1X31C

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords Sarcosine oxidase alpha subunit
total genus 51
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1x31C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1x31C01
3AD8C 1WSRA 3TFIA 1VRQC 5L46A 2GAHC 1X31C 1YX2A 1PJ5A 1WOPA 3AD9C 3GEHA 3AD7C 1WSVA 4P9SA 3TFHA 3GSIA 1V5VA 1XZPB 3A8KA 3GIRA 3GEIA 1XZQB 3TTGA 3A8IA 1WOSA 1XZQA 1VLOA 1PJ6A 1XZPA 4PAAA 1PJ7A 2GAGC 3GEEA 1WOOA 1WORA 3ADAC 3TFJA 4PABA 3A8JA
chains in the Genus database with same CATH superfamily
3V81B 3DDNA 4QIWD 4K59A 3P3DA 3GFYA 4KMUA 2EFGA 2MLZA 3A3NB 2K3IA 3VV2B 3FMWA 3HPOA 3PJ9A 3R5GA 5F8MA 3S1NC 2V63A 4QIEA 1T95A 4A8KA 1IM4A 3D67A 3PDNA 1ICEB 4FM9A 2PI5A 1HBUB 3K7RA 4OV1A 2HEKA 4G0WA 1WC0A 5EUHA 3AQPA 1MMNA 2QSWA 2BX6A 2HMIA 1WI8A 1IJEB 1X5PA 3M6XA 2H1YA 3GG0A 5A0YB 1ZBTA 2J9DE 4ZVPB 3S1QC 2R93C 4ECVA 1H7XA 4CYUB 3CD7A 5ETLA 4LFBF 1IKWA 4DV0F 1NDCA 1FNXH 4F3QA 4OZJA 3K5NA 5KFIA 4E98A 3ENQA 2Z58B 1N8RT 5C2CA 4KO0B 2E1CA 5J2MA 3ZFVA 2AGQA 2CPHA 2LEBA 5D3GB 5IYBK 5KFXA 4L74A 3ILIA 5J1PA 4DU8A 1HBOA 3OLBA 4DV7F 4MK7A 2VC0A 4N8NA 2PN6A 2QA2A 4H4MB 1SMYA 4WTYA 3MGJA 1YZ6A 4M95A 2CQ1A 2IBKA 2DGOA 1NK7A 3H40A 5EGYA 4A3JK 1HQEA 2ZFZA 4C3HK 4PYAA 3NOCA 2VFVA 4V1Ak 3HJFA 3GIJA 1CQNA 2FVSA 2RU3A 5GAHU 2QL9B 4PXBA 1S6PB 3MAQA 3FK4A 1LK7A 1K8AT 2E7VA 2MQPA 5C4JK 1T94A 4AL5A 3RB0A 3MOJB 3X1LB 3AY0A 5I3UB 1ZA1B 2CZ9A 1AB8A 1NXIA 2M2BA 1DHMA 3QNWB 2MQ8A 2F1FA 3CW2C 1BXNA 1N36J 4LIWA 4C3JC 5E2QA 1UJ5A 3MWBA 1RKIA 1YJ7A 2X7IA 2CPFA 3DN9A 3VHQA 3FCWA 5EDWA 3SSRA 3SIPB 2UXBJ 2CQIA 5BR8F 2JHEA 1S9EB 2R7ZA 4R8UA 1HWJA 2DNLA 1A6LA 3G4SS 1T7PA 4DX7A 3HHDA 3LO3A 2FC9A 2FZCB 3A13A 2M5YA 5KFQA 3SEOA 4YFKA 1YBTA 4J9SA 1BY9A 2IPOB 4RW8B 3CCUS 1D9FA 4WP8A 1XZQB 1HHQA 4C0BA 2BOPA 5IV3A 1KQFB 3V6DA 4C45A 2KM8B 4ELTA 4UOFA 3HT0A 5KT7A 3HHLA 1KQSR 2VQFF 4FPIA 5AXNA 5AE3A 1RBLA 5SZTA 4AD6A 1FJEB 4FKXA 1H2UX 4F25A 4NLSA 1RWMB 3NCRA 5C44C 2FJVA 1SFOK 4CP5A 7AT1B 1UTAA 1YLXA 5B0AA 4WXOA 1O5JA 5GAEU 1ZM3A 2BKOA 3JYTA 2DGWA 3DRPB 4FKYA 3GJQB 2HHHF 1DBDA 3BR8A 1C0TA 4DV6F 4WK3A 2UUBJ 3OTDA 3AH6A 3GSDA 4KSEB 1UWBB 2GIFA 5C7PA 4KGMA 3NS6A 1JXLA 2OLWA 1H98A 2C2ZB 4I1TA 1FXLA 3CD6S 2VPYB 4Q45A 2C1EB 3BKTA 3SV4A 3ZNUA 4ZP8A 5DQIA 1T02A 3T00A 2VBXA 3MAHA 4KMDA 2DNOA 2D41A 4ZJQA 2J8SA 3A3OB 4KM8A 2GW8A 4L76A 1LW0B 4DPOA 1F5BA 3HD2A 4DOZA 4ZPCA 3TA0A 4K4TA 1TUWA 2CJBA 2JDJA 1RYRA 2VA3A 4X84A 3CMES 3KK2B 2C2EA 2AEFA 2HFNA 3DGVA 2R42A 1B3TA 3ZTPA 4DL2A 2HW3A 2RNEA 1QSYA 5E3RA 5E7OB 1RT1A 4CM2A 2K8GA 1WG1A 1P9QC 3HZEA 3MR7A 4RW9B 3IO1A 4N76A 3KJNB 5EX3A 3EVOA 3G71S 5HBMA 1RWNB 4Q7AA 4Z2XA 2RMLA 4C3LA 3EWGA 1WNEA 1FDAA 4KYZA 1O24A 2RHSB 3M8WA 3CJ8A 3NNCA 3VZIA 4NASA 4B3SF 4UOHA 3EUNA 2HHVA 2ROGA 3MUMP 2VPXB 3L7UA 2V6AA 2M4MA 1NBEB 4O4RA 1OPIA 3IPJA 4C7QA 4O4GA 1ZAWA 2MHNA 2RKIA 2DHAA 5FJ4A 2DNQA 1CULB 3UW1A 4K5SA 1U4BA 1O8BA 3F56A 2BYCA 1CULA 1T9UA 4DR3F 1N5SA 4BWJA 2J0SD 4CI0B 3MM5B 4X64F 1SUQB 3UCGA 2W2QP 3LQVA 4DPYA 4FNIA 4XCHA 3M4OK 5GAGI 1TUGB 3KK3B 1KLMA 3CCES 1MW7A 1NKBA 3I0RB 1JLCB 1XMQF 4YB1P 2HHPA 2LKZA 4JI1F 3SBMA 2QTWA 1J2VA 4OL8A 5CJ9A 1FKPB 4YUDA 3NGSA 2ZH5A 3M9MB 2PT0A 3TQ1A 3QQCD 4M5IA 4DL4A 5BXIA 2MZTA 1T3OA 2GO9A 2DVIA 4YS2A 2ROEA 1C0AA 4KC6A 1R6VA 3N28A 3MMBB 2PI4A 3GTMA 2V5HG 2AQ4A 1VQLS 2OPRA 3E8OA 3OD2A 4HL9A 4HLBA 1CG2A 3DLGB 2UUCJ 2KZMA 1C1CA 4Y34A 5L39A 1PGZA 1E6YB 2V8GA 3WX8A 3DOMB 1R8CA 1SKWA 3VAFA 1VQ8S 1JLGB 1X60A 3GTPC 3OSPA 2ACMA 2E1PA 3ILJA 4IH6A 4LQYA 3GTKK 2VFUA 3RYLA 2YPYA 3DKDA 2PDAA 4F4WA 1YNJA 2HZCA 2CQPA 3IC1A 4DV2J 3PO2C 3N0VA 1ZXOA 3FQLA 2PC6A 4IG0B 3ZZPA 1XPPA 4CDIA 2AGPA 4P5BA 1UFWA 4L72B 5ETQA 4OYBA 4HYKA 1RACB 2FZKB 4KT0C 1HI9A 1JLBB 1DTTA 4LJMA 1J5EJ 2J0XA 5CCMA 3J81Y 1HD0A 1HQUA 3OVAA 4DR6F 2LQ8A 2GVDB 3KHHA 4TNOA 3UCUP 2CDQA 3BGRB 5M3FK 4ZN3A 3RBZA 4C2MA 2DH8A 5E3PA 2QLWA 4EK2A 4QPXA 4UZBA 2ZWPA 1GMWA 2DNGA 1LWCA 2LXFA 3K0JA 1WG4A 5LM7E 2DHSA 1WD6A 4A3DC 1JLFA 3N0BA 3FSYA 1K0TA 2BM1A 1PSDA 5GAEI 3C6TB 4EEYA 3QGGA 4GTDA 3UDVA 4GTCA 2V94A 3Q8UA 4YR2A 4JI8F 2CJYB 5G4DA 2ZE2A 2LFVA 5E68A 2GMLA 1TU0B 1YRXA 2N3OA 2HNDB 4WIIA 4DMZA 3E3XA 3FCHA 2ZBIA 1F6TA 4B9LA 3HXAA 4A3DK 2L9NA 2B5JB 2AZ1A 4R8UB 4Q0BA 2E2HK 3DXSX 2EK6A 1S1XA 1Q86T 3OTCA 2JLEA 9RUBA 3W5ZA 3V5RA 4DV4J 1V5VA 4TYBA 4GO5X 5H9FJ 1ZM9A 5KTQA 3MPVA 3IGVA 5IQ6A 2B51A 4B9SA 1JK9B 5IP9C 3HOZK 2WTFA 4DR7J 3BGLA 1N5YA 2H9ZA 2RD5C 5C2GA 4A8MP 3PO3K 1VRUA 3A8KA 4ETXA 1KHVA 3HDSA 4ZVRB 2DT9A 4ZIVA 2R7VA 2OP5A 4CT8A 1K1SA 1WQGA 3DYAB 2XO7A 3RZDK 3W1YC 4RWXA 3FEYB 2VG5B 2UU9F 2QIFA 4G1QB 3W65A 2BOAA 3M8QA 3P45B 1SBRA 2YWHA 1IBLJ 3UNYA 2DIUA 4DPWA 2ADCA 1SQGA 3RTVA 2JA8C 5KG0A 5DO2A 3G6ES 1HNWJ 2XB2D 5D4LA 1FF2A 5CHCB 1HBOB 1U48A 1GMWD 1BJTA 3KWMA 2VD3A 1DCOA 2WBRA 2ZM6F 1B7FA 1RXOB 3DU6A 3MXHP 3H2VE 3UR3C 3HOVC 3M6UA 3BQ0A 1RWKB 4MIBA 1TQLA 1ZYQA 2FJEB 3TAMB 1VOMA 2FGCA 2IRYA 2J9CA 2NSCA 4JI4F 2HQCA 2JA8K 3D3BJ 3V81A 1H73A 4FF2A 4X66F 5HI7A 3QO9A 4DWIA 4FNHA 3P6YC 4WTOB 1BWEA 2JFKA 3KUEA 5ETRA 3NG8A 2X1BA 4KB7A 5H9EJ 5F8IA 1SC1B 2YH0A 3ICLA 5FJ8K 3CJTA 3HFZB 3IRXB 4ZCIA 3DU5A 3V4IA 1TFWA 3N5BA 2C2RA 2FB0A 5DDPC 1WEXA 3AJ2A 3D2WA 4DR5J 1WG5A 4MTPA 3WX4A 2ZJPQ 2VDHA 3CQZA 4LF4F 2A18A 3HOUC 1VQOS 4UQGA 3GFXA 3E01B 3GR0A 3GTGA 4JI7J 4NLXA 3LP2A 1A9NB 3QZ7A 1IBMJ 4DUZJ 4WCEQ 3T1YJ 3CMQA 4PG4A 2KXHA 2Q79A 3KLEA 4C3KA 4EWTA 5AJ3F 1DRZA 3D28A 3I5AA 3NMRA 4KFBB 1UW4A 1XTZA 1G6BA 1Y1WK 4YY3J 3H59A 3PVXA 3D3CJ 2VUGA 4DPXA 1FXRA 2FHJA 5BJRA 1YI2S 5EGHA 4UUXA 4LF8F 1J5OA 1X8DA 2DGUA 1FT8A 2XS2A 1IE0A 3TRGA 3BP3A 3P8BB 1W7WA 4OYAA 2MQQA 4CO4A 1V3RA 4I56A 1GNKA 2ZKUA 2FVQA 3CIZA 3DOLA 4DCJB 1KP6A 2IM2A 2MZRA 4NA3A 1SC6A 5ETTA 2AHOB 4ILDA 3I5BA 1Q8BA 2ZBRA 1R7IA 2KRRA 2B8QA 4U7UK 4DR4J 2BKPA 1U6BA 5KT6A 1PC4A 3UE2A 3T1YF 3UQSA 5D77A 1K83K 1JMTA 2MZQA 5B0CA 2R2RA 4Y52K 4WBFA 1R89A 1EB0A 4A8FA 5KFWA 1ZTTA 3OV7A 5F9LA 5KG7A 3W3SA 1UAWA 2KG0A 1TKZB 4WFAQ 3K89A 1VJEA 1XMQJ 1S79A 2VG5A 3QT5A 4BBRC 3R5AA 2NVXK 2PA3A 3VTIA 4WJBA 3D6FB 1CLFA 3LPEA 1UVJA 3N01A 4PG7A 4FS1A 2ZDPA 2JZ5A 3TUZC 3WIUA 3DRRA 3HLUA 4M5KA 3NOGA 4ER8A 1N5YB 3UWTA 2ZH2A 5KFYA 5KFRA 4IH5A 1MSWD 4N41A 4JI0F 1UFKA 3DOKB 4Q4ZA 2QMUB 2ROPA 3W2WA 3DDIA 3WIVA 3C15B 2BMBA 3G6VA 1HQ2A 1EKRA 2G13A 2LU1A 3EXCX 3GTPK 4USMA 2RGRA 2ATCB 4B02A 1QDUB 2BE7D 1M5PC 5D15A 2I38A 3JQKA 2C2DA 2DB1A 4OQJA 3LH2S 1QSLA 1BQMB 1DLOA 3PZPA 1Y0HA 3ZZTA 1ULRA 1RT5A 1RT3B 2XZWA 3HOXC 3AB2B 3R1LA 4EGLA 4U8YA 3GZ7A 3L9ZA 5HN0A 1D9DA 3DM2A 2AJ4A 1XR7A 1RSCA 1S1VB 3I4MK 1MROA 3I32A 5F3ZA 3L7PA 2WONB 4LSNA 1RT7A 3AJDA 3BV8A 3CJ2A 4OHVA 5KFTA 1SH3A 5K8MA 3GTOA 3RZDC 4BC9A 4K4WA 3S2DK 4F50A 2MY8A 1YITS 4AFFA 1B4BA 1GXTA 3L4JA 2MGZA 2D3ZA 2IC3A 2U1AA 4A3EC 3VAHA 1FFSB 3S17C 1O51A 2CZVC 4MKAA 3CO0P 1IL2A 1PG5B 4Y2KA 2DPIA 3QJJA 1F9NA 4DFPA 2NVTC 4EFAC 2R2TA 4C8NA 4B3TJ 2NLWA 4F4ZA 3BPDA 4PAAA 3VWSA 4JBCA 2VICA 1U0SA 4CQ1A 3CUNA 4ED1A 2OIHA 1YJNS 4A3LK 2JWNA 1ZAVA 1TZ0A 2HQGA 1S12A 4UZCA 2BM0A 5IT0A 2R8JA 1IKVB 4YMEA 3M9OB 2IVFB 2JC1A 3HULA 1U26A 2VFSA 4Z7YA 1DTTB 3RBDA 1VQ5S 3S1RC 1DARA 3OFGA 2BZ2A 4GVBA 3QIPA 4AE5A 2PFFB 3VA7A 2APOA 4ELUA 1K9MT 2XO6A 4GC7A 1PYTA 3R7SB 3VAGA 2ACYA 2K7KA 3CCMS 4TY9A 1R43A 4LF9J 3LP1A 2JH3A 5D0RA 4LF4J 1VQNS 4NYZA 3ET6A 2ATLA 1UEVA 4DU7A 2V2VA 1B99A 2HGLA 4KB4A 4WK1A 3AD9C 1NNDA 4IFVB 2VG7A 2ZITA 2X1AA 2ZZTA 5CCLA 3UDCA 4DF4A 2A6HA 2C3UA 1SXLA 4QPTA 1HPZB 3M8QB 1RWOB 4DL0C 1RT2A 1FD2A 1RT3A 2B3TB 5KT2A 3V4GA 3BH6B 5F41A 4YP3A 1KFSA 1U25A 4NX9A 5F9NA 3W5YA 3GCWP 3K59A 4ECQA 2QGFB 4HHJA 2VJUA 4QWBA 1WTFA 1TK5A 1VRUB 4X65F 1HWLA 3KLVA 1FTCA 2M88A 4A3FC 2CQGA 3PO3C 4A8OA 1IR1A 2YKQA 4MEXA 3MUTP 4KDDA 1HBMA 2VBZA 4ZPTR 4NOHA 1U47A 4N77A 5DZ6A 4K0KF 1U1KA 1Q5YA 1IN0A 3HOUK 3BQ1A 3LA0A 5FD1A 4KN7A 2J9EA 2MZSA 2B6AB 4BC7A 2MLXA 2JSXA 4RNMA 4JP8A 2MQMA 2ZH6A 4C8KA 3H90A 5DLFA 3LGNA 1TWCA 1N33F 1UMJA 3RJMB 3MEKA 5HBMB 1NB2A 2F7VA 3JSRA 3Q83A 3DHXA 2V69A 1VIOA 2ZE2B 2A3JA 3KMQA 2QLBB 2EFQA 4QJVA 4IG3B 1WOOA 1I5OB 1UWAA 4CLWA 1JLQA 3OEPA 4C11B 2V6UA 4WP9A 1U45A 1NCLA 3M8YA 5HO4A 4Q8FA 4QW8A 1RB0A 1TKDA 2O67A 3BDPA 4P7TA 3A4TA 3NGKA 2HBQB 5LJ5Y 4NA2A 2DH9A 4OYXA 5JUMA 2YNFA 3K8WA 5C25B 2MKCA 2YKAA 1BLUA 1B4SA 3IAS9 2JC0A 3M2RB 4YOEA 4G7OA 2QL5B 3DRSA 3OPKA 1USMA 1BS2A 2HZAA 2DNKA 5DGBA 4DLGA 1RABB 1S1TA 3QAEA 2NXNA 1OSDA 3RGIA 2YKMB 3VCDA 4Z7CA 3ILLA 5M5YK 3PIOQ 3DXJA 2R8KA 1FD8A 4F7VA 1FRMA 3CNQP 1REVA 4D3GA 3U1MA 2B4VA 2AGOA 1GMVA 3DLKB 4F3OA 1N88A 3D4JA 2HVIA 3OLAA 5KFMA 4LJZA 2GVDA 1S5ZA 3MCNA 4Q2LA 2LDIA 3K5LA 3D1QA 4F0KA 4XIUA 