  3MTK A;  3QSY B;  3W63 A;  3ZTS A;  4BC9 A;  5B0G A;  5CYQ B;  3DOM B;  3EXY A;  2MY7 A;  5T14 A;  1WQH A;  1KS2 A;  3DLH A;  1R89 A;  3I32 A;  2Y1L B;  4LRB A;  3K57 A;  5LSL A;  3UNY A;  2R2U A;  1P1L A;  1MNE A;  4ZH4 A;  4DSK A;  2OPQ A;  4ZVH A;  1XR5 A;  2AEF A;  1DTT B;  2BJ8 A;  3C16 A;  3HT0 A;  4X65 J;  3S1R C;  4F4A A;  4ECT A;  3TJ9 A;  3PW7 A;  1HBN B;  1LWE A;  1UWA A;  1X5O A;  1JOE A;  2YKM B;  5LOQ A;  2HZA A;  4JI4 F;  1N8R T;  3MPW A;  2E2H A;  3F41 A;  2E1R A;  4IDK B;  3TAN A;  3D4J A;  2W2O P;  2GVD A;  2Q1L A;  2V8P A;  3SDE A;  1KFS A;  2MMY A;  2J6T A;  4A3L K;  2A2C A;  2DB1 A;  1VRU A;  2BJE A;  1FDD A;  3HT3 A;  4JV5 J;  5F3T A;  3IAM 9;  3T9Z A;  1CPZ A;  1LV5 A;  3QGI A;  4RBT A;  1S9G A;  4Z2X A;  4HKQ A;  1VJW A;  4A3C C;  1NXI A;  4BKW A;  2KO1 A;  3TQE A;  1TV6 B;  1RE1 B;  1M5H A;  4IKA A;  5EGE A;  1LW2 A;  2UU9 J;  2B51 A;  4DG1 A;  3B54 A;  2V4J A;  1TR0 A;  1QAJ A;  4L6V 3;  4RW6 A;  5JUM A;  1RT6 B;  3MFH A;  1F3V A;  1HHS A;  4K59 A;  5IT9 Y;  1TKX A;  3HSJ A;  3R3T A;  1HLW A;  2VQE J;  3TEG A;  4DSL A;  2DNL A;  1N0U A;  1SH0 A;  1DRZ A;  1B7F A;  3J80 Y;  3PYG A;  4ZJO A;  1S59 A;  3I55 S;  3Q8Q B;  2ZH4 A;  3RW6 A;  2I5J B;  1G6B A;  2YWK A;  3W66 A;  5M2R A;  5GAG I;  3H2U B;  3P49 B;  5HQM A;  3OR2 B;  5CXT A;  4AD6 A;  1TK8 A;  1S0V A;  3M30 A;  5I3Q A;  2EVZ A;  3ZZZ A;  1QVG R;  2HMI B;  5KFE A;  1YKW A;  3EZ5 A;  3NOC A;  3NCR A;  4X4T A;  4MK8 A;  4FM9 A;  4KSE B;  2P6S A;  3RUB L;  1FX4 A;  2EWH A;  1HHQ A;  2UUW A;  1U02 A;  3VAF A;  3CXC R;  3L4B C;  4OX8 A;  2B8P A;  4DV1 F;  2GA7 A;  4YR0 A;  1B7Y B;  1WCM A;  1WG4 A;  2KWA A;  3POT B;  3DOL A;  3D6M B;  3QAT A;  2HWI A;  2LQB A;  1C1C A;  4KE5 A;  4K4X A;  3T3F A;  2UUC J;  2LDI A;  4OV1 A;  1ZXO A;  5AJ3 J;  3WX8 A;  5CHC B;  2RT3 A;  3U1M A;  5T41 A;  3NCP A;  3ZNU A;  2COL A;  2VFV A;  1TL7 B;  2R7Z K;  3PAC A;  1TKZ A;  1WTF A;  4A3C K;  4A48 A;  1DBD A;  2J7U A;  2C3U A;  2O5I A;  4RW9 B;  1HR0 F;  3K59 A;  3CTR A;  3D66 A;  2GJ2 A;  3GTK C;  4WXW A;  2HK2 A;  2BYC A;  2JC0 A;  2CVE A;  3RB3 A;  2NYH A;  4KGZ B;  3TRG A;  3MUM P;  3RZO C;  3W5X A;  1U49 A;  1TWC A;  2DNQ A;  2XO7 