1X31C

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
195
structure length
195
Chain Sequence
b'QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sarcosine oxidase alpha subunit
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
total genus 51
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1x31C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1x31C01
1PJ5A 3GIRA 4P9SA 3A8KA 3GEIA 3AD9C 1VRQC 3TFHA 3AD7C 3TFJA 1VLOA 1V5VA 1WOSA 1WOOA 1XZPA 3TTGA 2GAHC 3A8IA 1XZPB 4PABA 3AD8C 3GEHA 2GAGC 3ADAC 1WSRA 3GSIA 1PJ7A 1X31C 1WORA 1XZQA 1WOPA 3TFIA 1XZQB 5L46A 3GEEA 4PAAA 1PJ6A 1YX2A 1WSVA 3A8JA
chains in the Genus database with same CATH superfamily
1YG0A 2WW8A 3MAAB 3CAGA 5IV4A 4PG6A 5C42A 3ZFVA 4YDDB 2W7OA 2IYIA 1HQEA 2G2ZA 1ZM9A 1GT8A 1Q86T 4CO3A 4OQJA 3PR5B 2V8GA 2VKRA 2E5GA 3QMQA 3IA0A 1T9XA 5HVFA 1JVIA 2GO9A 4LF6J 3TUZC 3HT0A 3VA7A 1HL6A 2UUWA 4YFUA 1XPPA 4O0IA 1YCLA 2XHCA 4DL2A 2PEBA 1IWGA 3GTJK 3SQOP 5BR8F 2RS2A 4GVBA 5LJ3Y 2FQQB 1S9FA 1PBAA 4A3CK 2HZCA 3UR0A 2KFNA 1VRUA 2IMOA 2DNRA 4GC7A 3PY8A 4M95A 3TJAA 4CZCA 4DV4J 2GQQA 1KD1T 2NVYC 3L3CA 4ANEA 5B0AA 3V81A 1Q4RA 3LGMA 5DETA 3PW7A 2MKYA 5L1LA 1U26A 3M6WA 2J5AA 1KS2A 4C2MA 3N3YA 3UN3A 2AIRB 1WKJA 3M8WA 2PMHA 3BZQA 3R6GB 1FDAA 3TA0A 2AYEA 3S0XA 1H3DA 4I67A 1KKHA 4J9KA 5J2PA 4I2QB 5M3MK 1FX4A 2ZH6A 3CIMA 3PX4A 2OD6A 2ZJQQ 3RZOC 3TA1A 4B3RJ 4P5AA 1VYAA 5H1SV 4WE1B 3T6JA 4U9RA 5DQIA 2JOQA 4XAKA 4Z37A 4WFYA 5C3EC 3ERED 2HBRB 1X4BA 1FK9B 2V6UA 4ZP6A 3UD3P 3C16B 1TL1B 2GNKA 5AE3A 2C2OB 3I6PA 3AOAA 2OIHA 4AQYF 1S1WB 4O44B 2K1RA 1RT5B 2VB6A 3GTYX 3PACA 3N28A 1RWMB 1B7YB 3MMBB 5ETMA 2FGOA 1X60A 3ICLA 4I56A 4ZCIA 5MLCV 3UPFA 1Q8BA 3GSIA 1ROFA 1X5OA 2H5EA 3ENAA 4G7HA 4J9LA 4OL8A 4A3MC 4RKUC 1NEEA 2AF6A 4I6WA 4P75A 3M6VA 2F5GA 2OHDA 2J8SA 5AXKA 4XK8C 3CD0A 3T1HF 3VTIA 1NLKL 4ZJOA 3HO1A 1QE1A 1S5ZA 3GCWP 1YVFA 2XHWA 3CJTA 1VJQA 2HHVA 1FDDA 2XEXA 1D9DA 2MKHA 4X66F 3CIZA 1SL1A 1LWEA 3OTOJ 1UJ6A 3DLBA 3BF4A 2R7UA 5J2MA 3ILOA 3PJWA 5F8IA 2KG1A 1XR6A 9RUBA 4C0OC 2EBGA 2CJKA 2GQ2A 4A8KA 2XULA 3HT3A 1S9EA 2LVWA 1N56A 4PPDA 3UDEA 1WEZA 4LMZA 2ASLA 2MSTA 1A9NB 2O5DA 4NLUA 4U8YA 3QJLA 3L95X 4YB5A 5E33A 1YRXA 2M88A 2NVQK 2CJXB 1CPZA 2XI3A 3OUYB 1SKWA 3NMRA 4EWTA 4C8MA 5KFRA 3CXCR 3DXBA 4JV5J 4DR2F 2VFSA 5K8OA 3T9ZA 1XMQJ 1HA1A 2GW8A 2V4RA 1HKAA 3EVMA 2E9ZA 3JSYA 2FJBB 2D41A 3KUHA 2ZNZA 1MROA 4U7UK 2ZH1A 2QYCA 1GX5A 4ZK7M 2OPPB 1F6TA 1IKXA 3Q86A 2ZE2B 2MLXA 2JA6C 3FZBA 2LEAA 1QSSA 4KV8A 1S97A 3VVTA 4J9RA 1N5QA 2L48A 4PQAA 3BKFA 2ZM6F 3ZZPA 2PT0A 5D0HA 2D3OR 4B3MJ 2BM0A 1ZYRA 2MHEA 2VG6A 4WYLA 4F4WA 2HMIA 2CNKB 3PZPA 2Q6CA 4F26A 3MR2A 1KVIA 4DQRA 4L74A 4NE9C 4H4OB 3P8BB 4RZRA 2PSZA 4LSLB 3OR1A 2RU9A 2IJNA 2XCAA 4MKBA 1HBOA 1N4LA 3DDKA 3HVAA 3SEOA 3GWCA 1ITPA 4ZPBA 3Q8QB 5HAOA 3TVZA 1QAIA 3JB9k 3DLGA 3I4PA 3LQVA 3A3OB 2I8EA 3I0RA 3EZOA 4DS4A 2MKIA 1ZOTA 2Q43A 4DR5F 1EQRA 3DOLB 5KFFA 2VA3A 1ZBSA 1LWFB 3ZZYA 2OH2A 1P9YA 5AXLA 2RQCA 3D3CJ 3KLGB 3P6YC 2ADCA 1P27B 3HHNB 4DZDA 3A13A 1B4AA 3QRPA 1H2TZ 2IM2A 1SJ3P 3TR5A 5LM7E 1NZ8A 2JH3A 1JLFA 2JA6K 1WTFA 4C11B 1AW0A 3Q22A 2UZAA 2X1FA 3RR7A 3ETMA 4NXMF 4I7FB 4DCJB 3UVJA 5T7LB 1N8RT 3DM2A 4ILRA 3H2UB 3F41A 1B7FA 3FFIA 3QPIA 3MXHP 2Z56B 2E2IC 3DYAB 5L1IA 4J9VA 3NMAA 2IIHA 4IQMA 4RNNA 2CDRB 1NK6A 1XWLA 4Q5VA 1D9FA 2OSQA 2R8KA 3C15B 2ROGA 2D3O1 5IC6B 1N34J 1S6QA 3OV7A 2I5JB 1EQ0A 2XCOA 1NAQA 2HHHF 2DNYA 2F8HA 2DXEA 2EFQA 1DD5A 2LYVA 1BWVA 2V94A 4EGLA 2H9ZA 2J9CA 3L7OA 1UP1A 3TZXA 3KLFB 4ZLJA 1F5CA 4L3NA 5LMNF 1RTZA 4LBIA 3UFCX 3GPAA 3QAEA 3QJPA 3VAJA 2HQGA 3IN5A 4KY3A 1FVQA 5T14A 1WG4A 2ZUGA 2R92C 3FSXA 3FBCA 2PA3A 1RA7A 2VHGA 4U7CA 4TKTA 5EWEA 1K83C 1R8AA 3ENWA 2EW9A 3I9ZA 1YSJA 1XMBA 2J6UA 4QR2A 5DM7Q 2P6TA 2K3IA 1K73T 2V4JB 4OJ1A 4J9UE 1CEZA 2HNYB 1U1LA 3MPYA 2ZHBA 2B9WA 3UDLA 3KK3B 3H0GC 1M1GA 4ES1A 2YNIB 3GIIA 3ISZA 3RB4A 3D1HA 4LFBF 4DS5A 5IT0A 4KAWX 4FKXA 4KASA 3N6NA 4OI3A 4FF3A 5HQ8A 4A8FA 3A3NB 1IBLJ 2UP1A 3IM9A 4HH0A 2FVQA 1I1GA 5EX3A 4DSKA 2R2RA 3EQLA 2C2KB 4R0JA 2ZKUA 2JEJA 4DLGA 4C8KA 3HOVK 2OFGX 3BS9A 4O2DA 4Y2KA 1X4DA 2YU9C 1HW9A 3KMQA 1REVA 4RUAA 1QUVA 4PXDA 1G2EA 3G82B 4X66J 2UXCF 3M7VA 2W9BA 5K14B 3GEHA 2CG4A 1JLQB 2CPXA 2BQUA 1CJTB 3MDFA 1U2FA 2R92K 4FF4A 1I50K 2MQLA 2MGZB 5HP1B 1FO1A 4ECQA 3MTKA 2MKKA 3SCLE 2N4DA 4IQXA 1K83K 1HBMA 4C3HC 3C14B 3BH7B 1M5VC 2Q1LA 2V8PA 3DLJA 1DZ5A 1EARA 2JZ5A 4OX9F 1GMWD 2AD9A 2LCWA 1SL2A 4NCBA 1SVDA 2DK2A 2XBPA 4DWIA 3T5HA 2GX8A 4Y52K 1N32F 1DTTB 1U2CA 2V69A 2MTLA 1M5SA 3JS9A 4ED2A 3ZZZA 2NREA 5ETPA 1DARA 2VIHA 2J7UA 4P72A 1B4BA 2XO6A 2LQ9A 2W2PP 1T8EA 4LLGA 3BBBA 3K59A 1NHUA 5C24B 3U1LA 2N82B 2EPIA 2GVZB 2J0XA 2F3JA 2C2EA 4K4WA 4ZPWR 1IM4A 3OR2B 4ILDA 5DM6Q 4DR3F 5CYQB 1FXLA 4ECTA 3ENQA 3ZZOA 3LGHA 1INNA 1MN7A 1R9TA 2POKA 5IOLA 1X4CA 2DR6A 4HKQA 2YKOA 1ACMB 1WF1A 1CG2A 3HZGA 4ANCA 4GO7X 3TFHA 3AY0A 1D8ZA 4PWUA 3ONQA 1SKUB 2HRUA 5F3ZA 2ABYA 1S6UA 4ID5B 4IOCQ 1B0PA 3CNQP 1SMYA 3EM1A 2XSJB 4RU2A 1KTVA 4C3HK 2NXCA 1KBRA 5IM0A 4O23A 5AT1B 2HWIA 4B08A 2RHSB 1VFJA 3I96A 3Q83A 4FM9A 2B56A 3PX6A 1DLOA 4DR5J 3HOUK 3IG1B 3LH2S 5J2QB 3M1VA 3THVA 2RH6A 4AD6A 1L3UA 2KYXA 1L3TA 4MJKA 1HYSB 1BC6A 2BJ1A 3TWZA 2VFRA 2QSWA 2CPHA 1OSDA 3J80Y 2ZJPQ 3S15C 2GCFA 2XNQA 2LECA 4MTPA 4B9LA 1WD6A 4GMKA 1DTQB 3C46A 3QNWB 3OQ2A 1QSYA 4YG2A 3QO9B 3EX7B 4LIWA 3DLKA 5B0DA 2NVXA 2W7AA 1GEHA 1UA0A 4IUFA 3PKMA 3OBIA 1FKOA 3GR0A 4QIWL 1IN0A 1YJRA 3ISND 2Y8WA 1G6BA 5J1NA 2Y1LB 1UW9A 3CPWR 3MUMP 4DSEA 4QYZK 2D7SA 3GEIA 4P7TA 2PFDA 3M8RA 3G2XA 4GT9A 2QFJA 5C2CA 2RAQA 4C8YA 3DKDA 1E6VB 4BC7A 4ZN1A 2E7WA 1BUXA 2CYYA 3OTDA 4CCHA 4UOCA 4X84A 1RYSA 2DBBA 4IG3A 3KXDA 2HHHJ 5FD1A 2L9NA 4C2MC 4PABA 3AJ1A 3F44A 2RD5C 5I3UB 1TP7A 1J6WA 1SH0A 1NK8A 2RQMA 1NKBA 4FNIA 3WZ0A 1Y5LB 5ETNA 1SC6A 3SZZA 4PPZA 3GIJA 2VA2A 3OPFA 3S16C 2LXIA 1YJTA 1TMMA 1YQHA 3KK1A 1NNDA 4OLOA 5EDWA 5GAEI 3J81Y 4XSZA 4NCAA 4RNHA 1IR1A 3W64A 5KG2A 3CW2C 2WBRA 3GTQA 4NL5A 4P6QA 2YQ3A 2XI2A 3HHLB 4ZDNA 4JI0J 4O0NA 4ZVSB 3S15K 3GLJA 1EETB 1RT7B 4OV1A 1QLNA 4ILLA 4JK1A 1ZZFA 3RBEA 1VHIA 4MEYA 1MMLA 3EJMA 3KG1A 3W2VA 4ED5A 3KHGA 4UTGA 4ZIWA 2YTCA 4ZA1A 1V3SA 4I69A 3BB5A 4LFBJ 2CDQA 1FE0A 3QBCA 2VBZA 3RRGA 5K5MA 4Q4ZA 2OEJA 1U1QA 1M1KT 2E5LF 1DY3A 4FDFA 4QWBA 3RG6A 1O0PA 2HS0A 4A46A 4A3DC 5F9LA 4QJVA 2HHXA 4LF5F 3GSDA 5H9FJ 4LR7A 1SB6A 4KE5A 4GO5X 2F7VA 4KGVB 1N6QB 4C3MA 3SV3A 4C2MK 4N5SA 2D9PA 3A1YG 3J7AN 4BBYA 2M7SA 3TOQA 4CO0A 4A3GC 5E7OB 4NLXA 2V9KA 3TO8A 3ILLA 2UXCJ 3K5NA 1HNZF 4AL7A 2NZCA 4DR1F 4P2MA 3C66A 3ZZRA 1E6YB 5KFVA 4QIVA 3S16K 3H2LA 2CQGA 3T1AA 4OYXA 4UOGA 1N33J 3T3FA 3W60A 2LFVA 1XBWA 4KPCA 2QRRA 1H2UX 2XLIA 3KLIB 1JLEA 2AJ1A 3R8YA 3CJKB 1VJWA 1CJUA 1B70B 4OIPA 5A6WA 1XQIA 1XZPB 3NBPA 3TEHB 4WPAA 1RTIA 2Y1RI 5IV3A 1NPPA 3EMTA 3K8VA 2B6AA 5A8KA 1YJUA 2BV3A 1SBRA 4ID8A 3Q8SB 1WC1A 4NOIA 3CCLS 5C44C 4KGKA 2FD2A 1JLBB 4UY8T 3DOKA 4Q5SA 2J76E 3A8KA 1U6ZA 3DHXA 2VICA 2W4CA 6FD1A 4YP3A 1L3KA 4EBDA 4AYBD 4G7ZA 5KFMA 4A3DK 2WONA 3OJSA 2KVIA 3UNGC 1Z4UA 3OSPA 3SDEA 2AGQA 5F8MA 2ZITA 4UOHA 1URNA 3DI6B 2KL8A 1PSDA 1GXTA 1FJ7A 2CIMA 1YIJS 4DR3J 4A3GK 2IPOB 5ETKA 1RT1A 3PXGa 3TX0A 1FJGJ 3LAMA 5KAKA 4JI5F 5IS2A 4X4RA 3PO4A 2I6WA 4DSIA 2CNNB 2A6EA 1RQ0A 5M5WK 4H4KA 2IRYA 2Z2YB 3CUNA 1RUSA 5DLGA 3N0CA 3GIMA 2C3UA 3CJ0A 2E44A 3IS9B 5I3QA 2QMUB 3TEGA 2FLOA 2ZDOA 1PYOB 4A8SA 3NS6A 2HQCA 2A69A 4KTQA 2E29A 3D5MA 1S9GB 3A4TA 1UWAA 4ZVRB 2CA9A 4Y6IA 1SC1B 3ITHA 4MK7A 3CEDA 5C44K 3NP5A 1Q5VA 1ULRA 3R5JB 2IJFA 3FRYA 3S6EA 4NPOA 3BQ0A 4DI6A 1CJKA 2YNHA 4ZHRB 3RRHA 5CH7B 2M0GB 2W25A 3IP0A 2LU1A 2HIYA 2JA5K 1R8BA 1HWUA 4WP8A 1HI9A 3R97A 1L5UA 3R3TA 3MEEA 1GMUA 1IBMF 2CQ3A 1OO0B 2QSFA 2VG7A 3BQ1A 5GAEU 3NCPA 3TJ8A 4YR0A 4NA2A 4PWDA 5SUHA 4UY85 1PO6A 1QY7A 1YBTA 2FQOA 1KQGB 3GTKK 4R8UB 4MAKA 3I5BA 1DFDA 1MWQA 3KK2B 4OI4A 2QJ3A 3MMAA 2CQ1A 2XMAA 3W7BA 1R0AA 4KPYA 3NGKA 5KFBA 1ZTTA 4CLTA 1KFDA 2DY9A 2G13A 4UQGA 3H5XA 2RT3A 3RBDA 4Z2XA 4W4MA 2CFXA 2COLA 1Y1WA 5HL8A 2FLLA 2MZ1A 3ZZTA 5HROA 4LF4F 4FXDA 3SCJE 1JIHA 1F93A 1NDKA 3HM9A 3HVTB 1FFWB 3C2PA 3TAMB 4I6YA 3FKBA 2RF2B 2GV1A 1RAAB 4DUZF 4KB7A 4DV0F 4AXJA 1D0EA 2BJ3A 1GTEA 1AZSA 4JI7F 1NDLA 1NSQA 4PXEA 2BR0A 3VAGA 1WSVA 4IRDA 5JVHQ 3IGVA 2NQPA 1TFWA 3NY0A 3NG8A 2XMUA 4HHHA 5BYRA 2YKAA 2ZZTA 4IYQA 3P3DA 4HDHA 2MQ8A 1YZ7A 4FBTA 4C8ZA 5C7PA 4BKWA 3HVRA 3M4OC 3OXFA 2J0QD 1RACB 2CPEA 5EGEA 3EZUA 2JSXA 2P9GA 1R31A 2E5LJ 2I9SA 4MK9A 1VLYA 3MZIA 5DQHA 5FLMC 2FHJA 3DRPA 4HLBA 2GGPB 4DX6A 2PD1A 3UCZP 2ZOMA 2YKMB 4RNFA 4ZPCA 3JSTA 2A6MA 2HVEA 3LP0B 4CLUA 4IG0A 5G0RA 3JAMY 1RAEB 2AX1A 3MM5A 3BYRA 4E0DA 2KJWA 1R43A 2AEMA 3D6HB 4IR1A 4F4AA 1HBUB 2RDIA 2OPRA 1IBAA 1O2BA 4WP9A 4DR1J 3UO0A 4M5JA 4ETXA 1L0WA 1WHVA 3G8TA 1FRJA 2VPYB 3OREA 3JTOA 1FNXH 4OZLA 1URRA 4PKDB 4KARA 4B3TF 1S6PB 1VH2A 1N36F 2EKYA 2Z57B 5A8RA 4B9VA 2B5JB 3M2RA 5I42B 4G0UA 2M9KA 2XWXA 2EG2A 1TK5A 3PNIA 2UUTA 1KC8T 4QYRA 4EEYA 3M05A 1WKLA 1PC4A 3M4OK 1QSLA 2FZKB 3BSCA 2CQ0A 3FJ2A 5ETOA 2EWHA 3OFEA 4A3EC 3TRGA 2HAFA 1Y4ZB 1SFOA 2R4FA 4FYXB 5DG9A 2VC1A 1CVJA 5FLMK 2Z2MA 4JI6F 1LW0B 2ZHOA 3H5YA 4QIFA 2NZ4A 4IH6A 1J98A 2LEPA 3C6TB 2R8JA 3KFWX 1RAJA 4DXLA 1TAQA 4N8OA 3SMZA 1RP5A 4NLPA 4QOTA 5J2NA 1R8CA 3MMCB 3G86A 3QLHA 4NRTA 4RNMA 1X4GA 4BBSK 1Q5YA 1DQ8A 1UL3A 3DN9A 2NYIA 1SIWB 4M8LA 3R7NB 1R9TC 4ZKAA 8ATCB 2EK1A 2FC8A 1SI9A 1K44A 5FDLB 2KZZA 1F9FA 1RT2A 3PKYA 1PAUB 2LQ8A 2M8DB 1F0XA 3AFGA 1C1CA 1U0HA 3H5SA 1JLAA 3G6XA 3FRZA 1KTQA 1YK9A 3GG0A 4RU9A 4I2PB 2YWKA 3MEGA 4ZVQB 3KLHA 4IH5A 3OL9A 2N7CA 2VBWA 3T00A 2XGPA 3M2VB 1RT3B 5KG4A 3ZNUA 2LP4A 4CNYA 2V0NA 3DOMB 4LFAF 1S76D 4A3EK 3T5LA 3S01A 4NLGA 3IRWP 4KATA 2J7WA 1UW4A 4KKOA 5ETQA 2BMBA 2DNPA 5AJ3F 2R7OA 2OMOA 4XTTA 1SXLA 3PYGA 4U67Q 4DL5A 2NVXC 2QFIA 3X3UA 2O66A 4KMAA 2Z2LA 2KT3A 4UZBA 1IBMJ 1X4HA 1NU4A 3HOXC 3NGSA 2DCLA 1U1OA 5KFOA 1G7CB 3DNCA 2E5IA 3OFFA 2NUHA 1OQ6A 1LWCB 1R9TK 1QTMA 1S1VA 2Y8YA 1WKKA 4ZVEA 3KHLA 2Z4PA 1UZDA 2FDNA 2Q3PA 2CFAB 4E98A 2QIFA 1Y5IB 4WK3A 2JC0A 1MMNA 2RB7A 3SCKE 4GKJJ 4DL3A 1S1TA 1W25A 3IFEA 3LAJA 5GAGI 5DO2A 4PG8A 3BUEA 2P5MA 4DPOA 4N41A 5IP9C 2ZC4A 3H20A 3SSRA 5DG8A 4JB8B 4PUOA 3K8WA 5D3GB 2R7ZA 4CM0A 3S8SA 4ZVUB 2KU7A 4DUZJ 1Q79A 4NLYA 2DXFA 1N5VA 4DV0J 3R5AA 7AT1B 2PMWA 1IKVB 1TVRB 2CZ9A 4IH7A 3SV4A 4NEYA 3IO1A 3E01B 2VH7A 2G2OA 3GTQC 5ETRA 1FFSB 3LP1A 3BP3A 1RK8A 3G4AA 3KDOA 3I0SB 2UXDJ 3O8WA 2BACA 3ETOA 2Y1JA 2VUMA 4L6V3 3HKZD 2AP6A 1WNEA 4BLAA 2DNZA 3MM9A 2YWEA 1FRKA 3GU0A 4ZLPA 3HHEA 4YQWA 3RAQA 1NM2A 4OYBA 4CQ1A 2BABA 2XMTA 1IQ0A 3W9JA 5KFSA 3PRVA 1S0VA 1ZA2B 3MUVP 2WVFA 3VQSA 3CT9A 2ZBIA 4MKVA 2L08A 1N5YB 1VCTA 1Q7LB 3HSZA 5E3CA 4DSFA 5E3AA 3ZTPA 5KFIA 3S1NC 5FJ8K 5FJ4A 3MEDB 4B3SF 1TUWA 2WVEA 3M9MB 3WDOA 2E2JC 2W7VA 4GTLA 3D68A 4PYDA 1B0TA 4EFAC 5HJXA 2BXJA 2BBEA 1KVKA 2YH0A 2PI4A 5KFEA 2CKWA 2DXDA 2F4FA 1RAFB 3VGSA 3CDEA 2DH7A 5A76A 2M3DA 4CP5A 3OFHA 1NMEB 5IP9K 3O2IA 1GMVA 4RW7B 3VAHA 3T01A 2C2ZB 3D66A 1ZXOA 1D8YA 1FJCA 2XC9A 4HL9A 5C42B 1U0SA 1P6TA 4Y34A 1Q81T 1IJFB 2CNLB 4JI1F 2EC0A 2ROPA 3PFEA 2V8VA 4OI1A 5KG0A 1V3RA 4O3SA 2DIUA 4B3TJ 3GTQK 5IXUA 2ATLA 