2V6TA 4ZPVR 3GSIA 1BUXA 1CJTB 4DR4F 2OPRB 3QPIA 2CNKB 3MCMA 1YGYA 1TWGC 3JQJA 1B0VA 4PEOA 1GQEA 2HS4A 4UOCA 2BACA 3EVWA 3DRPA 3GQCA 2E7XA 2W4CA 4C4WA 2NXJA 3NGTA 4ILRA 2DXEA 3X3UA 1RHRB 3GV5B 3JB9k 4Y2AA 5KFKA 2C42A 1OYEA 2CVIA 2QLXA 3M4XA 4TU8A 4M5HA 1SPBP 3FKIK 1VQKS 5SUHA 4A93C 1VDHA 3LALA 2M7SA 4M1KA 1RAIB 2E44A 4NL5A 2P6SA 3MM5A 1BQMA 2V4RA 1TWFA 4BXXK 2W24A 4ITSA 3CJ5A 2Y8WA 3CC2S 1I50C 4WYWA 3RR8A 2LU2A 4U9RA 3TUJC 5C25A 2YNFB 4RLEA 3LW5C 3M6VA 1X31C 3PO2K 1UVKA 1X5TA 2LQBA 4YB7A 3FBEA 4I69A 1KR4A 4I68A 1F2HA 2MZ1A 1DQ8A 1LNQA 1OMSA 5IWAJ 2QYGA 3NLCA 4A3EK 4ZVUB 3AOBA 3S1MC 2KU7A 2HIYA 2B4UA 2O66A 3GJTB 2ZBCA 1O2BA 1VQSA 2XTJP 1XEZA 1IR0A 2AJFE 2PMZD 1TL7A 3LAPA 2MYFA 3CJKB 3TEGA 4JB8B 3CF5Q 7FD1A 2QL7B 3PV8A 2HS0A 4XPCA 2VPWB 4J37A 2IM3A 4OYIA 1VR6A 1VMBA 3R6LB 3G6YA 5FLMC 2JEGA 3IGNA 3NS5A 1Y4ZB 2R7RA 2B6AA 2E2JC 1SV5A 1TL7B 4JI8J 1RADB 1KWMA 4FF1A 2D3OR 5D0EA 4NMXA 2Z2ZA 2NS1B 3V2UC 2FTRA 3CT9A 2KXFA 2OEMA 1V5IB 2UUWA 3IBCB 3TEHB 4NEZA 2R92A 4C8OA 3VGUA 4F67A 1KVKA 4DN0A 1E6VB 2XWXA 1WQFA 4H54A 2CYYA 1VYAA 4P75A 2R4FA 1Q81T 4JI7F 4HT7A 3CEDA 3CD0A 4DUTA 1IBMF 1J6XA 2B9EA 4NYPA 1RHQB 1MN9A 1P8GA 3PX6A 3IR6B 4I2PA 1L3TA 1HKAA 1S7HA 1FJGJ 3PRDA 4U6PA 3GEHA 4F3MA 8ATCB 4DSLA 1Z2LA 3QFHA 5CABA 3T02A 4NZ0A 1IJFB 3FVYA 1NZ8A 4X4RA 4WFZA 4J9VA 4P2SA 2QYCA 1GXLA 2VG7B 2VONA 1FKOA 1XR5A 4NLWA 2W1BA 2E5LF 1TK8A 2YNIB 4RNNA 3VGTA 4Q0BB 3OXGA 2UUBF 3RU0A 2VOPA 5KFEA 1IQTA 3RW7A 4YHHF 1H3DA 2HGNA 1VBYA 5IS2A 1VJQA 5KG6A 3BN4A 2I2YA 1T9VA 2XMJA 1N6QA 3PJWA 3H8YA 1APSA 3OFEA 3M2UB 3QGIA 2N7CA 1TKXA 2LQ5A 1U09A 2CQ3A 3EE3A 3DI6A 3TVKA 4EO8A 2NVYC 1N5TA 1N54B 5DDQC 1LW2B 2VKRA 4CLUA 4G6VB 2DTJA 1WOSA 4ECZA 3GTQC 3UDLA 2OTJS 4X4PA 2ZM6J 3NAHA 1H74A 1CJVA 1HI8A 3TFIA 1YWXA 2ZH4A 3F41A 5F0UA 2CVEA 5DETA 1XZPA 3BM7A 2RILA 2ILZA 2NVYK 2FQQB 5IC6B 2WCXA 3MR2A 1M1GA 3TR5A 4DUYF 2CFAB 1X9SA 1CPZA 3GIRA 3DLGA 3H20A 3I96A 4WZMA 3SQOP 3LP2B 2O01C 4AQYF 1PC5A 3Q23A 3ZZYA 4IFYB 1HR0F 3GTJC 2P8IA 1ROFA 2A69A 4JI0J 1C0UA 2XLKA 3H42A 2ZH1A 3RZAA 4KKOB 1C4AA 2QEXS 1O2AA 4Z37A 2JEFA 6AT1B 3PXGa 2WONA 5RUBA 4A3IC 3DNCA 3IRWP 5E3CA 3LAJA 1S1VA 2Z0GA 2NZ4A 1O2FB 3AA9A 2J5AA 2KVQE 4ES2A 4LF7F 5AE1A 4PPZA 3MR6A 5B0EA 1CEZA 4B08A 4LOWA 2XI2A 2LMIA 1XWLA 3A12A 2GMJA 2NPFA 4DL3A 2FY8A 2XSJB 1PJ5A 2RT3A 2HVDA 1DQ9A 2AP6A 4DQIA 4JI1J 5J2QB 4X6AK 3MHYA 3Q86A 1S9FA 2F4VF 4C3IK 3LAMA 3CJKA 1YVFA 3CPWR 1FE0A 3W66A 3FCVA 3AH5A 2W2NP 4AXIA 3MCOA 1RU0A 3CQZK 2R93K 2Z30B 1I3QK 1PAUB 3D0GE 4NPOA 3AOAA 3B54A 5K8OA 5HSPA 3RZOK 4BXXC 2KT3A 3GYXB 1DD5A 3GB0A 1K47A 4J9NA 5HMZA 1LWEA 4GRSA 4PXEA 1XMBA 2C2MB 4IRDA 1KQ4A 4GKJF 1SUQA 2V34A 1J27A 3NXZA 3G96A 1RT6A 5J2MB 4HHUA 5HATA 4A3GC 3DYAA 4WXWA 4RL1A 4UOGA 4LF7J 1Q7YT 2Z8QA 3EYZA 1DZ5A 1R27B 2HQIA 3D0IE 2E29A 4CYUA 1GX6A 2DHHA 1TWFC 5KFNA 3J80U 2KKHA 1S59A 4DF8A 4ECTA 1S49A 2YY3A 3EGNA 3FMBA 1EETA 2R7ZC 1WC5A 1L5UA 3VAIA 5KFPA 4ZPAA 2BE2A 3QBCA 2IYIA 4CNZA 1B7YB 2W9AA 4O44A 4MFBB 3VVUA 2MKSA 3ZZZA 1B70B 4G3IA 4EBCA 2GS8A 3V6HA 3KHLA 1QSSA 2WVDA 3H4DA 3KXDA 3FQKA 5HVGA 1IBKF 4A8XA 4NLRA 3NBPB 4OZ1A 4OJGA 3QWUA 5B08A 4DQSA 1FEEA 2XGPA 4GKKJ 3GMGA 4DSIA 1S0NA 2DIVA 1MWQA 2HNYB 4IFVA 4R5PB 1S1WB 4RX6A 1XZPB 2CZ4A 5DDRC 4OYOA 1IKXB 2VUMC 1RT4B 1BQNB 5L1LA 3J81j 1JJCB 3T1AA 3ZTOA 3HHNB 1U1QA 4C97A 1QAJA 2IJFA 2CPIA 5CZXA 3K8VA 2EFVA 1REVB 3EMTA 2DBBA 2K06A 3GTKC 5FLMK 1FA0A 2AT1B 4M94A 2WB1L 3QO9B 4F04B 2YWKA 3HHEA 2VUMK 2KI2A 1UEKA 4K4UA 2PSZA 2GC8A 2EW9A 5LMUF 1I6HK 3DGPA 4FP9A 4A8WA 1AFIA 4PPDA 2F8MA 1TL4A 2E9RX 2AEJA 4HDGA 4M5JA 3IRXA 4B17A 1AZSA 1VIXA 3PY8A 2RRAA 2DGSA 1IBAA 1FFGB 1YJRA 4OHZA 2UUAJ 3S17K 4MQ9A 3PM9A 4ZVEA 4B3RJ 2RSQA 5L9NA 4HR2A 3KK3A 1ZYRA 2XS5A 2L08A 4DLEA 3Q22A 1VGYA 1FNOA 4OIOA 3GEIA 1TWHK 3OJUA 4L6V3 3QFWA 3P96A 4FVMA 3PNIA 5CA5A 2W7OA 3WC0A 2P8TA 4BBYA 1I6JA 3D6MB 2GJ2A 1TL5A 3M3YK 1SKSA 4ZCKA 2NREA 4CLYA 1Q5VA 2XS7A 1L0WA 4OIPA 3BJYA 4LSNB 3CJ3A 1VBZA 3KG1A 2M9KA 1TAQA 4PR6A 4WZQA 2KVIA 2RH6A 1RE1B 1FVSA 5HMXA 3R3TA 1FJGF 4DCPB 4OYMA 2QJ3A 2L3MA 1LWFB 1JXEA 8RUCA 4ENOA 4FBUA 4CLFA 4USWA 4A47A 4AUKA 1NDLA 5LMNJ 4R0JA 2Z2MA 3GTYX 1H72C 3GTKA 3O2IA 5I3QA 1GFWB 5G0RB 4H4KA 3H4BA 5A8WB 2W25A 3HX9A 3KMSA 3GTGC 4W92B 3J7Z5 3EPGA 2J0WA 2VH7A 3JTNA 2VA2A 3UD4P 2XMWA 4XTTA 2BV3A 3I82A 1SIZA 1IKWB 1AYEA 3PO5A 4XSZA 2RE1A 1UA1A 3TUPA 1Q0NA 2XNQA 3OT9A 4BS2A 3C6TA 1ZM4A 4ELVA 3OR1A 1TKTA 1HBMB 1YCLA 2G2OA 4YFNA 5IOTA 1EQ0A 1UEUA 1T9TA 5LSRA 4LF6F 5C3EC 1CSJA 4QYRA 2FVCA 5F8LA 4HH0A 2OMOA 2ZBQA 4TU7A 1M5HA 3V4MA 1K44A 4NLGA 4USVA 1HHTP 5IT4A 1NHUA 2F4FA 1AFJA 4E2FB 4QYZK 5J2QA 1NHVA 1N36F 2KXNB 2KZZA 1PBUA 1N5VA 3NMAA 1WF1A 1XXAA 3JSMA 2IMWP 3FUYA 5A8RA 4CLPA 4N5SA 5AXKA 2FLLA 4ECYA 3ENVA 3P5BP 3Q0AA 2UXBF 5EWFA 2IY5B 5M3MK 2PGCA 1DFDA 1JNRB 2HFOA 5A8KA 1IXKA 2LP4A 2ZNYA 1ZM2A 3OQ2A 3MFIA 4BY1C 4ZVFA 1PKUA 3IG1A 4G1IA 2XG8A 3TAQA 4FBTA 3CCZA 3KLHA 3ZZRA 2V9KA 2W7VA 3MD3A 5IYCK 1MMDA 2HHQA 4OZ3A 3MFHA 4B9VA 4CTAA 5HL8A 1E6YA 4R5PA 1SH0A 2VL1A 4OYWA 3G4AA 4MMOA 1VH2A 3MI7X 3HVRA 1BE4A 1A0OB 3G82B 3KLEB 3JAMU 5IM0A 3HOYK 2FZGB 4PWDB 4YFXA 2G0CA 3M8SA 1NJXA 2DXFA 4EMDA 1UWBA 1LKZA 2ZKTA 2FJDB 2KH9A 4FYWB 3MMBA 2FLPA 1Q95G 5KFFA 1N6QB 3L4KA 2NSBA 3QLHB 1RWXB 2KFZA 2GGPA 4Y65A 3EGZA 3J80Y 1S9EA 2KO1A 5AXLA 4ZVTB 3RRKA 3V4IB 2NVXC 2E2IA 3HSJA 2HHTA 1FFWB 3CCQS 4DSJA 3H3VL 1NO8A 2QT7A 5K9FA 1C1CB 2F5GA 5D8HB 4L75A 2O1PA 3FFIA 1RTDB 2C3YA 3IS9A 2NYIA 3PRVA 1KLMB 1FK9A 2KDOA 2BXJA 4OI4A 2BE9B 1KONA 2ZEJA 3PKMA 1TVRB 1TMMA 2XSFA 4UY8T 3UVJB 3ENAA 3MM9B 4A3CC 4RJVA 3TZZA 2V8PA 4CH0S 4O44B 2GSUA 4GKJJ 1FKPA 4CRJA 3FRYA 1Y00A 4NI2A 3IWLA 3PW0A 3OR2A 3KJVA 4JV1A 2XMUA 2UZAA 2YNIA 1RAJA 2OD6A 2E2IC 1TTHB 3OUYA 2V9WA 1RISA 1OYDA 2V2KA 4USJC 4DR2F 4ED0A 2AJ1A 4DSFA 2X1FA 4BBSK 2CWKA 2YNGB 4RNHA 2EC0A 2XBPA 1OY6A 1CS4B 1RA7A 4J90A 3PTWA 3JTPA 3QSYB 2UUAF 2E2HC 3I4MC 2ZVIA 4ED3A 3ERED 2CQ0A 3WDOA 2R7WA 1T0TV 2E1AA 1R0AA 4YQWA 2HVHA 1Q8KA 3NAIA 2RAQA 3GU0A 2L9DA 3POTA 2ZOFA 1JLEB 2WVBA 3AODA 5EWGA 3SFGA 1XR6A 5CXTA 4BDPA 2FPHX 3TFJA 5L8RC 4KC5A 2XQCA 3IM9A 3POTB 3CCRS 4NLTA 4F2RA 3SCJE 3Q8RB 2R7ZK 3GONA 2YWFA 4U7UD 1VC0A 3BGOP 4N56A 2VG6A 3C8YA 2E5IA 2IM1A 3TZXA 1Y3JA 5TMCA 4OIXA 3LPXA 3SZZA 3K58A 2EKNA 3ZXWA 2J7KA 2J6SA 2V6SA 1V3SA 4I6AA 1OY9A 5K20B 2JEJA 2OD4A 4WU3A 4ZKAA 2CNNB 3GTGK 3A1YG 3MMAB 2MB0B 3H25A 2NVQC 4ZITA 2BE5A 5LXRA 3FRZA 1Y5LB 3GIKA 1MWZA 1HA1A 2E66A 3BGRA 3ELHA 3IN5A 3QT6A 2VQEJ 5D4OA 4KASA 4Y7NC 1RWPB 1YJTA 2GQCA 3QIPB 3MMAA 4DJBA 1S6QA 4NYOA 2OAUA 1TKXB 3RR7A 1FX2A 4ZMMA 2ZOGA 1Z2ZA 1YBAA 4B3RF 3NGDA 5C24B 3CDUA 4DR1F 2VODA 1Y5IB 2JVOA 1YIJS 2BJEA 5JJBA 4EYIB 1GTHA 4OIQA 2JVRA 2WZ1A 4K4XA 2CDRB 2WAQL 1X4EA 2M70A 5K5MA 3PW7A 2CQ4A 4ZJLA 2BJDA 2VC1A 5KG5A 4RBVA 3OL8A 5DRKA 3BQ2A 3DOMA 1T03B 2E5LJ 3QX3A 5F8GA 2ZWOA 4WFBQ 2GJFA 2YWWA 3RRHA 1D8ZA 1SIWB 3PYFA 4B3SJ 3FDSA 3TAMA 4ECUA 4URQU 4JI3J 1CJTA 4PXDA 2IC3B 1X4DA 2ASLA 2LVWA 4IOAQ 4B3MJ 2ZUAA 4MK9A 2WVFA 3DLEA 3M2VA 3BYPA 3OL7A 2QFJA 1KQGB 3R7BB 4LR9A 5C3EK 5KOWA 4M5MA 2BANB 2UP1A 2XYPB 1JLGA 1I50A 1E6VA 3UDEA 2YKOA 1RYSA 3N79A 2MTLA 1UJ6A 4KQZA 1HBNA 2XMTA 2BQRA 2I1RA 5CQGA 4FVCA 3EGVA 2R7SA 5BYQA 3BO4A 1M1HA 4LLGA 3TZYA 4H4MA 2WSFC 4UT4A 2DR8A 1L3SA 3E2EA 4F02A 3MECA 5B09A 1FDNA 2V4QA 3I9V9 2CW0A 5A8RB 1EZZB 1S72S 1HQMA 1REGX 2NPIA 3U02A 4NXMF 4ANDA 4K8RA 2GV1A 2O5DA 3MM6A 5LT5A 3UN5A 1TWAA 1Y5NB 4X4OA 2ZJRQ 4UUWA 3M2RA 2EKYA 2XZDB 5IT9Y 1HWIA 4MH8A 3T5JA 1KNZA 3M1VA 5BR8J 6FD1A 3T01A 4MIAA 5LSOA 3CCWA 4PQUA 1FRXA 3H0PA 3FGVA 3KTQA 4WFNQ 2QA4G 2IRUA 2ZVSA 3HOYC 1QTNB 5KFLA 3W8PA 3M8RA 3EPIA 5CD4A 2G9OA 1OWXA 2V2QA 3PFOA 1V6HA 3P4UB 3ONQA 1MU2B 2BJ1A 3IWXA 3HHLC 4XPEA 1RHKB 1TWAK 3L4BC 1EJ7L 5IOSA 5L46A 3I4PA 4P72A 4ES1A 1TMJA 2GGPB 3BS9A 4WIQA 3C2PA 4C2MK 5IOQA 2FHKA 4Q5VA 1G51A 2FLOA 2HWHA 4E0DA 4O3QA 2GHPA 4ZLNA 2VBWA 1NJWA 2FVPA 4C8ZA 1D9AA 2CJKA 4ECWA 2OUGA 2FJWA 4K4SA 2VJVA 2XHWA 2XC9A 4IOBA 2XY7A 3IR5B 3FFIB 4A8SA 2BW2A 3IFEA 1S6OA 1S10A 3I0SA 3U1LA 1KTQA 2HSEB 3BN7A 1IBCB 4DV1J 3C19A 5BYRA 3DCAA 3N6MA 4K2XA 5KFSA 1VQMS 3U1NA 3LP1B 3QLHA 3MMJA 5K8PA 3Q2SC 4YDXA 1HQUB 4OLOA 3W60A 1BGWA 3G8SA 4PG6A 2RRBA 1D8YA 3N4WA 2R3VA 4KGKA 1VJWA 4OI3A 3N6LA 1VQ6S 1TL1B 1V3ZA 3RRGA 2W7PA 1V9OA 2RHQB 3BGFA 4NXNF 2CQCA 4K4YA 1FRLA 4M8LA 3EDRB 1URRA 3BP8C 1ELOA 2I6WA 3AT1B 1OSCA 1HI0P 3S2DC 1IKVA 1HNVB 3ILOA 2AJ0A 2XZTB 2ZJQQ 4DZ6A 5J2NB 3OJSA 2MXYA 4GT9A 1RTHA 4OX6A 3B78A 5THWA 2W2MP 1GAOA 3JAMY 2X51A 2IA6A 4NZ6A 2HNZB 1F9FA 1JLAA 4TN2A 3IA0A 4GO7X 1F3FA 4ZP7A 3OTOJ 4IDKB 4NZ7A 