A;  3V6D A;  2RH3 A;  1IQ0 A;  2SXL A;  2C28 A;  1BLU A;  3W9I A;  4C2M A;  3GII A;  1RAH B;  3FSI A;  1QSY A;  4ZPB A;  2U2F A;  4RWW A;  1UVL A;  1PAU B;  2B9Y A;  3AOD A;  4WFA Q;  3FOF A;  1WQF A;  3EGZ A;  2VG5 B;  1IKX B;  3JB9 k;  1ZET A;  1JLE A;  2PDA A;  4PCQ A;  2KL8 A;  1IM6 A;  2XLJ A;  4Y6I A;  4C97 A;  4PKD B;  1JB0 C;  1B99 A;  4OZ3 A;  2RVJ A;  3FFI B;  2FY8 A;  2D9O A;  1XZQ B;  4AYB D;  1YBU A;  2OI2 A;  3LAJ A;  1U24 A;  1XMO J;  4KN7 A;  2OHD A;  3GFZ A;  4ZP6 A;  3CCU S;  2FQQ B;  2MLY A;  3PDN A;  2HGM A;  1MWQ A;  1OPI A;  4X4P A;  3HOW K;  4XK8 C;  3QJP A;  3DDI A;  3V5R A;  2DXE A;  1RAC B;  5KG5 A;  4NLD A;  4X66 J;  4JI5 F;  1TWC K;  1BHN A;  1O8B A;  3IXQ A;  4OZL A;  3VAH A;  2N7C A;  2EK1 A;  5AE1 A;  1FE4 A;  2DGV A;  4LQ3 A;  1IQT A;  1TKT B;  4F4X A;  4X64 J;  4F4W A;  1HMV A;  4HI2 A;  5KFP A;  1GE9 A;  4ES3 A;  2IJR A;  4WKY A;  1DCO A;  4XPE A;  3PHE A;  1U1M A;  4PXE A;  4DUZ J;  4HDH A;  5CZV A;  2XCA A;  3L7P A;  5J2M A;  5CJ9 A;  3BJY A;  2ZDO A;  3K8W A;  5LL6 d;  4KGK A;  3H0G K;  3O2I A;  3HOU K;  1GFW B;  1WQG A;  3HKW A;  4N5S A;  2KHC A;  1YJR A;  3F56 A;  3V4I A;  4UW2 A;  3L3C A;  3N3Y A;  3DLG B;  3TAQ A;  4OX9 J;  2QA1 A;  2XGQ A;  3N5B A;  3C46 A;  1SJ4 P;  3MMC B;  2W4C A;  2IMW P;  4DR6 F;  4U8V A;  1U1K A;  1BGW A;  2QLX A;  1FNM A;  2VFU A;  1VGY A;  3DFE A;  1S5Z A;  3AD8 C;  1X4C A;  4DV4 J;  4DV0 J;  2C2N A;  3BDP A;  5E41 A;  1X9S A;  2CQ4 A;  5B08 A;  2CJ9 A;  2LVW A;  2XMA A;  3GV5 B;  3KNA A;  1MW7 A;  5HN0 A;  3EGV A;  4C8M A;  4ENO A;  3CGI A;  2DGU A;  1H38 A;  3H8Y A;  1W2B R;  1KQS R;  3RRG A;  4P6Q A;  5THW A;  4DOZ A;  4NL5 A;  4F4Y A;  2D69 A;  4DPY A;  1LFW A;  1K1S A;  3WIU A;  1AXQ A;  1WF1 A;  4OYI A;  5F9L A;  4OIR A;  2V63 A;  4LFA F;  2V2Q A;  4AND A;  1JLB A;  2P6T A;  4BLA A;  4LLG A;  2IYG A;  3V6H A;  1CEZ A;  3NKY A;  2O5J A;  2IRX A;  2WVB A;  5E3R A;  3K89 A;  3PO3 K;  4C4W A;  2OPP A;  1B4S A;  3QZ7 A;  3B82 A;  2OTJ S;  4CLU A;  1FKO A;  3KLG A;  5IP7 K;  1RT2 A;  4M95 A;  1XZP B;  1W2I A;  4GKK F;  3EM1 A;  2NXC A;  3A4T A;  5KT7 A;  2AJQ A;  4ANC A;  2JA6 K;  3I0R A;  2IRU A;  2KRR A;  4RW6 B;  4WU2 A;  4G7Z