4P5BA 3QT5A 4YUDA 4Y65A 4ECRA 5HQLA 5LSRA 4ECYA 2JC1A 1O27A 2QLFB 4HH1A 2ZUFA 4KGZB 1WDDA 2U1AA 4A3KC 2FVPA 1RU1A 2EK6A 3MAHA 3CE8A 3KJVA 4MIAA 1DBDA 4GVBB 1ZAVA 1XR7A 1XNQF 4ILMA 2KXNB 2UXBF 4CO2A 5MAOA 1VRUB 4ANDA 2BE7D 1FK9A 2DHXA 2M52A 2KN4A 3UR3C 3IBWA 1IWAA 4CT9A 2VOOA 1HPZA 3S1NK 3V81B 2AQ4A 2KI2A 3K2YA 2R3VA 2E2JK 4NA3A 3M3YC 4DX8H 4ED6A 3EDRB 4FF1A 3EICA 2M2BA 4RW4A 3G9CA 2B8QA 3H42A 4DG1B 2FJXA 3PW4A 4ELTA 4QCLA 4KDDA 4YDXA 2O5JA 4NLSA 2DH8A 1CLFA 2R9LA 1TL4A 1WF0A 3OFGA 3OTCA 4B02A 4BLGA 2AWZA 5J2PB 2CZ4A 1B3TA 1TL3A 1VIOA 3S2DC 3F56A 3HX9A 4H4KC 1VQOS 2WZ1A 2W2NP 2X7IA 5C4XK 2LMIA 3TZZA 1Q82T 2AGPA 2RU3A 5HBMA 3FGVA 5E41A 4U95A 3DXJA 3J80U 5J1EA 1TMJA 1WCMA 5KFKA 4X64J 1VDHA 4IO9Q 3SCIE 4RW8B 3HDSA 1EKRA 4A3KK 1QAJA 4ZVTB 2K1RB 4O3PA 5HSPA 4DDFA 1VQMS 4RWWA 4LBHA 2YPYA 1HQUB 4Q8FA 4LFAJ 2AKWB 4DFJA 2JLEA 3GYXB 4XSXA 1EZZB 3D0IE 3TA2A 4F3OA 5LXRA 3PW0A 3VWSA 3FDSA 5GAGU 3NAIA 3UQSA 2CW0A 3I5AA 2FHOB 4LRDA 2KXFA 2ZUAA 3M9OB 1H38A 3HOWC 1XZQA 3M2UB 1HI0P 2E5JA 1U8WA 2B51A 1GXLA 4TXSA 2CJYB 3VZIA 1QE1B 4KH0B 1NSKL 3D67A 1RT6A 4MH8A 4WCEQ 1IW7A 2IVFB 2UVWA 4HACA 3WIUA 2QX0A 2FJAB 3MM7A 2BE9B 2YWFA 5A8WA 1FA0A 1S1XA 4X4TA 4EO8A 1NXIA 1LWEB 4WIIA 3N6LA 1S0NA 1JLGA 2X3GA 3S2DK 3Q8PB 3N0BA 1IQZA 3S2HK 5IOTA 4JI8F 1S9EB 1YJ9S 1Y1WC 4L75A 1VRQC 4LF7F 1JJ2R 3DHWC 4USHA 1WJ9A 5F9NA 2V8DA 4USWA 1UAWA 3RRKA 1FHTA 2XZWA 4A48A 2HGLA 3V4GA 1DRZA 1OY8A 4C3KA 2K2PA 1S0MA 4ZP8A 3BBCA 1WORA 5D4OA 2MY7A 1KQKA 4DN0A 1F7UA 4C97A 1MROB 2DISA 3B78A 2GA7A 3G6ES 5B08A 2NPFA 5KT2A 4WWSA 4OX7A 1IKXB 3EVOA 4LJZA 1FKPA 3HOWK 2EFPA 2DH9A 1C1BA 1TUVA 4KV8B 2P8IA 1XIQA 4GVLA 3M30A 4RMFA 1HNWF 5HVGA 1JB0C 1V5IB 4BXXC 4V19X 4X4VA 2GHVC 2VG6B 4F7VA 2KTQA 2HMIB 4CI0B 4C98A 2KO1A 3DGPA 2WVBA 4QR0A 1FXDA 2QEXS 4K4VA 3IRXA 3EGZA 5H9EK 2QLXA 4R5PA 3V6KA 1WC6A 1XC9A 1YLXA 3PW2A 3OR1B 3QSIA 1WQHA 3OVAA 1CULB 1BMQB 3Q89A 3I56S 1FF2A 3B6BA 4KR0B 1X31C 1HBOB 4FNHA 3RW7A 2R2TA 2N3LA 1Y1WK 3G8QA 4CDIA 1WTBA 4QBUA 2JRSA 1X7VA 3BPSP 4A8YA 2DGXA 3HZEA 2FUG9 3DLGB 3P49B 5AE1A 4OYWA 3I0RB 2RSQA 1WI8A 2ZHAA 1R6VA 2VPZB 2ZOGA 2DO4A 4GTCA 4RW9A 4JI1J 1Q95G 1K1SA 2G0JA 3NGUA 3PYEA 4K2XA 4BDPA 1FWLA 1UA1A 2MB0B 1S79A 1X5PA 3VGUA 1UV7A 4F0MA 1KSPA 3LF0A 4HVZA 4WIQA 4LIRA 4LUBA 4GTDA 2R93A 3AA9A 4A3LK 1T03A 2DRDA 3CO0P 3A12A 3GE9A 3ZTQA 2BVZA 3LPXA 2DPIA 1JLFB 2FPHX 3MURP 1T05A 4RR5A 5LSLA 4BXXK 1XNQJ 3UVJB 3EGWB 3DMJB 3HHKA 3E2EA 4L76A 3EGNA 3DM2B 3AAWB 1MNEA 3V4IA 1USMA 2UXBJ 3Q2SC 1SFOC 3FFIB 2HZAA 5K9FA 4LR9A 3D0HE 4LBPA 3GIRA 1I50A 2B4UA 4DX5A 4B9TA 3SFGA 1YRTA 2VG5A 1HARA 1VBZA 2AT1B 2XLKA 5DDQC 2ADBA 1WC4A 3T5KA 3I32A 1S6QB 1TWCA 3AQOA 2VV5A 5CCMA 2Z0GA 2DITA 4OYIA 1IL2A 4DDQA 1M5OC 1VQ7S 4X4QA 3GILA 5K20B 4U7UD 4Y28C 2XMVA 3G71S 3UW1A 1VJEA 5C25A 3MPVA 1QDUB 4NLRA 1J5OA 2BANA 2CAJA 1MN9A 3P4UB 4ZOSA 4JI3F 2VQFJ 2IDEA 1JLCA 4ZH4A 3H25A 4NASA 2CWXA 3GJSB 4NI2A 4ZPDA 2G0CA 2HPUA 4X6AK 1VBXA 4IFYA 2UUAJ 1FD8A 4YOEA 4BLBA 3S17C 5ITHA 2QE5A 4D3HA 1DCHA 2YWWA 1F5BA 2C1EB 5ETSA 2R7XA 4NMXA 3H8YA 1JLQA 1Q1KA 2DKOB 3UWTA 3EXYA 4TN2A 1RBAA 2CPDA 2NUUG 3QQCD 4DPYA 1AB8A 4LVNP 2MGZA 4YB1P 2W7PA 4S0MA 2EFNA 1M0SA 1SFOK 4NXNF 3T41A 3KG0A 3D1QA 4CTAB 3AT1B 2J7KA 1P9QC 3ELHA 3L9ZA 4DUTA 2QA4S 5KFQA 3M32A 3CVKA 2OJ3A 4QU6A 3H4DA 5KFJA 1I51B 2EKNA 3TUPA 5E2QA 1FT8A 1RBOB 5CJ9A 2MHNA 4ZMMA 2BQRA 2XMJA 2DVIA 4F3MA 4PAAA 2O01C 4IKAA 3J7ZT 1FTCA 1REVB 3Q23A 4JV0A 4ZVFA 4OI0A 2RHQB 3MCMA 1I6VA 3M4XA 3CJ5A 4IOAQ 5FLXU 5IOSA 2E9RX 2W9BB 2DNOA 1TKDA 2QT7A 3C8YA 4I68A 2OTJS 2RE1A 4HR2A 2ACYA 3V5RA 4O3OA 2B9YA 2GSOA 5KFAA 2G9OA 2K7JA 3MPUB 2GVZA 4ZCLA 4FN5A 2FC9A 4NLVA 2CPIA 3VGVA 1HBMB 1YITS 4IR9A 3S17K 1R6YA 2HQIA 4KGMA 4KB4A 2AJFE 3GFHA 4Q8EA 3G4CA 5DG7A 3MR7A 3PYDA 2AYBA 3IR5B 2XYGB 4LFCJ 2ZBPA 2KDOA 2R7ZC 1PJ7A 3MI7X 1R3NA 2WSEC 4C3IC 4LQ9A 4M5IA 4J9OA 1JK9B 4YMEA 4ECZA 5F41A 3L4BC 4WFAQ 1WEXA 2ZWOA 4DL0C 1O2AA 2FYXA 1T3OA 1Y3KA 5IYDC 2DJWA 4YY3F 1HD0A 2VUMC 2WB1L 1S72S 5B09A 1P8GA 4HI1A 3AH5A 3KHHA 4JI2F 2WB1D 1RABB 1RTDB 1XXBA 1VQSA 3H0PA 4DUYJ 2MYFA 4WBFA 1O24A 5J2QA 2YKPA 2EXUA 4QR1A 4C3JK 4C48A 1T9TA 1IBCB 2Z8QA 1NJIT 2W4DA 1MWZA 3KLVA 2E66A 1WOOA 1HHSA 5GAHI 3IR7B 1RBLA 1GK8A 1ZM2A 4NLOA 4CLFA 2BW7A 4ZVHA 4WTOB 1WELA 5CZXA 1TK8A 3UE2A 3KYLA 3R9LA 4DV7F 1Y3JA 3BM7A 3HI9A 2DGQA 2ZD1A 3J7Z5 4WKRA 2L41A 4DR4F 4RNOA 3T1YF 1UVIA 5IM0B 1O28A 1I6JA 1BD6A 2EEYA 3DRSA 2R7ZK 1DLOB 2DIVA 4C3IK 3ZTOA 4X62F 2FVSA 1MLAA 3JQKA 1WOPA 2PHCB 3NGDA 5GMDA 1LOUA 3NS7B 3HHDA 4TU8A 2DNHA 5IYDK 2KKHA 4FKYA 2JA7A 2J8AA 2NXEA 3PM9A 1AYEA 4QYZJ 2WAQL 3VAKA 2C2NA 2VUMK 1FRLA 2WAQD 4DF4A 4OHVA 4DV6F 2GIRA 3C3LA 3HJFA 2F8MA 3HULA 3DLKB 4M94A 4QPXA 3D1OA 2VASA 1AFJA 2J9EA 2C2RA 5DDRC 3OT9A 1PILA 4FXWA 2E9TA 1HR0J 5IP7K 4LF9F 4ITSA 2LXFA 3NLCA 1XR5A 3AD7C 2R2SA 4RW6B 4C9DA 3DRYA 4PXBA 1S6OA 3CCRS 5RUBA 3I9V9 3HHLA 1W26A 3S1RC 5KFUA 3N6MA 2BRKA 1EX8A 2KRBA 3S1TA 2DPJA 3R5DA 3OXLA 4GTEA 3VR1A 4OZ2A 3KWMA 4MEXA 3IMQJ 2XNRA 1IKWA 4E2FB 2NVQC 3V6DB 3TARA 4Q0BA 4K4SA 2H1YA 2D3ZA 2FHKA 3GCXP 3FMBA 1FX2A 3PJ9A 1YBUA 2YY3A 3BO3A 3RB6A 2K7KA 3JSMA 2CJ9A 3KJQB 3GG1A 3KK1B 1SUQA 3D7SB 4OINA 2FJVA 4JBCA 3WX8A 1BGWA 2JVRA 1BQMA 2KT2A 1NK0A 4YFXA 2VFVA 4TY9A 4DV2F 1W7WA 3R7BB 4OZ5A 5LJ5Y 1WCMC 4WFXA 3AB2B 4RBVA 2J0WA 3CQZK 2DGUA 4A8WA 2BJDA 2V4QA 3W8GA 3AH6A 1VI7A 4ZLLA 6AT1B 5HI7A 3GONA 5H9FK 5D0RA 4PWWA 1N54B 5E3RA 3VF0B 3KTQA 2YWGA 3D6TB 1JQGA 3LUYA 4DR6F 3LW5C 2C3PA 3QZ8A 1IBKF 1JOEA 4PG5A 3O44A 3S1RK 4M5NA 2KXHA 2FLNA 4QJVB 1UMJA 3ILIA 3THPA 3C6UA 1FESA 2HYIB 3B54A 4ZS6A 2DHGA 5KFCA 1Y11A 4J90A 3W63A 3GMGA 4DJBA 4WK1A 2BDPA 3EZ5A 2DT9A 3M8PA 2W1BA 4DR7F 5KOXA 1S1UA 2W8LA 3W65A 4P2FA 1JXVA 4OYOA 3EPGA 3U7JA 1O2FB 4QU7A 3BSAA 1KOOA 1U1RA 2OD4A 4A93C 1Y1VA 3W61A 3NNCA 3W9HA 3AOCA 1RHKB 3NOCA 1R27B 4HHUA 4DPTA 2VODA 5GMEA 1JLEB 2JA5A 1VRTA 1F9EB 4KIAA 1WCMK 1CJUB 2OELA 5HN0A 4AL5A 3VHQA 1ZZNA 2AJ2A 3W5XA 3NBPB 8RUCA 2V2VA 2WOMA 2Z58B 1MW7A 4NZ0A 1RTIB 5GAHU 2B6AB 2C3MA 5A8KB 1T7PA 3PRDA 1RADB 1FKAF 1J6VA 3PG9A 1QAXA 1S10A 3GTKA 5E0OA 4J5OA 3OL7A 4CIOA 2MKCA 5D15A 3H98A 4NLQA 4IO1A 5E5NA 2QA2A 3GTMA 3P45B 3DFEA 2WONB 3JYTA 4P7VA 2W01A 3BV8A 4LF8F 3MMLB 4NCGA 3SDEB 3EWGA 1AROP 2BJ8A 5D0EA 3BGRA 2DGOA 1WHYA 1NJWA 1NB2A 3KMSA 4H4MA 2R7QA 2HHTA 1VGXA 4M1KA 1VMBA 3H7HB 1H6KX 3PX0A 1U1PA 4RLEA 2E5HA 1RT1B 3NUHA 3PEJA 2RDDA 4F0HA 4ERDA 5KT5A 1CJVA 3Q3QA 1VQPS 1S99A 4YHHF 1K8AT 1MSWD 4X65F 4A93K 4CT8A 2DRBA 2FVRA 3PV8A 3TFIA 2OUGA 5GMKa 2BUNA 3LP2A 4ZJLA 2WSFC 1XJWB 2KWAA 4KC6A 2XCQA 4DR4J 1T11A 4LQ3A 1GX6A 2W24A 5BR8J 2OFHX 1JKHA 1NK4A 4RBTA 4IRKA 1P1LA 1S49A 1X9WA 3ITHB 3CB4A 2JX2A 4QWEA 2KFYA 2AX0A 3B4DA 4DV3F 4CLKA 3PVXA 4Y2MA 2KG0A 3GZ7A 1KLMA 2CG8A 3ZTRA 3MOJB 2YVSA 4CLSA 3CC2S 5F8HA 1AUDA 3MCOA 3TZWA 1IR0A 3PEHA 2YNHB 4FPIA 2R93C 1HHQA 3PFOA 1TWFK 3TJ9A 3CJ3A 2CNOB 3HOVC 1HNVA 2U2FA 4QPTA 1WHWA 2ZBQA 4CO4A 4LK1A 4ELUA 3MEEB 1FXRA 3EE3A 4K50A 1OY9A 1WG5A 3QIPB 1IKYA 1I5OB 4QIGA 4LF9J 3IWLA 4PWDB 3CCTA 3TQEA 3VGTA 5EX0A 1I50C 3UI3A 3LTOA 3CC7S 1QVFR 4FZBA 4OJ3A 3MMAB 1R0AB 1RE1B 2DNGA 4KHPF 4OHYA 1RTJA 3CJ2A 4J9NA 4XLPA 3CF5Q 1TWCC 1OJ4A 2P6SA 4PQUA 2QA4G 3NAHA 2KHDA 1N48A 5HROB 5GADI 2JEIA 4AQYJ 2WRMA 2ILZA 2GAHC 5KT4A 1RYRA 4ED0A 4AL6A 4XPCA 2E7VA 1SPBP 3F0NA 2RRAA 4Y52C 2BEFA 3R2DJ 4JYAF 4OHZA 3MAQA 2EC2A 1SV5A 1OYDA 1AZSB 1H74A 2PIIA 2KJVA 3LO3A 1DHMA 1ZH5A 1PGZA 4K8RA 4JP8A 3GTOA 1TKZA 2V5HG 2R93K 4FYYB 4DL7A 3I82A 1VBYA 1YDLA 3T1HJ 4IDKA 1TKTA 3UN2A 3BREA 2HFUA 2KHCA 4EZ6A 2OEMA 1TUGB 4EBEA 2IAJA 2VPXB 3Q0AA 4P10A 3BYPA 4Q44A 4O3NA 1ZPVA 3AOBA 2RKIB 2K06A 4TYBA 4YS2A 1IBKJ 4KBIA 1UVMA 2QN6B 1RWOB 2AYGA 2YXLA 2L3MA 3BKTA 3CMES 3DRPB 1TFYA 2ZC3A 2BE2A 1X8DA 5KG7A 5KFXA 1RWUA 2BX6A 5ADZA 4LF6F 1G3OA 2HHUA 2HNZA 5I42A 5KFYA 4B9UA 4U6PA 1N52B 1TWCK 1TV6B 2V8HA 3RU0A 4IG0B 3BN4A 5G0RB 4G3IA 3OLBA 3MM5B 4XCHA 2RRBA 3SSSA 1ISEA 4L73A 4C8OA 3HP6A 4DR7J 2OPRB 1JQWA 3HOUC 2IRUA 3CULA 2GC8A 3SZ2A 4WF9Q 2IBOA 1RHRB 2HGNA 4DR2J 2V6TA 4KGXB 5E68A 2RMLA 2CQHA 3JSRA 3NGTA 3KNGA 4X4NA 4LVOP 4F67A 4F0KA 2QLWA 3QWUA 4ED3A 1EB0A 1FRHA 1NKCA 2XWYA 1V6HA 4N7TA 1REGX 5CD4H 2RILA 3QGHA 5A8RB 4K4TA 1TWGA 2GMJA 3M2RB 2HRYA 1XEZA 2FHMA 1F3FA 4FVMA 4G1PA 2ZM6J 1TQLA 2V68A 3OEPA 2QLBB 3NWRA 4FXVA 2B4VA 5IYCC 1A0OB 2XO7A 1OSCA 1F2GA 4B3RF 3NKYA 1ZPWX 1S12A 1FJEB 3NGRA 4NRUA 2VQEF 2BE5A 4FS2A 2NR0A 1PJ6A 3AA8A 3FVYA 2C2DA 1FE4A 2PN6A 2IM3A 2F8EX 3R1LA 4DCPB 1SCJB 2OSRA 3VVUA 2GAGC 1MMDA 3J81j 4HT7A 2IYGA 4RUHA 1KHWA 3BR8A 4OHWA 3RW6A 4ICLA 3DOMA 5J2NB 5KT7A 4OLPA 3QLHB 2W2OP 4DPUA 3UD5A 3JTPA 2B7CB 4GTFA 4CYUA 4W92B 1IR2A 2IBKA 4TVAB 3RAXA 4CLWA 1X5TA 2WVCA 3A8EA 3CGIA 5D4DA 4X65J 1IXKA 2AYMA 2Y0BB 1OPZA 3VAIA 4TNOA 2WW4A 1VK3A 2IJRA 3G6VA 1DCPA 5T41A 1TK0A 1A6LA 3K17A 3W1YC 2HHQA 1C1CB 1U0HB 4ED8A 4YB7A 1JLAB 2RRNA 4M5DA 2JEFA 3MD1A 2LA6A 3MEGB 1B64A 3QYYA 1B99A 5L9XA 4ZP7A 1T9WA 1VLOA 4NXMJ 3OTOF 3N5BA 2RQKA 3DRRA 2KM8C 4QIWD 3P5BP 1U25A 2GMHA 2YKNB 1TL7A 3A8JA 1TTHB 1PJ5A 1VQ4S 5IYCK 4DV3J 4B17A 3CJ4A 2YNFA 3QX3A 3OXGA 1CC7A 2JA7C 4F25A 5F8LA 5CAAA 5HMZA 4KKOB 5GADU 4FS1A 1J6XA 3CMQA 3PO3C 1YJVA 2HLUA 3HCXA 2HNDA 1TWAK 1O29A 1U1NA 5KG6A 2DGWA 4DX7A 3W2WA 1R89A 1K1QA 4J91A 1VS3A 5CA5A 3QFHA 2B0GA 3FOFA 2A0FB 1SH2A 1ZM3A 3DLLQ 2LQ5A 2HHPA 2XMKA 1NUEA 5LMNJ 2XY6A 4Z7CA 2DY1A 2LQBA 2DNQA 4M5KA 4WFBQ 1XMQF 1S1VB 3HHLC 2NVTC 2EI5A 4LSNA 5KFLA 2RS8A 1HWJA 4N76A 2PFFB 2IHR1 4YR3A 1JNRB 2L9WA 3CSKA 2XZTB 4CLLA 1Y7PA 2KFZA 1G1XA 4K4ZA 3NNHA 1SKSA 1F3VA 5KG1A 1S1TB 2HAIA 5KFDA 2B43A 2F1FA 3PHEA 3L7UA 4YB6A 1G51A 1XTZA 3BDEA 3N0VA 5HO4A 4B3MF 2OPQA 2GS8A 1RTHB 3KLEA 1Q7YT 2HWTA 4AXIA 3K7RA 4PUOB 4XIUA 2MKJA 1C0AA 4JYAJ 2W9CA 1EFWA 2NSBA 2H54B 3EGVA 2QMWA 2FB0A 2GHWA 4P2SA 3OD2A 4F3QA 1S59A 3ZXWA 1USOA 4AE5A 3JTNA 3P5TL 1VK8A 2JA7K 3LP1B 1H2VZ 2UU9F 2GIFA 1NSPA 1UVJA 4IRCA 3E51A 2MXYA 3PO3K 1FEHA 5FIIA 4RW7A 1Y5NB 3MM9B 2Y3PA 1Q78A 4USMA 4V1Ak 5KFTA 4FBUA 4K4YA 1RT4A 5L9NA 5KT6A 1VBKA 3M6UA 4K59A 1RA6A 1O25A 4RL1A 3R5BA 3D6MB 5ETLA 1U45A 1AA1B 3P96A 4PG7A 4MKAA 2NVTK 5HMXA 1UPPA 3M8QA 5F8GA 2Q66A 1RLCL 3W8PA 3LA0A 2R8GA 2KYZA 2HFVA 3ET6B 1XMOF 5JVGQ 3GTGK 1S0OA 1HW8A 1YJWS 3GV8B 2V67A 3MECA 4MIWA 4OX9J 5C4JK 3HSGA 2JFDA 3RTVA 4G65A 2ZVIA 4LRFA 3GP9A 3SQGA 4URGA 1C0UA 1EP4A 4RJVA 1RAOA 4HT5A 1N32J 4KM8A 4GKKF 1C0TA 3POTA 3OSNA 4F2SA 1Y1VC 2O67A 5G4DA 1ZQ1C 1N34F 3NOGA 3DLHA 2GO8A 5DGBA 4URQU 3TVYA 4BBRC 2JA5C 1JJHA 1Q8KA 1IQTA 1FTRA 4DG1A 2G4BA 1UFLA 1LW2A 2V2QA 2ZH4A 1RU2A 5JVOA 2VKZG 2GFFA 3X1LB 1NHKL 2WK4A 3R5CA 2XCRB 2ZWPA 1HQ2A 3KJVB 3BR9A 1F60B 3WODA 1KR4A 1DCOA 1BQNA 1KN6A 3GTKC 4A8MP 2GZOA 2VQEJ 3W3SA 3WC0A 1AUSL 4KM9A 5DRKA 4QWAA 3R27A 5DGAA 2ZNYA 3PTWA 4LJMA 3GTMC 2YBVA 3GJQB 1HPZB 3BO4A 4RW8A 4F2RA 1VQNS 3N01A 2R7RA 5IQQA 2RQ4A 2XS2A 2AU0A 3IC1A 4RW4B 2HZVA 1UEVA 2RUGA 5TMFA 1FDNA 4IFVA 1HQUA 1TELA 3OL6A 1JJCB 5D4NA 5AE2A 1F9NA 4PR6A 3CCVS 5IFMA 4NWBA 4CNZA 3RYLA 1UKUA 5L1KA 1KP6A 4M5GA 3QATA 1R8PA 1IBLF 4URSA 1I3QA 2NVYK 1TL3B 2A18A 1RWWB 1X0PA 5KG5A 2AMCB 1Y1VK 5HBMB 3M2UA 4WFNQ 4MYTA 4DEZA 2G1HA 1BWEA 3TYTA 2YNGA 