1JKHA 2DCLA 1Y11A 5DDOC 4MEYA 1ZBSA 4FZVA 2FHJD 3BUEA 4WP3A 4WWSA 5IT9U 2CJQA 3Q8VA 2XYGB 4DR2J 4B9MA 5HP1B 1WEZA 2W9CB 4A3LC 1I3QA 1WKJA 4K0KJ 2NXEA 2V4JA 2R93A 4RW8A 3UR0A 5H1SV 4GTBA 3C16A 4JV5F 3NGUA 1YJ9S 3HP6A 1IUJA 4GTAA 2BVZA 4A3BC 2F40A 4I2QB 3LTOA 3NP5A 8AT1B 1S1UB 2B43A 1HNZJ 3P49B 6FDRA 2UXCF 2OPPB 1DY3A 3HF5A 1HYSA 4DV6J 2EFOA 4L3KA 2VB6A 4X4QA 2HQ3A 3EQLA 2OEKA 5FIIA 3BZQA 2J7WA 5A2QU 1JB0C 2MQLA 2L9WA 1Q8LA 2JFDA 1SJ3P 1B0TA 1UFLA 2P9CA 3SCLE 4OV6A 1WCMA 5I42B 2PHCB 3KDOA 2Y9HA 1HWUA 4A93K 1QVFR 3NKYA 3HHLD 1K0VA 1U6ZA 4OZLA 1O26A 1ITPA 1AXQA 3BBBA 5ETMA 5DGAA 5KFGA 4HEA9 3BF4A 3KJFB 3RBXA 2HQFA 4AXJA 1HNWF 1DJ0A 1XN9A 3D6HB 2D9PA 4AH6A 1X7VA 2OPQB 1QUVA 1S57A 2JA7K 2BE2B 1U8SA 1IQ0A 4C11A 2GNKA 4I4BA 3S14C 1MWYA 1XNRJ 3GDZA 4KJIA 3M32A 4P9SA 2RRNA 2N4CA 5B0GA 1FWPA 1P1TA 5A6PA 2W2OP 4K50A 2C28A 1C1BA 4JI4J 1NEEA 2OMLA 1FJCA 2BKNA 3OXFA 4RBUA 4Q8EA 3R97A 4HI2A 2AF6A 3DRXA 4IKAA 4A3FK 3FSXA 4FYXB 3TUIC 3HKZL 3UN2A 2NVYA 2J6UA 2PD1A 5MLCV 5A2QY 4RKUC 3FBBA 1SCJB 5D6GA 1R0CB 4LVOP 4Y7NK 4QZVB 3R5BA 1NDKA 4OZ2A 1RT2B 4EYHB 5ETNA 3TJ9A 4ILMA 7FDRA 3S01A 4C0HA 3CMAS 4JK1A 1I94F 3GIMA 2XGQA 2BBEA 4EU0A 4RNFA 3KK2A 1VBKA 1WJ9A 2WOMA 1BHNA 3V6KA 5IV4A 2V8VA 4RW4B 3L7OA 3OSNA 2YX7A 2DEJA 3VAJA 2W8KA 4WKRA 1FHTA 4OJ3A 3GTOC 5KFCA 3UN3A 1ACMB 3BREA 3MMLB 1KBRA 1RTHB 1NDPA 4KO0A 4PG8A 5HK4A 3KUGA 3CJQA 2AX1A 5H9EK 1WHYA 5ETSA 3DGPB 4DR6J 3J7A1 3SSQA 1C0TB 3HVTB 2H5EA 1IKXA 4A8YA 3G4CA 1Q4RA 4Q44A 3T6JA 3FKBA 2A2DA 4BCAA 5CHPA 4P71A 3S2HK 2G1HA 1T05B 2V8HA 1GX5A 2BQ3A 3MR5A 3R1HA 3ULHA 3OL6A 1J5OB 2R7TA 2KN4A 4CIOA 2QC3A 4DN9A 2GQQA 1HR0J 5GVQA 4B3MF 3H0GC 3Q8PB 2XM3A 1WDTA 4KGZB 4DV3J 3M4OC 3AJ1A 5IOLA 4A3IK 1OQ6A 5JVHQ 5M5WK 4K4ZA 1JOEA 4TKTA 2LXIA 2XWYA 3S15C 3NY0A 1UVMA 3RAQA 1NJIT 1FRIA 2GSOA 5ETKA 2MGZB 3S6EA 1WUUA 1KHWA 2PMWA 1XNQF 5J2NA 2OJ3A 2G2ZA 2NYHA 2BJ9A 1UVLA 2D6FC 2Z4PA 3GR1A 1X9MA 4Y00A 4DI6A 2Y1LB 3ADAC 5B7WA 1CC8A 2BDPA 3BO2A 2QO3A 1O25A 1R9TC 2B0GA 3KK1B 3U7JA 2FVRA 2G0JA 2OPSB 2I9SA 2GSNA 2AV5A 4NCAA 1WHVA 4C3MA 3T19A 1RU2A 3A8JA 1N56A 4LMZA 1YDLA 4DS5A 4OINA 3OFFA 5CYJA 4X62J 4BY7C 1IBLF 2CJ9A 4G1PA 2ALZA 1HWKA 4C98A 4DX6A 1WC1A 2ZDOA 3K7AC 4P7VA 1VQ9S 1RHMB 3KFWX 4DV5J 5HMWA 3CJ0A 5HLFA 3M8PA 4DEZA 1WC4A 2OEJA 5IYDK 4KH0B 3LANA 1ZVUA 4G0VA 4KATA 1LWEB 2VFTA 4WE1A 3I87A 3W62A 2R7QA 2CNOB 3H7HB 4KHMA 1TWFK 1FKOB 1FEHA 1D1UA 4NRUA 2R9LA 2IJRA 4DCOB 1J6WA 1R31A 1TWGA 3QJLA 3GIIA 1UCNA 4G7HA 2J7UA 4G7ZA 4J9RA 3FC9A 3PJXA 1VRTA 4JUZA 2QG9B 4YR3A 2OH2A 1G4CA 3I4NK 5HP1A 4QWCA 3SYZA 5IORA 1IWAA 3BGUA 3PRBA 4DDFA 5K14B 4RWWA 3J7ZT 4BLBA 1S9GB 4AL7A 2EG2A 2D9OA 2J9DA 4TXSA 4X4TA 3RUBL 1JKHB 2V68A 1FKAF 3TARA 4A3CK 3UO0A 3TX0A 4TLRA 3GP9A 1JLAB 4N8OA 1M5OC 1QAYA 4LUBA 1N0UA 2YNHB 1NJZA 3TNVA 1HNIA 2KJVA 3A8EA 2HFSA 2A10A 2B5JA 3L3CA 4F4KA 2OO4A 3CO9A 1XC9A 1K73T 1S0VA 2B4OA 1N32J 4RW9A 1VLOA 2E2IK 3VVTA 3KLGB 1OO0B 4L73A 5HQMA 1YG0A 3THTA 1TWHA 3RAXA 2PE8A 2AWZA 2WRMA 3DHWC 3GV8B 2KT5A 5HROA 4LK1A 4PWUA 1VC6A 4EUVA 4ID5A 1N5QA 4WJ4A 1LQ9A 5KFBA 3RBEA 2AU0A 3QMQA 4ZH4A 1Y7PA 2HHHJ 1RHJB 4KFBA 2ZC3A 3RW6A 4A3MC 2ZD1A 1NHKL 4J9KA 4NLPA 2ZFHA 3D66A 4X66J 3G87A 3R9LA 3C6UA 1NU4A 2YWGA 2Y1RI 3ZTSA 3NUHA 1JXVA 2EBEA 4LF9F 3C66A 2UUCF 4I7FA 3MAAB 3MM7B 4X2BA 3HSGA 4KH1B 2KB2A 4UY85 1AROP 4QQBA 2KM8C 1PYSB 4NA1A 2DPJA 4RZRA 1Y10A 5HANA 1JLFB 3A8IA 1M5VC 1U0HB 1PJ6A 1LWCB 1ZH5A 2RVJA 2BEFA 2KL8A 3BBCA 4ZIWA 3C6UB 3GPAA 4ID8A 4ZVHA 4YB6A 1WC6A 1W2BR 4JI6F 4XAKA 3WZ0A 2AKWB 4W4MA 3NWGA 2HZVA 4PKDB 5EX0A 5KG3A 1NJYA 1VCTA 1BC6A 2WB4A 2DITA 2GAGC 4YN3B 1ZS6A 2Y0SL 1HMVA 1NKCA 1SFOC 5L38A 3L09A 1RAEB 3TQEA 4OYZA 1VGXA 4J5OA 2D74B 3IBWA 1QTMA 2C2OB 4A48A 1S6QB 2FJXA 3H5YA 2VKZG 4DV7J 2LA6A 4PRFA 4HTIA 1XZQA 3BSOA 4W98A 1RTIA 1BD6A 2FYXA 4NEYA 4KPYA 2UVWA 4FF3A 1UW9A 4URGA 1IQZA 4XO0A 1NUEA 4S0MA 3SDEA 1FRKA 2MKYA 1FNMA 1RLCL 2WVCA 2ZH9A 1N33J 4I64A 3W5XA 1F93A 2EFNA 3C3LA 3MPUB 2DHXA 4LR2A 5M2UA 4DSKA 2BJ3A 4GTLA 2R8HA 4X62F 3PO4A 2LQJA 2ZHAA 2SXLA 3T9ZA 1U1RA 3W63A 2KJWA 4MYTA 3F73A 2Y0BB 2HVZA 1WSVA 2FD2A 3HOWK 4WE1B 3FZ2A 2V67A 1F0XA 2IYGA 3DMJA 2YQ0A 4GMKA 1I1GA 1SC4B 4KGVB 2VQFJ 3CDBA 2EXUA 2KWAA 1VQ7S 1U7LA 2ASJA 3SCKE 2H3EB 5KFZA 3S2HC 1T9YA 4A4JA 1OQ3A 4R0EA 2CQ2A 2BJ8A 4X4UA 3GTLC 2WHOA 2DISA 3PYEA 1M1KT 4WYLA 5C5JA 2HLUA 3Q8YA 2IJNA 3IP0A 2UVUA 3TA1A 5KFUA 2IVMA 4NI2B 4U96A 3LUYA 4OZ0A 5C42A 2RS8A 2FUG9 3GJSB 2V0NA 3KLIA 1FWKA 2OGUA 4O4GB 2CPZA 4F0HA 2GHVC 2JX2A 4Y52C 2VHGA 1MLAA 3CD5A 1RJJA 2BJ7A 2H5JB 1NH7A 3OREA 4FN5A 4KR0B 4OI0A 1WACA 2YX1A 1HBUA 1WF2A 2OPSA 4IH7A 4JI5J 3GFZA 2HWIA 5C4XK 5LXYA 3I9ZA 3HKWA 2HK2A 3LP0A 1UZDA 1IS1A 4PUOA 4A3KK 3QRQA 2DHGA 4RMFA 2F3JA 5DZ7A 1L3UA 3W2VB 3UFCX 3S1QK 2E5JA 1HNZF 2P5VA 3OVBA 5CYQB 2DXDA 3EZUA 4MIWA 1R8HA 1HNXJ 1VK3A 1I50K 4I0WA 4QWDA 1TAUA 3MURP 1OS5A 1UL3A 2AYMA 1N32F 3PR5B 4YHHJ 3FHZA 2CPDA 2YKNB 2Y1JA 2JOQA 1TL3A 2EVZA 1NK9A 3J7YU 1SL0A 4DV5F 4DFKA 3S8SA 4DPTA 4H4OA 3NGRA 4DSEA 1SL1A 2Y8YA 2JNJA 1FXDA 2D7SA 3VF0B 4ICLB 5A8KB 3WODA 5JVOA 3PW2A 2OSRA 4JI5F 4LSLB 2C22A 4ED6A 1YQHA 4NWBA 4CLZA 3WHIA 3IM8A 4RO0A 3DDKA 1RCOB 3HVWA 3T3FA 4DR7F 3GE9A 3I4NC 1H7WA 4UQTA 2I5JA 2E2JK 2KTQA 4C6AA 1G2EA 5EGEA 1OIAA 5AXMA 1X0FA 2YNHA 4NMLA 4K4VA 3ISNC 2YX4A 4OMFG 1NK5A 5A8WA 2O5JA 3NNAA 3T5KA 4OZNA 4N7TA 3G6XA 3FBCA 2R2SA 2CPJA 5KG2A 3MEDB 1M5SA 1UPMB 4IQMA 5DQGA 1AA1B 4BKWA 1U2FA 2DY1A 1QAIA 2WOMB 4OIRA 2G2YA 3I55S 4CM0A 1YJVA 1C2PA 3FZBA 1XMOF 1K83A 1NB7A 3PEHA 3EXYA 2FC8A 2HS3A 2JL9A 2Q43A 4RUBA 1GTEA 3CB4A 3DMJB 2CQBA 4WPAA 1NK8A 1JWWA 2W4PA 2M8DB 2R92K 4H4KC 4YDDB 1RBOB 3MM9A 4TQRA 3T6BA 3BPSP 4ZA1A 1XBWA 2QLJB 3OXLA 1EQMA 1W25A 3PFEA 2RQMA 3OR1B 3MEGA 3QJPA 2XY5A 1RCXB 1S48A 4IG3A 4QJVB 4K5RA 1U2CA 3QRRA 2ZHBA 4LFCF 3MEGB 3CDWA 4KAIA 4ZVQB 5HLFB 2HBRB 2L41A 4OLPA 3C14B 2QZ8A 4BLAA 4EBEA 5HMYA 4FZBA 1S6PA 3DLBA 3HK2A 4QIWL 3QATA 3CSKA 2ZC4A 3B82A 3OVSA 1HD1A 2K1RB 2WW4A 2J76E 2XMKA 4ED5A 4F2SA 2XCAA 1SL2A 3ITHA 4LRCA 1QE1A 5IXUA 4CO0A 1F5AA 2FLNA 1R8PA 2HHXA 3PHEA 4QWEA 2G4BA 1LEOA 1VHFA 5ETPA 1LW0A 1N4LA 3Q3QA 1WI6A 4H4OB 1YBUA 3R2DJ 1ZAXA 2CUYA 3IAM9 4QWAA 1FRJA 2PA8L 1T9XA 2IHR1 3B4DA 2Q1LA 3KLHB 3LF0A 4LRFA 2I5JB 1XNRF 2IBOA 1HIYA 1RT1B 1HHSA 2W9BB 4Y0FA 3AHPA 4KAWX 3AFGA 2F8EX 4JI6J 3IMQJ 5TJ3A 1Q16B 2DNMA 1VK8A 3MD1A 2W9CA 4ED2A 3UI3A 1JVIA 4ZOSA 4FXDA 1I6VA 2W7AA 3QGPA 3G8QA 1RWWB 2DO4A 5KG4A 1N0VC 2PPBA 4OX9J 1RA6A 4JI3F 5L9XA 2IDLA 3GTQK 1FDDA 3PHTA 4ZCMA 2GA7A 3HOWC 4IR9A 1GT8A 2C2KB 4RBTA 3WQPA 1X4FA 5HQLA 2QA4S 1CJKA 2F9JA 3EZ5A 1VI7A 1KEKA 2DCUB 1WORA 2DYAA 3EGWB 1NK4A 1NPRA 4ILLA 1FCAA 2RDJA 2N3LA 4ZLJA 1JX4A 3V6DB 1IR2A 4ZP6A 1TP7A 3SCIE 5CAAA 2MQNA 2JA5A 1ZA2B 1S99A 4B3TF 1LOUA 4PG5A 2UV8A 2DEIA 4KIAA 1JQGA 2OELA 3G86A 1F7UA 5KT5A 4OHYA 4X6AC 2UUTA 4B3OA 3SFUA 1D3WA 4O0IA 5F8JA 4CLKA 4DV2F 1H0HB 3HJVA 5HQ8A 1WKKA 3DM2B 4MFBA 1GMUA 2DH7A 1HNIB 4AT1B 3AAWB 2ZHOA 2DNHA 1I3QC 2COLA 2FQOA 3JXOA 1MU2A 3HI9A 2GJIA 2HWTA 4KN4A 5E5NA 3PCOB 3HT3A 1SKRA 1N52B 5M5XK 3MMCA 3QWPA 1VFJA 3AD8C 4ECXA 4QCLA 2RS2A 4LT6A 4Y2CA 2MKIA 3H0GK 4A3GK 1HLWA 2HHWA 4AL6A 2M52A 1RT7B 1YJWS 4XDDA 4U7CA 1FWLA 4DQQA 3VQSA 3WC2A 4M63A 2JLFA 1H6KX 3LWLA 2AMCB 2LA4A 1KQKA 2AYEA 4NE9C 2IM0A 2Z2YB 2DD8S 3S15K 4FS2A 3VQTA 4DFMA 4P74A 1RI7A 4C2MC 4O2DA 4XLPA 2D1CA 1T11A 4DG1A 2B7BB 3HFVA 3O44A 3NWRA 4QYZJ 2DNRA 1FESA 4ZPWR 4Q2MA 1TV6B 4GFQA 3KUHA 2MSSA 4JV2A 1DLOB 1RQ0A 1W26A 4OFZA 3D7SB 2DRAA 4X65J 3CE8A 1TWCK 3UPFA 4P73A 5D0HA 1YRTA 3CULA 1RUSA 2QMWA 1SQFA 3M6WA 3I31A 1HL6A 5DM6Q 1RT6B 1BGXT 1W2IA 3I6PA 5IP7C 1R3NA 3R7NB 2BANA 4A3KC 4NLQA 3TYTA 4AYBL 4BBRK 4LFAJ 2MKHA 1S0MA 5K8NA 1NPPA 3KDNA 2ZH8A 3MM6B 4CH7A 5F3TA 4NCBA 2VIHA 3TAPA 3PW4A 2KG1A 1WSRA 3VGSA 4F4XA 1RLDA 1YKWA 2KHCA 4IFYA 4GC6A 1EP4A 3H5SA 1LV5A 2CPYA 4F8RA 4IOCQ 3M7VA 1XMOJ 5HJYA 3OHAA 1FE4A 2ZH7A 3UNGC 4R25A 2JLGA 5IP7K 1HBNB 1WCMC 4G65A 4ZHRB 3FKIA 1AUSL 2HVEA 4EZ9A 3IWNC 4F26A 2AYBA 1ZOTA 2B63C 2NXUA 1PIEA 4LBIA 3O3LA 4Q5SA 2HYIB 5FDLB 3NNHA 4ED8A 3THPA 3BBFA 2XSJA 1DTQA 1G3OA 4OI2A 3OFHA 1QD1A 2HMIB 1TELA 1HW9A 2YU9A 4LFCJ 1YSJA 4ECRA 4HVZA 2NUUG 4F4YA 3DI6B 5JFEA 4DUYJ 2EK1A 3S0XA 1HI1A 2CFAA 1S1XB 1WQHA 3NEKA 1T03A 3OTBA 3GTMK 4XSXA 3KG4A 1D09B 4OI1A 5D4NA 3HXMA 3OHBA 5E3QA 1LFWA 3R2CJ 3H3VD 4Y2IA 4DV0J 3CC7S 1FRHA 3V6JA 1Q53A 4RW6A 3MPWA 2A2CA 2LLZA 4U67Q 1HFEL 5KT3A 5IC4B 4ANCA 2FHOB 2UXCJ 4WU2A 5CYQA 1XK8A 2MMYA 3T9NA 1XXBA 2E5HA 1NK6A 1CBKA 2ILYA 5I3PA 4LVNP 3TZWA 1URNA 2WB1D 3SZYA 4G0UA 1WHWA 1DURA 3W61A 3I56S 1QAXA 2LDYA 