A;  2NXU A;  1VK3 A;  2LMI A;  1RK8 A;  4PQU A;  1VHI A;  4YDX A;  2ZC3 A;  1NJY A;  1N5Y A;  1Q53 A;  3M8Z A;  1RQ0 A;  4F50 A;  1CC8 A;  3VZH A;  5C4J K;  3UI3 A;  4GTE A;  4EBD A;  2H65 B;  5D3G A;  2RDD A;  2AJ4 A;  3W9J A;  4AL6 A;  1FER A;  2O5D A;  1ZVU A;  4BXX C;  1BWE A;  2EKN A;  1K73 T;  4QJV A;  2A6H A;  3T1H J;  2JLG A;  4MIW A;  4P2F A;  2F65 A;  2ZUF A;  3GU0 A;  4LFC F;  4C8Y A;  3N6N A;  3WC0 A;  2VPZ B;  4Y3C A;  3GTM A;  3FRY A;  4Q4Z A;  3AOC A;  3S1N C;  4IOC Q;  1U26 A;  4OLP A;  3LAK A;  3FBE A;  4NXM J;  1XEZ A;  5D15 A;  3W2W B;  1UEV A;  4QIG A;  2W4D A;  3GPA A;  4L76 A;  4ICL B;  3R5D A;  2CPF A;  4WBF A;  2CQ1 A;  4NYO A;  2OIH A;  1BQN B;  1VIS A;  3UQS A;  3SMZ A;  3OPF A;  5KFG A;  4IUF A;  3DN9 A;  3EYZ A;  4M5H A;  3A8J A;  3KUG A;  3C3L A;  3MEG B;  4LF2 A;  3CUL A;  4ES1 A;  5B0E A;  2GML A;  2KYX A;  2XWY A;  4EGL A;  4P71 A;  3PX4 A;  4GC6 A;  1NJX A;  2CQB A;  2XS2 A;  4HT5 A;  3PEH A;  1LXN A;  3ZTP A;  4IRD A;  4DUY F;  3PJ9 A;  2J6U A;  2D3Z A;  2DCL A;  1KLN A;  2CNN B;  5CCL A;  3D3C J;  4UOF A;  2YY3 A;  1OYD A;  2CPD A;  2VFT A;  3QRQ A;  3CCS S;  3BSO A;  5DZ6 A;  2CJA A;  2F9D A;  2OAU A;  4B3O B;  5MLC V;  1NU4 A;  3ETO A;  4CZC A;  1K8A T;  5IFM A;  1VQL S;  3QIP B;  4L73 A;  3ETM A;  1A6L A;  2V9K A;  3UDC A;  4XO0 A;  5A76 A;  5CYQ A;  1RT7 A;  4O3R A;  2V68 A;  1ZYR A;  1O0P A;  1FEE A;  3Q8R B;  3DU5 A;  1SJ3 P;  4QR0 A;  1Q4R A;  2ZH8 A;  3M1V A;  1U1Q A;  1S6O A;  1WJ9 A;  4WYL A;  4CDI A;  1HQM A;  5DO2 A;  3AA8 A;  3M9N B;  2R7R A;  2IBK A;  2IFX A;  2ALY B;  3G6V A;  1E6Y A;  1RHQ B;  4KM8 A;  3IGN A;  2E5L F;  1YK9 A;  3H25 A;  4OV6 A;  1O26 A;  4M1K A;  4WKR A;  5E3C A;  1KLM B;  4DR4 J;  2DBB A;  5HQ8 A;  7AT1 B;  2G13 A;  4QZV B;  3S2D K;  1YQH A;  1T11 A;  5GAH I;  4EZ9 A;  1IBA A;  3KLI B;  4OX6 A;  4RWX A;  2GW8 A;  3LUY A;  3S1Q C;  3A3P B;  4PYA A;  4JYA F;  3OT9 A;  3MPV A;  4ZIT A;  4A47 A;  4DCJ B;  5ITH A;  1NPK A;  2C3M A;  3MEC A;  4UOH A;  2D3O 1;  4Q0B B;  2JFD A;  4X4R A;  4YG2 A;  1X4H A;  1MMN A;  1LW2 B;  1QUV A;  3S16 K;  5G4D A;  1RT1 B;  3ZZT A;  1T8E A;  3OVB A;  4OHY A;  2F40 A;  4A3G C;  3RU0 A;  3HHN B;  3FKB