3FKIA 3HVWA 4EYIB 4BBRK 2A10A 3L09A 5J1EB 3SZYA 1UJ5A 2ZVSA 2RNEA 5KFHA 3DCAA 4G1QA 4NOHA 3Q2TC 4EK2A 3CO9A 3PO5A 2QTWA 2VBXA 4TY8A 1HMVA 2ZFHA 3I87A 3RZOK 4ZP9A 4ED1A 2XM3A 2MQQA 5C3EK 5KFGA 1UFWA 4WP3A 4NZ7A 4TQSA 1FNOA 3FQKA 2BM1A 3GTMK 1PC5A 1JXLA 3QRRA 1R0CB 1BLUA 2IC3B 1U2RA 2LDYA 1O8BA 4MFBA 1XZQB 1Y10A 2DRAA 1RT6B 3GYGA 3MCSA 1SC3B 4HACB 3MM7B 3PRBA 3OTBA 3BN7A 4Q2LA 3K58A 2OMLA 5A8WB 2J6SA 1S1XB 4A3MK 2BJEA 5FLXY 1Q0NA 4GC6A 3SIPB 2GVDA 4X2BA 3CD5A 1JLGB 1GMWA 2X1AA 1RKIA 3H59A 1TU0B 2UUCF 3AODA 4KYZA 4KHMA 3Q8YA 3CC4S 3DLEA 4ZIVA 4C7QA 2ZH3A 4G7OA 3PIOQ 3US5A 3J7YI 4ES2A 2JHEA 4U8VA 3DXSX 4PCQA 3CDAA 3CDBA 2HHSA 3MR6A 4AH6A 4DCOB 5B0FA 4O4GA 3ADAC 4NYPA 2R42A 4KHRA 2H48B 2C42A 7FDRA 2QL9B 4A3IC 4RUCA 2FVCA 4M5MA 1RHMB 1S7HA 1NPRA 3M6XA 5L1JA 4K4XA 2CPFA 1B0VA 1CULA 4KFBB 1KDNA 2XCPA 2NYHA 3NCRA 3RAMA 4CWBA 2B4OA 2UU9J 3GTOC 4UQTA 1PIEA 4LF5J 2NXUA 5H9EJ 2ZOFA 1FKPB 4C45A 3M9NB 1FCAA 3G8SA 1C1BB 2IY5B 1FRMA 2CQIA 4F4YA 2VFUA 1K0VA 4BBSC 3VAMA 4LR2A 3M30B 1X0FA 4X4OA 1WI6A 1A7GE 1HNZJ 2MZQA 4D3GA 1Q8IA 1OS5A 2QO3A 1S57A 4A8XA 4LSZB 5E3QA 2ZH7A 1LK5A 3DGPB 3E3XA 1QTNB 4ATNA 3IRXB 2OO4A 1RHUB 4DU7A 4R5PB 1EJ7L 3MPWA 1G4CA 5HQMA 3GV7B 2DO0A 5IORA 2XYHB 5DZ7A 1XMOJ 2DNLA 3AJ2A 4J3NA 5EGYA 2I0XA 1J2VA 1HWLA 3CCQS 3FSYA 4H54A 1QUPA 8AT1B 4OZ3A 1H7XA 2J9DA 2KVQE 1R0BG 4PXCA 3DMJA 3ZZ0A 3TFJA 1TKXA 4DU8A 3OVBA 1T0TV 3FBFA 1AXQA 3PIPQ 3K5MA 4A3IK 3FNNA 2W8KA 5DQGA 2E2HA 2XMMA 1LFWA 4J7CA 5IYBC 1VQLS 4B3OA 3HOZC 2DHSA 4RW9B 5D8HB 4GKKJ 4UT4A 2V50A 1KWMA 3LWMA 1T9VA 2XB2D 3Q8RB 1J5EF 4CH1A 2R8IA 4HHJA 3FEZA 4OHXA 3VV2B 4FF2A 3MUTP 5HLFA 2CADA 1U09A 3WIVA 2GQCA 5L8RC 5KFWA 3GTOK 1TWGC 1HNIA 1JMTA 4ZPTR 4DV5F 1T03B 4WTYA 1RLDA 4I64A 1T05B 4FYDA 2ASYA 1N0VC 2CUYA 3OHBA 1SQFA 1V5VA 2XZDB 1GQEA 1LNQA 1RAGB 2J9DE 2MLYA 3V4IB 9ATCB 4JI5J 2BKNA 5M5YK 2ASJA 4OX6A 1UWBA 2DGSA 1RISA 3D54A 1GAOA 4JI0F 3MM8A 3LANA 1CQNA 2VG5B 3V6HA 3VCDA 1DQ9A 1HNXF 3FQLA 2LA4A 1CS4A 4OIOA 2IVMA 3SFUA 1DURA 5L38A 5ETTA 4UW2A 1SQEA 1YNJA 1RWKB 2E2IK 4ED4A 4KO0A 4CTAA 3BPDA 1BY9A 4USUA 5C25B 3CWJA 1MG7A 5IYBK 3HOZK 1VQ8S 4F8RA 4C0HA 1J5OB 2BANB 4ZJQA 5KFZA 2ZBRA 3EUNA 1HBNA 1JLCB 2XGQA 1FWKA 1WSRA 3TAPA 2BKOA 4NI2B 1AT1B 2ZFZA 3HF5A 4IFYB 5LL6d 4ELVA 3HOYC 1WC0A 4Y2CA 4R0EA 1TWGK 4Q45A 4B9NA 3TNVA 2K8GA 1T3NA 5A0YA 2HQ3A 4DF8A 3FCHA 3JSBA 2E1PA 3MM6A 2V9WA 2MEWA 3U27A 5LSOA 2BW2A 1N33F 3PHTA 3A8IA 3L4JA 3J7YU 3I31A 1NJYA 1SJRA 2RGRA 1KQSR 4KAIA 3KG4A 2H5IB 4NYOA 3IAM9 3MWBA 3M32B 2C2MB 5D0GA 3LPEA 3H5UA 4Y7NC 3BSOA 2FLPA 3LAPA 2ZZNA 3CTRA 5LMUF 4HTJA 1T9YA 2QGFB 3QWPA 1RZMA 3B8HA 4LF4J 3G6YA 1RWNB 5D77A 3WHIA 3H0GK 3MF5A 3TVKA 2NS1B 4KSEB 3MR3A 1H98A 2WSCC 3H4BA 5F8JA 1KHVA 1MU2A 4N47A 5BXIA 4B9SA 2C3OA 5CYMA 4GTBA 3DRXA 4CO5A 4DOZA 4MQ9A 1OWXA 4NLTA 2UUCJ 4JI7J 2OPSA 4MKYA 1RTDA 1LWXA 4OI6A 3G4SS 2HURA 3GFXA 3CDWA 1NO8A 3OTEA 4QW9A 4FYWB 2YU9K 1U1KA 2DEIA 1OPIA 1RAHB 3HOYK 3MAAA 2FHJD 4O4RA 3IXQA 2AJQA 3G87A 2Q79A 4CLPA 2R7WA 4IOBA 3H40A 4BC9A 3QSYB 1FJGF 2MMYA 3I4HX 4CLZA 4ZVOB 1PKUA 1DJ0A 4DZ6A 4OZJA 4PZVA 3N9UC 2VONA 4DMZA 2JNJA 2MZJA 2W2QP 5AXMA 2OI2A 1SC4B 3D3BJ 1FRXA 1VC6A 2OP5A 3MCNA 3LALA 1KQ4A 3QZ7A 3M8ZA 2XSFA 3W9IA 3DGVA 3GIKA 1ICEB 4Y7NK 4P71A 1EI6A 5TJ3A 5K8MA 2JA8C 2ALYB 2MLZA 4AUKA 2DHHA 3FUYA 2IVYA 2DGVA 1D1UA 1FFGB 4ZPAA 2DR8A 5IT9U 2LU2A 1KLNA 5K8PA 2QG9B 4G6VB 3ENVA 3D28A 2OAUA 3IAS9 4Q7AA 1U02A 5C4XC 5F0UA 1HQEB 2YX4A 1P1TA 2PGCA 4Y0FA 2P8TA 4ZN3A 5IT4A 3HD1A 3QGGA 5KOWA 2JWNA 2UVUA 1N36J 1BGXT 2P2CB 4RO0A 1SJFA 2VJVA 3WBZA 2ZD1B 4ZCKA 3CQZA 4LK0A 3NNAA 4O3RA 1JWWA 2A3JA 4I2QA 1U6BA 4RW6A 1UVLA 2V2ZA 2QLJB 1WQGA 3DRSB 2KM8B 3MEKA 4WE1A 4C8LA 4P74A 2HG4A 3PW5A 1L3VA 1J5EJ 2A6OA 2E1MC 5IWAF 3BGLA 3QIDA 4JI6J 3C16A 3LOUA 3VALA 4G1IA 1TL1A 4Y2IA 2R7VA 3I5CA 2FGCA 4TQRA 3MR5A 3T5JA 2VFTA 1EAYC 3V6DA 1S1WA 4NA1A 5EHHA 4A3FC 4DV5J 4O44A 4OYPA 4K0KF 1RT5A 3BP8C 2O1PA 4DV1F 2XMWA 5CHCB 3MMBA 4ECXA 2JA8K 1C4AA 1F7VA 1RWVB 2LLZA 3GTLA 2D6FC 1M1HA 4F4ZA 3TANA 4WFZA 3NWGA 2MQMA 3AD9C 1J27A 4K2JA 5A2QY 1Z1ZA 2ZH9A 4EI2A 1EQMA 4OYZA 1H0HB 1S7IA 2BOAA 5U47A 2MQPA 2HKEA 4A8OA 3QGIA 2EG1A 2RDJA 4UUWA 2B4PA 4WJ4A 1VC0A 2NSCA 2LDIA 3S2HC 2X51A 1D9AA 5BJRA 1HNXJ 3NL0A 4CLYA 2VJUA 3PDNA 1LXNA 2Q6BA 4ZVPB 2X3DA 1IVZA 1IKWB 3OVSA 2MSSA 3S14C 2B8PA 2GMLA 1R8HA 4Q0BB 2XYPB 1OQ3A 3KJNB 1RI7A 1RDRA 3FCWA 2FTRA 2XS7A 7FD1A 5HANA 5EGHA 1I3QC 2FZGB 4J9PA 3JSMB 5F0WA 1T95A 1SUQB 1U7LA 1KVJA 3OJUA 4P2XA 1BQMB 3V2UC 1T94A 3AB4B 3FKIC 3IBFB 1ZS6A 5AJ3J 1LFPA 4LRAA 2ZH5A 1KNZA 3H90A 1VIXA 4A3FK 2P9EA 2OGUA 3OUYA 2MJNA 2Y1IA 1RWXB 3W62A 4KMHA 4J9MA 1UTAA 2HS4A 2V6AA 2IRXA 2F65A 2YPZA 1M5HA 1UEKA 1V9OA 1FRIA 4HI2A 3N79A 2CXEA 2WBMA 2OPPA 2VUGA 5J2MB 2ZE2A 3CDUA 2VC0A 3GTPA 2GSNA 3GFYA 3F73A 3KKFA 1NK7A 1CQMA 3C6UB 5LMUJ 1LQ9A 1RB0A 3IWXA 2HVZA 3FOEA 5BYQA 3MFHA 3AQPA 2FJDB 3LPYA 3HFVA 1YHQS 3RB3A 1VR6A 3S14K 4C8NA 3M8PB 1Z2ZA 4UOFA 2F9DA 1NDPA 1PYSB 1WDTA 1S1UB 4H4OA 4AYBL 2GSUA 4LSLA 1I3QK 2VBYA 3KJFB 3M8YA 4KH1B 2I38A 2G1DA 4BHQA 3ZC4A 1WIHA 1EHWA 2XS5A 4F50A 2PE8A 1VQ6S 2EFVA 3FKIK 2UVRA 1VISA 2P5VA 4A3LC 1VRTB 1TWFA 4PYAA 4GFQA 2A2DA 2H3EB 3OHAA 4EUVA 4BY1C 4QQBA 2WOMB 3DOLA 1ZAWA 5B0EA 4RBUA 2B9EA 3FK4A 1NB7A 4UUXA 1LWFA 5JFEA 2ZH2A 3UDCA 5JUMA 2YX1A 4DFMA 4DL6A 3KLGA 3GFZA 2UVVA 5DLFA 2HK3A 5SZTA 4KRWA 3Q24A 2CJAA 4K4UA 4B3SJ 4C11A 3JYTB 2R7SA 1RGVA 4Y00A 1GE9A 2HFNA 4NCGB 4Y2AA 3LGNA 3BGRB 2GJIA 4I7FA 1NBEB 2I2YA 5T7LA 1TR0A 3I4NC 4H4MB 3JQMA 3HPOA 1S4FA 1IJEB 4C3LA 2UV8A 4DPWA 3DYAA 4DBQA 1IM6A 2H4YB 1YBAA 1F2HA 5CYJA 3EYZA 2HEKA 4DL4A 2AGOA 3MGJA 3HFZB 4I1TA 1C2PA 4GTAA 1CJVB 3D0GE 3C15A 3KNAA 3CCWA 2I5JA 4BWJA 2BJ7A 4WJBA 5EUHA 2HBYB 4X6AC 3FBBA 2K3KA 3E8OA 2CJQA 3LP2B 1XXAA 4F04B 1IUJA 3KLFA 2QV6A 3MFIA 3QIPA 2BQ3A 1Q16B 1NKEA 4BY1K 2N3OA 3QT6A 1WC3A 3TUJC 2ZUEA 1VGYA 1JKHB 1APSA 5L46A 2B7BB 2F40A 5E3PA 3MD3A 2E2HC 2IA0A 4DHVA 4F4KA 4LQYA 1BHNA 4OIRA 1X4FA 3BGOP 2GIQA 4E8UA 3ISNC 5IWAJ 1KLMB 3V6JA 4GKJF 1R7IA 1SJ4P 2JLFA 2QZ8A 3D2WA 3BGFA 2V4JA 4A4JA 4K0KJ 2HNYA 4DV1J 3KK3A 1HNVB 3DC2A 2E1RA 3FHZA 2YNIA 2MZRA 3I4NK 3BGUA 3KDNA 2JLGA 1YGYA 2M70A 1IKYB 4ZVGA 1L3SA 5M2RA 1HI8A 5KTQA 2MKSA 4XO0A 2UXDF 4OIQA 1Q8LA 3GJRB 3H2VE 4NLDA 1X9MA 2J6TA 3EXCX 1TZ0A 4KJIA 2KT5A 2ZEJA 3V4MA 1FERA 4Y3CA 3T02A 4TU7A 3FC9A 1RTJB 2ZBCA 4M5LA 4MYUA 4OFZA 2A6HA 4J9SA 3HK2A 3MOZA 1JNZB 3QT7A 3GR1A 1YZ6A 4PQUB 4I6AA 3UD4P 3AJDA 3G82A 2A2CA 1U6FA 2PPBA 1H73A 1SJQA 2QL5B 4OJHA 1NSAA 2RJZA 2RKIA 5K14A 1YJNS 2HFZA 4FZVA 2FJWA 1CJTA 3L7PA 2E2HK 4RX6A 1KONA 5M3FK 5HP1A 4MMOA 4W98A 1SV5B 1NPKA 1TV6A 2MZSA 2CVIA 5IZHA 3C14A 4I0WA 4KT0C 1EH1A 1K47A 1D09B 1TKZB 4PEOA 1O51A 4CH0S 4ZITA 1U1MA 4IDKB 1EIYB 3PO2C 1TKTB 1OY6A 3U1MA 3BSNA 4TU9A 2V34A 4C3JC 5KFNA 4N77A 3RGIA 2IAJB 1DTTA 3NEKA 2AJ4A 1NK9A 3FSIA 1WOSA 2VDIA 2VDHA 2IFXA 3THTA 3N4WA 2JEGA 3EVWA 4J37A 4LT6A 5CCLA 1NH7A 2EFOA 3K5LA 2DHAA 4LRCA 3OW2R 2BE2B 5C24A 1YI2S 2HBQB 2MQNA 2HNZB 2BJ9A 3O1LA 5D4LA 3NRBA 2ERRA 2CPYA 4JI8J 4C4WA 5A6PA 4PG4A 2R8HA 3EDQB 4LF7J 2V63A 3OR2A 2DEJA 5DZ6A 3R1HA 5CYQA 4RUBA 4QIEA 2B63A 5CZVA 1NDCA 4C0BA 2LKZA 3RBXA 2VF3A 4HEA9 3TZYA 2E1AA 4EMDA 2ILYA 4DQSA 4QWCA 2MDAA 3GEEA 5HVHA 4M5HA 4P52A 1WG1A 4NLWA 3RR8A 2O5IA 4JUZA 4ALZA 1ZTWA 4ID5A 2XSJA 4N56A 1TWAA 5DS7A 1UVKA 3CJQA 1RCXB 3PO2K 3ZZUA 2VD3A 3D4JA 1UEUA 3IG1A 4K7QA 1HNWJ 2L9DA 4NYZA 5LXYA 1C4CA 3DU5A 1NK5A 5IP7C 2FIUA 3FZ2A 3CCES 1HYSA 3BBFA 1M90T 1UJ4A 5EN1A 1WEYA 2M8HA 1UETA 1RHQB 4OYMA 1S4EA 5JMNA 1DTQA 3U02A 3RZAA 4PRFA 3K5OA 3QO9A 1Y00A 1TWHA 2QL7B 5B7WA 4X64F 5M2PA 2DR9A 1IE0A 1Y0HA 1UFKA 2HIQA 3U1NA 2IA6A 4ZPVR 3IM8A 5M5XK 2HS3A 4JV2A 2CRLA 2YKNA 3HKWA 5TMCA 4ICLB 2FJEB 1VC5A 1BQXA 1BS2A 3UCUP 3B4MA 4LOWA 4CYUB 1E6VA 3O5TB 3M1VB 3HD2A 4ECSA 2UUBF 1T02A 4J9QA 3GV5B 4M1XA 1FVSA 1PG5B 2HHWA 3MPDA 2GHPA 1O6XA 5I3UA 1VQYA 3FBEA 2W2MP 4M5DB 3CMAS 4DQQA 4USKA 3CQZC 1ZM4A 4R25A 4CH7A 3HFKA 2X1BA 4XDDA 1PCAA 4NMLA 2A68A 4DQIA 1FKOB 3ILJA 2HVIA 3DRRB 5GVQA 2GJFA 5AXNA 1FWPA 4KN4A 3R5GA 1YNNA 1TL7B 3FCVA 4LREA 1LV5A 4OMFG 3AXMA 2YNFB 5HL7Q 4GZYA 4XLNA 2XQCA 1U47A 4Q2MA 2H5JB 2HQFA 3SXLA 2DD8S 4WYWA 1EETA 4AFFA 1WACA 1WUUA 2XLJA 1RT7A 1GH8A 5HMYA 5LT5A 3WX4A 4HTIA 3OLAA 2HNDB 1RTHA 4IG3B 4BCAA 3GTJA 3GTGA 2JVOA 1S77D 5CQGA 2X1GA 3W2WB 1DQAA 2HLTA 2ZH8A 3BO2A 3GTLC 1XN9A 4OYAA 3ZO7A 3S1QC 3SI8A 3IWNC 4FP9A 3K0JA 5M2UA 3FEYB 3CD6S 4JI3J 5CXTA 1ZBTA 3HKZL 3CJ8A 4LSNB 2RH3A 2B3TB 1ELOA 1N5SA 1N6QA 1X9SA 4XPEA 2CZVC 4LF2A 3PR4A 2NVXK 1HWKA 2HBZB 2IDLA 3HOXK 5J1PA 2ZJRQ 4OZ0A 1D3WA 2EBEA 2WCXA 1KFSA 2OPQB 2EFGA 3OPKA 3KLEB 1DAXA 1E6YA 5IC4B 3W2VB 2BA9A 2BOPA 1B4SA 2FQTA 3T6BA 3W66A 3TI0A 2W9CB 3ET6A 1Q53A 2DR7A 1HI1A 4NXNJ 2VOPA 1K0TA 5DDPC 3KLIA 3CJKA 1AB4A 4B9MA 4K5SA 2M5YA 1N0UA 2I1RA 4GRSA 1XZPA 3S7RA 4ETZA 2O3DA 3GYNA 5CHPA 5CD4A 2Z30B 3I4MC 1HIYA 2AEFA 1WWHA 3M8SA 2UV8G 4ENOA 2W4PA 2ACMA 2CQCA 4CO1A 3CCMS 5HK4A 3TTGA 1NJXA 5D78A 2DB1A 4AT1B 1RT4B 4TLRA 5KT3A 1JLBA 3IBCB 3GTLK 4K5RA 5LOQA 3O6QA 1YTYA 3S1QK 1HHTP 2BRLA 4X4SA 2HRTA 5IQ6A 1RHJB 4DQPA 5EWGA 4JV1A 2NVYA 1I94F 1X4EA 2F9JA 4USIA 3M8QB 2E7XA 3GTPC 2D74B 2C3YA 3A3PB 4UZCA 3BKUA 1BXNA 1TL5A 3UNYA 3DI6A 5D4PA 2D69A 5JXSA 1RSCA 1HLWA 1U24A 1FD2A 2N7YA 2CJBA 3MECB 3R6LB 1NH8A 4OX8A 2ATCB 4BS2A 3UN5A 1U48A 1KRPA 4F02A 3GDZA 2PO4A 2RVJA 1QD1A 3T19A 1HWIA 3SQGB 3SSQA 1SKRA 1C0UB 1EP4B 2QMXA 4U96A 1YRUA 2CWKA 4I4BA 2XG8A 5HJYA 1M5KC 1C0TB 3POTB 4NEZA 4USTA 1CC8A 3DU6A 3IS9A 2IMWP 4YY3J 2YKQA 1YWXA 3DOKB 1NHVA 3QAUA 3QT8A 1GNKA 2KB2A 1RCOB 1YJ7A 2HWHA 2HW3A 3I4MK 1TWFC 4CM2A 4JI2J 2XTJP 1F5AA 3HLUA 5F3TA 1S9GA 1JXEA 1LW2B 3NS5A 3R7SB 1N5TA 2XY7A 1XNRF 1RWPB 2YWHA 5D6GA 3HMJG 1NJZA 2PC6A 1FEEA 4LF1A 1SL0A 2NLWA 2VQFF 2CQDA 3UDVA 2VU5A 1BQNB 2G0IA 1LXJA 4A3BC 4P9SA 4ZHRA 3NXZA 3W5ZA 4USJC 2SXLA 3B82A 2UUAF 5C5JA 3GTPK 3PJXA 3CD7A 2HVDA 4EZ9A 2P9CA 3DDNA 3KUEA 2EBBA 4DV7J 2JL9A 3SBMA 5HATA 4WU3A 1BE4A 4JOUA 3VQTA 3C19A 3OL8A 3RZDC 3T1YJ 2MY8A 4IFVB 1O5JA 4YR2A 1H7WA 3KUGA 2AV5A 1W2IA 4BWMA 4DFKA 4R8UA 2A1BA 3KK2A 2V2KA 3BJYA 2JDJA 4X62J 5IOQA 3CCSS 4OIXA 1JX4A 1UVNA 2MJUA 3CJSA 1LKZA 2IC3A 1QJHA 3HJVA 5BYSA 2UUBJ 3JQJA 4TLQA 1RAIB 2DNKA 5THWA 3M3YK 3MMJA 2LXUA 4XDCA 5B0BA 1CSJA 1CJKB 2YNGB 1U49A 4WXOA 4Q43A 4NX9A 2FY1A 4DV6J 2OKQA 4G1QB 4Z7YA 3ZTSA 3K89A 3HHLD 3HVTA 5C2GA 3PYFA 2EVZA 3TAMA 3CCZA 2RF2A 1VQ5S 1VQ9S 2MPUA 3HXAA 4QZVB 4JI4F 1PYTA 2VG7B 2Y9HA 3J81U 1IS1A 4TY8B 2LEBA 2BZ2A 1HMVB 4P73A 5A2QU 2FY8A 2J0SD 3HXMA 2DR5A 4A3BK 3QFWA 5L39A 3H3VL 4DPXA 4KN7A 3EPIA 3H3VD 1KEKA 2OLWA 3T9NA 4FVCA 4LR8A 2CQBA 2JA6A 4YN3B 3CCJS 4MFBB 1VQKS 2BKPA 2F4VF 4LFCF 2CQ2A 2AEJA 4ED7A 1EKSA 2VZ9A 4KQZA 3RZDK 3D6FB 3KOAA 1NZAA 4KFBA 5KG3A 3UCGA 2WB4A 1JJ4A 3N5FA 2HVHA 2NXNA 2XY5A 2H65B 2GGPA 4KMDA 4TYAA 4KB2A 2F63A 3VZHA 4EBCA 1F1BB 2GVDB 2YKMA 4W90B 1WHXA 5K8NA 2YX7A 4OI2A 2D9OA 1FI4A 2ROEA 5I4MA 2HGMA 4WJ3M 3LP0A 4UF4A 4DV2J 3DLEB 4HDGA 1ZA1B 1SJ1A 4USVA 5DDOC 4DUYF 3FEXB 3BDPA 2HSEB 3KHRA 2QA1A 4RPFA 1HBUA 4CRJA 3O3LA 4EYHB 2W9AA 3W5YA 1GFWB 1NRKA 2IM1A 4O4GB 4WKYA 1Z2LA 3QJJA 1YX2A 2N4CA 