4I2PB 3SMZA 1EARA 2HBYB 4TY8A 2EEYA 2R7XA 4DUZF 1M90T 2IA0A 2XLJA 5CH7B 2GAHC 1JLBA 5MAOA 5CYMB 3ZZ0A 3QAUA 1IW7A 2GMHA 4OX9F 2AW0A 3R5JB 1EKSA 3ITHB 2RH3A 4PQUB 1TWHC 2RQKA 3AB4B 3M1VB 2V8DA 3KLIB 3OL9A 3RB4A 2QFIA 2LCWA 4C3HC 4JOUA 4CLTA 5GAHI 3D68A 4UW2A 5TMFA 4LF2A 4A3BK 2R92C 3HKZD 3BR9A 3O8WA 5IFMA 4DR1J 4DL7A 4DR3J 2B56A 1RAOA 4X64J 1RTZA 4A46A 3D5MA 1VQPS 1S0OA 5T7LB 2DJWA 3FBFA 4CCHA 1QE1B 3LPYA 4MKYA 2JA5K 3K5PA 4BWMA 2M8HA 1JQWA 4M5GA 2XMMA 4XLNA 3HSZA 3SV3A 4ES3A 2HG4A 4ZDNA 1F7VA 2MJNA 3BEGB 4NCGA 1OY8A 2NVTK 4DV1F 3CVKA 5J1EB 4TLQA 1T8EA 2YU9K 1RU1A 3R8YA 1KN6A 3NL0A 1SJ1A 2DNNA 2HNDA 4HKQA 3TVYA 4USIA 4LIRA 1WIHA 4LBPA 4KY3A 3CJSA 2F4VJ 5DG8A 4DL5A 1X9WA 2XLIA 1SKUB 4M5NA 3KLFB 1U1LA 2LXUA 2UVRA 4LR8A 1GH8A 1TR0A 1UA0A 1G1XA 4KV8B 1X4CA 4P2XA 3DLEB 5KFAA 2HFVA 3TFHA 2CIMA 4O3PA 1RGVA 4WKYA 4AYBD 4LQ9A 3D1OA 3T41A 4J3NA 1UV7A 4M5DB 1RAFB 3TOQA 2X3GA 2A6EA 4IYQA 2MY7A 4ZLPA 1RP5A 1ZZFA 3MMCB 2B9YA 1H2TZ 1PAEX 1RHUB 5ETOA 3R5DA 3KJQB 1EI6A 4QIFA 2W01A 1EIYB 1NSAA 4C0OC 1ZZNA 3PACA 4LFAF 3BO3A 3AXKA 5HJXA 5GADU 2UXDJ 3NCPA 3S1TA 3TJ8A 3EX7B 2LEPA 2C3MA 1YHQS 3QSIA 2J0QD 4PQAA 2R8GA 1S4FA 3DLKA 3MM8B 1KRPA 4LK0A 5JMNA 5B0FA 5M2PA 4QBUA 1BDFA 5HROB 3N9UC 1T05A 2GHWA 2POKA 4ANEA 1ZETA 1QLNA 2QSFA 1FO1A 3H0GA 1TWCC 2O5IA 2N82B 2GO8A 1AUDA 2CRLA 3ZZUA 1WHXA 1YTYA 1LXNA 3ZZOA 2Q66A 3M9NB 5HL7Q 3TP2A 3MPDA 4KM9A 4RNOA 3TW0A 3HHKA 4UF4A 4IG0A 1DAXA 3OW2R 1UVIA 1JLQB 2EFPA 2K1RA 2ABYA 1D0EA 2YKMA 5KOXA 4DDQA 2Y1IA 3GTMC 2I0XA 1I3OB 2E1RA 3LWMA 2ZH3A 5J1NA 3CWJA 3W9IA 2RF2A 2XCQA 1WTBA 3DRSB 5HAOA 4CO5A 3JSTA 4EZ6A 2FJAB 4JYAF 3LGMA 1KVIA 2HRUA 1X4BA 3HOXK 1WWHA 3DLHA 1CS4A 2DRBA 4LRAA 3W9JA 1MG7A 1JLCA 2MKKA 1F9HA 5U47A 4M1XA 2PMHA 2W8LA 4AQYJ 2A68A 4PXCA 1S4EA 2HHSA 2JRSA 1EP4B 1JLEA 2DR9A 1TUVA 1S77D 2R7OA 5B0BA 3OR2B 4KRWA 3KJVB 2A0FB 2HURA 4P52A 1X5OA 1EFWA 3T1HF 4GVLA 2RUSA 3ZNJ1 4QR2A 4MT1A 1PJ7A 3GEEA 4ZVSB 3GTQA 4ZN1A 4ZJOA 1VC5A 2MHEA 5J1EA 2CA9A 2MPUA 3KYLA 3M30B 3K7AK 3HVAA 4IQXA 5EHHA 1Q79A 4V19X 5T14A 3GFHA 5GMEA 1KD1T 2C3OA 1RTJA 2IVYA 3JTOA 4OHXA 2R7UA 5G0RA 3MEDA 1TV6A 2NUHA 3MEEA 5LMUJ 2M3DA 1J98A 2J6TA 5H9FK 1SJQA 3RB3A 3MEEB 5HVFA 1I51B 5L1KA 5DG9A 2WSCC 1RTJB 2A1BA 1O29A 3AA8A 2YPZA 4Y6IA 2BRLA 2QRRA 1KLNA 3CXCR 1DCHA 3MOZA 4Y2MA 2OPPA 3J7AN 2VFRA 1QUPA 5DG7A 3G2XA 1R8BA 1F3VA 4DFJA 3M2VB 4EBDA 3EZOA 3QGHA 1JNZB 3UVJA 4J9UE 1P9YA 5J2PA 1QVGR 2X1GA 5KFJA 2MKJA 3BKUA 1FERA 2U2FA 4IO1A 4DR5F 1GXUA 4DX5A 4DV3F 3FSIA 2JA7A 4GVBB 3N3YA 4DL6A 4KHRA 3MF5A 1VS3A 3TWZA 4RU2A 5IM0B 2OTLS 3SI8A 3H98A 2N7YA 2CADA 3GCXP 2W2PP 5ADZA 2CQDA 2PEBA 2A6MA 3TJAA 2P5MA 4DHVA 3SZ2A 1DCPA 3NS7B 4DX8H 1BMQB 2CNLB 4ZVGA 1L3KA 2RU9A 2H48B 1EX8A 2KFNA 4IRCA 2UVVA 2NVQK 2ZZNA 1LFPA 1Y1WA 4Y28C 2ALYB 3GV7B 3OPFA 3EICA 1GK8A 4YFUA 1BQNA 1UP1A 5CZVA 4CNYA 1F5CA 4C3JK 3D6TB 2HHUA 1NKEA 5AE2A 2WBMA 2DGQA 2H5IB 3IR7B 1NMEB 2RQ4A 3E51A 2B8PA 1VQ4S 4O3RA 4KMHA 2RJZA 2QN6B 2GZOA 2RB7A 2JA6K 3UD5A 4O23A 1U8WA 4A3JC 1ISEA 3NBPA 4RW6B 2JA5C 3KG0A 5F8NA 4CO3A 1Q7LB 3FEZA 3K57A 3BH7B 4RU9A 3BB5A 1I94J 3DRYA 2HAFA 3ISZA 2VASA 1B64A 4URSA 2F63A 2Y3PA 4C8MA 1RT4A 2Y3YA 4QU7A 1O0PA 2KFYA 5KT4A 4B9TA 3K5OA 4W90B 1TKTB 4LF6J 2L48A 2RUGA 1FVQA 3PX4A 4CZCA 3CTRA 2YTCA 2DGVA 1G7CB 2CXEA 1RBAA 1RT5B 2IRXA 1Z1ZA 3NCQA 4U95A 3KLFA 1VQYA 1NRKA 3GWCA 5GMKa 3BSNA 2H65B 4KGXB 2XNRA 1F9EB 2D3O1 4TVAB 4CLSA 1BQXA 5DM7Q 2YQ1A 4Q43A 2MDAA 3OTEA 3HD1A 1J5EF 1HQEB 3CIMA 2BUNA 5L1JA 1INNA 3HMJG 1A7GE 2VOOA 4C9DA 4YB5A 1PILA 1FI4A 1DTQB 2WAQD 4KV8A 2OPQA 3R5CA 5GADI 4FPRA 1F60B 2KHDA 2VPZB 4USHA 4YG2A 4USKA 1N34J 4DS4A 3MZIA 5GMDA 2B7CB 4C8LA 3N6NA 2DR5A 4RR5A 1Y1VA 2IFXA 2H51B 1LWFA 3CGIA 1XNQJ 3VAKA 2WW8A 1M5KC 1WOPA 2AIRB 2K3KA 5EWEA 2G0IA 3J81U 4I2QA 2RQCA 1T3NA 3KKFA 2M0GB 4KB2A 3HM9A 2P9GA 2EBBA 5EN1A 4L3NA 2BQUA 1O6XA 5IWAF 3JSBA 4Y3CA 5A0YA 1JJ4A 2ADBA 3GYNA 2D69A 2KT2A 2ZUEA 4PABA 4LF5F 1TVRA 1P1LA 4YY3F 3MTKA 1PYOB 3T5HA 3P5TL 2CFXA 1K83C 4LRDA 4KTQA 1HYSB 5E3AA 3DLLQ 5D3GA 2JEIA 1S1UA 4WILA 1N34F 3CC4S 1HNXF 5L1IA 5E41A 5ETVA 2R8IA 4OZ5A 1CJUA 4KMAA 1YRUA 3BDEA 1CQMA 3B4MA 1R9TK 3A3PB 2CJXB 4ZK7M 2Q3PA 4KKOA 3IBFB 2YBVA 5DQHA 4B3OB 4BBSC 1S1WA 3ETMA 3CCVS 1B4AA 4D3HA 4A8QA 3MM7A 2OHDA 5KFVA 1NM2A 2NZCA 4QR1A 2CG4A 3K2YA 2PO4A 1IVZA 3T5LA 4TY8B 4O3SA 3VALA 2P9EA 4CWBA 5JXSA 2NQPA 3AQOA 4PUOB 1J6VA 5KFHA 1XJWB 2XCPA 4JI2F 3VZHA 3QZ8A 1TL3B 1WC3A 4RUHA 2NR0A 3W8GA 1WEYA 5D78A 2BR0A 1X4AA 2XHCA 4NLUA 1WF0A 9ATCB 3CCSS 3N5FA 3HO1A 4C8YA 1R8AA 2XYHB 1CJVB 3I0SB 3Q24A 4ID5B 4ED7A 1U0HA 3ISND 3W9HA 1U49A 5A6WA 2MQOA 1C4CA 1TWGK 1HARA 1EQRA 4P2FA 1U02A 2XY6A 4OI6A 2F9DA 3W2VA 2DKOB 3E01A 4A3MK 4HDHA 4QW9A 2IAJA 3D9BA 3HVTA 2K2PA 3VAMA 4GTEA 4HI1A 3GYGA 1KC8T 1CJKB 4X4SA 2VG6B 5D0GA 1U1OA 3US5A 4TYAA 4I67A 4ZS6A 3CCJS 3CAGA 3QYYA 5KAKA 3MTJA 3FKIC 3S14K 4P10A 2DR7A 4MK8A 1LWXA 3C15A 1EH1A 2CPXA 2FY1A 4E8UA 4ECSA 3EJMA 1RAHB 1X5SA 1VISA 4P2MA 3TI0A 2JA6C 1M0SA 2LYVA 5ITHA 4BLGA 1QY7A 3DRRB 2EBGA 3G8TA 3QIDA 1NSPA 1IM6A 3GLJA 2GFFA 5D4DA 3O6QA 3ZO7A 2F65A 4G1QA 2NCKL 5CD4H 1VRTB 4EI2A 2VQEF 1CJUB 1Y9OA 2K7JA 4ZHRA 2ASDA 4ED4A 2AYGA 3TTGA 2HIQA 2QV6A 4LR7A 2GIRA 3H5XA 3PW5A 3EVMA 2HAIA 1UPPA 3F0NA 1S6UA 4GZYA 2XMAA 2Z56B 1RWUA 4U8VA 5AT1B 4O3NA 3RAMA 5LJ3Y 2GVZA 3GTOK 3GTLA 1UVNA 3Q8QB 1LXJA 1ZPWX 1RZMA 1Z4UA 1SV5B 3M30A 3ZC4A 3HOVK 1XIQA 2AJQA 2Z57B 2VF3A 2FIUA 4KHPF 3ETOA 1O28A 4FF4A 4KBIA 3G9CA 3TO8A 2P6TA 1Y3KA 1RTIB 4F0MA 4DV4F 2FJBB 3PYDA 2X3DA 1AW0A 4F36A 4FYYB 4DG1B 5DLGA 2Z2LA 1RWVB 1KS2A 1KOOA 3DFEA 2E9TA 4X4VA 5IP9K 3HOZC 1OPZA 3S1MK 2ASYA 4PWWA 3U27A 2V2ZA 3Q2TC 3ZTRA 4NXNJ 1Q78A 4K2JA 1X4HA 4GKKF 3W64A 3D54A 3GTPA 1NSKL 3B6BA 2XMVA 2UU9J 2DGXA 4RUCA 3FJ2A 4RUAA 1SC3B 2FGOA 4J9MA 2ZOMA 3I5CA 1NZAA 2V4JB 5C24A 4HACA 4LSLA 2JA7C 5CYMA 3CCTA 4LF1A 3MAAA 2BABA 3M2UA 1IKYA 1KOHA 2CKWA 2QMXA 2DK2A 1NH8A 5DJBA 2KYXA 2YWEA 2YQ3A 2Q6CA 3O5TB 1ZTWA 5T41A 5LOQA 2HNZA 4ZP9A 3S1RK 3G82A 4HHHA 2NVXA 1CC7A 1SJRA 1UETA 1VHIA 1XERA 1PBAA 1VRQC 2VDIA 1SFOA 3H5UA 2ZUGA 3H2LA 3C16B 4NLOA 1HNVA 1RKJA 2EI5A 3IG1B 1JJHA 1RAGB 2E9ZA 1LW2A 4WJ3M 3S7RA 2B9XA 4XK8C 4DBQA 2BRKA 2O3DA 1TWAC 2G1DA 5C4XC 5LL6d 4J9PA 4MKBA 4PWDA 3KLGA 1RK8A 4C3IC 2XEXA 2VV5A 4OHWA 4O0NA 3I4HX 3JSYA 4DQPA 3R27A 3LP0B 4J9OA 4BY1K 1PCAA 3QT7A 4CTAB 1IBKJ 4NLDA 2EPIA 1FTRA 4RW7B 3NRBA 2PEHA 2ZNZA 4V19J 3TVZA 1AT1B 1KKHA 2CPEA 2LECA 2OKQA 2PIIA 4P6QA 1WELA 3GTLK 1FDBA 2DNZA 3CJ4A 1X4GA 2MZJA 2HLTA 2QE5A 4BHQA 2DY9A 5J2PB 4WF9Q 3GTJK 2HPUA 5K14A 2W9BA 4IUFA 1WCMK 2ZBPA 2UXDF 1YNNA 4MKVA 2YH1A 4C48A 1BWVA 2MLYA 2B63K 3L95X 4BY7K 4J91A 3AOCA 5LMNF 2OSQA 4IR1A 2UV8G 3CJRA 1JIHA 4HTJA 2ZUFA 4F4AA 2W4DA 2OFGX 1KDNA 1EK8A 2MJUA 4LF8J 5BYSA 2KRBA 2CQHA 1C1BB 2XULA 2YNGA 4USTA 2ERRA 4YR0A 5DS7A 1YK9A 4X4NA 1IKYB 4P5AA 3I0RA 3TX8A 3BSAA 4JV5J 2HRTA 1S9GA 1RDRA 3RG6A 4M5DA 4ZLLA 1MN7A 2AX0A 4IO9Q 3FEXB 5FLXY 3MUVP 3C14A 3M8ZA 3MR3A 2WK4A 3BSCA 1N48A 4PZVA 4FXWA 1S97A 4ZCLA 2FQTA 3PKYA 1T9WA 3MCSA 3CQZC 1TK0A 4NLYA 3O1LA 2YVSA 3N0CA 1B0PA 2DO0A 2HFZA 2CJAA 3Q89A 5T7LA 4TU9A 2B4PA 1SB6A 1HPZA 4QR0A 4K7QA 1HW8A 3KK1A 2GQ2A 2BA9A 5FLXU 4J7CA 4JYAJ 1K1QA 1Q1KA 5C4JC 2P2CB 3LOUA 3WBZA 1NLKL 2VBYA 5GAGU 2QA1A 3THVA 2HQDA 4FDFA 1H2VZ 1AZSB 1P6TA 2E5GA 1SJFA 4NCGB 4WFYA 2E1MC 2F8HA 1CVJA 3FNNA 1KVJA 2CWXA 1NK0A 2NXCA 3ENWA 3MECB 3T1HJ 3PG9A 1RTDA 3EM1A 5I42A 2HBZB 5A76A 1HMVB 3JYTB 1VLYA 1UZHA 2QLFB 4ATNA 2VU5A 1U2RA 2YKNA 3R6GB 2R2UA 3H2UB 2RF2B 1SJ4P 4KHPJ 3QRPA 5IYBC 1Q8IA 1Q82T 4JV0A 5AJ3J 2AJ2A 2QX0A 3PR4A 4QIGA 1R9TA 3LGHA 3S1NK 3TA2A 3LAKA 2AD9A 4O3OA 2Q6BA 4ICLA 4HT5A 3SSSA 2ZZMA 1TL1A 2CAJA 5IQQA 2HNYA 1S1TB 2E2HA 4UTGA 5F0WA 3RB6A 4LBHA 3JSMB 4ERDA 3EDQB 2BW7A 3UCZP 2AEMA 4IDKA 1EHWA 3JQMA 4HACB 4RW7A 1O27A 4WFXA 1LK5A 1WDDA 1NSQA 1EAYC 3UD3P 1Y1VC 3KNGA 3BYRA 4OX7A 4HH1A 4J9LA 2VUMA 1YZ7A 1VBXA 4I6WA 2OFHX 3OBIA 1USOA 2WVEA 4KARA 1MROB 1MMLA 2DNYA 1ZQ1C 3KNAA 3PYGA 1X0PA 4OX8A 4DQRA 3HHLB 5KG1A 1UJ4A 3MM8A 2RDIA 1F2GA 3D1HA 4M5LA 3D0HE 1Y1VK 1NAQA 5B0DA 1XQIA 4FYVB 4EO6A 2HK3A 4FYDA 1OJ4A 1RAAB 4NXMJ 3HZGA 2RKIB 1U6FA 4NRTA 1SI9A 4ETZA 2GIQA 2HFUA 4XDCA 5LSLA 2WSEC 4RW4A 3W7BA 5I4MA 2N4DA 2IDEA 3GILA 3JS9A 4PCQA 2H54B 3DLJA 2IMOA 2C2NA 1EETB 3K5MA 4ZPBA 5IZHA 2VZ9A 3W2WB 3M32B 1NPKA 3DOKA 2XCOA 4GTFA 1SQEA 2RIJA 2Y0SD 1ZPVA 5D4PA 3PIPQ 2LQ9A 1I6HC 1UKUA 2FDNA 1MNEA 1GE9A 5C42B 5FDLA 5KFOA 2RDDA 4B9NA 2HRYA 2EC2A 2JJ4D 4J9QA 2DGTA 1F1BB 1YX2A 1KSPA 1S76D 2V50A 4I6YA 3DC2A 2XI3A 5KFDA 2PFDA 2D3UA 2GX8A 2FHMA 3S16K 1U1MA 2OI2A 4KPCA 3ZTQA 3KHGA 3Q8SB 4DPUA 2AZ3A 1DQAA 4MYUA 4ZVOB 2LEAA 3ET6B 3OUYB 5I3UA 1U24A 5F8HA 1FX4A 4CLLA 3KHRA 1QM9A 3SDEB 4CH1A 5M2RA 4DZDA 3CDAA 3FOFA 5IYCC 5E0OA 1U1NA 1R0AB 2YKPA 3M05A 2DNPA 4DXLA 1KTVA 3M8PB 3GG1A 1SH2A 1GEHA 3M3YC 3FOEA 4MJKA 4JI2J 4NOIA 4TQSA 1JJ2R 3AD7C 2GVZB 3S16C 1SVDA 2I8EA 3PEJA 1U1PA 3DOLB 2KYZA 4N47A 5C44K 4MAKA 2B9WA 1TKZA 2J8AA 3J7YI 1Y1WC 4NLVA 1TFYA 2YU9C 4CT9A 2EG1A 1FJ7A 2JA6A 2GCFA 1XXCA 1FK9B 4KE5A 4USUA 3QT8A 2HGMA 3HFKA 1R6YA 3CCLS 1IWGA 1QJHA 4OJ1A 3MDFA 1WKLA 2A6OA 4OYPA 5IYDC 2IIHA 3MPYA 1S7IA 3GJRB 2MEWA 3BKFA 3F44A 2B63A 2MSTA 2YXLA 2IAJB 2PA8D 3GTJA 3SQGA 1L3VA 3B8HA 1C0UB 5JVGQ 2HKEA 5HVHA 1PO6A 2XCRB 4QU6A 4I7FB 2PMZL 1YJUA 4OJHA 3OTOF 3IS9B 3SXLA 2CG8A 2C3PA 2DRDA 3VGVA 4LREA 3CDEA 3RZOC 2E7WA 2H4YB 4PYDA 4QOTA 2H4WB 4IRKA 5E33A 3SQGB 3TANA 2ZD1B 1H38A 2EWHA 3K17A 4B9UA 4FXVA 1KFDA 4LFBJ 4QIVA 4LSZB 4LF5J 3HCXA 4CO2A 4LQ3A 3DXBA 4ZPDA 4RPFA 1R0BG 4LRBA 2DR6A 3VR1A 4YEAA 3PX0A 3HSDA 4CO1A 3IXQA 3AXMA 4ALZA 3C46A 1AB4A 1P27B 3KOAA