A;  3UD5 A;  1MN7 A;  1U0H B;  4ECX A;  3RZA A;  3CCW A;  3RYL A;  2WAQ L;  1SKU B;  1OO0 B;  1R9T A;  2DHH A;  3M2U B;  4NEY A;  3DLK A;  4A8W A;  2DNK A;  4KM9 A;  5TMC A;  2RB7 A;  1EX8 A;  2KT2 A;  2FQO A;  2ADB A;  3HOU C;  2EFP A;  5HMZ A;  2NPF A;  1S1V B;  4TKT A;  1IXK A;  4CTA B;  3MCS A;  2YNI B;  5A8K B;  2UU9 F;  2Q79 A;  2AYG A;  2AZ3 A;  1QAI A;  2HRY A;  3GG1 A;  3Q86 A;  2KFN A;  2KN4 A;  5J2P A;  5FJ8 K;  1PYS B;  3A3N B;  1REG X;  4HHH A;  1UWB B;  2W9B A;  3H5U A;  4DDF A;  2R7X A;  2B4V A;  2DGX A;  3UPF A;  3I0S A;  4CLP A;  1WCM C;  2C3Y A;  4NLG A;  2CAJ A;  2KFY A;  1M1H A;  2I0X A;  3PXG a;  2AYM A;  2ZH9 A;  4RUC A;  2Z56 B;  2KXH A;  3OUY A;  1SJQ A;  3FNN A;  1N34 J;  2HVZ A;  3TVK A;  4F4K A;  3G6E S;  3KJV A;  4RNO A;  2AZ1 A;  3OR2 A;  3HUL A;  1CJK A;  2KT5 A;  4NRT A;  4GMK A;  2P2C B;  5HL7 Q;  1I6H K;  3PW4 A;  5KFY A;  5IXU A;  5F8I A;  3K5P A;  4IQX A;  3PYF A;  2E1A A;  4LRC A;  4LBH A;  1HI0 P;  1ULR A;  4OYP A;  1DLO A;  1HYS B;  3PY8 A;  2KT3 A;  1VBX A;  1NH7 A;  1EQR A;  2YX1 A;  1VQK S;  4XLP A;  3V6D B;  2J9E A;  4QIV A;  4GKJ F;  5K8O A;  4DL7 A;  3T6J A;  2DNN A;  5HL8 A;  3VGS A;  4YHH F;  3OSP A;  3LPE A;  1M0S A;  3LAM A;  3GTG C;  3TEH B;  4OHW A;  4P7T A;  1EET A;  2YNI A;  1FDB A;  2FLN A;  4QJV B;  4LF6 J;  2NVY C;  3RAM A;  2H5J B;  3QJJ A;  2AIR B;  2NVY K;  3NBP B;  1LFP A;  2XUL A;  4MKB A;  5FII A;  4DR5 J;  4QIW L;  4MEY A;  3FUY A;  1XBW A;  3QT5 A;  2M5Y A;  3TAM A;  2B4P A;  1HPZ A;  4PR6 A;  3D67 A;  1S1U A;  3RAX A;  1F0X A;  5KG4 A;  3LWL A;  2N4D A;  4B3M F;  4RW4 B;  2I8E A;  5L1J A;  3BH6 B;  4EBC A;  4ZVT B;  1R0A A;  1YNN A;  3G8Q A;  2BV3 A;  4D3G A;  2GV1 A;  2E29 A;  3QBC A;  3L9Z A;  2QFJ A;  3RZD C;  5J2N B;  2UXD F;  1OY9 A;  1UET A;  2XC9 A;  1BWV A;  1FTC A;  1HYS A;  1WC4 A;  5GMK a;  4I6Y A;  3BN7 A;  2UVV A;  4BY1 C;  3K5M A;  4OQJ A;  2NVY A;  3CJS A;  3IRX A;  2V2K A;  2HWT A;  2F9J A;  2ZEJ A;  3IBW A;  4ECV A;  2EPI A;  3CF5 Q;  4UUW A;  3K58 A;  2ABY A;  1HNX F;  3GV8 B;  2OO4 A;  3MR3 A;  1QE1 A;  2Q6C A;  3OPK A;  2UUA F;  2PSZ A;  3FCW A;  1I3O B;  3A8K A;  4MKY A;  2NPI A;  1U8W A;  1FHT A;  3V81 B;  