2MZTA 2CPJA 2V6SA 2BYCA 4DR6J 2PMZL 2DTJA 1S6PA 3AXKA 5F8NA 2PMZD 4KMUA 2QC3A 4FYVB 5CABA 2CVEA 1GXUA 2H51B 2B5JA 2JJ4D 3K57A 1OMSA 3SYZA 3HSDA 2WTFA 1X4AA 2E1CA 1MWYA 5EWFA 2Y3YA 4ER8A 3WC2A 3TUIC 1O26A 1OYEA 4ES3A 5IT9Y 2E2IA 4YFNA 4MK8A 1UCNA 4DV4F 2NCKL 2C22A 2PDAA 1LW0A 1F9HA 1RKJA 1I94J 4M63A 2AJ0A 3C6TA 4L72B 2OEKA 4F4XA 2YH1A 2DNNA 3DDIA 4YFKA 4G0VA 1I6HC 1NCLA 3MMCA 4RWXA 3LAKA 4X4UA 4OZ1A 2B63C 2ZKTA 3QRQA 1HR0F 3MHYA 1TKXB 2R2UA 1K9MT 1QVGR 1V3ZA 1VHFA 4L3KA 2CQPA 1AFIA 3S1MC 1ZYQA 4WXWA 1X5SA 5B0CA 5FDLA 2ASDA 2B9XA 2R92A 4C6AA 4B3OB 2HQDA 1S48A 4LRBA 4WILA 1HQMA 2CPZA 3TQ1A 1FNMA 1K83A 4QWDA 4X4PA 4I2PA 2PI5A 1TAUA 2H4WB 2AHOB 3IGNA 5HLFB 2NXJA 4YEAA 4LF8J 4EU0A 1TWAC 5JJBA 1HNIB 3CCUS 1YKWA 1XNRJ 3M2VA 1ZVUA 1RT3A 1RXOB 1HD1A 3H0GA 1QM9A 1ZAXA 4BY7C 4N8NA 4OJGA 3IPJA 1BDFA 3CJRA 2RIJA 1UPMB 2PEHA 1EK8A 4WU2A 1ZETA 6FDRA 1T9UA 2VL1A 2JFKA 4MT1A 1XK8A 4ECWA 4YHHJ 1UWBB 3ULHA 4A3JC 1RT2B 2QYGA 3MM8B 1TWHC 3MTJA 1Y9OA 3HSJA 2DYAA 3TX8A 1VOMA 4DSJA 4MIBA 2AZ1A 2YU9A 1I6HK 3RB0A 2KH9A 2PA8L 4F36A 2GJ2A 2PA8D 4ECVA 2B63K 2YQ0A 3RJMB 1CS4B 2DNMA 3K7AC 3PCOB 4OZNA 2DCUB 3KLHB 1LWCA 2DGTA 3GJTB 1PAEX 3BH6B 2R7TA 1XXCA 1N88A 3S1MK 4KO0B 3JXOA 2CFAA 1WQFA 2FZCB 5ETVA 2VPWB 2ZZMA 1HBNB 1WF2A 4DSLA 1LK7A 4DFPA 2CQ4A 5B0GA 3IR6B 3LWLA 1HFEL 1U8SA 2LQJA 3TP2A 4A47A 1RU0A 3ZNJ1 5DJBA 3Q8UA 2KZMA 4KC5A 2G2YA 3BQ2A 1SIZA 4G0WA 1XERA 3GQCA 2WHOA 5D3GA 3R2CJ 5A0YB 5KFPA 4JI4J 3Q8VA 1GTHA 3TAQA 3D9BA 1IKVA 4BY7K 1TVRA 2OTLS 1U4BA 3MM6B 4EO6A 3E01A 4JV5F 4FPRA 2D1CA 2Z2ZA 1PBUA 3I0SA 1OIAA 3TW0A 1H72C 2AW0A 1RJJA 1CBKA 1KOHA 1LEOA 4HYKA 3FMWA 1WC5A 4A3JK 3WQPA 4KHPJ 4ZCMA 4DLEA 4WZMA 4OV6A 1TWHK 3GTJC 3GTGC 1FDBA 4V19J 3QGPA 2F4VJ 3AD8C 4WZQA 2WVDA 1QAYA 3K5PA 2Y0SL 4A3CC 4O3QA 2Y0SD 1SQGA 3K7AK 5C4JC 5HMWA 2HFOA 3G96A 1N5YA 3RUBL 4A8QA 3L4KA 1BJTA 2C28A 1MU2B 3J7A1 2M4MA 3I55S 1M5PC 4ECUA 1SH3A 2RUSA 5CYMB 1W2BR 3MEDA 2AZ3A 3VAFA 4QW8A 2ZDPA 3AHPA 2ALZA 4DN9A 2OPSB 4NZ6A 2D3UA 3JAMU 2HK2A 3GB0A 4ZLNA 3RBZA 2YQ1A 1KQFB 2HFSA 3BEGB 3NCQA 1UZHA 1I3OB 5I3PA 2NPIA 2APOA 2IM0A 2MQOA 2KRRA
chains in the Genus database with same CATH topology
1PJ5A 3GIRA 4P9SA 3A8KA 3GEIA 3AD9C 1VRQC 3TFHA 3AD7C 3TFJA 1VLOA 1V5VA 1WOSA 1WOOA 1XZPA 3TTGA 2GAHC 3A8IA 1XZPB 4PABA 3AD8C 3GEHA 2GAGC 3ADAC 1WSRA 3GSIA 1PJ7A 1X31C 1WORA 1XZQA 1WOPA 3TFIA 1XZQB 5L46A 3GEEA 4PAAA 1PJ6A 1YX2A 1WSVA 3A8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJ5 A;  3GIR A;  4P9S A;  3A8K A;  3GEI A;  3AD9 C;  1VRQ C;  3TFH A;  3AD7 C;  3TFJ A;  1VLO A;  1V5V A;  1WOS A;  1WOO A;  1XZP A;  3TTG A;  2GAH C;  3A8I A;  1XZP B;  4PAB A;  3AD8 C;  3GEH A;  2GAG C;  3ADA C;  1WSR A;  3GSI A;  1PJ7 A;  1X31 C;  1WOR A;  1XZQ A;  1WOP A;  3TFI A;  1XZQ B;  5L46 A;  3GEE A;  4PAA A;  1PJ6 A;  1YX2 A;  1WSV A;  3A8J A; 
#chains in the Genus database with same CATH topology
 1YG0 A;  2WW8 A;  3MAA B;  3CAG A;  5IV4 A;  4PG6 A;  5C42 A;  3ZFV A;  4YDD B;  2W7O A;  2IYI A;  1HQE A;  2G2Z A;  1ZM9 A;  1GT8 A;  1Q86 T;  4CO3 A;  4OQJ A;  3PR5 B;  2V8G A;  2VKR A;  2E5G A;  3QMQ A;  3IA0 A;  1T9X A;  5HVF A;  1JVI A;  2GO9 A;  4LF6 J;  3TUZ C;  3HT0 A;  3VA7 A;  1HL6 A;  2UUW A;  4YFU A;  1XPP A;  4O0I A;  1YCL A;  2XHC A;  4DL2 A;  2PEB A;  1IWG A;  3GTJ K;  3SQO P;  5BR8 F;  2RS2 A;  4GVB A;  5LJ3 Y;  2FQQ B;  1S9F A;  1PBA A;  4A3C K;  2HZC A;  3UR0 A;  2KFN A;  1VRU A;  2IMO A;  2DNR A;  4GC7 A;  3PY8 A;  4M95 A;  3TJA A;  4CZC A;  4DV4 J;  2GQQ A;  1KD1 T;  2NVY C;  3L3C A;  4ANE A;  5B0A A;  3V81 A;  1Q4R A;  3LGM A;  5DET A;  3PW7 A;  2MKY A;  5L1L A;  1U26 A;  3M6W A;  2J5A A;  1KS2 A;  4C2M A;  3N3Y A;  3UN3 A;  2AIR B;  1WKJ A;  3M8W A;  2PMH A;  3BZQ A;  3R6G B;  1FDA A;  3TA0 A;  2AYE A;  3S0X A;  1H3D A;  4I67 A;  1KKH A;  4J9K A;  5J2P A;  4I2Q B;  5M3M K;  1FX4 A;  2ZH6 A;  3CIM A;  3PX4 A;  2OD6 A;  2ZJQ Q;  3RZO C;  3TA1 A;  4B3R J;  4P5A A;  1VYA A;  5H1S V;  4WE1 B;  3T6J A;  4U9R A;  5DQI A;  2JOQ A;  4XAK A;  4Z37 A;  4WFY A;  5C3E C;  3ERE D;  2HBR B;  1X4B A;  1FK9 B;  2V6U A;  4ZP6 A;  3UD3 P;  3C16 B;  1TL1 B;  2GNK A;  5AE3 A;  2C2O B;  3I6P A;  3AOA A;  2OIH A;  4AQY F;  1S1W B;  4O44 B;  2K1R A;  1RT5 B;  2VB6 A;  3GTY X;  3PAC A;  3N28 A;  1RWM B;  1B7Y B;  3MMB B;  5ETM A;  2FGO A;  1X60 A;  3ICL A;  4I56 A;  4ZCI A;  5MLC V;  3UPF A;  1Q8B A;  3GSI A;  1ROF A;  1X5O A;  2H5E A;  3ENA A;  4G7H A;  4J9L A;  4OL8 A;  4A3M C;  4RKU C;  1NEE A;  2AF6 A;  4I6W A;  4P75 A;  3M6V A;  2F5G A;  2OHD A;  2J8S A;  5AXK A;  4XK8 C;  3CD0 A;  3T1H F;  3VTI A;  1NLK L;  4ZJO A;  3HO1 A;  1QE1 A;  1S5Z A;  3GCW P;  1YVF A;  2XHW A;  3CJT A;  1VJQ A;  2HHV A;  1FDD A;  2XEX A;  1D9D A;  2MKH A;  4X66 F;  3CIZ A;  1SL1 A;  1LWE A;  3OTO J;  1UJ6 A;  3DLB A;  3BF4 A;  2R7U A;  5J2M A;  3ILO A;  3PJW A;  5F8I A;  2KG1 A;  1XR6 A;  9RUB A;  4C0O C;  2EBG A;  2CJK A;  2GQ2 A;  4A8K A;  2XUL A;  3HT3 A;  1S9E A;  2LVW A;  1N56 A;  4PPD A;  3UDE A;  1WEZ A;  4LMZ A;  2ASL A;  2MST A;  1A9N B;  2O5D A;  4NLU A;  4U8Y A;  3QJL A;  3L95 X;  4YB5 A;  5E33 A;  1YRX A;  2M88 A;  2NVQ K;  2CJX B;  1CPZ A;  2XI3 A;  3OUY B;  1SKW A;  3NMR A;  4EWT A;  4C8M A;  5KFR A;  3CXC R;  3DXB A;  4JV5 J;  4DR2 F;  2VFS A;  5K8O A;  3T9Z A;  1XMQ J;  1HA1 A;  2GW8 A;  2V4R A;  1HKA A;  3EVM A;  2E9Z A;  3JSY A;  2FJB B;  2D41 A;  3KUH A;  2ZNZ A;  1MRO A;  4U7U K;  2ZH1 A;  2QYC A;  1GX5 A;  4ZK7 M;  2OPP B;  1F6T A;  1IKX A;  3Q86 A;  2ZE2 B;  2MLX A;  2JA6 C;  3FZB A;  2LEA A;  1QSS A;  4KV8 A;  1S97 A;  3VVT A;  4J9R A;  1N5Q A;  2L48 A;  4PQA A;  3BKF A;  2ZM6 F;  3ZZP A;  2PT0 A;  5D0H A;  2D3O R;  4B3M J;  2BM0 A;  1ZYR A;  2MHE A;  2VG6 A;  4WYL A;  4F4W A;  2HMI A;  2CNK B;  3PZP A;  2Q6C A;  4F26 A;  3MR2 A;  1KVI A;  4DQR A;  4L74 A;  4NE9 C;  4H4O B;  3P8B B;  4RZR A;  2PSZ A;  4LSL B;  3OR1 A;  2RU9 A;  2IJN A;  2XCA A;  4MKB A;  1HBO A;  1N4L A;  3DDK A;  3HVA A;  3SEO A;  3GWC A;  1ITP A;  4ZPB A;  3Q8Q B;  5HAO A;  3TVZ A;  1QAI A;  3JB9 k;  3DLG A;  3I4P A;  3LQV A;  3A3O B;  2I8E A;  3I0R A;  3EZO A;  4DS4 A;  2MKI A;  1ZOT A;  2Q43 A;  4DR5 F;  1EQR A;  3DOL B;  5KFF A;  2VA3 A;  1ZBS A;  1LWF B;  3ZZY A;  2OH2 A;  1P9Y A;  5AXL A;  2RQC A;  3D3C J;  3KLG B;  3P6Y C;  2ADC A;  1P27 B;  3HHN B;  4DZD A;  3A13 A;  1B4A A;  3QRP A;  1H2T Z;  2IM2 A;  1SJ3 P;  3TR5 A;  5LM7 E;  1NZ8 A;  2JH3 A;  1JLF A;  2JA6 K;  1WTF A;  4C11 B;  1AW0 A;  3Q22 A;  2UZA A;  2X1F A;  3RR7 A;  3ETM A;  4NXM F;  4I7F B;  4DCJ B;  3UVJ A;  5T7L B;  1N8R T;  3DM2 A;  4ILR A;  3H2U B;  3F41 A;  1B7F A;  3FFI A;  3QPI A;  3MXH P;  2Z56 B;  2E2I C;  3DYA B;  5L1I A;  4J9V A;  3NMA A;  2IIH A;  4IQM A;  4RNN A;  2CDR B;  1NK6 A;  1XWL A;  4Q5V A;  1D9F A;  2OSQ A;  2R8K A;  3C15 B;  2ROG A;  2D3O 1;  5IC6 B;  1N34 J;  1S6Q A;  3OV7 A;  2I5J B;  1EQ0 A;  2XCO A;  1NAQ A;  2HHH F;  2DNY A;  2F8H A;  2DXE A;  2EFQ A;  1DD5 A;  2LYV A;  1BWV A;  2V94 A;  4EGL A;  2H9Z A;  2J9C A;  3L7O A;  1UP1 A;  3TZX A;  3KLF B;  4ZLJ A;  1F5C A;  4L3N A;  5LMN F;  1RTZ A;  4LBI A;  3UFC X;  3GPA A;  3QAE A;  3QJP A;  3VAJ A;  2HQG A;  3IN5 A;  4KY3 A;  1FVQ A;  5T14 A;  1WG4 A;  2ZUG A;  2R92 C;  3FSX A;  3FBC A;  2PA3 A;  1RA7 A;  2VHG A;  4U7C A;  4TKT A;  5EWE A;  1K83 C;  1R8A A;  3ENW A;  2EW9 A;  3I9Z A;  1YSJ A;  1XMB A;  2J6U A;  4QR2 A;  5DM7 Q;  2P6T A;  2K3I A;  1K73 T;  2V4J B;  4OJ1 A;  4J9U E;  1CEZ A;  2HNY B;  1U1L A;  3MPY A;  2ZHB A;  2B9W A;  3UDL A;  3KK3 B;  3H0G C;  1M1G A;  4ES1 A;  2YNI B;  3GII A;  3ISZ A;  3RB4 A;  3D1H A;  4LFB F;  4DS5 A;  5IT0 A;  4KAW X;  4FKX A;  4KAS A;  3N6N A;  4OI3 A;  4FF3 A;  5HQ8 A;  4A8F A;  3A3N B;  1IBL J;  2UP1 A;  3IM9 A;  4HH0 A;  2FVQ A;  1I1G A;  5EX3 A;  4DSK A;  2R2R A;  3EQL A;  2C2K B;  4R0J A;  2ZKU A;  2JEJ A;  4DLG A;  4C8K A;  3HOV K;  2OFG X;  3BS9 A;  4O2D A;  4Y2K A;  1X4D A;  2YU9 C;  1HW9 A;  3KMQ A;  1REV A;  4RUA A;  1QUV A;  4PXD A;  1G2E A;  3G82 B;  4X66 J;  2UXC F;  3M7V A;  2W9B A;  5K14 B;  3GEH A;  2CG4 A;  1JLQ B;  2CPX A;  2BQU A;  1CJT B;  3MDF A;  1U2F A;  2R92 K;  4FF4 A;  1I50 K;  2MQL A;  2MGZ B;  5HP1 B;  1FO1 A;  4ECQ A;  3MTK A;  2MKK A;  3SCL E;  2N4D A;  4IQX A;  1K83 K;  1HBM A;  4C3H C;  3C14 B;  3BH7 B;  1M5V C;  2Q1L A;  2V8P A;  3DLJ A;  1DZ5 A;  1EAR A;  2JZ5 A;  4OX9 F;  1GMW D;  2AD9 A;  2LCW A;  1SL2 A;  4NCB A;  1SVD A;  2DK2 A;  2XBP A;  4DWI A;  3T5H A;  2GX8 A;  4Y52 K;  1N32 F;  1DTT B;  1U2C A;  2V69 A;  2MTL A;  1M5S A;  3JS9 A;  4ED2 A;  3ZZZ A;  2NRE A;  5ETP A;  1DAR A;  2VIH A;  2J7U A;  4P72 A;  1B4B A;  2XO6 A;  2LQ9 A;  2W2P P;  1T8E A;  4LLG A;  3BBB A;  3K59 A;  1NHU A;  5C24 B;  3U1L A;  2N82 B;  2EPI A;  2GVZ B;  2J0X A;  2F3J A;  2C2E A;  4K4W A;  4ZPW R;  1IM4 A;  3OR2 B;  4ILD A;  5DM6 Q;  4DR3 F;  5CYQ B;  1FXL A;  4ECT A;  3ENQ A;  3ZZO A;  3LGH A;  1INN A;  1MN7 A;  1R9T A;  2POK A;  5IOL A;  1X4C A;  2DR6 A;  4HKQ A;  2YKO A;  1ACM B;  1WF1 A;  1CG2 A;  3HZG A;  4ANC A;  4GO7 X;  3TFH A;  3AY0 A;  1D8Z A;  4PWU A;  3ONQ A;  1SKU B;  2HRU A;  5F3Z A;  2ABY A;  1S6U A;  4ID5 B;  4IOC Q;  1B0P A;  3CNQ P;  1SMY A;  3EM1 A;  2XSJ B;  4RU2 A;  1KTV A;  4C3H K;  2NXC A;  1KBR A;  5IM0 A;  4O23 A;  5AT1 B;  2HWI A;  4B08 A;  2RHS B;  1VFJ A;  3I96 A;  3Q83 A;  4FM9 A;  2B56 A;  3PX6 A;  1DLO A;  4DR5 J;  3HOU K;  3IG1 B;  3LH2 S;  5J2Q B;  3M1V A;  3THV A;  2RH6 A;  4AD6 A;  1L3U A;  2KYX A;  1L3T A;  4MJK A;  1HYS B;  1BC6 A;  2BJ1 A;  3TWZ A;  2VFR A;  2QSW A;  2CPH A;  1OSD A;  3J80 Y;  2ZJP Q;  3S15 C;  2GCF A;  2XNQ A;  2LEC A;  4MTP A;  4B9L A;  1WD6 A;  4GMK A;  1DTQ B;  3C46 A;  3QNW B;  3OQ2 A;  1QSY A;  4YG2 A;  3QO9 B;  3EX7 B;  4LIW A;  3DLK A;  5B0D A;  2NVX A;  2W7A A;  1GEH A;  1UA0 A;  4IUF A;  3PKM A;  3OBI A;  1FKO A;  3GR0 A;  4QIW L;  1IN0 A;  1YJR A;  3ISN D;  2Y8W A;  1G6B A;  5J1N A;  2Y1L B;  1UW9 A;  3CPW R;  3MUM P;  4DSE A;  4QYZ K;  2D7S A;  3GEI A;  4P7T A;  2PFD A;  3M8R A;  3G2X A;  4GT9 A;  2QFJ A;  5C2C A;  2RAQ A;  4C8Y A;  3DKD A;  1E6V B;  4BC7 A;  4ZN1 A;  2E7W A;  1BUX A;  2CYY A;  3OTD A;  4CCH A;  4UOC A;  4X84 A;  1RYS A;  2DBB A;  4IG3 A;  3KXD A;  2HHH J;  5FD1 A;  2L9N A;  4C2M C;  4PAB A;  3AJ1 A;  3F44 A;  2RD5 C;  5I3U B;  1TP7 A;  1J6W A;  1SH0 A;  1NK8 A;  2RQM A;  1NKB A;  4FNI A;  3WZ0 A;  1Y5L B;  5ETN A;  1SC6 A;  3SZZ A;  4PPZ A;  3GIJ A;  2VA2 A;  3OPF A;  3S16 C;  2LXI A;  1YJT A;  1TMM A;  1YQH A;  3KK1 A;  1NND A;  4OLO A;  5EDW A;  5GAE I;  3J81 Y;  4XSZ A;  4NCA A;  4RNH A;  1IR1 A;  3W64 A;  5KG2 A;  3CW2 C;  2WBR A;  3GTQ A;  4NL5 A;  4P6Q A;  2YQ3 A;  2XI2 A;  3HHL B;  4ZDN A;  4JI0 J;  4O0N A;  4ZVS B;  3S15 K;  3GLJ A;  1EET B;  1RT7 B;  4OV1 A;  1QLN A;  4ILL A;  4JK1 A;  1ZZF A;  3RBE A;  1VHI A;  4MEY A;  1MML A;  3EJM A;  3KG1 A;  3W2V A;  4ED5 A;  3KHG A;  4UTG A;  4ZIW A;  2YTC A;  4ZA1 A;  