chains in the Genus database with same CATH topology
3AD8C 1WSRA 3TFIA 1VRQC 5L46A 2GAHC 1X31C 1YX2A 1PJ5A 1WOPA 3AD9C 3GEHA 3AD7C 1WSVA 4P9SA 3TFHA 3GSIA 1V5VA 1XZPB 3A8KA 3GIRA 3GEIA 1XZQB 3TTGA 3A8IA 1WOSA 1XZQA 1VLOA 1PJ6A 1XZPA 4PAAA 1PJ7A 2GAGC 3GEEA 1WOOA 1WORA 3ADAC 3TFJA 4PABA 3A8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AD8 C;  1WSR A;  3TFI A;  1VRQ C;  5L46 A;  2GAH C;  1X31 C;  1YX2 A;  1PJ5 A;  1WOP A;  3AD9 C;  3GEH A;  3AD7 C;  1WSV A;  4P9S A;  3TFH A;  3GSI A;  1V5V A;  1XZP B;  3A8K A;  3GIR A;  3GEI A;  1XZQ B;  3TTG A;  3A8I A;  1WOS A;  1XZQ A;  1VLO A;  1PJ6 A;  1XZP A;  4PAA A;  1PJ7 A;  2GAG C;  3GEE A;  1WOO A;  1WOR A;  3ADA C;  3TFJ A;  4PAB A;  3A8J A; 
#chains in the Genus database with same CATH topology
 3V81 B;  3DDN A;  4QIW D;  4K59 A;  3P3D A;  3GFY A;  4KMU A;  2EFG A;  2MLZ A;  3A3N B;  2K3I A;  3VV2 B;  3FMW A;  3HPO A;  3PJ9 A;  3R5G A;  5F8M A;  3S1N C;  2V63 A;  4QIE A;  1T95 A;  4A8K A;  1IM4 A;  3D67 A;  3PDN A;  1ICE B;  4FM9 A;  2PI5 A;  1HBU B;  3K7R A;  4OV1 A;  2HEK A;  4G0W A;  1WC0 A;  5EUH A;  3AQP A;  1MMN A;  2QSW A;  2BX6 A;  2HMI A;  1WI8 A;  1IJE B;  1X5P A;  3M6X A;  2H1Y A;  3GG0 A;  5A0Y B;  1ZBT A;  2J9D E;  4ZVP B;  3S1Q C;  2R93 C;  4ECV A;  1H7X A;  4CYU B;  3CD7 A;  5ETL A;  4LFB F;  1IKW A;  4DV0 F;  1NDC A;  1FNX H;  4F3Q A;  4OZJ A;  3K5N A;  5KFI A;  4E98 A;  3ENQ A;  2Z58 B;  1N8R T;  5C2C A;  4KO0 B;  2E1C A;  5J2M A;  3ZFV A;  2AGQ A;  2CPH A;  2LEB A;  5D3G B;  5IYB K;  5KFX A;  4L74 A;  3ILI A;  5J1P A;  4DU8 A;  1HBO A;  3OLB A;  4DV7 F;  4MK7 A;  2VC0 A;  4N8N A;  2PN6 A;  2QA2 A;  4H4M B;  1SMY A;  4WTY A;  3MGJ A;  1YZ6 A;  4M95 A;  2CQ1 A;  2IBK A;  2DGO A;  1NK7 A;  3H40 A;  5EGY A;  4A3J K;  1HQE A;  2ZFZ A;  4C3H K;  4PYA A;  3NOC A;  2VFV A;  4V1A k;  3HJF A;  3GIJ A;  1CQN A;  2FVS A;  2RU3 A;  5GAH U;  2QL9 B;  4PXB A;  1S6P B;  3MAQ A;  3FK4 A;  1LK7 A;  1K8A T;  2E7V A;  2MQP A;  5C4J K;  1T94 A;  4AL5 A;  3RB0 A;  3MOJ B;  3X1L B;  3AY0 A;  5I3U B;  1ZA1 B;  2CZ9 A;  1AB8 A;  1NXI A;  2M2B A;  1DHM A;  3QNW B;  2MQ8 A;  2F1F A;  3CW2 C;  1BXN A;  1N36 J;  4LIW A;  4C3J C;  5E2Q A;  1UJ5 A;  3MWB A;  1RKI A;  1YJ7 A;  2X7I A;  2CPF A;  3DN9 A;  3VHQ A;  3FCW A;  5EDW A;  3SSR A;  3SIP B;  2UXB J;  2CQI A;  5BR8 F;  2JHE A;  1S9E B;  2R7Z A;  4R8U A;  1HWJ A;  2DNL A;  1A6L A;  3G4S S;  1T7P A;  4DX7 A;  3HHD A;  3LO3 A;  2FC9 A;  2FZC B;  3A13 A;  2M5Y A;  5KFQ A;  3SEO A;  4YFK A;  1YBT A;  4J9S A;  1BY9 A;  2IPO B;  4RW8 B;  3CCU S;  1D9F A;  4WP8 A;  1XZQ B;  1HHQ A;  4C0B A;  2BOP A;  5IV3 A;  1KQF B;  3V6D A;  4C45 A;  2KM8 B;  4ELT A;  4UOF A;  3HT0 A;  5KT7 A;  3HHL A;  1KQS R;  2VQF F;  4FPI A;  5AXN A;  5AE3 A;  1RBL A;  5SZT A;  4AD6 A;  1FJE B;  4FKX A;  1H2U X;  4F25 A;  4NLS A;  1RWM B;  3NCR A;  5C44 C;  2FJV A;  1SFO K;  4CP5 A;  7AT1 B;  1UTA A;  1YLX A;  5B0A A;  4WXO A;  1O5J A;  5GAE U;  1ZM3 A;  2BKO A;  3JYT A;  2DGW A;  3DRP B;  4FKY A;  3GJQ B;  2HHH F;  1DBD A;  3BR8 A;  1C0T A;  4DV6 F;  4WK3 A;  2UUB J;  3OTD A;  3AH6 A;  3GSD A;  4KSE B;  1UWB B;  2GIF A;  5C7P A;  4KGM A;  3NS6 A;  1JXL A;  2OLW A;  1H98 A;  2C2Z B;  4I1T A;  1FXL A;  3CD6 S;  2VPY B;  4Q45 A;  2C1E B;  3BKT A;  3SV4 A;  3ZNU A;  4ZP8 A;  5DQI A;  1T02 A;  3T00 A;  2VBX A;  3MAH A;  4KMD A;  2DNO A;  2D41 A;  4ZJQ A;  2J8S A;  3A3O B;  4KM8 A;  2GW8 A;  4L76 A;  1LW0 B;  4DPO A;  1F5B A;  3HD2 A;  4DOZ A;  4ZPC A;  3TA0 A;  4K4T A;  1TUW A;  2CJB A;  2JDJ A;  1RYR A;  2VA3 A;  4X84 A;  3CME S;  3KK2 B;  2C2E A;  2AEF A;  2HFN A;  3DGV A;  2R42 A;  1B3T A;  3ZTP A;  4DL2 A;  2HW3 A;  2RNE A;  1QSY A;  5E3R A;  5E7O B;  1RT1 A;  4CM2 A;  2K8G A;  1WG1 A;  1P9Q C;  3HZE A;  3MR7 A;  4RW9 B;  3IO1 A;  4N76 A;  3KJN B;  5EX3 A;  3EVO A;  3G71 S;  5HBM A;  1RWN B;  4Q7A A;  4Z2X A;  2RML A;  4C3L A;  3EWG A;  1WNE A;  1FDA A;  4KYZ A;  1O24 A;  2RHS B;  3M8W A;  3CJ8 A;  3NNC A;  3VZI A;  4NAS A;  4B3S F;  4UOH A;  3EUN A;  2HHV A;  2ROG A;  3MUM P;  2VPX B;  3L7U A;  2V6A A;  2M4M A;  1NBE B;  4O4R A;  1OPI A;  3IPJ A;  4C7Q A;  4O4G A;  1ZAW A;  2MHN A;  2RKI A;  2DHA A;  5FJ4 A;  2DNQ A;  1CUL B;  3UW1 A;  4K5S A;  1U4B A;  1O8B A;  3F56 A;  2BYC A;  1CUL A;  1T9U A;  4DR3 F;  1N5S A;  4BWJ A;  2J0S D;  4CI0 B;  3MM5 B;  4X64 F;  1SUQ B;  3UCG A;  2W2Q P;  3LQV A;  4DPY A;  4FNI A;  4XCH A;  3M4O K;  5GAG I;  1TUG B;  3KK3 B;  1KLM A;  3CCE S;  1MW7 A;  1NKB A;  3I0R B;  1JLC B;  1XMQ F;  4YB1 P;  2HHP A;  2LKZ A;  4JI1 F;  3SBM A;  2QTW A;  1J2V A;  4OL8 A;  5CJ9 A;  1FKP B;  4YUD A;  3NGS A;  2ZH5 A;  3M9M B;  2PT0 A;  3TQ1 A;  3QQC D;  4M5I A;  4DL4 A;  5BXI A;  2MZT A;  1T3O A;  2GO9 A;  2DVI A;  4YS2 A;  2ROE A;  1C0A A;  4KC6 A;  1R6V A;  3N28 A;  3MMB B;  2PI4 A;  3GTM A;  2V5H G;  2AQ4 A;  1VQL S;  2OPR A;  3E8O A;  3OD2 A;  4HL9 A;  4HLB A;  1CG2 A;  3DLG B;  2UUC J;  2KZM A;  1C1C A;  4Y34 A;  5L39 A;  1PGZ A;  1E6Y B;  2V8G A;  3WX8 A;  3DOM B;  1R8C A;  1SKW A;  3VAF A;  1VQ8 S;  1JLG B;  1X60 A;  3GTP C;  3OSP A;  2ACM A;  2E1P A;  3ILJ A;  4IH6 A;  4LQY A;  3GTK K;  2VFU A;  3RYL A;  2YPY A;  3DKD A;  2PDA A;  4F4W A;  1YNJ A;  2HZC A;  2CQP A;  3IC1 A;  4DV2 J;  3PO2 C;  3N0V A;  1ZXO A;  3FQL A;  2PC6 A;  4IG0 B;  3ZZP A;  1XPP A;  4CDI A;  2AGP A;  4P5B A;  1UFW A;  4L72 B;  5ETQ A;  4OYB A;  4HYK A;  1RAC B;  2FZK B;  4KT0 C;  1HI9 A;  1JLB B;  1DTT A;  4LJM A;  1J5E J;  2J0X A;  5CCM A;  3J81 Y;  1HD0 A;  1HQU A;  3OVA A;  4DR6 F;  2LQ8 A;  2GVD B;  3KHH A;  4TNO A;  3UCU P;  2CDQ A;  3BGR B;  5M3F K;  4ZN3 A;  3RBZ A;  4C2M A;  2DH8 A;  5E3P A;  2QLW A;  4EK2 A;  4QPX A;  4UZB A;  2ZWP A;  1GMW A;  2DNG A;  1LWC A;  2LXF A;  3K0J A;  1WG4 A;  5LM7 E;  2DHS A;  1WD6 A;  4A3D C;  1JLF A;  3N0B A;  3FSY A;  1K0T A;  2BM1 A;  1PSD A;  5GAE I;  3C6T B;  4EEY A;  3QGG A;  4GTD A;  3UDV A;  4GTC A;  2V94 A;  3Q8U A;  4YR2 A;  4JI8 F;  2CJY B;  5G4D A;  2ZE2 A;  2LFV A;  5E68 A;  2GML A;  1TU0 B;  1YRX A;  2N3O A;  2HND B;  4WII A;  4DMZ A;  3E3X A;  3FCH A;  2ZBI A;  1F6T A;  4B9L A;  3HXA A;  4A3D K;  2L9N A;  2B5J B;  2AZ1 A;  4R8U B;  4Q0B A;  2E2H K;  3DXS X;  2EK6 A;  1S1X A;  1Q86 T;  3OTC A;  2JLE A;  9RUB A;  3W5Z A;  3V5R A;  4DV4 J;  1V5V A;  4TYB A;  4GO5 X;  5H9F J;  1ZM9 A;  5KTQ A;  3MPV A;  3IGV A;  5IQ6 A;  2B51 A;  4B9S A;  1JK9 B;  5IP9 C;  3HOZ K;  2WTF A;  4DR7 J;  3BGL A;  1N5Y A;  2H9Z A;  2RD5 C;  5C2G A;  4A8M P;  3PO3 K;  1VRU A;  3A8K A;  4ETX A;  1KHV A;  3HDS A;  4ZVR B;  2DT9 A;  4ZIV A;  2R7V A;  2OP5 A;  4CT8 A;  1K1S A;  1WQG A;  3DYA B;  2XO7 A;  3RZD K;  3W1Y C;  4RWX A;  3FEY B;  2VG5 B;  2UU9 F;  2QIF A;  4G1Q B;  3W65 A;  2BOA A;  3M8Q A;  3P45 B;  1SBR A;  2YWH A;  1IBL J;  3UNY A;  2DIU A;  4DPW A;  2ADC A;  1SQG A;  3RTV A;  2JA8 C;  5KG0 A;  5DO2 A;  3G6E S;  1HNW J;  2XB2 D;  5D4L A;  1FF2 A;  5CHC B;  1HBO B;  1U48 A;  1GMW D;  1BJT A;  3KWM A;  2VD3 A;  1DCO A;  2WBR A;  2ZM6 F;  1B7F A;  1RXO B;  3DU6 A;  3MXH P;  3H2V E;  3UR3 C;  3HOV C;  3M6U A;  3BQ0 A;  1RWK B;  4MIB A;  1TQL A;  1ZYQ A;  2FJE B;  3TAM B;  1VOM A;  2FGC A;  2IRY A;  2J9C A;  2NSC A;  4JI4 F;  2HQC A;  2JA8 K;  3D3B J;  3V81 A;  1H73 A;  4FF2 A;  4X66 F;  5HI7 A;  3QO9 A;  4DWI A;  4FNH A;  3P6Y C;  4WTO B;  1BWE A;  2JFK A;  3KUE A;  5ETR