1RAB B;  1VLY A;  4ZPC A;  5MAO A;  2JSX A;  2ROE A;  3ZTR A;  3UNG C;  4FS1 A;  1JXL A;  3HO1 A;  1VLO A;  4ID5 A;  1YIT S;  3GTQ C;  4I67 A;  4JI7 J;  3MM5 A;  4ES2 A;  5C25 A;  2GAH C;  2ZM6 F;  4P10 A;  3OTO J;  3GTG K;  5A8W A;  2QYC A;  2BX6 A;  4LF5 J;  4ELU A;  2GIQ A;  2ADC A;  3V4G A;  4LT6 A;  2RE1 A;  1VIX A;  3MCN A;  3O3L A;  2HLU A;  4F0H A;  2VL1 A;  4I7F A;  4F0M A;  1X9W A;  2HS0 A;  2CPX A;  2YU9 A;  2DH7 A;  1A7G E;  2HQF A;  3TVZ A;  1HNW J;  1Y5I B;  4DPU A;  4KAI A;  1RIS A;  1F9N A;  2YXL A;  5LMU J;  2VFR A;  2B43 A;  2CJX B;  1YDL A;  1WHW A;  1XWL A;  2R8I A;  1M5K C;  3EDQ B;  1UVK A;  1DLO B;  2XMU A;  3VZI A;  4LR9 A;  2BJD A;  2MQP A;  5E68 A;  2F8M A;  2VAS A;  3S15 K;  1YJU A;  4AXI A;  2CQP A;  4DV6 J;  4BY1 K;  1F60 B;  4XSZ A;  2W7V A;  3GTO C;  3H2L A;  2HFN A;  3S1R K;  3HFK A;  1VJQ A;  3MEE B;  4RPF A;  4P74 A;  2A68 A;  3LTO A;  1ZBT A;  4PUO B;  4ELV A;  1MML A;  2XZD B;  2LYV A;  1NK5 A;  3GJR B;  3TAM B;  1B4B A;  1X8D A;  1C4C A;  2HHH F;  2PFF B;  3KG1 A;  2DT9 A;  4R5P B;  3NG8 A;  2EBB A;  1H2T Z;  2JDJ A;  3SSS A;  5K9F A;  4N7T A;  2NXE A;  5D0H A;  4A3I C;  3U1L A;  3MED A;  1H2V Z;  2QL5 B;  4M5D A;  4KFB B;  3ZZR A;  2XCR B;  1HQE B;  1YZ7 A;  4IQM A;  1P8G A;  2R8K A;  1FRM A;  1N88 A;  5KFD A;  5C5J A;  2GVZ A;  4HI1 A;  4MEX A;  2MZ1 A;  3HMJ G;  5E3A A;  4KHR A;  3NMR A;  4X62 J;  2R7O A;  2GMJ A;  1RUS A;  3M8R A;  2HHP A;  2MST A;  4NLR A;  4QPT A;  1UWB A;  3DRR B;  3VCD A;  4RNH A;  1YBT A;  4ZA1 A;  4A3E C;  1RWM B;  4HTJ A;  5HVF A;  1X5T A;  1R27 B;  4DV3 F;  5DQI A;  2ZOF A;  5KFQ A;  3BB5 A;  5M3M K;  1SFO A;  3HOY C;  2AU0 A;  1F9E B;  4N8N A;  4TU9 A;  3M8Q B;  1ZPW X;  2Y8W A;  1X4E A;  3DYA B;  2C3O A;  4JYA J;  3U7J A;  2ZD1 B;  2XQC A;  4O3Q A;  3MR7 A;  4Y28 C;  2FB0 A;  4ECW A;  3BN4 A;  4ZN3 A;  2DEJ A;  3MPD A;  3GSI A;  2CIM A;  3QLH A;  4IR1 A;  4O3S A;  2ILZ A;  3U02 A;  3RG6 A;  2RH6 A;  1S6Q B;  5ADZ A;  3K0J A;  1U0S A;  3UW1 A;  3OL8 A;  3N5F A;  5CH7 B;  4XCH A;  2H3E B;  2BAN A;  2Q6B A;  1A0O B;  3Q0A A;  2L9D A;  1C1C B;  2GIR A;  1BUX A;  3OL7 A;  1UVN A;  3BO4 A;  1WOR A;  1KVJ A;  2DR8 A;  3CJ2 A;  1FKP A;  