1V3S A;  4I69 A;  3BB5 A;  4LFB J;  2CDQ A;  1FE0 A;  3QBC A;  2VBZ A;  3RRG A;  5K5M A;  4Q4Z A;  2OEJ A;  1U1Q A;  1M1K T;  2E5L F;  1DY3 A;  4FDF A;  4QWB A;  3RG6 A;  1O0P A;  2HS0 A;  4A46 A;  4A3D C;  5F9L A;  4QJV A;  2HHX A;  4LF5 F;  3GSD A;  5H9F J;  4LR7 A;  1SB6 A;  4KE5 A;  4GO5 X;  2F7V A;  4KGV B;  1N6Q B;  4C3M A;  3SV3 A;  4C2M K;  4N5S A;  2D9P A;  3A1Y G;  3J7A N;  4BBY A;  2M7S A;  3TOQ A;  4CO0 A;  4A3G C;  5E7O B;  4NLX A;  2V9K A;  3TO8 A;  3ILL A;  2UXC J;  3K5N A;  1HNZ F;  4AL7 A;  2NZC A;  4DR1 F;  4P2M A;  3C66 A;  3ZZR A;  1E6Y B;  5KFV A;  4QIV A;  3S16 K;  3H2L A;  2CQG A;  3T1A A;  4OYX A;  4UOG A;  1N33 J;  3T3F A;  3W60 A;  2LFV A;  1XBW A;  4KPC A;  2QRR A;  1H2U X;  2XLI A;  3KLI B;  1JLE A;  2AJ1 A;  3R8Y A;  3CJK B;  1VJW A;  1CJU A;  1B70 B;  4OIP A;  5A6W A;  1XQI A;  1XZP B;  3NBP A;  3TEH B;  4WPA A;  1RTI A;  2Y1R I;  5IV3 A;  1NPP A;  3EMT A;  3K8V A;  2B6A A;  5A8K A;  1YJU A;  2BV3 A;  1SBR A;  4ID8 A;  3Q8S B;  1WC1 A;  4NOI A;  3CCL S;  5C44 C;  4KGK A;  2FD2 A;  1JLB B;  4UY8 T;  3DOK A;  4Q5S A;  2J76 E;  3A8K A;  1U6Z A;  3DHX A;  2VIC A;  2W4C A;  6FD1 A;  4YP3 A;  1L3K A;  4EBD A;  4AYB D;  4G7Z A;  5KFM A;  4A3D K;  2WON A;  3OJS A;  2KVI A;  3UNG C;  1Z4U A;  3OSP A;  3SDE A;  2AGQ A;  5F8M A;  2ZIT A;  4UOH A;  1URN A;  3DI6 B;  2KL8 A;  1PSD A;  1GXT A;  1FJ7 A;  2CIM A;  1YIJ S;  4DR3 J;  4A3G K;  2IPO B;  5ETK A;  1RT1 A;  3PXG a;  3TX0 A;  1FJG J;  3LAM A;  5KAK A;  4JI5 F;  5IS2 A;  4X4R A;  3PO4 A;  2I6W A;  4DSI A;  2CNN B;  2A6E A;  1RQ0 A;  5M5W K;  4H4K A;  2IRY A;  2Z2Y B;  3CUN A;  1RUS A;  5DLG A;  3N0C A;  3GIM A;  2C3U A;  3CJ0 A;  2E44 A;  3IS9 B;  5I3Q A;  2QMU B;  3TEG A;  2FLO A;  2ZDO A;  1PYO B;  4A8S A;  3NS6 A;  2HQC A;  2A69 A;  4KTQ A;  2E29 A;  3D5M A;  1S9G B;  3A4T A;  1UWA A;  4ZVR B;  2CA9 A;  4Y6I A;  1SC1 B;  3ITH A;  4MK7 A;  3CED A;  5C44 K;  3NP5 A;  1Q5V A;  1ULR A;  3R5J B;  2IJF A;  3FRY A;  3S6E A;  4NPO A;  3BQ0 A;  4DI6 A;  1CJK A;  2YNH A;  4ZHR B;  3RRH A;  5CH7 B;  2M0G B;  2W25 A;  3IP0 A;  2LU1 A;  2HIY A;  2JA5 K;  1R8B A;  1HWU A;  4WP8 A;  1HI9 A;  3R97 A;  1L5U A;  3R3T A;  3MEE A;  1GMU A;  1IBM F;  2CQ3 A;  1OO0 B;  2QSF A;  2VG7 A;  3BQ1 A;  5GAE U;  3NCP A;  3TJ8 A;  4YR0 A;  4NA2 A;  4PWD A;  5SUH A;  4UY8 5;  1PO6 A;  1QY7 A;  1YBT A;  2FQO A;  1KQG B;  3GTK K;  4R8U B;  4MAK A;  3I5B A;  1DFD A;  1MWQ A;  3KK2 B;  4OI4 A;  2QJ3 A;  3MMA A;  2CQ1 A;  2XMA A;  3W7B A;  1R0A A;  4KPY A;  3NGK A;  5KFB A;  1ZTT A;  4CLT A;  1KFD A;  2DY9 A;  2G13 A;  4UQG A;  3H5X A;  2RT3 A;  3RBD A;  4Z2X A;  4W4M A;  2CFX A;  2COL A;  1Y1W A;  5HL8 A;  2FLL A;  2MZ1 A;  3ZZT A;  5HRO A;  4LF4 F;  4FXD A;  3SCJ E;  1JIH A;  1F93 A;  1NDK A;  3HM9 A;  3HVT B;  1FFW B;  3C2P A;  3TAM B;  4I6Y A;  3FKB A;  2RF2 B;  2GV1 A;  1RAA B;  4DUZ F;  4KB7 A;  4DV0 F;  4AXJ A;  1D0E A;  2BJ3 A;  1GTE A;  1AZS A;  4JI7 F;  1NDL A;  1NSQ A;  4PXE A;  2BR0 A;  3VAG A;  1WSV A;  4IRD A;  5JVH Q;  3IGV A;  2NQP A;  1TFW A;  3NY0 A;  3NG8 A;  2XMU A;  4HHH A;  5BYR A;  2YKA A;  2ZZT A;  4IYQ A;  3P3D A;  4HDH A;  2MQ8 A;  1YZ7 A;  4FBT A;  4C8Z A;  5C7P A;  4BKW A;  3HVR A;  3M4O C;  3OXF A;  2J0Q D;  1RAC B;  2CPE A;  5EGE A;  3EZU A;  2JSX A;  2P9G A;  1R31 A;  2E5L J;  2I9S A;  4MK9 A;  1VLY A;  3MZI A;  5DQH A;  5FLM C;  2FHJ A;  3DRP A;  4HLB A;  2GGP B;  4DX6 A;  2PD1 A;  3UCZ P;  2ZOM A;  2YKM B;  4RNF A;  4ZPC A;  3JST A;  2A6M A;  2HVE A;  3LP0 B;  4CLU A;  4IG0 A;  5G0R A;  3JAM Y;  1RAE B;  2AX1 A;  3MM5 A;  3BYR A;  4E0D A;  2KJW A;  1R43 A;  2AEM A;  3D6H B;  4IR1 A;  4F4A A;  1HBU B;  2RDI A;  2OPR A;  1IBA A;  1O2B A;  4WP9 A;  4DR1 J;  3UO0 A;  4M5J A;  4ETX A;  1L0W A;  1WHV A;  3G8T A;  1FRJ A;  2VPY B;  3ORE A;  3JTO A;  1FNX H;  4OZL A;  1URR A;  4PKD B;  4KAR A;  4B3T F;  1S6P B;  1VH2 A;  1N36 F;  2EKY A;  2Z57 B;  5A8R A;  4B9V A;  2B5J B;  3M2R A;  5I42 B;  4G0U A;  2M9K A;  2XWX A;  2EG2 A;  1TK5 A;  3PNI A;  2UUT A;  1KC8 T;  4QYR A;  4EEY A;  3M05 A;  1WKL A;  1PC4 A;  3M4O K;  1QSL A;  2FZK B;  3BSC A;  2CQ0 A;  3FJ2 A;  5ETO A;  2EWH A;  3OFE A;  4A3E C;  3TRG A;  2HAF A;  1Y4Z B;  1SFO A;  2R4F A;  4FYX B;  5DG9 A;  2VC1 A;  1CVJ A;  5FLM K;  2Z2M A;  4JI6 F;  1LW0 B;  2ZHO A;  3H5Y A;  4QIF A;  2NZ4 A;  4IH6 A;  1J98 A;  2LEP A;  3C6T B;  2R8J A;  3KFW X;  1RAJ A;  4DXL A;  1TAQ A;  4N8O A;  3SMZ A;  1RP5 A;  4NLP A;  4QOT A;  5J2N A;  1R8C A;  3MMC B;  3G86 A;  3QLH A;  4NRT A;  4RNM A;  1X4G A;  4BBS K;  1Q5Y A;  1DQ8 A;  1UL3 A;  3DN9 A;  2NYI A;  1SIW B;  4M8L A;  3R7N B;  1R9T C;  4ZKA A;  8ATC B;  2EK1 A;  2FC8 A;  1SI9 A;  1K44 A;  5FDL B;  2KZZ A;  1F9F A;  1RT2 A;  3PKY A;  1PAU B;  2LQ8 A;  2M8D B;  1F0X A;  3AFG A;  1C1C A;  1U0H A;  3H5S A;  1JLA A;  3G6X A;  3FRZ A;  1KTQ A;  1YK9 A;  3GG0 A;  4RU9 A;  4I2P B;  2YWK A;  3MEG A;  4ZVQ B;  3KLH A;  4IH5 A;  3OL9 A;  2N7C A;  2VBW A;  3T00 A;  2XGP A;  3M2V B;  1RT3 B;  5KG4 A;  3ZNU A;  2LP4 A;  4CNY A;  2V0N A;  3DOM B;  4LFA F;  1S76 D;  4A3E K;  3T5L A;  3S01 A;  4NLG A;  3IRW P;  4KAT A;  2J7W A;  1UW4 A;  4KKO A;  5ETQ A;  2BMB A;  2DNP A;  5AJ3 F;  2R7O A;  2OMO A;  4XTT A;  1SXL A;  3PYG A;  4U67 Q;  4DL5 A;  2NVX C;  2QFI A;  3X3U A;  2O66 A;  4KMA A;  2Z2L A;  2KT3 A;  4UZB A;  1IBM J;  1X4H A;  1NU4 A;  3HOX C;  3NGS A;  2DCL A;  1U1O A;  5KFO A;  1G7C B;  3DNC A;  2E5I A;  3OFF A;  2NUH A;  1OQ6 A;  1LWC B;  1R9T K;  1QTM A;  1S1V A;  2Y8Y A;  1WKK A;  4ZVE A;  3KHL A;  2Z4P A;  1UZD A;  2FDN A;  2Q3P A;  2CFA B;  4E98 A;  2QIF A;  1Y5I B;  4WK3 A;  2JC0 A;  1MMN A;  2RB7 A;  3SCK E;  4GKJ J;  4DL3 A;  1S1T A;  1W25 A;  3IFE A;  3LAJ A;  5GAG I;  5DO2 A;  4PG8 A;  3BUE A;  2P5M A;  4DPO A;  4N41 A;  5IP9 C;  2ZC4 A;  3H20 A;  3SSR A;  5DG8 A;  4JB8 B;  4PUO A;  3K8W A;  5D3G B;  2R7Z A;  4CM0 A;  3S8S A;  4ZVU B;  2KU7 A;  4DUZ J;  1Q79 A;  4NLY A;  2DXF A;  1N5V A;  4DV0 J;  3R5A A;  7AT1 B;  2PMW A;  1IKV B;  1TVR B;  2CZ9 A;  4IH7 A;  3SV4 A;  4NEY A;  3IO1 A;  3E01 B;  2VH7 A;  2G2O A;  3GTQ C;  5ETR A;  1FFS B;  3LP1 A;  3BP3 A;  1RK8 A;  3G4A A;  3KDO A;  3I0S B;  2UXD J;  3O8W A;  2BAC A;  3ETO A;  2Y1J A;  2VUM A;  4L6V 3;  3HKZ D;  2AP6 A;  1WNE A;  4BLA A;  2DNZ A;  3MM9 A;  2YWE A;  1FRK A;  3GU0 A;  4ZLP A;  3HHE A;  4YQW A;  3RAQ A;  1NM2 A;  4OYB A;  4CQ1 A;  2BAB A;  2XMT A;  1IQ0 A;  3W9J A;  5KFS A;  3PRV A;  1S0V A;  1ZA2 B;  3MUV P;  2WVF A;  3VQS A;  3CT9 A;  2ZBI A;  4MKV A;  2L08 A;  1N5Y B;  1VCT A;  1Q7L B;  3HSZ A;  5E3C A;  4DSF A;  5E3A A;  3ZTP A;  5KFI A;  3S1N C;  5FJ8 K;  5FJ4 A;  3MED B;  4B3S F;  1TUW A;  2WVE A;  3M9M B;  3WDO A;  2E2J C;  2W7V A;  4GTL A;  3D68 A;  4PYD A;  1B0T A;  4EFA C;  5HJX A;  2BXJ A;  2BBE A;  1KVK A;  2YH0 A;  2PI4 A;  5KFE A;  2CKW A;  2DXD A;  2F4F A;  1RAF B;  3VGS A;  3CDE A;  2DH7 A;  5A76 A;  2M3D A;  4CP5 A;  3OFH A;  1NME B;  5IP9 K;  3O2I A;  1GMV A;  4RW7 B;  3VAH A;  3T01 A;  2C2Z B;  3D66 A;  1ZXO A;  1D8Y A;  1FJC A;  2XC9 A;  4HL9 A;  5C42 B;  1U0S A;  1P6T A;  4Y34 A;  1Q81 T;  1IJF B;  2CNL B;  4JI1 F;  2EC0 A;  2ROP A;  3PFE A;  2V8V A;  4OI1 A;  5KG0 A;  1V3R A;  4O3S A;  2DIU A;  4B3T J;  3GTQ K;  5IXU A;  2ATL A;  4P5B A;  3QT5 A;  4YUD A;  4Y65 A;  4ECR A;  5HQL A;  5LSR A;  4ECY A;  2JC1 A;  1O27 A;  2QLF B;  4HH1 A;  2ZUF A;  4KGZ B;  1WDD A;  2U1A A;  4A3K C;  2FVP A;  1RU1 A;  2EK6 A;  3MAH A;  3CE8 A;  3KJV A;  4MIA A;  1DBD A;  4GVB B;  1ZAV A;  1XR7 A;  1XNQ F;  4ILM A;  2KXN B;  2UXB F;  4CO2 A;  5MAO A;  1VRU B;  4AND A;  2BE7 D;  1FK9 A;  2DHX A;  2M52 A;  2KN4 A;  3UR3 C;  3IBW A;  1IWA A;  4CT9 A;  2VOO A;  1HPZ A;  3S1N K;  3V81 B;  2AQ4 A;  2KI2 A;  3K2Y A;  2R3V A;  2E2J K;  4NA3 A;  3M3Y C;  4DX8 H;  4ED6 A;  3EDR B;  4FF1 A;  3EIC A;  2M2B A;  4RW4 A;  3G9C A;  2B8Q A;  3H42 A;  4DG1 B;  2FJX A;  3PW4 A;  4ELT A;  4QCL A;  4KDD A;  4YDX A;  2O5J A;  4NLS A;  2DH8 A;  1CLF A;  2R9L A;  1TL4 A;  1WF0 A;  3OFG A;  3OTC A;  4B02 A;  4BLG A;  2AWZ A;  5J2P B;  2CZ4 A;  1B3T A;  1TL3 A;  1VIO A;  3S2D C;  3F56 A;  3HX9 A;  4H4K C;  1VQO S;  2WZ1 A;  2W2N P;  2X7I A;  5C4X K;  2LMI A;  3TZZ A;  1Q82 T;  2AGP A;  2RU3 A;  5HBM A;  3FGV A;  5E41 A;  4U95 A;  3DXJ A;  3J80 U;  5J1E A;  1TMJ A;  1WCM A;  5KFK A;  4X64 J;  1VDH A;  4IO9 Q;  3SCI E;  4RW8 B;  3HDS A;  1EKR A;  4A3K K;  1QAJ A;  4ZVT B;  2K1R B;  4O3P A;  5HSP A;  4DDF A;  1VQM S;  4RWW A;  4LBH A;  2YPY A;  1HQU B;  4Q8F A;  4LFA J;  2AKW B;  4DFJ A;  2JLE A;  3GYX B;  4XSX A;  1EZZ B;  3D0I E;  3TA2 A;  4F3O A;  5LXR A;  3PW0 A;  3VWS A;  3FDS A;  5GAG U;  3NAI A;  3UQS A;  2CW0 A;  3I5A A;  2FHO B;  4LRD A;  2KXF A;  2ZUA A;  3M9O B;  1H38 A;  3HOW C;  1XZQ A;  3M2U B;  1HI0 P;  2E5J A;  1U8W A;  2B51 A;  1GXL A;  4TXS A;  2CJY B;  3VZI A;  1QE1 B;  4KH0 B;  1NSK L;  3D67 A;  1RT6 A;  4MH8 A;  4WCE Q;  1IW7 A;  2IVF B;  2UVW A;  4HAC A;  3WIU A;  2QX0 A;  2FJA B;  3MM7 A;  2BE9 B;  2YWF A;  5A8W A;  1FA0 A;  1S1X A;  4X4T A;  4EO8 A;  1NXI A;  1LWE B;  4WII A;  3N6L A;  1S0N A;  1JLG A;  2X3G A;  3S2D K;  3Q8P B;  3N0B A;  1IQZ A;  3S2H K;  5IOT A;  4JI8 F;  1S9E B;  1YJ9 S;  1Y1W C;  4L75 A;  1VRQ C;  4LF7 F;  1JJ2 R;  3DHW C;  4USH A;  1WJ9 A;  5F9N A;  2V8D A;  4USW A;  1UAW A;  3RRK A;  1FHT A;  2XZW A;  4A48 A;  2HGL A;  3V4G A;  1DRZ A;  1OY8 A;  4C3K A;  2K2P A;  1S0M A;  4ZP8 A;  3BBC A;  1WOR A;  5D4O A;  2MY7 A;  1KQK A;  4DN0 A;  1F7U A;  4C97 A;  1MRO B;  2DIS A;  3B78 A;  2GA7 A;  3G6E S;  5B08 A;  2NPF A;  5KT2 A;  4WWS A;  4OX7 A;  1IKX B;  3EVO A;  4LJZ A;  1FKP A;  3HOW K;  2EFP A;  2DH9 A;  1C1B A;  1TUV A;  4KV8 B;  2P8I A;  1XIQ A;  4GVL A;  3M30 A;  4RMF A;  1HNW F;  5HVG A;  1JB0 C;  1V5I B;  4BXX C;  4V19 X;  4X4V A;  2GHV C;  2VG6 B;  4F7V A;  2KTQ A;  2HMI B;  4CI0 B;  4C98 A;  2KO1 A;  3DGP A;  2WVB A;  4QR0 A;  1FXD A;  2QEX S;  4K4V A;  3IRX A;  3EGZ A;  5H9E K;  2QLX A;  4R5P A;  3V6K A;  1WC6 A;  1XC9 A;  1YLX A;  3PW2 A;  3OR1 B;  3QSI A;  1WQH A;  3OVA A;  1CUL B;  1BMQ B;  3Q89 A;  3I56 S;  1FF2 A;  3B6B A;  4KR0 B;  1X31 C;  1HBO B;  4FNH A;  3RW7 A;  2R2T A;  2N3L A;  1Y1W K;  3G8Q A;  4CDI A;  1WTB A;  4QBU A;  2JRS A;  1X7V A;  3BPS P;  4A8Y A;  2DGX A;  3HZE A;  2FUG 9;  3DLG B;  3P49 B;  5AE1 A;  4OYW A;  3I0R B;  2RSQ A;  1WI8 A;  2ZHA A;  1R6V A;  2VPZ B;  2ZOG A;  2DO4 A;  4GTC A;  4RW9 A;  4JI1 J;  1Q95 G;  1K1S A;  2G0J A;  3NGU A;  3PYE A;  4K2X A;  4BDP A;  1FWL A;  1UA1 A;  2MB0 B;  1S79 A;  1X5P A;  3VGU A;  1UV7 A;  4F0M A;  1KSP A;  3LF0 A;  4HVZ A;  4WIQ A;  4LIR A;  4LUB A;  4GTD A;  2R93 A;  3AA9 A;  4A3L K;  1T03 A;  2DRD A;  3CO0 P;  3A12 A;  3GE9 A;  3ZTQ A;  2BVZ A;  3LPX A;  2DPI A;  1JLF B;  2FPH X;  3MUR P;  1T05 A;  4RR5 A;  5LSL A;  4BXX K;  1XNQ J;  3UVJ B;  3EGW B;  3DMJ B;  3HHK A;  3E2E