A;  3NG8 A;  2X1B A;  4KB7 A;  5H9E J;  5F8I A;  1SC1 B;  2YH0 A;  3ICL A;  5FJ8 K;  3CJT A;  3HFZ B;  3IRX B;  4ZCI A;  3DU5 A;  3V4I A;  1TFW A;  3N5B A;  2C2R A;  2FB0 A;  5DDP C;  1WEX A;  3AJ2 A;  3D2W A;  4DR5 J;  1WG5 A;  4MTP A;  3WX4 A;  2ZJP Q;  2VDH A;  3CQZ A;  4LF4 F;  2A18 A;  3HOU C;  1VQO S;  4UQG A;  3GFX A;  3E01 B;  3GR0 A;  3GTG A;  4JI7 J;  4NLX A;  3LP2 A;  1A9N B;  3QZ7 A;  1IBM J;  4DUZ J;  4WCE Q;  3T1Y J;  3CMQ A;  4PG4 A;  2KXH A;  2Q79 A;  3KLE A;  4C3K A;  4EWT A;  5AJ3 F;  1DRZ A;  3D28 A;  3I5A A;  3NMR A;  4KFB B;  1UW4 A;  1XTZ A;  1G6B A;  1Y1W K;  4YY3 J;  3H59 A;  3PVX A;  3D3C J;  2VUG A;  4DPX A;  1FXR A;  2FHJ A;  5BJR A;  1YI2 S;  5EGH A;  4UUX A;  4LF8 F;  1J5O A;  1X8D A;  2DGU A;  1FT8 A;  2XS2 A;  1IE0 A;  3TRG A;  3BP3 A;  3P8B B;  1W7W A;  4OYA A;  2MQQ A;  4CO4 A;  1V3R A;  4I56 A;  1GNK A;  2ZKU A;  2FVQ A;  3CIZ A;  3DOL A;  4DCJ B;  1KP6 A;  2IM2 A;  2MZR A;  4NA3 A;  1SC6 A;  5ETT A;  2AHO B;  4ILD A;  3I5B A;  1Q8B A;  2ZBR A;  1R7I A;  2KRR A;  2B8Q A;  4U7U K;  4DR4 J;  2BKP A;  1U6B A;  5KT6 A;  1PC4 A;  3UE2 A;  3T1Y F;  3UQS A;  5D77 A;  1K83 K;  1JMT A;  2MZQ A;  5B0C A;  2R2R A;  4Y52 K;  4WBF A;  1R89 A;  1EB0 A;  4A8F A;  5KFW A;  1ZTT A;  3OV7 A;  5F9L A;  5KG7 A;  3W3S A;  1UAW A;  2KG0 A;  1TKZ B;  4WFA Q;  3K89 A;  1VJE A;  1XMQ J;  1S79 A;  2VG5 A;  3QT5 A;  4BBR C;  3R5A A;  2NVX K;  2PA3 A;  3VTI A;  4WJB A;  3D6F B;  1CLF A;  3LPE A;  1UVJ A;  3N01 A;  4PG7 A;  4FS1 A;  2ZDP A;  2JZ5 A;  3TUZ C;  3WIU A;  3DRR A;  3HLU A;  4M5K A;  3NOG A;  4ER8 A;  1N5Y B;  3UWT A;  2ZH2 A;  5KFY A;  5KFR A;  4IH5 A;  1MSW D;  4N41 A;  4JI0 F;  1UFK A;  3DOK B;  4Q4Z A;  2QMU B;  2ROP A;  3W2W A;  3DDI A;  3WIV A;  3C15 B;  2BMB A;  3G6V A;  1HQ2 A;  1EKR A;  2G13 A;  2LU1 A;  3EXC X;  3GTP K;  4USM A;  2RGR A;  2ATC B;  4B02 A;  1QDU B;  2BE7 D;  1M5P C;  5D15 A;  2I38 A;  3JQK A;  2C2D A;  2DB1 A;  4OQJ A;  3LH2 S;  1QSL A;  1BQM B;  1DLO A;  3PZP A;  1Y0H A;  3ZZT A;  1ULR A;  1RT5 A;  1RT3 B;  2XZW A;  3HOX C;  3AB2 B;  3R1L A;  4EGL A;  4U8Y A;  3GZ7 A;  3L9Z A;  5HN0 A;  1D9D A;  3DM2 A;  2AJ4 A;  1XR7 A;  1RSC A;  1S1V B;  3I4M K;  1MRO A;  3I32 A;  5F3Z A;  3L7P A;  2WON B;  4LSN A;  1RT7 A;  3AJD A;  3BV8 A;  3CJ2 A;  4OHV A;  5KFT A;  1SH3 A;  5K8M A;  3GTO A;  3RZD C;  4BC9 A;  4K4W A;  3S2D K;  4F50 A;  2MY8 A;  1YIT S;  4AFF A;  1B4B A;  1GXT A;  3L4J A;  2MGZ A;  2D3Z A;  2IC3 A;  2U1A A;  4A3E C;  3VAH A;  1FFS B;  3S17 C;  1O51 A;  2CZV C;  4MKA A;  3CO0 P;  1IL2 A;  1PG5 B;  4Y2K A;  2DPI A;  3QJJ A;  1F9N A;  4DFP A;  2NVT C;  4EFA C;  2R2T A;  4C8N A;  4B3T J;  2NLW A;  4F4Z A;  3BPD A;  4PAA A;  3VWS A;  4JBC A;  2VIC A;  1U0S A;  4CQ1 A;  3CUN A;  4ED1 A;  2OIH A;  1YJN S;  4A3L K;  2JWN A;  1ZAV A;  1TZ0 A;  2HQG A;  1S12 A;  4UZC A;  2BM0 A;  5IT0 A;  2R8J A;  1IKV B;  4YME A;  3M9O B;  2IVF B;  2JC1 A;  3HUL A;  1U26 A;  2VFS A;  4Z7Y A;  1DTT B;  3RBD A;  1VQ5 S;  3S1R C;  1DAR A;  3OFG A;  2BZ2 A;  4GVB A;  3QIP A;  4AE5 A;  2PFF B;  3VA7 A;  2APO A;  4ELU A;  1K9M T;  2XO6 A;  4GC7 A;  1PYT A;  3R7S B;  3VAG A;  2ACY A;  2K7K A;  3CCM S;  4TY9 A;  1R43 A;  4LF9 J;  3LP1 A;  2JH3 A;  5D0R A;  4LF4 J;  1VQN S;  4NYZ A;  3ET6 A;  2ATL A;  1UEV A;  4DU7 A;  2V2V A;  1B99 A;  2HGL A;  4KB4 A;  4WK1 A;  3AD9 C;  1NND A;  4IFV B;  2VG7 A;  2ZIT A;  2X1A A;  2ZZT A;  5CCL A;  3UDC A;  4DF4 A;  2A6H A;  2C3U A;  1SXL A;  4QPT A;  1HPZ B;  3M8Q B;  1RWO B;  4DL0 C;  1RT2 A;  1FD2 A;  1RT3 A;  2B3T B;  5KT2 A;  3V4G A;  3BH6 B;  5F41 A;  4YP3 A;  1KFS A;  1U25 A;  4NX9 A;  5F9N A;  3W5Y A;  3GCW P;  3K59 A;  4ECQ A;  2QGF B;  4HHJ A;  2VJU A;  4QWB A;  1WTF A;  1TK5 A;  1VRU B;  4X65 F;  1HWL A;  3KLV A;  1FTC A;  2M88 A;  4A3F C;  2CQG A;  3PO3 C;  4A8O A;  1IR1 A;  2YKQ A;  4MEX A;  3MUT P;  4KDD A;  1HBM A;  2VBZ A;  4ZPT R;  4NOH A;  1U47 A;  4N77 A;  5DZ6 A;  4K0K F;  1U1K A;  1Q5Y A;  1IN0 A;  3HOU K;  3BQ1 A;  3LA0 A;  5FD1 A;  4KN7 A;  2J9E A;  2MZS A;  2B6A B;  4BC7 A;  2MLX A;  2JSX A;  4RNM A;  4JP8 A;  2MQM A;  2ZH6 A;  4C8K A;  3H90 A;  5DLF A;  3LGN A;  1TWC A;  1N33 F;  1UMJ A;  3RJM B;  3MEK A;  5HBM B;  1NB2 A;  2F7V A;  3JSR A;  3Q83 A;  3DHX A;  2V69 A;  1VIO A;  2ZE2 B;  2A3J A;  3KMQ A;  2QLB B;  2EFQ A;  4QJV A;  4IG3 B;  1WOO A;  1I5O B;  1UWA A;  4CLW A;  1JLQ A;  3OEP A;  4C11 B;  2V6U A;  4WP9 A;  1U45 A;  1NCL A;  3M8Y A;  5HO4 A;  4Q8F A;  4QW8 A;  1RB0 A;  1TKD A;  2O67 A;  3BDP A;  4P7T A;  3A4T A;  3NGK A;  2HBQ B;  5LJ5 Y;  4NA2 A;  2DH9 A;  4OYX A;  5JUM A;  2YNF A;  3K8W A;  5C25 B;  2MKC A;  2YKA A;  1BLU A;  1B4S A;  3IAS 9;  2JC0 A;  3M2R B;  4YOE A;  4G7O A;  2QL5 B;  3DRS A;  3OPK A;  1USM A;  1BS2 A;  2HZA A;  2DNK A;  5DGB A;  4DLG A;  1RAB B;  1S1T A;  3QAE A;  2NXN A;  1OSD A;  3RGI A;  2YKM B;  3VCD A;  4Z7C A;  3ILL A;  5M5Y K;  3PIO Q;  3DXJ A;  2R8K A;  1FD8 A;  4F7V A;  1FRM A;  3CNQ P;  1REV A;  4D3G A;  3U1M A;  2B4V A;  2AGO A;  1GMV A;  3DLK B;  4F3O A;  1N88 A;  3D4J A;  2HVI A;  3OLA A;  5KFM A;  4LJZ A;  2GVD A;  1S5Z A;  3MCN A;  4Q2L A;  2LDI A;  3K5L A;  3D1Q A;  4F0K A;  4XIU A;  2V6T A;  4ZPV R;  3GSI A;  1BUX A;  1CJT B;  4DR4 F;  2OPR B;  3QPI A;  2CNK B;  3MCM A;  1YGY A;  1TWG C;  3JQJ A;  1B0V A;  4PEO A;  1GQE A;  2HS4 A;  4UOC A;  2BAC A;  3EVW A;  3DRP A;  3GQC A;  2E7X A;  2W4C A;  4C4W A;  2NXJ A;  3NGT A;  4ILR A;  2DXE A;  3X3U A;  1RHR B;  3GV5 B;  3JB9 k;  4Y2A A;  5KFK A;  2C42 A;  1OYE A;  2CVI A;  2QLX A;  3M4X A;  4TU8 A;  4M5H A;  1SPB P;  3FKI K;  1VQK S;  5SUH A;  4A93 C;  1VDH A;  3LAL A;  2M7S A;  4M1K A;  1RAI B;  2E44 A;  4NL5 A;  2P6S A;  3MM5 A;  1BQM A;  2V4R A;  1TWF A;  4BXX K;  2W24 A;  4ITS A;  3CJ5 A;  2Y8W A;  3CC2 S;  1I50 C;  4WYW A;  3RR8 A;  2LU2 A;  4U9R A;  3TUJ C;  5C25 A;  2YNF B;  4RLE A;  3LW5 C;  3M6V A;  1X31 C;  3PO2 K;  1UVK A;  1X5T A;  2LQB A;  4YB7 A;  3FBE A;  4I69 A;  1KR4 A;  4I68 A;  1F2H A;  2MZ1 A;  1DQ8 A;  1LNQ A;  1OMS A;  5IWA J;  2QYG A;  3NLC A;  4A3E K;  4ZVU B;  3AOB A;  3S1M C;  2KU7 A;  2HIY A;  2B4U A;  2O66 A;  3GJT B;  2ZBC A;  1O2B A;  1VQS A;  2XTJ P;  1XEZ A;  1IR0 A;  2AJF E;  2PMZ D;  1TL7 A;  3LAP A;  2MYF A;  3CJK B;  3TEG A;  4JB8 B;  3CF5 Q;  7FD1 A;  2QL7 B;  3PV8 A;  2HS0 A;  4XPC A;  2VPW B;  4J37 A;  2IM3 A;  4OYI A;  1VR6 A;  1VMB A;  3R6L B;  3G6Y A;  5FLM C;  2JEG A;  3IGN A;  3NS5 A;  1Y4Z B;  2R7R A;  2B6A A;  2E2J C;  1SV5 A;  1TL7 B;  4JI8 J;  1RAD B;  1KWM A;  4FF1 A;  2D3O R;  5D0E A;  4NMX A;  2Z2Z A;  2NS1 B;  3V2U C;  2FTR A;  3CT9 A;  2KXF A;  2OEM A;  1V5I B;  2UUW A;  3IBC B;  3TEH B;  4NEZ A;  2R92 A;  4C8O A;  3VGU A;  4F67 A;  1KVK A;  4DN0 A;  1E6V B;  2XWX A;  1WQF A;  4H54 A;  2CYY A;  1VYA A;  4P75 A;  2R4F A;  1Q81 T;  4JI7 F;  4HT7 A;  3CED A;  3CD0 A;  4DUT A;  1IBM F;  1J6X A;  2B9E A;  4NYP A;  1RHQ B;  1MN9 A;  1P8G A;  3PX6 A;  3IR6 B;  4I2P A;  1L3T A;  1HKA A;  1S7H A;  1FJG J;  3PRD A;  4U6P A;  3GEH A;  4F3M A;  8ATC B;  4DSL A;  1Z2L A;  3QFH A;  5CAB A;  3T02 A;  4NZ0 A;  1IJF B;  3FVY A;  1NZ8 A;  4X4R A;  4WFZ A;  4J9V A;  4P2S A;  2QYC A;  1GXL A;  2VG7 B;  2VON A;  1FKO A;  1XR5 A;  4NLW A;  2W1B A;  2E5L F;  1TK8 A;  2YNI B;  4RNN A;  3VGT A;  4Q0B B;  3OXG A;  2UUB F;  3RU0 A;  2VOP A;  5KFE A;  1IQT A;  3RW7 A;  4YHH F;  1H3D A;  2HGN A;  1VBY A;  5IS2 A;  1VJQ A;  5KG6 A;  3BN4 A;  2I2Y A;  1T9V A;  2XMJ A;  1N6Q A;  3PJW A;  3H8Y A;  1APS A;  3OFE A;  3M2U B;  3QGI A;  2N7C A;  1TKX A;  2LQ5 A;  1U09 A;  2CQ3 A;  3EE3 A;  3DI6 A;  3TVK A;  4EO8 A;  2NVY C;  1N5T A;  1N54 B;  5DDQ C;  1LW2 B;  2VKR A;  4CLU A;  4G6V B;  2DTJ A;  1WOS A;  4ECZ A;  3GTQ C;  3UDL A;  2OTJ S;  4X4P A;  2ZM6 J;  3NAH A;  1H74 A;  1CJV A;  1HI8 A;  3TFI A;  1YWX A;  2ZH4 A;  3F41 A;  5F0U A;  2CVE A;  5DET A;  1XZP A;  3BM7 A;  2RIL A;  2ILZ A;  2NVY K;  2FQQ B;  5IC6 B;  2WCX A;  3MR2 A;  1M1G A;  3TR5 A;  4DUY F;  2CFA B;  1X9S A;  1CPZ A;  3GIR A;  3DLG A;  3H20 A;  3I96 A;  4WZM A;  3SQO P;  3LP2 B;  2O01 C;  4AQY F;  1PC5 A;  3Q23 A;  3ZZY A;  4IFY B;  1HR0 F;  3GTJ C;  2P8I A;  1ROF A;  2A69 A;  4JI0 J;  1C0U A;  2XLK A;  3H42 A;  2ZH1 A;  3RZA A;  4KKO B;  1C4A A;  2QEX S;  1O2A A;  4Z37 A;  2JEF A;  6AT1 B;  3PXG a;  2WON A;  5RUB A;  4A3I C;  3DNC A;  3IRW P;  5E3C A;  3LAJ A;  1S1V A;  2Z0G