4YB7 A;  4U95 A;  3GTP C;  3BPD A;  2ALZ A;  5EWF A;  2FYX A;  1DY3 A;  2MJU A;  4ZOS A;  1R6V A;  1J27 A;  2C2D A;  2DRA A;  3HVT B;  1GH8 A;  9ATC B;  2VUM K;  2F5G A;  2CPZ A;  4DZ6 A;  3MF5 A;  4A8F A;  5C25 B;  3FKI A;  1SJR A;  2HRU A;  3FBB A;  1TFW A;  5K14 B;  4RU9 A;  4Q5V A;  3G4C A;  3OJU A;  2WB4 A;  3T5L A;  2OPS B;  2JA5 A;  4G1P A;  4CO0 A;  4DL4 A;  3N4W A;  4JI3 F;  4U96 A;  2W9A A;  1HNW F;  2YU9 C;  5B0A A;  1ZYQ A;  3KUE A;  1RHU B;  4FZB A;  4JI4 J;  2YKQ A;  1B0T A;  1N36 J;  1KVI A;  1K83 C;  4OIN A;  2YKO A;  3ILO A;  4Y00 A;  2OML A;  5KT4 A;  4ZJQ A;  3T5J A;  2DYA A;  2XGP A;  1LK7 A;  5BJR A;  4X65 F;  4GTD A;  1UFK A;  4L3K A;  3DOL B;  3BBB A;  5ETK A;  4FPR A;  4ED0 A;  4CLW A;  2IY5 B;  1Q5Y A;  4ID5 B;  3R1H A;  2GSN A;  2OKQ A;  3H98 A;  4CRJ A;  3PW0 A;  1NKC A;  1AFI A;  1ZBS A;  2CNL B;  2KZZ A;  4N8O A;  3TWZ A;  4LFA J;  2ASL A;  4Y2I A;  1ITP A;  4CO4 A;  3H7H B;  1S1V A;  2GVD B;  1T94 A;  4ILR A;  4CLF A;  2KXN B;  5IWA F;  2H5I B;  4OYA A;  2JC1 A;  3FHZ A;  1T02 A;  2ZJR Q;  1BY9 A;  2DR7 A;  3OUY B;  2HG4 A;  5HRO B;  4WIQ A;  3DGP A;  4B3T J;  1VRT A;  4JI6 F;  2BKN A;  3KLH A;  2DR5 A;  2R92 C;  1ZZF A;  4B08 A;  1RWK B;  2ZOG A;  3I4H X;  2B7C B;  2GGP B;  4ZVF A;  1SV5 B;  4DN9 A;  3THT A;  1WG5 A;  2HHW A;  2RRN A;  3BKT A;  1MSW D;  3BM7 A;  3NOG A;  4EYI B;  1WF0 A;  4URS A;  2C2K B;  2DNM A;  2YU9 K;  2M88 A;  1QJH A;  2KHD A;  3KLF A;  3DDK A;  1S57 A;  4KGM A;  1RHR B;  4OIP A;  4K2J A;  2RNE A;  1B3T A;  4BBR C;  4FBT A;  2DHG A;  4F67 A;  3EDR B;  1ICE B;  3OV7 A;  1N5T A;  5KOX A;  4OI3 A;  3UE2 A;  2H51 B;  3QLH B;  1YI2 S;  2KFZ A;  4ATN A;  4FPI A;  1TTH B;  1KP6 A;  2LEC A;  2VQF F;  3GTG A;  3NS7 B;  4YHH J;  2ATC B;  2O67 A;  1MLA A;  3I5C A;  2HNY A;  3NWG A;  1ZM4 A;  2PI4 A;  1TWF K;  3IS9 A;  3CJ8 A;  2EFO A;  5IM0 B;  3LGH A;  2HNZ B;  1XXA A;  3MAH A;  1XMO F;  4LF8 F;  4PG8 A;  2F7V A;  3VAI A;  3F0N A;  3GZ7 A;  1KQ4 A;  1RAO A;  3A3O B;  4Q43 A;  4I56 A;  3T5H A;  2RQM A;  3HI9 A;  4USU A;  3QGH A;  1FKP B;  2CQI A;  4C45 A;  4ETZ A;  4IR9 A;  2KZM A;  1WD6 A;  3KMS A;  4J9P A;  5B09 A;  3Q24 A;  4K0K J;  3M8P A;  4U9R A;  