A;  4L76 A;  3EGN A;  3DM2 B;  3AAW B;  1MNE A;  3V4I A;  1USM A;  2UXB J;  3Q2S C;  1SFO C;  3FFI B;  2HZA A;  5K9F A;  4LR9 A;  3D0H E;  4LBP A;  3GIR A;  1I50 A;  2B4U A;  4DX5 A;  4B9T A;  3SFG A;  1YRT A;  2VG5 A;  1HAR A;  1VBZ A;  2AT1 B;  2XLK A;  5DDQ C;  2ADB A;  1WC4 A;  3T5K A;  3I32 A;  1S6Q B;  1TWC A;  3AQO A;  2VV5 A;  5CCM A;  2Z0G A;  2DIT A;  4OYI A;  1IL2 A;  4DDQ A;  1M5O C;  1VQ7 S;  4X4Q A;  3GIL A;  5K20 B;  4U7U D;  4Y28 C;  2XMV A;  3G71 S;  3UW1 A;  1VJE A;  5C25 A;  3MPV A;  1QDU B;  4NLR A;  1J5O A;  2BAN A;  2CAJ A;  1MN9 A;  3P4U B;  4ZOS A;  4JI3 F;  2VQF J;  2IDE A;  1JLC A;  4ZH4 A;  3H25 A;  4NAS A;  2CWX A;  3GJS B;  4NI2 A;  4ZPD A;  2G0C A;  2HPU A;  4X6A K;  1VBX A;  4IFY A;  2UUA J;  1FD8 A;  4YOE A;  4BLB A;  3S17 C;  5ITH A;  2QE5 A;  4D3H A;  1DCH A;  2YWW A;  1F5B A;  2C1E B;  5ETS A;  2R7X A;  4NMX A;  3H8Y A;  1JLQ A;  1Q1K A;  2DKO B;  3UWT A;  3EXY A;  4TN2 A;  1RBA A;  2CPD A;  2NUU G;  3QQC D;  4DPY A;  1AB8 A;  4LVN P;  2MGZ A;  4YB1 P;  2W7P A;  4S0M A;  2EFN A;  1M0S A;  1SFO K;  4NXN F;  3T41 A;  3KG0 A;  3D1Q A;  4CTA B;  3AT1 B;  2J7K A;  1P9Q C;  3ELH A;  3L9Z A;  4DUT A;  2QA4 S;  5KFQ A;  3M32 A;  3CVK A;  2OJ3 A;  4QU6 A;  3H4D A;  5KFJ A;  1I51 B;  2EKN A;  3TUP A;  5E2Q A;  1FT8 A;  1RBO B;  5CJ9 A;  2MHN A;  4ZMM A;  2BQR A;  2XMJ A;  2DVI A;  4F3M A;  4PAA A;  2O01 C;  4IKA A;  3J7Z T;  1FTC A;  1REV B;  3Q23 A;  4JV0 A;  4ZVF A;  4OI0 A;  2RHQ B;  3MCM A;  1I6V A;  3M4X A;  3CJ5 A;  4IOA Q;  5FLX U;  5IOS A;  2E9R X;  2W9B B;  2DNO A;  1TKD A;  2QT7 A;  3C8Y A;  4I68 A;  2OTJ S;  2RE1 A;  4HR2 A;  2ACY A;  3V5R A;  4O3O A;  2B9Y A;  2GSO A;  5KFA A;  2G9O A;  2K7J A;  3MPU B;  2GVZ A;  4ZCL A;  4FN5 A;  2FC9 A;  4NLV A;  2CPI A;  3VGV A;  1HBM B;  1YIT S;  4IR9 A;  3S17 K;  1R6Y A;  2HQI A;  4KGM A;  4KB4 A;  2AJF E;  3GFH A;  4Q8E A;  3G4C A;  5DG7 A;  3MR7 A;  3PYD A;  2AYB A;  3IR5 B;  2XYG B;  4LFC J;  2ZBP A;  2KDO A;  2R7Z C;  1PJ7 A;  3MI7 X;  1R3N A;  2WSE C;  4C3I C;  4LQ9 A;  4M5I A;  4J9O A;  1JK9 B;  4YME A;  4ECZ A;  5F41 A;  3L4B C;  4WFA Q;  1WEX A;  2ZWO A;  4DL0 C;  1O2A A;  2FYX A;  1T3O A;  1Y3K A;  5IYD C;  2DJW A;  4YY3 F;  1HD0 A;  2VUM C;  2WB1 L;  1S72 S;  5B09 A;  1P8G A;  4HI1 A;  3AH5 A;  3KHH A;  4JI2 F;  2WB1 D;  1RAB B;  1RTD B;  1XXB A;  1VQS A;  3H0P A;  4DUY J;  2MYF A;  4WBF A;  1O24 A;  5J2Q A;  2YKP A;  2EXU A;  4QR1 A;  4C3J K;  4C48 A;  1T9T A;  1IBC B;  2Z8Q A;  1NJI T;  2W4D A;  1MWZ A;  3KLV A;  2E66 A;  1WOO A;  1HHS A;  5GAH I;  3IR7 B;  1RBL A;  1GK8 A;  1ZM2 A;  4NLO A;  4CLF A;  2BW7 A;  4ZVH A;  4WTO B;  1WEL A;  5CZX A;  1TK8 A;  3UE2 A;  3KYL A;  3R9L A;  4DV7 F;  1Y3J A;  3BM7 A;  3HI9 A;  2DGQ A;  2ZD1 A;  3J7Z 5;  4WKR A;  2L41 A;  4DR4 F;  4RNO A;  3T1Y F;  1UVI A;  5IM0 B;  1O28 A;  1I6J A;  1BD6 A;  2EEY A;  3DRS A;  2R7Z K;  1DLO B;  2DIV A;  4C3I K;  3ZTO A;  4X62 F;  2FVS A;  1MLA A;  3JQK A;  1WOP A;  2PHC B;  3NGD A;  5GMD A;  1LOU A;  3NS7 B;  3HHD A;  4TU8 A;  2DNH A;  5IYD K;  2KKH A;  4FKY A;  2JA7 A;  2J8A A;  2NXE A;  3PM9 A;  1AYE A;  4QYZ J;  2WAQ L;  3VAK A;  2C2N A;  2VUM K;  1FRL A;  2WAQ D;  4DF4 A;  4OHV A;  4DV6 F;  2GIR A;  3C3L A;  3HJF A;  2F8M A;  3HUL A;  3DLK B;  4M94 A;  4QPX A;  3D1O A;  2VAS A;  1AFJ A;  2J9E A;  2C2R A;  5DDR C;  3OT9 A;  1PIL A;  4FXW A;  2E9T A;  1HR0 J;  5IP7 K;  4LF9 F;  4ITS A;  2LXF A;  3NLC A;  1XR5 A;  3AD7 C;  2R2S A;  4RW6 B;  4C9D A;  3DRY A;  4PXB A;  1S6O A;  3CCR S;  5RUB A;  3I9V 9;  3HHL A;  1W26 A;  3S1R C;  5KFU A;  3N6M A;  2BRK A;  1EX8 A;  2KRB A;  3S1T A;  2DPJ A;  3R5D A;  3OXL A;  4GTE A;  3VR1 A;  4OZ2 A;  3KWM A;  4MEX A;  3IMQ J;  2XNR A;  1IKW A;  4E2F B;  2NVQ C;  3V6D B;  3TAR A;  4Q0B A;  4K4S A;  2H1Y A;  2D3Z A;  2FHK A;  3GCX P;  3FMB A;  1FX2 A;  3PJ9 A;  1YBU A;  2YY3 A;  3BO3 A;  3RB6 A;  2K7K A;  3JSM A;  2CJ9 A;  3KJQ B;  3GG1 A;  3KK1 B;  1SUQ A;  3D7S B;  4OIN A;  2FJV A;  4JBC A;  3WX8 A;  1BGW A;  2JVR A;  1BQM A;  2KT2 A;  1NK0 A;  4YFX A;  2VFV A;  4TY9 A;  4DV2 F;  1W7W A;  3R7B B;  4OZ5 A;  5LJ5 Y;  1WCM C;  4WFX A;  3AB2 B;  4RBV A;  2J0W A;  3CQZ K;  2DGU A;  4A8W A;  2BJD A;  2V4Q A;  3W8G A;  3AH6 A;  1VI7 A;  4ZLL A;  6AT1 B;  5HI7 A;  3GON A;  5H9F K;  5D0R A;  4PWW A;  1N54 B;  5E3R A;  3VF0 B;  3KTQ A;  2YWG A;  3D6T B;  1JQG A;  3LUY A;  4DR6 F;  3LW5 C;  2C3P A;  3QZ8 A;  1IBK F;  1JOE A;  4PG5 A;  3O44 A;  3S1R K;  4M5N A;  2KXH A;  2FLN A;  4QJV B;  1UMJ A;  3ILI A;  3THP A;  3C6U A;  1FES A;  2HYI B;  3B54 A;  4ZS6 A;  2DHG A;  5KFC A;  1Y11 A;  4J90 A;  3W63 A;  3GMG A;  4DJB A;  4WK1 A;  2BDP A;  3EZ5 A;  2DT9 A;  3M8P A;  2W1B A;  4DR7 F;  5KOX A;  1S1U A;  2W8L A;  3W65 A;  4P2F A;  1JXV A;  4OYO A;  3EPG A;  3U7J A;  1O2F B;  4QU7 A;  3BSA A;  1KOO A;  1U1R A;  2OD4 A;  4A93 C;  1Y1V A;  3W61 A;  3NNC A;  3W9H A;  3AOC A;  1RHK B;  3NOC A;  1R27 B;  4HHU A;  4DPT A;  2VOD A;  5GME A;  1JLE B;  2JA5 A;  1VRT A;  1F9E B;  4KIA A;  1WCM K;  1CJU B;  2OEL A;  5HN0 A;  4AL5 A;  3VHQ A;  1ZZN A;  2AJ2 A;  3W5X A;  3NBP B;  8RUC A;  2V2V A;  2WOM A;  2Z58 B;  1MW7 A;  4NZ0 A;  1RTI B;  5GAH U;  2B6A B;  2C3M A;  5A8K B;  1T7P A;  3PRD A;  1RAD B;  1FKA F;  1J6V A;  3PG9 A;  1QAX A;  1S10 A;  3GTK A;  5E0O A;  4J5O A;  3OL7 A;  4CIO A;  2MKC A;  5D15 A;  3H98 A;  4NLQ A;  4IO1 A;  5E5N A;  2QA2 A;  3GTM A;  3P45 B;  3DFE A;  2WON B;  3JYT A;  4P7V A;  2W01 A;  3BV8 A;  4LF8 F;  3MML B;  4NCG A;  3SDE B;  3EWG A;  1ARO P;  2BJ8 A;  5D0E A;  3BGR A;  2DGO A;  1WHY A;  1NJW A;  1NB2 A;  3KMS A;  4H4M A;  2R7Q A;  2HHT A;  1VGX A;  4M1K A;  1VMB A;  3H7H B;  1H6K X;  3PX0 A;  1U1P A;  4RLE A;  2E5H A;  1RT1 B;  3NUH A;  3PEJ A;  2RDD A;  4F0H A;  4ERD A;  5KT5 A;  1CJV A;  3Q3Q A;  1VQP S;  1S99 A;  4YHH F;  1K8A T;  1MSW D;  4X65 F;  4A93 K;  4CT8 A;  2DRB A;  2FVR A;  3PV8 A;  3TFI A;  2OUG A;  5GMK a;  2BUN A;  3LP2 A;  4ZJL A;  2WSF C;  1XJW B;  2KWA A;  4KC6 A;  2XCQ A;  4DR4 J;  1T11 A;  4LQ3 A;  1GX6 A;  2W24 A;  5BR8 J;  2OFH X;  1JKH A;  1NK4 A;  4RBT A;  4IRK A;  1P1L A;  1S49 A;  1X9W A;  3ITH B;  3CB4 A;  2JX2 A;  4QWE A;  2KFY A;  2AX0 A;  3B4D A;  4DV3 F;  4CLK A;  3PVX A;  4Y2M A;  2KG0 A;  3GZ7 A;  1KLM A;  2CG8 A;  3ZTR A;  3MOJ B;  2YVS A;  4CLS A;  3CC2 S;  5F8H A;  1AUD A;  3MCO A;  3TZW A;  1IR0 A;  3PEH A;  2YNH B;  4FPI A;  2R93 C;  1HHQ A;  3PFO A;  1TWF K;  3TJ9 A;  3CJ3 A;  2CNO B;  3HOV C;  1HNV A;  2U2F A;  4QPT A;  1WHW A;  2ZBQ A;  4CO4 A;  4LK1 A;  4ELU A;  3MEE B;  1FXR A;  3EE3 A;  4K50 A;  1OY9 A;  1WG5 A;  3QIP B;  1IKY A;  1I5O B;  4QIG A;  4LF9 J;  3IWL A;  4PWD B;  3CCT A;  3TQE A;  3VGT A;  5EX0 A;  1I50 C;  3UI3 A;  3LTO A;  3CC7 S;  1QVF R;  4FZB A;  4OJ3 A;  3MMA B;  1R0A B;  1RE1 B;  2DNG A;  4KHP F;  4OHY A;  1RTJ A;  3CJ2 A;  4J9N A;  4XLP A;  3CF5 Q;  1TWC C;  1OJ4 A;  2P6S A;  4PQU A;  2QA4 G;  3NAH A;  2KHD A;  1N48 A;  5HRO B;  5GAD I;  2JEI A;  4AQY J;  2WRM A;  2ILZ A;  2GAH C;  5KT4 A;  1RYR A;  4ED0 A;  4AL6 A;  4XPC A;  2E7V A;  1SPB P;  3F0N A;  2RRA A;  4Y52 C;  2BEF A;  3R2D J;  4JYA F;  4OHZ A;  3MAQ A;  2EC2 A;  1SV5 A;  1OYD A;  1AZS B;  1H74 A;  2PII A;  2KJV A;  3LO3 A;  1DHM A;  1ZH5 A;  1PGZ A;  4K8R A;  4JP8 A;  3GTO A;  1TKZ A;  2V5H G;  2R93 K;  4FYY B;  4DL7 A;  3I82 A;  1VBY A;  1YDL A;  3T1H J;  4IDK A;  1TKT A;  3UN2 A;  3BRE A;  2HFU A;  2KHC A;  4EZ6 A;  2OEM A;  1TUG B;  4EBE A;  2IAJ A;  2VPX B;  3Q0A A;  4P10 A;  3BYP A;  4Q44 A;  4O3N A;  1ZPV A;  3AOB A;  2RKI B;  2K06 A;  4TYB A;  4YS2 A;  1IBK J;  4KBI A;  1UVM A;  2QN6 B;  1RWO B;  2AYG A;  2YXL A;  2L3M A;  3BKT A;  3CME S;  3DRP B;  1TFY A;  2ZC3 A;  2BE2 A;  1X8D A;  5KG7 A;  5KFX A;  1RWU A;  2BX6 A;  5ADZ A;  4LF6 F;  1G3O A;  2HHU A;  2HNZ A;  5I42 A;  5KFY A;  4B9U A;  4U6P A;  1N52 B;  1TWC K;  1TV6 B;  2V8H A;  3RU0 A;  4IG0 B;  3BN4 A;  5G0R B;  4G3I A;  3OLB A;  3MM5 B;  4XCH A;  2RRB A;  3SSS A;  1ISE A;  4L73 A;  4C8O A;  3HP6 A;  4DR7 J;  2OPR B;  1JQW A;  3HOU C;  2IRU A;  3CUL A;  2GC8 A;  3SZ2 A;  4WF9 Q;  2IBO A;  1RHR B;  2HGN A;  4DR2 J;  2V6T A;  4KGX B;  5E68 A;  2RML A;  2CQH A;  3JSR A;  3NGT A;  3KNG A;  4X4N A;  4LVO P;  4F67 A;  4F0K A;  2QLW A;  3QWU A;  4ED3 A;  1EB0 A;  1FRH A;  1NKC A;  2XWY A;  1V6H A;  4N7T A;  1REG X;  5CD4 H;  2RIL A;  3QGH A;  5A8R B;  4K4T A;  1TWG A;  2GMJ A;  3M2R B;  2HRY A;  1XEZ A;  2FHM A;  1F3F A;  4FVM A;  4G1P A;  2ZM6 J;  1TQL A;  2V68 A;  3OEP A;  2QLB B;  3NWR A;  4FXV A;  2B4V A;  5IYC C;  1A0O B;  2XO7 A;  1OSC A;  1F2G A;  4B3R F;  3NKY A;  1ZPW X;  1S12 A;  1FJE B;  3NGR A;  4NRU A;  2VQE F;  2BE5 A;  4FS2 A;  2NR0 A;  1PJ6 A;  3AA8 A;  3FVY A;  2C2D A;  1FE4 A;  2PN6 A;  2IM3 A;  2F8E X;  3R1L A;  4DCP B;  1SCJ B;  2OSR A;  3VVU A;  2GAG C;  1MMD A;  3J81 j;  4HT7 A;  2IYG A;  4RUH A;  1KHW A;  3BR8 A;  4OHW A;  3RW6 A;  4ICL A;  3DOM A;  5J2N B;  5KT7 A;  4OLP A;  3QLH B;  2W2O P;  4DPU A;  3UD5 A;  3JTP A;  2B7C B;  4GTF A;  4CYU A;  4W92 B;  1IR2 A;  2IBK A;  4TVA B;  3RAX A;  4CLW A;  1X5T A;  2WVC A;  3A8E A;  3CGI A;  5D4D A;  4X65 J;  1IXK A;  2AYM A;  2Y0B B;  1OPZ A;  3VAI A;  4TNO A;  2WW4 A;  1VK3 A;  2IJR A;  3G6V A;  1DCP A;  5T41 A;  1TK0 A;  1A6L A;  3K17 A;  3W1Y C;  2HHQ A;  1C1C B;  1U0H B;  4ED8 A;  4YB7 A;  1JLA B;  2RRN A;  4M5D A;  2JEF A;  3MD1 A;  2LA6 A;  3MEG B;  1B64 A;  3QYY A;  1B99 A;  5L9X A;  4ZP7 A;  1T9W A;  1VLO A;  4NXM J;  3OTO F;  3N5B A;  2RQK A;  3DRR A;  2KM8 C;  4QIW D;  3P5B P;  1U25 A;  2GMH A;  2YKN B;  1TL7 A;  3A8J A;  1TTH B;  1PJ5 A;  1VQ4 S;  5IYC K;  4DV3 J;  4B17 A;  3CJ4 A;  2YNF A;  3QX3 A;  3OXG A;  1CC7 A;  2JA7 C;  4F25 A;  5F8L A;  5CAA A;  5HMZ A;  4KKO B;  5GAD U;  4FS1 A;  1J6X A;  3CMQ A;  3PO3 C;  1YJV A;  2HLU A;  3HCX A;  2HND A;  1TWA K;  1O29 A;  1U1N A;  5KG6 A;  2DGW A;  4DX7 A;  3W2W A;  1R89 A;  1K1Q A;  4J91 A;  1VS3 A;  5CA5 A;  3QFH A;  2B0G A;  3FOF A;  2A0F B;  1SH2 A;  1ZM3 A;  3DLL Q;  2LQ5 A;  2HHP A;  2XMK A;  1NUE A;  5LMN J;  2XY6 A;  4Z7C A;  2DY1 A;  2LQB A;  2DNQ A;  4M5K A;  4WFB Q;  1XMQ F;  1S1V B;  3HHL C;  2NVT C;  2EI5 A;  4LSN A;  5KFL A;  2RS8 A;  1HWJ A;  4N76 A;  2PFF B;  2IHR 1;  4YR3 A;  1JNR B;  2L9W A;  3CSK A;  2XZT B;  4CLL A;  1Y7P A;  2KFZ A;  1G1X A;  4K4Z A;  3NNH A;  1SKS A;  1F3V A;  5KG1 A;  1S1T B;  2HAI A;  5KFD A;  2B43 A;  2F1F A;  3PHE A;  3L7U A;  4YB6 A;  1G51 A;  1XTZ A;  3BDE A;  3N0V A;  5HO4 A;  4B3M F;  2OPQ A;  2GS8 A;  1RTH B;  3KLE A;  1Q7Y T;  2HWT A;  4AXI A;  3K7R A;  4PUO B;  4XIU A;  2MKJ A;  1C0A A;  4JYA J;  2W9C A;  1EFW A;  2NSB A;  2H54 B;  3EGV A;  2QMW A;  2FB0 A;  2GHW A;  4P2S A;  3OD2 A;  4F3Q A;  1S59 A;  3ZXW A;  1USO A;  4AE5 A;  3JTN A;  3P5T L;  1VK8 A;  2JA7 K;  3LP1 B;  1H2V Z;  2UU9 F;  2GIF A;  1NSP A;  1UVJ A;  4IRC A;  3E51 