A;  2NZ4 A;  1O2F B;  3AA9 A;  2J5A A;  2KVQ E;  4ES2 A;  4LF7 F;  5AE1 A;  4PPZ A;  3MR6 A;  5B0E A;  1CEZ A;  4B08 A;  4LOW A;  2XI2 A;  2LMI A;  1XWL A;  3A12 A;  2GMJ A;  2NPF A;  4DL3 A;  2FY8 A;  2XSJ B;  1PJ5 A;  2RT3 A;  2HVD A;  1DQ9 A;  2AP6 A;  4DQI A;  4JI1 J;  5J2Q B;  4X6A K;  3MHY A;  3Q86 A;  1S9F A;  2F4V F;  4C3I K;  3LAM A;  3CJK A;  1YVF A;  3CPW R;  1FE0 A;  3W66 A;  3FCV A;  3AH5 A;  2W2N P;  4AXI A;  3MCO A;  1RU0 A;  3CQZ K;  2R93 K;  2Z30 B;  1I3Q K;  1PAU B;  3D0G E;  4NPO A;  3AOA A;  3B54 A;  5K8O A;  5HSP A;  3RZO K;  4BXX C;  2KT3 A;  3GYX B;  1DD5 A;  3GB0 A;  1K47 A;  4J9N A;  5HMZ A;  1LWE A;  4GRS A;  4PXE A;  1XMB A;  2C2M B;  4IRD A;  1KQ4 A;  4GKJ F;  1SUQ A;  2V34 A;  1J27 A;  3NXZ A;  3G96 A;  1RT6 A;  5J2M B;  4HHU A;  5HAT A;  4A3G C;  3DYA A;  4WXW A;  4RL1 A;  4UOG A;  4LF7 J;  1Q7Y T;  2Z8Q A;  3EYZ A;  1DZ5 A;  1R27 B;  2HQI A;  3D0I E;  2E29 A;  4CYU A;  1GX6 A;  2DHH A;  1TWF C;  5KFN A;  3J80 U;  2KKH A;  1S59 A;  4DF8 A;  4ECT A;  1S49 A;  2YY3 A;  3EGN A;  3FMB A;  1EET A;  2R7Z C;  1WC5 A;  1L5U A;  3VAI A;  5KFP A;  4ZPA A;  2BE2 A;  3QBC A;  2IYI A;  4CNZ A;  1B7Y B;  2W9A A;  4O44 A;  4MFB B;  3VVU A;  2MKS A;  3ZZZ A;  1B70 B;  4G3I A;  4EBC A;  2GS8 A;  3V6H A;  3KHL A;  1QSS A;  2WVD A;  3H4D A;  3KXD A;  3FQK A;  5HVG A;  1IBK F;  4A8X A;  4NLR A;  3NBP B;  4OZ1 A;  4OJG A;  3QWU A;  5B08 A;  4DQS A;  1FEE A;  2XGP A;  4GKK J;  3GMG A;  4DSI A;  1S0N A;  2DIV A;  1MWQ A;  2HNY B;  4IFV A;  4R5P B;  1S1W B;  4RX6 A;  1XZP B;  2CZ4 A;  5DDR C;  4OYO A;  1IKX B;  2VUM C;  1RT4 B;  1BQN B;  5L1L A;  3J81 j;  1JJC B;  3T1A A;  3ZTO A;  3HHN B;  1U1Q A;  4C97 A;  1QAJ A;  2IJF A;  2CPI A;  5CZX A;  3K8V A;  2EFV A;  1REV B;  3EMT A;  2DBB A;  2K06 A;  3GTK C;  5FLM K;  1FA0 A;  2AT1 B;  4M94 A;  2WB1 L;  3QO9 B;  4F04 B;  2YWK A;  3HHE A;  2VUM K;  2KI2 A;  1UEK A;  4K4U A;  2PSZ A;  2GC8 A;  2EW9 A;  5LMU F;  1I6H K;  3DGP A;  4FP9 A;  4A8W A;  1AFI A;  4PPD A;  2F8M A;  1TL4 A;  2E9R X;  2AEJ A;  4HDG A;  4M5J A;  3IRX A;  4B17 A;  1AZS A;  1VIX A;  3PY8 A;  2RRA A;  2DGS A;  1IBA A;  1FFG B;  1YJR A;  4OHZ A;  2UUA J;  3S17 K;  4MQ9 A;  3PM9 A;  4ZVE A;  4B3R J;  2RSQ A;  5L9N A;  4HR2 A;  3KK3 A;  1ZYR A;  2XS5 A;  2L08 A;  4DLE A;  3Q22 A;  1VGY A;  1FNO A;  4OIO A;  3GEI A;  1TWH K;  3OJU A;  4L6V 3;  3QFW A;  3P96 A;  4FVM A;  3PNI A;  5CA5 A;  2W7O A;  3WC0 A;  2P8T A;  4BBY A;  1I6J A;  3D6M B;  2GJ2 A;  1TL5 A;  3M3Y K;  1SKS A;  4ZCK A;  2NRE A;  4CLY A;  1Q5V A;  2XS7 A;  1L0W A;  4OIP A;  3BJY A;  4LSN B;  3CJ3 A;  1VBZ A;  3KG1 A;  2M9K A;  1TAQ A;  4PR6 A;  4WZQ A;  2KVI A;  2RH6 A;  1RE1 B;  1FVS A;  5HMX A;  3R3T A;  1FJG F;  4DCP B;  4OYM A;  2QJ3 A;  2L3M A;  1LWF B;  1JXE A;  8RUC A;  4ENO A;  4FBU A;  4CLF A;  4USW A;  4A47 A;  4AUK A;  1NDL A;  5LMN J;  4R0J A;  2Z2M A;  3GTY X;  1H72 C;  3GTK A;  3O2I A;  5I3Q A;  1GFW B;  5G0R B;  4H4K A;  3H4B A;  5A8W B;  2W25 A;  3HX9 A;  3KMS A;  3GTG C;  4W92 B;  3J7Z 5;  3EPG A;  2J0W A;  2VH7 A;  3JTN A;  2VA2 A;  3UD4 P;  2XMW A;  4XTT A;  2BV3 A;  3I82 A;  1SIZ A;  1IKW B;  1AYE A;  3PO5 A;  4XSZ A;  2RE1 A;  1UA1 A;  3TUP A;  1Q0N A;  2XNQ A;  3OT9 A;  4BS2 A;  3C6T A;  1ZM4 A;  4ELV A;  3OR1 A;  1TKT A;  1HBM B;  1YCL A;  2G2O A;  4YFN A;  5IOT A;  1EQ0 A;  1UEU A;  1T9T A;  5LSR A;  4LF6 F;  5C3E C;  1CSJ A;  4QYR A;  2FVC A;  5F8L A;  4HH0 A;  2OMO A;  2ZBQ A;  4TU7 A;  1M5H A;  3V4M A;  1K44 A;  4NLG A;  4USV A;  1HHT P;  5IT4 A;  1NHU A;  2F4F A;  1AFJ A;  4E2F B;  4QYZ K;  5J2Q A;  1NHV A;  1N36 F;  2KXN B;  2KZZ A;  1PBU A;  1N5V A;  3NMA A;  1WF1 A;  1XXA A;  3JSM A;  2IMW P;  3FUY A;  5A8R A;  4CLP A;  4N5S A;  5AXK A;  2FLL A;  4ECY A;  3ENV A;  3P5B P;  3Q0A A;  2UXB F;  5EWF A;  2IY5 B;  5M3M K;  2PGC A;  1DFD A;  1JNR B;  2HFO A;  5A8K A;  1IXK A;  2LP4 A;  2ZNY A;  1ZM2 A;  3OQ2 A;  3MFI A;  4BY1 C;  4ZVF A;  1PKU A;  3IG1 A;  4G1I A;  2XG8 A;  3TAQ A;  4FBT A;  3CCZ A;  3KLH A;  3ZZR A;  2V9K A;  2W7V A;  3MD3 A;  5IYC K;  1MMD A;  2HHQ A;  4OZ3 A;  3MFH A;  4B9V A;  4CTA A;  5HL8 A;  1E6Y A;  4R5P A;  1SH0 A;  2VL1 A;  4OYW A;  3G4A A;  4MMO A;  1VH2 A;  3MI7 X;  3HVR A;  1BE4 A;  1A0O B;  3G82 B;  3KLE B;  3JAM U;  5IM0 A;  3HOY K;  2FZG B;  4PWD B;  4YFX A;  2G0C A;  3M8S A;  1NJX A;  2DXF A;  4EMD A;  1UWB A;  1LKZ A;  2ZKT A;  2FJD B;  2KH9 A;  4FYW B;  3MMB A;  2FLP A;  1Q95 G;  5KFF A;  1N6Q B;  3L4K A;  2NSB A;  3QLH B;  1RWX B;  2KFZ A;  2GGP A;  4Y65 A;  3EGZ A;  3J80 Y;  1S9E A;  2KO1 A;  5AXL A;  4ZVT B;  3RRK A;  3V4I B;  2NVX C;  2E2I A;  3HSJ A;  2HHT A;  1FFW B;  3CCQ S;  4DSJ A;  3H3V L;  1NO8 A;  2QT7 A;  5K9F A;  1C1C B;  2F5G A;  5D8H B;  4L75 A;  2O1P A;  3FFI A;  1RTD B;  2C3Y A;  3IS9 A;  2NYI A;  3PRV A;  1KLM B;  1FK9 A;  2KDO A;  2BXJ A;  4OI4 A;  2BE9 B;  1KON A;  2ZEJ A;  3PKM A;  1TVR B;  1TMM A;  2XSF A;  4UY8 T;  3UVJ B;  3ENA A;  3MM9 B;  4A3C C;  4RJV A;  3TZZ A;  2V8P A;  4CH0 S;  4O44 B;  2GSU A;  4GKJ J;  1FKP A;  4CRJ A;  3FRY A;  1Y00 A;  4NI2 A;  3IWL A;  3PW0 A;  3OR2 A;  3KJV A;  4JV1 A;  2XMU A;  2UZA A;  2YNI A;  1RAJ A;  2OD6 A;  2E2I C;  1TTH B;  3OUY A;  2V9W A;  1RIS A;  1OYD A;  2V2K A;  4USJ C;  4DR2 F;  4ED0 A;  2AJ1 A;  4DSF A;  2X1F A;  4BBS K;  2CWK A;  2YNG B;  4RNH A;  2EC0 A;  2XBP A;  1OY6 A;  1CS4 B;  1RA7 A;  4J90 A;  3PTW A;  3JTP A;  3QSY B;  2UUA F;  2E2H C;  3I4M C;  2ZVI A;  4ED3 A;  3ERE D;  2CQ0 A;  3WDO A;  2R7W A;  1T0T V;  2E1A A;  1R0A A;  4YQW A;  2HVH A;  1Q8K A;  3NAI A;  2RAQ A;  3GU0 A;  2L9D A;  3POT A;  2ZOF A;  1JLE B;  2WVB A;  3AOD A;  5EWG A;  3SFG A;  1XR6 A;  5CXT A;  4BDP A;  2FPH X;  3TFJ A;  5L8R C;  4KC5 A;  2XQC A;  3IM9 A;  3POT B;  3CCR S;  4NLT A;  4F2R A;  3SCJ E;  3Q8R B;  2R7Z K;  3GON A;  2YWF A;  4U7U D;  1VC0 A;  3BGO P;  4N56 A;  2VG6 A;  3C8Y A;  2E5I A;  2IM1 A;  3TZX A;  1Y3J A;  5TMC A;  4OIX A;  3LPX A;  3SZZ A;  3K58 A;  2EKN A;  3ZXW A;  2J7K A;  2J6S A;  2V6S A;  1V3S A;  4I6A A;  1OY9 A;  5K20 B;  2JEJ A;  2OD4 A;  4WU3 A;  4ZKA A;  2CNN B;  3GTG K;  3A1Y G;  3MMA B;  2MB0 B;  3H25 A;  2NVQ C;  4ZIT A;  2BE5 A;  5LXR A;  3FRZ A;  1Y5L B;  3GIK A;  1MWZ A;  1HA1 A;  2E66 A;  3BGR A;  3ELH A;  3IN5 A;  3QT6 A;  2VQE J;  5D4O A;  4KAS A;  4Y7N C;  1RWP B;  1YJT A;  2GQC A;  3QIP B;  3MMA A;  4DJB A;  1S6Q A;  4NYO A;  2OAU A;  1TKX B;  3RR7 A;  1FX2 A;  4ZMM A;  2ZOG A;  1Z2Z A;  1YBA A;  4B3R F;  3NGD A;  5C24 B;  3CDU A;  4DR1 F;  2VOD A;  1Y5I B;  2JVO A;  1YIJ S;  2BJE A;  5JJB A;  4EYI B;  1GTH A;  4OIQ A;  2JVR A;  2WZ1 A;  4K4X A;  2CDR B;  2WAQ L;  1X4E A;  2M70 A;  5K5M A;  3PW7 A;  2CQ4 A;  4ZJL A;  2BJD A;  2VC1 A;  5KG5 A;  4RBV A;  3OL8 A;  5DRK A;  3BQ2 A;  3DOM A;  1T03 B;  2E5L J;  3QX3 A;  5F8G A;  2ZWO A;  4WFB Q;  2GJF A;  2YWW A;  3RRH A;  1D8Z A;  1SIW B;  3PYF A;  4B3S J;  3FDS A;  3TAM A;  4ECU A;  4URQ U;  4JI3 J;  1CJT A;  4PXD A;  2IC3 B;  1X4D A;  2ASL A;  2LVW A;  4IOA Q;  4B3M J;  2ZUA A;  4MK9 A;  2WVF A;  3DLE A;  3M2V A;  3BYP A;  3OL7 A;  2QFJ A;  1KQG B;  3R7B B;  4LR9 A;  5C3E K;  5KOW A;  4M5M A;  2BAN B;  2UP1 A;  2XYP B;  1JLG A;  1I50 A;  1E6V A;  3UDE A;  2YKO A;  1RYS A;  3N79 A;  2MTL A;  1UJ6 A;  4KQZ A;  1HBN A;  2XMT A;  2BQR A;  2I1R A;  5CQG A;  4FVC A;  3EGV A;  2R7S A;  5BYQ A;  3BO4 A;  1M1H A;  4LLG A;  3TZY A;  4H4M A;  2WSF C;  4UT4 A;  2DR8 A;  1L3S A;  3E2E A;  4F02 A;  3MEC A;  5B09 A;  1FDN A;  2V4Q A;  3I9V 9;  2CW0 A;  5A8R B;  1EZZ B;  1S72 S;  1HQM A;  1REG X;  2NPI A;  3U02 A;  4NXM F;  4AND A;  4K8R A;  2GV1 A;  2O5D A;  3MM6 A;  5LT5 A;  3UN5 A;  1TWA A;  1Y5N B;  4X4O A;  2ZJR Q;  4UUW A;  3M2R A;  2EKY A;  2XZD B;  5IT9 Y;  1HWI A;  4MH8 A;  3T5J A;  1KNZ A;  3M1V A;  5BR8 J;  6FD1 A;  3T01 A;  4MIA A;  5LSO A;  3CCW A;  4PQU A;  1FRX A;  3H0P A;  3FGV A;  3KTQ A;  4WFN Q;  2QA4 G;  2IRU A;  2ZVS A;  3HOY C;  1QTN B;  5KFL A;  3W8P A;  3M8R A;  3EPI A;  5CD4 A;  2G9O A;  1OWX A;  2V2Q A;  3PFO A;  1V6H A;  3P4U B;  3ONQ A;  1MU2 B;  2BJ1 A;  3IWX A;  3HHL C;  4XPE A;  1RHK B;  1TWA K;  3L4B C;  1EJ7 L;  5IOS A;  5L46 A;  3I4P A;  4P72 A;  4ES1 A;  1TMJ A;  2GGP B;  3BS9 A;  4WIQ A;  3C2P A;  4C2M K;  5IOQ A;  2FHK A;  4Q5V A;  1G51 A;  2FLO A;  2HWH A;  4E0D A;  4O3Q A;  2GHP A;  4ZLN A;  2VBW A;  1NJW A;  2FVP A;  4C8Z A;  