9RUB A;  1UTA A;  5JVH Q;  4OZJ A;  4DV2 J;  1RAF B;  1IM4 A;  3MMA A;  3PO2 K;  2AWZ A;  5M5W K;  2C2E A;  4IRC A;  2N3O A;  2ZZT A;  2HIQ A;  1WOS A;  3IBC B;  3RBZ A;  3VA7 A;  2WVF A;  4K4U A;  4DL5 A;  4WP9 A;  5A8K A;  1F2H A;  3Q22 A;  5C4J C;  3E01 B;  4TU8 A;  2ZH2 A;  2DHS A;  1QY7 A;  3FC9 A;  2EG2 A;  1X4A A;  4HTI A;  2M52 A;  2GS8 A;  3BUE A;  2XNQ A;  4C3H C;  2K7K A;  4J9K A;  2X7I A;  1EI6 A;  1HNZ J;  2UVW A;  2CUY A;  3QQC D;  4W98 A;  1HAR A;  3W8G A;  4Z37 A;  5HLF B;  3B8H A;  2QV6 A;  3C6T A;  3HVT A;  4YY3 J;  4N56 A;  3SDE B;  4FN5 A;  2A69 A;  1RHM B;  2D6F C;  4B3R F;  1DJ0 A;  4LFB F;  1JLE B;  4ZCL A;  1Y0H A;  1Y1W K;  3IR7 B;  1U4B A;  4Y7N C;  4Y2A A;  4A8Q A;  1X7V A;  2F8E X;  4QCL A;  4Y52 K;  2QFI A;  3S1T A;  3U27 A;  1VGX A;  4ANE A;  2QIF A;  5F8N A;  4B02 A;  3I4M K;  4PWD A;  4QW9 A;  3RGI A;  1FX2 A;  4OIX A;  3JXO A;  4LSL A;  1Z1Z A;  5H9F K;  3P4U B;  2WBM A;  1HBO B;  2VJU A;  4LSZ B;  3ZO7 A;  1HWJ A;  4NXN J;  2YKN A;  4H4K A;  4ILM A;  1UVM A;  3KHH A;  4B9L A;  3P3D A;  4DR4 F;  1APS A;  2C2Z B;  3DLL Q;  4NCB A;  3SSR A;  2NXJ A;  3DM2 A;  5KG1 A;  4OHZ A;  3D2W A;  2ASJ A;  4MK9 A;  5HP1 B;  4F0K A;  1NJI T;  4CH0 S;  4BBS C;  1J2V A;  1OQ3 A;  2DY9 A;  1HBU B;  4JV2 A;  1RT4 A;  3N9U C;  3BP8 C;  3LAL A;  3GTL C;  1OSC A;  1Z4U A;  4UZC A;  4AE5 A;  2BQR A;  2PHC B;  2KJV A;  3CC4 S;  3BZQ A;  1T03 A;  2J0S D;  3OJS A;  4K4T A;  2W25 A;  4O3P A;  3CD6 S;  2HFU A;  1YJN S;  2XO6 A;  4USW A;  1KTV A;  1I3Q K;  4G7O A;  2A6O A;  2ZC4 A;  5BYQ A;  5HRO A;  2QL9 B;  1LW0 B;  1WCM K;  2EBG A;  2BJ3 A;  1IJF B;  2L3M A;  1OIA A;  4KQZ A;  5C2G A;  3GJT B;  2XMT A;  1YZ6 A;  2J9C A;  4BHQ A; 
#chains in the Genus database with same CATH homology
 1VLO A;  4PAA A;  1PJ5 A;  3GSI A;  3GEE A;  3TFH A;  3GEH A;  1VRQ C;  1YX2 A;  2GAH C;  3AD9 C;  1WSV A;  4P9S A;  3TFI A;  3GIR A;  3AD8 C;  1XZQ A;  3TFJ A;  1PJ7 A;  1XZQ B;  3A8I A;  3GEI A;  5L46 A;  1XZP B;  3AD7 C;  3ADA C;  4PAB A;  1WOR A;  2GAG C;  1WSR A;  1WOO A;  1XZP A;  3A8K A;  1X31 C;  1V5V A;  1WOS A;  1WOP A;  3TTG A;  3A8J A;  1PJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...