A;  2MXY A;  3PO3 K;  1FEH A;  5FII A;  4RW7 A;  1Y5N B;  3MM9 B;  2Y3P A;  1Q78 A;  4USM A;  4V1A k;  5KFT A;  4FBU A;  4K4Y A;  1RT4 A;  5L9N A;  5KT6 A;  1VBK A;  3M6U A;  4K59 A;  1RA6 A;  1O25 A;  4RL1 A;  3R5B A;  3D6M B;  5ETL A;  1U45 A;  1AA1 B;  3P96 A;  4PG7 A;  4MKA A;  2NVT K;  5HMX A;  1UPP A;  3M8Q A;  5F8G A;  2Q66 A;  1RLC L;  3W8P A;  3LA0 A;  2R8G A;  2KYZ A;  2HFV A;  3ET6 B;  1XMO F;  5JVG Q;  3GTG K;  1S0O A;  1HW8 A;  1YJW S;  3GV8 B;  2V67 A;  3MEC A;  4MIW A;  4OX9 J;  5C4J K;  3HSG A;  2JFD A;  3RTV A;  4G65 A;  2ZVI A;  4LRF A;  3GP9 A;  3SQG A;  4URG A;  1C0U A;  1EP4 A;  4RJV A;  1RAO A;  4HT5 A;  1N32 J;  4KM8 A;  4GKK F;  1C0T A;  3POT A;  3OSN A;  4F2S A;  1Y1V C;  2O67 A;  5G4D A;  1ZQ1 C;  1N34 F;  3NOG A;  3DLH A;  2GO8 A;  5DGB A;  4URQ U;  3TVY A;  4BBR C;  2JA5 C;  1JJH A;  1Q8K A;  1IQT A;  1FTR A;  4DG1 A;  2G4B A;  1UFL A;  1LW2 A;  2V2Q A;  2ZH4 A;  1RU2 A;  5JVO A;  2VKZ G;  2GFF A;  3X1L B;  1NHK L;  2WK4 A;  3R5C A;  2XCR B;  2ZWP A;  1HQ2 A;  3KJV B;  3BR9 A;  1F60 B;  3WOD A;  1KR4 A;  1DCO A;  1BQN A;  1KN6 A;  3GTK C;  4A8M P;  2GZO A;  2VQE J;  3W3S A;  3WC0 A;  1AUS L;  4KM9 A;  5DRK A;  4QWA A;  3R27 A;  5DGA A;  2ZNY A;  3PTW A;  4LJM A;  3GTM C;  2YBV A;  3GJQ B;  1HPZ B;  3BO4 A;  4RW8 A;  4F2R A;  1VQN S;  3N01 A;  2R7R A;  5IQQ A;  2RQ4 A;  2XS2 A;  2AU0 A;  3IC1 A;  4RW4 B;  2HZV A;  1UEV A;  2RUG A;  5TMF A;  1FDN A;  4IFV A;  1HQU A;  1TEL A;  3OL6 A;  1JJC B;  5D4N A;  5AE2 A;  1F9N A;  4PR6 A;  3CCV S;  5IFM A;  4NWB A;  4CNZ A;  3RYL A;  1UKU A;  5L1K A;  1KP6 A;  4M5G A;  3QAT A;  1R8P A;  1IBL F;  4URS A;  1I3Q A;  2NVY K;  1TL3 B;  2A18 A;  1RWW B;  1X0P A;  5KG5 A;  2AMC B;  1Y1V K;  5HBM B;  3M2U A;  4WFN Q;  4MYT A;  4DEZ A;  2G1H A;  1BWE A;  3TYT A;  2YNG A;  3FKI A;  3HVW A;  4EYI B;  4BBR K;  2A10 A;  3L09 A;  5J1E B;  3SZY A;  1UJ5 A;  2ZVS A;  2RNE A;  5KFH A;  3DCA A;  4G1Q A;  4NOH A;  3Q2T C;  4EK2 A;  3CO9 A;  3PO5 A;  2QTW A;  2VBX A;  4TY8 A;  1HMV A;  2ZFH A;  3I87 A;  3RZO K;  4ZP9 A;  4ED1 A;  2XM3 A;  2MQQ A;  5C3E K;  5KFG A;  1UFW A;  4WP3 A;  4NZ7 A;  4TQS A;  1FNO A;  3FQK A;  2BM1 A;  3GTM K;  1PC5 A;  1JXL A;  3QRR A;  1R0C B;  1BLU A;  2IC3 B;  1U2R A;  2LDY A;  1O8B A;  4MFB A;  1XZQ B;  1Y10 A;  2DRA A;  1RT6 B;  3GYG A;  3MCS A;  1SC3 B;  4HAC B;  3MM7 B;  3PRB A;  3OTB A;  3BN7 A;  4Q2L A;  3K58 A;  2OML A;  5A8W B;  2J6S A;  1S1X B;  4A3M K;  2BJE A;  5FLX Y;  1Q0N A;  4GC6 A;  3SIP B;  2GVD A;  4X2B A;  3CD5 A;  1JLG B;  1GMW A;  2X1A A;  1RKI A;  3H59 A;  1TU0 B;  2UUC F;  3AOD A;  4KYZ A;  4KHM A;  3Q8Y A;  3CC4 S;  3DLE A;  4ZIV A;  4C7Q A;  2ZH3 A;  4G7O A;  3PIO Q;  3US5 A;  3J7Y I;  4ES2 A;  2JHE A;  4U8V A;  3DXS X;  4PCQ A;  3CDA A;  3CDB A;  2HHS A;  3MR6 A;  4AH6 A;  4DCO B;  5B0F A;  4O4G A;  3ADA C;  4NYP A;  2R42 A;  4KHR A;  2H48 B;  2C42 A;  7FDR A;  2QL9 B;  4A3I C;  4RUC A;  2FVC A;  4M5M A;  1RHM B;  1S7H A;  1NPR A;  3M6X A;  5L1J A;  4K4X A;  2CPF A;  1B0V A;  1CUL A;  4KFB B;  1KDN A;  2XCP A;  2NYH A;  3NCR A;  3RAM A;  4CWB A;  2B4O A;  2UU9 J;  3GTO C;  4UQT A;  1PIE A;  4LF5 J;  2NXU A;  5H9E J;  2ZOF A;  1FKP B;  4C45 A;  3M9N B;  1FCA A;  3G8S A;  1C1B B;  2IY5 B;  1FRM A;  2CQI A;  4F4Y A;  2VFU A;  1K0V A;  4BBS C;  3VAM A;  4LR2 A;  3M30 B;  1X0F A;  4X4O A;  1WI6 A;  1A7G E;  1HNZ J;  2MZQ A;  4D3G A;  1Q8I A;  1OS5 A;  2QO3 A;  1S57 A;  4A8X A;  4LSZ B;  5E3Q A;  2ZH7 A;  1LK5 A;  3DGP B;  3E3X A;  1QTN B;  4ATN A;  3IRX B;  2OO4 A;  1RHU B;  4DU7 A;  4R5P B;  1EJ7 L;  3MPW A;  1G4C A;  5HQM A;  3GV7 B;  2DO0 A;  5IOR A;  2XYH B;  5DZ7 A;  1XMO J;  2DNL A;  3AJ2 A;  4J3N A;  5EGY A;  2I0X A;  1J2V A;  1HWL A;  3CCQ S;  3FSY A;  4H54 A;  1QUP A;  8AT1 B;  4OZ3 A;  1H7X A;  2J9D A;  2KVQ E;  1R0B G;  4PXC A;  3DMJ A;  3ZZ0 A;  3TFJ A;  1TKX A;  4DU8 A;  3OVB A;  1T0T V;  3FBF A;  1AXQ A;  3PIP Q;  3K5M A;  4A3I K;  3FNN A;  2W8K A;  5DQG A;  2E2H A;  2XMM A;  1LFW A;  4J7C A;  5IYB C;  1VQL S;  4B3O A;  3HOZ C;  2DHS A;  4RW9 B;  5D8H B;  4GKK J;  4UT4 A;  2V50 A;  1KWM A;  3LWM A;  1T9V A;  2XB2 D;  3Q8R B;  1J5E F;  4CH1 A;  2R8I A;  4HHJ A;  3FEZ A;  4OHX A;  3VV2 B;  4FF2 A;  3MUT P;  5HLF A;  2CAD A;  1U09 A;  3WIV A;  2GQC A;  5L8R C;  5KFW A;  3GTO K;  1TWG C;  1HNI A;  1JMT A;  4ZPT R;  4DV5 F;  1T03 B;  4WTY A;  1RLD A;  4I64 A;  1T05 B;  4FYD A;  2ASY A;  1N0V C;  2CUY A;  3OHB A;  1SQF A;  1V5V A;  2XZD B;  1GQE A;  1LNQ A;  1RAG B;  2J9D E;  2MLY A;  3V4I B;  9ATC B;  4JI5 J;  2BKN A;  5M5Y K;  2ASJ A;  4OX6 A;  1UWB A;  2DGS A;  1RIS A;  3D54 A;  1GAO A;  4JI0 F;  3MM8 A;  3LAN A;  1CQN A;  2VG5 B;  3V6H A;  3VCD A;  1DQ9 A;  1HNX F;  3FQL A;  2LA4 A;  1CS4 A;  4OIO A;  2IVM A;  3SFU A;  1DUR A;  5L38 A;  5ETT A;  4UW2 A;  1SQE A;  1YNJ A;  1RWK B;  2E2I K;  4ED4 A;  4KO0 A;  4CTA A;  3BPD A;  1BY9 A;  4USU A;  5C25 B;  3CWJ A;  1MG7 A;  5IYB K;  3HOZ K;  1VQ8 S;  4F8R A;  4C0H A;  1J5O B;  2BAN B;  4ZJQ A;  5KFZ A;  2ZBR A;  3EUN A;  1HBN A;  1JLC B;  2XGQ A;  1FWK A;  1WSR A;  3TAP A;  2BKO A;  4NI2 B;  1AT1 B;  2ZFZ A;  3HF5 A;  4IFY B;  5LL6 d;  4ELV A;  3HOY C;  1WC0 A;  4Y2C A;  4R0E A;  1TWG K;  4Q45 A;  4B9N A;  3TNV A;  2K8G A;  1T3N A;  5A0Y A;  2HQ3 A;  4DF8 A;  3FCH A;  3JSB A;  2E1P A;  3MM6 A;  2V9W A;  2MEW A;  3U27 A;  5LSO A;  2BW2 A;  1N33 F;  3PHT A;  3A8I A;  3L4J A;  3J7Y U;  3I31 A;  1NJY A;  1SJR A;  2RGR A;  1KQS R;  4KAI A;  3KG4 A;  2H5I B;  4NYO A;  3IAM 9;  3MWB A;  3M32 B;  2C2M B;  5D0G A;  3LPE A;  3H5U A;  4Y7N C;  3BSO A;  2FLP A;  3LAP A;  2ZZN A;  3CTR A;  5LMU F;  4HTJ A;  1T9Y A;  2QGF B;  3QWP A;  1RZM A;  3B8H A;  4LF4 J;  3G6Y A;  1RWN B;  5D77 A;  3WHI A;  3H0G K;  3MF5 A;  3TVK A;  2NS1 B;  4KSE B;  3MR3 A;  1H98 A;  2WSC C;  3H4B A;  5F8J A;  1KHV A;  1MU2 A;  4N47 A;  5BXI A;  4B9S A;  2C3O A;  5CYM A;  4GTB A;  3DRX A;  4CO5 A;  4DOZ A;  4MQ9 A;  1OWX A;  4NLT A;  2UUC J;  4JI7 J;  2OPS A;  4MKY A;  1RTD A;  1LWX A;  4OI6 A;  3G4S S;  2HUR A;  3GFX A;  3CDW A;  1NO8 A;  3OTE A;  4QW9 A;  4FYW B;  2YU9 K;  1U1K A;  2DEI A;  1OPI A;  1RAH B;  3HOY K;  3MAA A;  2FHJ D;  4O4R A;  3IXQ A;  2AJQ A;  3G87 A;  2Q79 A;  4CLP A;  2R7W A;  4IOB A;  3H40 A;  4BC9 A;  3QSY B;  1FJG F;  2MMY A;  3I4H X;  4CLZ A;  4ZVO B;  1PKU A;  1DJ0 A;  4DZ6 A;  4OZJ A;  4PZV A;  3N9U C;  2VON A;  4DMZ A;  2JNJ A;  2MZJ A;  2W2Q P;  5AXM A;  2OI2 A;  1SC4 B;  3D3B J;  1FRX A;  1VC6 A;  2OP5 A;  3MCN A;  3LAL A;  1KQ4 A;  3QZ7 A;  3M8Z A;  2XSF A;  3W9I A;  3DGV A;  3GIK A;  1ICE B;  4Y7N K;  4P71 A;  1EI6 A;  5TJ3 A;  5K8M A;  2JA8 C;  2ALY B;  2MLZ A;  4AUK A;  2DHH A;  3FUY A;  2IVY A;  2DGV A;  1D1U A;  1FFG B;  4ZPA A;  2DR8 A;  5IT9 U;  2LU2 A;  1KLN A;  5K8P A;  2QG9 B;  4G6V B;  3ENV A;  3D28 A;  2OAU A;  3IAS 9;  4Q7A A;  1U02 A;  5C4X C;  5F0U A;  1HQE B;  2YX4 A;  1P1T A;  2PGC A;  4Y0F A;  2P8T A;  4ZN3 A;  5IT4 A;  3HD1 A;  3QGG A;  5KOW A;  2JWN A;  2UVU A;  1N36 J;  1BGX T;  2P2C B;  4RO0 A;  1SJF A;  2VJV A;  3WBZ A;  2ZD1 B;  4ZCK A;  3CQZ A;  4LK0 A;  3NNA A;  4O3R A;  1JWW A;  2A3J A;  4I2Q A;  1U6B A;  4RW6 A;  1UVL A;  2V2Z A;  2QLJ B;  1WQG A;  3DRS B;  2KM8 B;  3MEK A;  4WE1 A;  4C8L A;  4P74 A;  2HG4 A;  3PW5 A;  1L3V A;  1J5E J;  2A6O A;  2E1M C;  5IWA F;  3BGL A;  3QID A;  4JI6 J;  3C16 A;  3LOU A;  3VAL A;  4G1I A;  1TL1 A;  4Y2I A;  2R7V A;  3I5C A;  2FGC A;  4TQR A;  3MR5 A;  3T5J A;  2VFT A;  1EAY C;  3V6D A;  1S1W A;  4NA1 A;  5EHH A;  4A3F C;  4DV5 J;  4O44 A;  4OYP A;  4K0K F;  1RT5 A;  3BP8 C;  2O1P A;  4DV1 F;  2XMW A;  5CHC B;  3MMB A;  4ECX A;  2JA8 K;  1C4A A;  1F7V A;  1RWV B;  2LLZ A;  3GTL A;  2D6F C;  1M1H A;  4F4Z A;  3TAN A;  4WFZ A;  3NWG A;  2MQM A;  3AD9 C;  1J27 A;  4K2J A;  5A2Q Y;  1Z1Z A;  2ZH9 A;  4EI2 A;  1EQM A;  4OYZ A;  1H0H B;  1S7I A;  2BOA A;  5U47 A;  2MQP A;  2HKE A;  4A8O A;  3QGI A;  2EG1 A;  2RDJ A;  4UUW A;  2B4P A;  4WJ4 A;  1VC0 A;  2NSC A;  2LDI A;  3S2H C;  2X51 A;  1D9A A;  5BJR A;  1HNX J;  3NL0 A;  4CLY A;  2VJU A;  3PDN A;  1LXN A;  2Q6B A;  4ZVP B;  2X3D A;  1IVZ A;  1IKW B;  3OVS A;  2MSS A;  3S14 C;  2B8P A;  2GML A;  1R8H A;  4Q0B B;  2XYP B;  1OQ3 A;  3KJN B;  1RI7 A;  1RDR A;  3FCW A;  2FTR A;  2XS7 A;  7FD1 A;  5HAN A;  5EGH A;  1I3Q C;  2FZG B;  4J9P A;  3JSM B;  5F0W A;  1T95 A;  1SUQ B;  1U7L A;  1KVJ A;  3OJU A;  4P2X A;  1BQM B;  3V2U C;  1T94 A;  3AB4 B;  3FKI C;  3IBF B;  1ZS6 A;  5AJ3 J;  1LFP A;  4LRA A;  2ZH5 A;  1KNZ A;  3H90 A;  1VIX A;  4A3F K;  2P9E A;  2OGU A;  3OUY A;  2MJN A;  2Y1I A;  1RWX B;  3W62 A;  4KMH A;  4J9M A;  1UTA A;  2HS4 A;  2V6A A;  2IRX A;  2F65 A;  2YPZ A;  1M5H A;  1UEK A;  1V9O A;  1FRI A;  4HI2 A;  3N79 A;  2CXE A;  2WBM A;  2OPP A;  2VUG A;  5J2M B;  2ZE2 A;  3CDU A;  2VC0 A;  3GTP A;  2GSN A;  3GFY A;  3F73 A;  3KKF A;  1NK7 A;  1CQM A;  3C6U B;  5LMU J;  1LQ9 A;  1RB0 A;  3IWX A;  2HVZ A;  3FOE A;  5BYQ A;  3MFH A;  3AQP A;  2FJD B;  3LPY A;  3HFV A;  1YHQ S;  3RB3 A;  1VR6 A;  3S14 K;  4C8N A;  3M8P B;  1Z2Z A;  4UOF A;  2F9D A;  1NDP A;  1PYS B;  1WDT A;  1S1U B;  4H4O A;  4AYB L;  2GSU A;  4LSL A;  1I3Q K;  2VBY A;  3KJF B;  3M8Y A;  4KH1 B;  2I38 A;  2G1D A;  4BHQ A;  3ZC4 A;  1WIH A;  1EHW A;  2XS5 A;  4F50 A;  2PE8 A;  1VQ6 S;  2EFV A;  3FKI K;  2UVR A;  1VIS A;  2P5V A;  4A3L C;  1VRT B;  1TWF A;  4PYA A;  4GFQ A;  2A2D A;  2H3E B;  3OHA A;  4EUV A;  4BY1 C;  4QQB A;  2WOM B;  3DOL A;  1ZAW A;  5B0E A;  4RBU A;  2B9E A;  3FK4 A;  1NB7 A;  4UUX A;  1LWF A;  5JFE A;  2ZH2 A;  3UDC A;  5JUM A;  2YX1 A;  4DFM A;  4DL6 A;  3KLG A;  3GFZ A;  2UVV A;  5DLF A;  2HK3 A;  5SZT A;  4KRW A;  3Q24 A;  2CJA A;  4K4U A;  4B3S J;  4C11 A;  3JYT B;  2R7S A;  1RGV A;  4Y00 A;  1GE9 A;  2HFN A;  4NCG B;  4Y2A A;  3LGN A;  3BGR B;  2GJI A;  4I7F A;  1NBE B;  2I2Y A;  5T7L A;  1TR0 A;  3I4N C;  4H4M B;  3JQM A;  3HPO A;  1S4F A;  1IJE B;  4C3L A;  2UV8 A;  4DPW A;  3DYA A;  4DBQ A;  1IM6 A;  2H4Y B;  1YBA A;  1F2H A;  5CYJ A;  3EYZ A;  2HEK A;  4DL4 A;  2AGO A;  3MGJ A;  3HFZ B;  4I1T A;  1C2P A;  4GTA A;  1CJV B;  3D0G E;  3C15 A;  3KNA A;  3CCW A;  2I5J A;  4BWJ A;  2BJ7 A;  4WJB A;  5EUH A;  2HBY B;  4X6A C;  3FBB A;  2K3K A;  3E8O A;  2CJQ A;  3LP2 B;  1XXA A;  4F04 B;  1IUJ A;  3KLF A;  2QV6 A;  3MFI A;  3QIP A;  2BQ3 A;  1Q16 B;  1NKE A;  4BY1 K;  2N3O A;  3QT6 A;  1WC3 A;  3TUJ C;  2ZUE A;  1VGY A;  1JKH B;  1APS A;  5L46 A;  2B7B B;  2F40 A;  5E3P A;  3MD3 A;  2E2H C;  2IA0 A;  4DHV A;  4F4K A;  4LQY A;  1BHN A;  4OIR A;  1X4F A;  3BGO P;  2GIQ A;  4E8U A;  3ISN C;  5IWA J;  1KLM B;  3V6J A;  4GKJ F;  1R7I A;  1SJ4 P;  2JLF A;  2QZ8 A;  3D2W A;  3BGF A;  2V4J A;  4A4J A;  4K0K J;  2HNY A;  4DV1 J;  3KK3 A;  1HNV B;  3DC2 A;  2E1R A;  3FHZ A;  2YNI A;  2MZR A;  3I4N K;  3BGU A;  3KDN A;  2JLG A;  1YGY A;  2M70 A;  1IKY B;  4ZVG A;  1L3S A;  5M2R A;  1HI8 A;  5KTQ A;  2MKS A;  4XO0 A;  2UXD F;  4OIQ A;  1Q8L A;  3GJR B;  3H2V E;  4NLD A;  1X9M A;  2J6T A;  3EXC X;  1TZ0 A;  4KJI A;  2KT5 A;  2ZEJ A;  3V4M A;  1FER A;  4Y3C A;  3T02 A;  4TU7 A;  3FC9 A;  1RTJ B;  2ZBC A;  4M5L A;  4MYU A;  4OFZ A;  2A6H A;  4J9S A;  3HK2 A;  3MOZ A;  1JNZ B;  3QT7 A;  3GR1 A;  1YZ6 A;  4PQU B;  4I6A A;  3UD4 P;  3AJD A;  3G82 A;  2A2C A;  1U6F A;  2PPB A;  1H73 A;  1SJQ A;  2QL5 B;  4OJH A;  1NSA A;  2RJZ A;  2RKI A;  5K14 A;  1YJN S;  2HFZ A;  4FZV A;  2FJW A;  1CJT A;  3L7P A;  2E2H K;  4RX6 A;  1KON A;  5M3F K;  5HP1 A;  4MMO A;  4W98 A;  1SV5 B;  1NPK A;  1TV6 A;  2MZS A;  2CVI A;  5IZH A;  3C14 A;  4I0W A;  4KT0 C;  1EH1 A;  1K47 A;  1D09 B;  1TKZ B;  4PEO A;  1O51 A;  4CH0 S;  4ZIT A;  1U1M A;  4IDK B;  1EIY B;  3PO2 C;  1TKT B;  1OY6 A;  3U1M A;  3BSN A;  4TU9 A;  2V34 A;  4C3J C;  5KFN A;  4N77 A;  3RGI A;  2IAJ B;  1DTT A;  3NEK A;  2AJ4 A;  1NK9 A;  3FSI A;  1WOS A;  2VDI A;  2VDH A;  2IFX A;  3THT A;  3N4W A;  2JEG A;  3EVW A;  4J37 A;  4LT6 A;  5CCL A;  1NH7 A;  2EFO A;  3K5L A;  2DHA A;  4LRC A;  3OW2 R;  2BE2 B;  5C24 A;  1YI2 S;  2HBQ B;  2MQN A;  2HNZ B;  2BJ9 A;  3O1L A;  5D4L A;  3NRB A;  2ERR A;  2CPY A;  4JI8 J;  4C4W A;  5A6P A;  4PG4 A;  2R8H A;  3EDQ B;  4LF7 J;  2V63 A;  3OR2 A;  2DEJ A;  5DZ6 A;  3R1H A;  5CYQ A;  4RUB A;  4QIE A;  2B63 A;  5CZV A;  1NDC A;  4C0B A;  2LKZ A;  3RBX A;  2VF3 A;  4HEA 9;  3TZY A;  2E1A A;  4EMD A;  2ILY A;  4DQS A;  4QWC A;  2MDA A;  3GEE A;  5HVH A;  4M5H A;  4P52 A;  1WG1 A;  4NLW A;  3RR8 A;  2O5I A;  4JUZ A;  4ALZ A;  1ZTW A;  4ID5 A;  2XSJ A;  4N56 A;  1TWA A;  5DS7 A;  1UVK A;  3CJQ A;  1RCX B;  3PO2 K;  3ZZU A;  2VD3 A;  3D4J A;  1UEU A;  3IG1 A;  4K7Q A;  1HNW J;  2L9D A;  4NYZ A;  5LXY A;  1C4C A;  3DU5 A;  1NK5 A;  5IP7 C;  2FIU A;  3FZ2 A;  3CCE S;  1HYS A;  3BBF A;  1M90 T;  1UJ4 A;  5EN1 A;  1WEY A;  2M8H A;  1UET A;  1RHQ B;  4OYM A;  1S4E A;  5JMN A;  1DTQ A;  3U02 A;  3RZA A;  4PRF A;  3K5O A;  3QO9 A;  1Y00 A;  1TWH A;  2QL7 B;  5B7W A;  4X64 F;  5M2P A;  2DR9 A;  1IE0 A;  1Y0H A;  1UFK A;  2HIQ A;  3U1N A;  2IA6 A;  4ZPV R;  3IM8 A;  5M5X K;  2HS3 A;  4JV2 A;  2CRL A;  2YKN A;  3HKW A;  5TMC A;  4ICL B;  2FJE B;  1VC5 A;  1BQX A;  1BS2 A;  3UCU P;  3B4M A;  4LOW A;  4CYU B;  1E6V A;  3O5T B;  3M1V B;  3HD2 A;  4ECS A;  2UUB F;  1T02 A;  4J9Q A;  3GV5 B;  4M1X A;  1FVS A;  1PG5 B;  2HHW A;  3MPD A;  2GHP A;  1O6X A;  5I3U A;  1VQY A;  3FBE A;  2W2M P;  4M5D B;  3CMA S;  4DQQ A;  4USK A;  3CQZ C;  1ZM4 A;  4R25 A;  4CH7 A;  3HFK A;  2X1B A;  4XDD A;  1PCA A;  4NML A;  2A68 A;  4DQI A;  1FKO B;  3ILJ A;  2HVI A;  3DRR B;  5GVQ A;  2GJF A;  5AXN A;  1FWP A;  4KN4 A;  3R5G A;  1YNN A;  1TL7 B;  3FCV A;  4LRE A;  1LV5 A;  4OMF G;  3AXM A;  2YNF B;  5HL7 Q;  4GZY A;  4XLN A;  2XQC A;  1U47 A;  4Q2M A;  2H5J B;  2HQF A;  3SXL A;  2DD8 S;  4WYW A;  1EET A;  4AFF A;  1WAC A;  1WUU A;  2XLJ A;  1RT7 A;  1GH8 A;  5HMY A;  5LT5 A;  3WX4 A;  4HTI A;  3OLA A;  2HND B;  1RTH A;  4IG3 B;  4BCA A;  3GTJ A;  3GTG A;  2JVO A;  1S77 D;  5CQG A;  2X1G A;  3W2W B;  1DQA A;  2HLT A;  2ZH8 A;  3BO2 A;  3GTL C;  1XN9 A;  4OYA A;  3ZO7 A;  3S1Q C;  3SI8 A;  3IWN C;  4FP9 A;  3K0J A;  5M2U A;  3FEY B;  3CD6 S;  4JI3 J;  5CXT A;  1ZBT A;  3HKZ L;  3CJ8 A;  4LSN B;  2RH3 A;  2B3T B;  1ELO A;  1N5S A;  1N6Q A;  1X9S A;  4XPE A;  2CZV C;  4LF2 A;  3PR4 A;  2NVX K;  1HWK A;  2HBZ B;  2IDL A;  3HOX K;  5J1P A;  2ZJR Q;  4OZ0 A;  1D3W A;  2EBE A;  2WCX A;  1KFS A;  2OPQ B;  2EFG A;  3OPK A;  3KLE B;  1DAX A;  1E6Y A;  5IC4 B;  3W2V B;  2BA9 A;  2BOP A;  1B4S A;  2FQT A;  3T6B A;  3W66 A;  3TI0 A;  2W9C B;  3ET6 A;  1Q53 A;  2DR7 A;  1HI1 A;  4NXN J;  2VOP A;  1K0T A;  5DDP C;  3KLI A;  3CJK A;  1AB4 A;  4B9M A;  4K5S A;  2M5Y A;  1N0U A;  2I1R A;  4GRS A;  1XZP A;  3S7R A;  4ETZ A;  2O3D A;  3GYN A;  5CHP A;  5CD4 A;  2Z30 B;  3I4M C;  1HIY A;  2AEF A;  1WWH A;  3M8S A;  2UV8 G;  4ENO A;  2W4P A;  2ACM A;  2CQC A;  4CO1 A;  3CCM S;  5HK4 A;  3TTG A;  1NJX A;  5D78 A;  2DB1 A;  4AT1 B;  1RT4 B;  4TLR A;  5KT3 A;  1JLB A;  3IBC B;  3GTL K;  4K5R A;  5LOQ A;  3O6Q A;  1YTY A;  3S1Q K;  1HHT P;  2BRL A;  4X4S A;  2HRT A;  5IQ6 A;  1RHJ B;  4DQP A;  5EWG A;  4JV1 A;  2NVY A;  1I94 F;  1X4E A;  2F9J A;  4USI A;  3M8Q B;  2E7X A;  3GTP C;  2D74 B;  2C3Y A;  3A3P B;  4UZC A;  3BKU A;  1BXN A;  1TL5 A;  3UNY A;  3DI6 A;  5D4P A;  2D69 A;  5JXS A;  1RSC A;  1HLW A;  1U24 A;  1FD2 A;  2N7Y A;  2CJB A;  3MEC B;  3R6L B;  1NH8 A;  4OX8 A;  2ATC B;  4BS2 A;  3UN5 A;  1U48 A;  1KRP A;  4F02 A;  3GDZ A;  2PO4 A;  2RVJ A;  1QD1 A;  3T19 A;  1HWI A;  3SQG B;  3SSQ A;  1SKR A;  1C0U B;  1EP4 B;  2QMX A;  4U96 A;  1YRU A;  2CWK A;  4I4B A;  2XG8 A;  5HJY A;  1M5K C;  1C0T B;  3POT B;  4NEZ A;  4UST A;  1CC8 A;  3DU6 A;  3IS9 A;  2IMW P;  4YY3 J;  2YKQ A;  1YWX A;  3DOK B;  1NHV A;  3QAU A;  3QT8 A;  1GNK A;  2KB2 A;  1RCO B;  1YJ7 A;  2HWH A;  2HW3 A;  3I4M K;  1TWF C;  4CM2 A;  4JI2 J;  2XTJ P;  1F5A A;  3HLU A;  5F3T A;  1S9G A;  1JXE A;  1LW2 B;  3NS5 A;  3R7S B;  1N5T A;  2XY7 A;  1XNR F;  1RWP B;  2YWH A;  5D6G A;  3HMJ G;  1NJZ A;  2PC6 A;  1FEE A;  4LF1 A;  1SL0 A;  2NLW A;  2VQF F;  2CQD A;  3UDV A;  2VU5 A;  1BQN B;  2G0I A;  1LXJ A;  4A3B C;  4P9S A;  4ZHR A;  3NXZ A;  3W5Z A;  4USJ C;  2SXL A;  3B82 A;  2UUA F;  5C5J A;  3GTP K;  3PJX A;  3CD7 A;  2HVD A;  4EZ9 A;  2P9C A;  3DDN A;  3KUE A;  2EBB A;  4DV7 J;  2JL9 A;  3SBM A;  5HAT A;  4WU3 A;  1BE4 A;  4JOU A;  3VQT A;  3C19 A;  3OL8 A;  3RZD C;  3T1Y J;  2MY8 A;  4IFV B;  1O5J A;  4YR2 A;  1H7W A;  3KUG A;  2AV5 A;  1W2I A;  4BWM A;  4DFK A;  4R8U A;  2A1B A;  3KK2 A;  2V2K A;  3BJY A;  2JDJ A;  4X62 J;  5IOQ A;  3CCS S;  4OIX A;  1JX4 A;  1UVN A;  2MJU A;  3CJS A;  1LKZ A;  2IC3 A;  1QJH A;  3HJV A;  5BYS A;  2UUB J;  3JQJ A;  4TLQ A;  1RAI B;  2DNK A;  5THW A;  3M3Y K;  3MMJ A;  2LXU A;  4XDC A;  5B0B A;  1CSJ A;  1CJK B;  2YNG B;  1U49 A;  4WXO A;  4Q43 A;  4NX9 A;  2FY1 A;  4DV6 J;  2OKQ A;  4G1Q B;  4Z7Y A;  3ZTS A;  3K89 A;  3HHL D;  3HVT A;  5C2G A;  3PYF A;  2EVZ A;  3TAM A;  3CCZ A;  2RF2 A;  1VQ5 S;  1VQ9 S;  2MPU A;  3HXA A;  4QZV B;  4JI4 F;  1PYT A;  2VG7 B;  2Y9H A;  3J81 U;  1IS1 A;  4TY8 B;  2LEB A;  2BZ2 A;  1HMV B;  4P73 A;  5A2Q U;  2FY8 A;  2J0S D;  3HXM A;  2DR5 A;  4A3B K;  3QFW A;  5L39 A;  3H3V L;  4DPX A;  4KN7 A;  3EPI A;  3H3V D;  1KEK A;  2OLW A;  3T9N A;  4FVC A;  4LR8 A;  2CQB A;  2JA6 A;  4YN3 B;  3CCJ S;  4MFB B;  1VQK S;  2BKP A;  2F4V F;  4LFC F;  2CQ2 A;  2AEJ A;  4ED7 A;  1EKS A;  2VZ9 A;  4KQZ A;  3RZD K;  3D6F B;  3KOA A;  1NZA A;  4KFB A;  5KG3 A;  3UCG A;  2WB4 A;  1JJ4 A;  3N5F A;  2HVH A;  2NXN A;  2XY5 A;  2H65 B;  2GGP A;  4KMD A;  4TYA A;  4KB2 A;  2F63 A;  3VZH A;  4EBC A;  1F1B B;  2GVD B;  2YKM A;  4W90 B;  1WHX A;  5K8N A;  2YX7 A;  4OI2 A;  2D9O A;  1FI4 A;  2ROE A;  5I4M A;  2HGM A;  4WJ3 M;  3LP0 A;  4UF4 A;  4DV2 J;  3DLE B;  4HDG A;  1ZA1 B;  1SJ1 A;  4USV A;  5DDO C;  4DUY F;  3FEX B;  3BDP A;  2HSE B;  3KHR A;  2QA1 A;  4RPF A;  1HBU A;  4CRJ A;  3O3L A;  4EYH B;  2W9A A;  3W5Y A;  1GFW B;  1NRK A;  2IM1 A;  4O4G B;  4WKY A;  1Z2L A;  3QJJ A;  1YX2 A;  2N4C A;  2MZT A;  2CPJ A;  2V6S A;  2BYC A;  4DR6 J;  2PMZ L;  2DTJ A;  1S6P A;  3AXK A;  5F8N A;  2PMZ D;  4KMU A;  2QC3 A;  4FYV B;  5CAB A;  2CVE A;  1GXU A;  2H51 B;  2B5J A;  2JJ4 D;  3K57 A;  1OMS A;  3SYZ A;  3HSD A;  2WTF A;  1X4A A;  2E1C A;  1MWY A;  5EWF A;  2Y3Y A;  4ER8 A;  3WC2 A;  3TUI C;  1O26 A;  1OYE A;  4ES3 A;  5IT9 Y;  2E2I A;  4YFN A;  4MK8 A;  1UCN A;  4DV4 F;  2NCK L;  2C22 A;  2PDA A;  1LW0 A;  1F9H A;  1RKJ A;  1I94 J;  4M63 A;  2AJ0 A;  3C6T A;  4L72 B;  2OEK A;  4F4X A;  2YH1 A;  2DNN A;  3DDI A;  4YFK A;  4G0V A;  1I6H C;  1NCL A;  3MMC A;  4RWX A;  3LAK A;  4X4U A;  4OZ1 A;  2B63 C;  2ZKT A;  3QRQ A;  1HR0 F;  3MHY A;  1TKX B;  2R2U A;  1K9M T;  1QVG R;  1V3Z A;  1VHF A;  4L3K A;  2CQP A;  1AFI A;  3S1M C;  1ZYQ A;  4WXW A;  1X5S A;  5B0C A;  5FDL A;  2ASD A;  2B9X A;  2R92 A;  4C6A A;  4B3O B;  2HQD A;  1S48 A;  4LRB A;  4WIL A;  1HQM A;  2CPZ A;  3TQ1 A;  1FNM A;  1K83 A;  4QWD A;  4X4P A;  4I2P A;  2PI5 A;  1TAU A;  2H4W B;  2AHO B;  3IGN A;  5HLF B;  2NXJ A;  4YEA A;  4LF8 J;  4EU0 A;  1TWA C;  5JJB A;  1HNI B;  3CCU S;  1YKW A;  1XNR J;  3M2V A;  1ZVU A;  1RT3 A;  1RXO B;  1HD1 A;  3H0G A;  1QM9 A;  1ZAX A;  4BY7 C;  4N8N A;  4OJG A;  3IPJ A;  1BDF A;  3CJR A;  2RIJ A;  1UPM B;  2PEH A;  1EK8 A;  4WU2 A;  1ZET A;  6FDR A;  1T9U A;  2VL1 A;  2JFK A;  4MT1 A;  1XK8 A;  4ECW A;  4YHH J;  1UWB B;  3ULH A;  4A3J C;  1RT2 B;  2QYG A;  3MM8 B;  1TWH C;  3MTJ A;  1Y9O A;  3HSJ A;  2DYA A;  3TX8 A;  1VOM A;  4DSJ A;  4MIB A;  2AZ1 A;  2YU9 A;  1I6H K;  3RB0 A;  2KH9 A;  2PA8 L;  4F36 A;  2GJ2 A;  2PA8 D;  4ECV A;  2B63 K;  2YQ0 A;  3RJM B;  1CS4 B;  2DNM A;  3K7A C;  3PCO B;  4OZN A;  2DCU B;  3KLH B;  1LWC A;  2DGT A;  3GJT B;  1PAE X;  3BH6 B;  2R7T A;  1XXC A;  1N88 A;  3S1M K;  4KO0 B;  3JXO A;  2CFA A;  1WQF A;  2FZC B;  5ETV A;  2VPW B;  2ZZM A;  1HBN B;  1WF2 A;  4DSL A;  1LK7 A;  4DFP A;  2CQ4 A;  5B0G A;  3IR6 B;  3LWL A;  1HFE L;  1U8S A;  2LQJ A;  3TP2 A;  4A47 A;  1RU0 A;  3ZNJ 1;  5DJB A;  3Q8U A;  2KZM A;  4KC5 A;  2G2Y A;  3BQ2 A;  1SIZ A;  4G0W A;  1XER A;  3GQC A;  2WHO A;  5D3G A;  3R2C J;  5A0Y B;  5KFP A;  4JI4 J;  3Q8V A;  1GTH A;  3TAQ A;  3D9B A;  1IKV A;  4BY7 K;  1TVR A;  2OTL S;  1U4B A;  3MM6 B;  4EO6 A;  3E01 A;  4JV5 F;  4FPR A;  2D1C A;  2Z2Z A;  1PBU A;  3I0S A;  1OIA A;  3TW0 A;  1H72 C;  2AW0 A;  1RJJ A;  1CBK A;  1KOH A;  1LEO A;  4HYK A;  3FMW A;  1WC5 A;  4A3J K;  3WQP A;  4KHP J;  4ZCM A;  4DLE A;  4WZM A;  4OV6 A;  1TWH K;  3GTJ C;  3GTG C;  1FDB A;  4V19 J;  3QGP A;  2F4V J;  3AD8 C;  4WZQ A;  2WVD A;  1QAY A;  3K5P A;  2Y0S L;  4A3C C;  4O3Q A;  2Y0S D;  1SQG A;  3K7A K;  5C4J C;  5HMW A;  2HFO A;  3G96 A;  1N5Y A;  3RUB L;  4A8Q A;  3L4K A;  1BJT A;  2C28 A;  1MU2 B;  3J7A 1;  2M4M A;  3I55 S;  1M5P C;  4ECU A;  1SH3 A;  2RUS A;  5CYM B;  1W2B R;  3MED A;  2AZ3 A;  3VAF A;  4QW8 A;  2ZDP A;  3AHP A;  2ALZ A;  4DN9 A;  2OPS B;  4NZ6 A;  2D3U A;  3JAM U;  2HK2 A;  3GB0 A;  4ZLN A;  3RBZ A;  2YQ1 A;  1KQF B;  2HFS A;  3BEG B;  3NCQ A;  1UZH A;  1I3O B;  5I3P A;  2NPI A;  2APO A;  2IM0 A;  2MQO A;  2KRR A; 
#chains in the Genus database with same CATH homology
 1PJ5 A;  3GIR A;  4P9S A;  3A8K A;  3GEI A;  3AD9 C;  1VRQ C;  3TFH A;  3AD7 C;  3TFJ A;  1VLO A;  1V5V A;  1WOS A;  1WOO A;  1XZP A;  3TTG A;  2GAH C;  3A8I A;  1XZP B;  4PAB A;  3AD8 C;  3GEH A;  2GAG C;  3ADA C;  1WSR A;  3GSI A;  1PJ7 A;  1X31 C;  1WOR A;  1XZQ A;  1WOP A;  3TFI A;  1XZQ B;  5L46 A;  3GEE A;  4PAA A;  1PJ6 A;  1YX2 A;  1WSV A;  3A8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...