1D9A A;  2CJK A;  4ECW A;  2OUG A;  2FJW A;  4K4S A;  2VJV A;  2XHW A;  2XC9 A;  4IOB A;  2XY7 A;  3IR5 B;  3FFI B;  4A8S A;  2BW2 A;  3IFE A;  1S6O A;  1S10 A;  3I0S A;  3U1L A;  1KTQ A;  2HSE B;  3BN7 A;  1IBC B;  4DV1 J;  3C19 A;  5BYR A;  3DCA A;  3N6M A;  4K2X A;  5KFS A;  1VQM S;  3U1N A;  3LP1 B;  3QLH A;  3MMJ A;  5K8P A;  3Q2S C;  4YDX A;  1HQU B;  4OLO A;  3W60 A;  1BGW A;  3G8S A;  4PG6 A;  2RRB A;  1D8Y A;  3N4W A;  2R3V A;  4KGK A;  1VJW A;  4OI3 A;  3N6L A;  1VQ6 S;  1TL1 B;  1V3Z A;  3RRG A;  2W7P A;  1V9O A;  2RHQ B;  3BGF A;  4NXN F;  2CQC A;  4K4Y A;  1FRL A;  4M8L A;  3EDR B;  1URR A;  3BP8 C;  1ELO A;  2I6W A;  3AT1 B;  1OSC A;  1HI0 P;  3S2D C;  1IKV A;  1HNV B;  3ILO A;  2AJ0 A;  2XZT B;  2ZJQ Q;  4DZ6 A;  5J2N B;  3OJS A;  2MXY A;  4GT9 A;  1RTH A;  4OX6 A;  3B78 A;  5THW A;  2W2M P;  1GAO A;  3JAM Y;  2X51 A;  2IA6 A;  4NZ6 A;  2HNZ B;  1F9F A;  1JLA A;  4TN2 A;  3IA0 A;  4GO7 X;  1F3F A;  4ZP7 A;  3OTO J;  4IDK B;  4NZ7 A;  1JKH A;  2DCL A;  1Y11 A;  5DDO C;  4MEY A;  1ZBS A;  4FZV A;  2FHJ D;  3BUE A;  4WP3 A;  4WWS A;  5IT9 U;  2CJQ A;  3Q8V A;  2XYG B;  4DR2 J;  4B9M A;  5HP1 B;  1WEZ A;  2W9C B;  4A3L C;  1I3Q A;  1WKJ A;  4K0K J;  2NXE A;  2V4J A;  2R93 A;  4RW8 A;  3UR0 A;  5H1S V;  4GTB A;  3C16 A;  4JV5 F;  3NGU A;  1YJ9 S;  3HP6 A;  1IUJ A;  4GTA A;  2BVZ A;  4A3B C;  2F40 A;  4I2Q B;  3LTO A;  3NP5 A;  8AT1 B;  1S1U B;  2B43 A;  1HNZ J;  3P49 B;  6FDR A;  2UXC F;  2OPP B;  1DY3 A;  3HF5 A;  1HYS A;  4DV6 J;  2EFO A;  4L3K A;  2VB6 A;  4X4Q A;  2HQ3 A;  3EQL A;  2OEK A;  5FII A;  3BZQ A;  2J7W A;  5A2Q U;  1JB0 C;  2MQL A;  2L9W A;  1Q8L A;  2JFD A;  1SJ3 P;  1B0T A;  1UFL A;  2P9C A;  3SCL E;  4OV6 A;  1WCM A;  5I42 B;  2PHC B;  3KDO A;  2Y9H A;  1HWU A;  4A93 K;  1QVF R;  3NKY A;  3HHL D;  1K0V A;  1U6Z A;  4OZL A;  1O26 A;  1ITP A;  1AXQ A;  3BBB A;  5ETM A;  5DGA A;  5KFG A;  4HEA 9;  3BF4 A;  3KJF B;  3RBX A;  2HQF A;  4AXJ A;  1HNW F;  1DJ0 A;  1XN9 A;  3D6H B;  2D9P A;  4AH6 A;  1X7V A;  2OPQ B;  1QUV A;  1S57 A;  2JA7 K;  2BE2 B;  1U8S A;  1IQ0 A;  4C11 A;  2GNK A;  4I4B A;  3S14 C;  1MWY A;  1XNR J;  3GDZ A;  4KJI A;  3M32 A;  4P9S A;  2RRN A;  2N4C A;  5B0G A;  1FWP A;  1P1T A;  5A6P A;  2W2O P;  4K50 A;  2C28 A;  1C1B A;  4JI4 J;  1NEE A;  2OML A;  1FJC A;  2BKN A;  3OXF A;  4RBU A;  4Q8E A;  3R97 A;  4HI2 A;  2AF6 A;  3DRX A;  4IKA A;  4A3F K;  3FSX A;  4FYX B;  3TUI C;  3HKZ L;  3UN2 A;  2NVY A;  2J6U A;  2PD1 A;  5MLC V;  5A2Q Y;  4RKU C;  3FBB A;  1SCJ B;  5D6G A;  1R0C B;  4LVO P;  4Y7N K;  4QZV B;  3R5B A;  1NDK A;  4OZ2 A;  1RT2 B;  4EYH B;  5ETN A;  3TJ9 A;  4ILM A;  7FDR A;  3S01 A;  4C0H A;  3CMA S;  4JK1 A;  1I94 F;  3GIM A;  2XGQ A;  2BBE A;  4EU0 A;  4RNF A;  3KK2 A;  1VBK A;  1WJ9 A;  2WOM A;  1BHN A;  3V6K A;  5IV4 A;  2V8V A;  4RW4 B;  3L7O A;  3OSN A;  2YX7 A;  2DEJ A;  3VAJ A;  2W8K A;  4WKR A;  1FHT A;  4OJ3 A;  3GTO C;  5KFC A;  3UN3 A;  1ACM B;  3BRE A;  3MML B;  1KBR A;  1RTH B;  1NDP A;  4KO0 A;  4PG8 A;  5HK4 A;  3KUG A;  3CJQ A;  2AX1 A;  5H9E K;  1WHY A;  5ETS A;  3DGP B;  4DR6 J;  3J7A 1;  3SSQ A;  1C0T B;  3HVT B;  2H5E A;  1IKX A;  4A8Y A;  3G4C A;  1Q4R A;  4Q44 A;  3T6J A;  3FKB A;  2A2D A;  4BCA A;  5CHP A;  4P71 A;  3S2H K;  2G1H A;  1T05 B;  2V8H A;  1GX5 A;  2BQ3 A;  3MR5 A;  3R1H A;  3ULH A;  3OL6 A;  1J5O B;  2R7T A;  2KN4 A;  4CIO A;  2QC3 A;  4DN9 A;  2GQQ A;  1HR0 J;  5GVQ A;  4B3M F;  3H0G C;  3Q8P B;  2XM3 A;  1WDT A;  4KGZ B;  4DV3 J;  3M4O C;  3AJ1 A;  5IOL A;  4A3I K;  1OQ6 A;  5JVH Q;  5M5W K;  4K4Z A;  1JOE A;  4TKT A;  2LXI A;  2XWY A;  3S15 C;  3NY0 A;  1UVM A;  3RAQ A;  1NJI T;  1FRI A;  2GSO A;  5ETK A;  2MGZ B;  3S6E A;  1WUU A;  1KHW A;  2PMW A;  1XNQ F;  5J2N A;  2OJ3 A;  2G2Z A;  2NYH A;  2BJ9 A;  1UVL A;  2D6F C;  2Z4P A;  3GR1 A;  1X9M A;  4Y00 A;  4DI6 A;  2Y1L B;  3ADA C;  5B7W A;  1CC8 A;  2BDP A;  3BO2 A;  2QO3 A;  1O25 A;  1R9T C;  2B0G A;  3KK1 B;  3U7J A;  2FVR A;  2G0J A;  2OPS B;  2I9S A;  2GSN A;  2AV5 A;  4NCA A;  1WHV A;  4C3M A;  3T19 A;  1RU2 A;  3A8J A;  1N56 A;  4LMZ A;  1YDL A;  4DS5 A;  4OIN A;  3OFF A;  5CYJ A;  4X62 J;  4BY7 C;  1IBL F;  2CJ9 A;  4G1P A;  2ALZ A;  1HWK A;  4C98 A;  4DX6 A;  1WC1 A;  2ZDO A;  3K7A C;  4P7V A;  1VQ9 S;  1RHM B;  3KFW X;  4DV5 J;  5HMW A;  3CJ0 A;  5HLF A;  3M8P A;  4DEZ A;  1WC4 A;  2OEJ A;  5IYD K;  4KH0 B;  3LAN A;  1ZVU A;  4G0V A;  4KAT A;  1LWE B;  2VFT A;  4WE1 A;  3I87 A;  3W62 A;  2R7Q A;  2CNO B;  3H7H B;  4KHM A;  1TWF K;  1FKO B;  1FEH A;  1D1U A;  4NRU A;  2R9L A;  2IJR A;  4DCO B;  1J6W A;  1R31 A;  1TWG A;  3QJL A;  3GII A;  1UCN A;  4G7H A;  2J7U A;  4G7Z A;  4J9R A;  3FC9 A;  3PJX A;  1VRT A;  4JUZ A;  2QG9 B;  4YR3 A;  2OH2 A;  1G4C A;  3I4N K;  5HP1 A;  4QWC A;  3SYZ A;  5IOR A;  1IWA A;  3BGU A;  3PRB A;  4DDF A;  5K14 B;  4RWW A;  3J7Z T;  4BLB A;  1S9G B;  4AL7 A;  2EG2 A;  2D9O A;  2J9D A;  4TXS A;  4X4T A;  3RUB L;  1JKH B;  2V68 A;  1FKA F;  3TAR A;  4A3C K;  3UO0 A;  3TX0 A;  4TLR A;  3GP9 A;  1JLA B;  4N8O A;  1M5O C;  1QAY A;  4LUB A;  1N0U A;  2YNH B;  1NJZ A;  3TNV A;  1HNI A;  2KJV A;  3A8E A;  2HFS A;  2A10 A;  2B5J A;  3L3C A;  4F4K A;  2OO4 A;  3CO9 A;  1XC9 A;  1K73 T;  1S0V A;  2B4O A;  1N32 J;  4RW9 A;  1VLO A;  2E2I K;  3VVT A;  3KLG B;  1OO0 B;  4L73 A;  5HQM A;  1YG0 A;  3THT A;  1TWH A;  3RAX A;  2PE8 A;  2AWZ A;  2WRM A;  3DHW C;  3GV8 B;  2KT5 A;  5HRO A;  4LK1 A;  4PWU A;  1VC6 A;  4EUV A;  4ID5 A;  1N5Q A;  4WJ4 A;  1LQ9 A;  5KFB A;  3RBE A;  2AU0 A;  3QMQ A;  4ZH4 A;  1Y7P A;  2HHH J;  1RHJ B;  4KFB A;  2ZC3 A;  3RW6 A;  4A3M C;  2ZD1 A;  1NHK L;  4J9K A;  4NLP A;  2ZFH A;  3D66 A;  4X66 J;  3G87 A;  3R9L A;  3C6U A;  1NU4 A;  2YWG A;  2Y1R I;  3ZTS A;  3NUH A;  1JXV A;  2EBE A;  4LF9 F;  3C66 A;  2UUC F;  4I7F A;  3MAA B;  3MM7 B;  4X2B A;  3HSG A;  4KH1 B;  2KB2 A;  4UY8 5;  1ARO P;  4QQB A;  2KM8 C;  1PYS B;  4NA1 A;  2DPJ A;  4RZR A;  1Y10 A;  5HAN A;  1JLF B;  3A8I A;  1M5V C;  1U0H B;  1PJ6 A;  1LWC B;  1ZH5 A;  2RVJ A;  2BEF A;  2KL8 A;  3BBC A;  4ZIW A;  3C6U B;  3GPA A;  4ID8 A;  4ZVH A;  4YB6 A;  1WC6 A;  1W2B R;  4JI6 F;  4XAK A;  3WZ0 A;  2AKW B;  4W4M A;  3NWG A;  2HZV A;  4PKD B;  5EX0 A;  5KG3 A;  1NJY A;  1VCT A;  1BC6 A;  2WB4 A;  2DIT A;  2GAG C;  4YN3 B;  1ZS6 A;  2Y0S L;  1HMV A;  1NKC A;  1SFO C;  5L38 A;  3L09 A;  1RAE B;  3TQE A;  4OYZ A;  1VGX A;  4J5O A;  2D74 B;  3IBW A;  1QTM A;  2C2O B;  4A48 A;  1S6Q B;  2FJX A;  3H5Y A;  2VKZ G;  4DV7 J;  2LA6 A;  4PRF A;  4HTI A;  1XZQ A;  3BSO A;  4W98 A;  1RTI A;  1BD6 A;  2FYX A;  4NEY A;  4KPY A;  2UVW A;  4FF3 A;  1UW9 A;  4URG A;  1IQZ A;  4XO0 A;  1NUE A;  4S0M A;  3SDE A;  1FRK A;  2MKY A;  1FNM A;  1RLC L;  2WVC A;  2ZH9 A;  1N33 J;  4I64 A;  3W5X A;  1F93 A;  2EFN A;  3C3L A;  3MPU B;  2DHX A;  4LR2 A;  5M2U A;  4DSK A;  2BJ3 A;  4GTL A;  2R8H A;  4X62 F;  3PO4 A;  2LQJ A;  2ZHA A;  2SXL A;  3T9Z A;  1U1R A;  3W63 A;  2KJW A;  4MYT A;  3F73 A;  2Y0B B;  2HVZ A;  1WSV A;  2FD2 A;  3HOW K;  4WE1 B;  3FZ2 A;  2V67 A;  1F0X A;  2IYG A;  3DMJ A;  2YQ0 A;  4GMK A;  1I1G A;  1SC4 B;  4KGV B;  2VQF J;  3CDB A;  2EXU A;  2KWA A;  1VQ7 S;  1U7L A;  2ASJ A;  3SCK E;  2H3E B;  5KFZ A;  3S2H C;  1T9Y A;  4A4J A;  1OQ3 A;  4R0E A;  2CQ2 A;  2BJ8 A;  4X4U A;  3GTL C;  2WHO A;  2DIS A;  3PYE A;  1M1K T;  4WYL A;  5C5J A;  2HLU A;  3Q8Y A;  2IJN A;  3IP0 A;  2UVU A;  3TA1 A;  5KFU A;  2IVM A;  4NI2 B;  4U96 A;  3LUY A;  4OZ0 A;  5C42 A;  2RS8 A;  2FUG 9;  3GJS B;  2V0N A;  3KLI A;  1FWK A;  2OGU A;  4O4G B;  2CPZ A;  4F0H A;  2GHV C;  2JX2 A;  4Y52 C;  2VHG A;  1MLA A;  3CD5 A;  1RJJ A;  2BJ7 A;  2H5J B;  1NH7 A;  3ORE A;  4FN5 A;  4KR0 B;  4OI0 A;  1WAC A;  2YX1 A;  1HBU A;  1WF2 A;  2OPS A;  4IH7 A;  4JI5 J;  3GFZ A;  2HWI A;  5C4X K;  5LXY A;  3I9Z A;  3HKW A;  2HK2 A;  3LP0 A;  1UZD A;  1IS1 A;  4PUO A;  4A3K K;  3QRQ A;  2DHG A;  4RMF A;  2F3J A;  5DZ7 A;  1L3U A;  3W2V B;  3UFC X;  3S1Q K;  2E5J A;  1HNZ F;  2P5V A;  3OVB A;  5CYQ B;  2DXD A;  3EZU A;  4MIW A;  1R8H A;  1HNX J;  1VK3 A;  1I50 K;  4I0W A;  4QWD A;  1TAU A;  3MUR P;  1OS5 A;  1UL3 A;  2AYM A;  1N32 F;  3PR5 B;  4YHH J;  3FHZ A;  2CPD A;  2YKN B;  2Y1J A;  2JOQ A;  1TL3 A;  2EVZ A;  1NK9 A;  3J7Y U;  1SL0 A;  4DV5 F;  4DFK A;  3S8S A;  4DPT A;  4H4O A;  3NGR A;  4DSE A;  1SL1 A;  2Y8Y A;  2JNJ A;  1FXD A;  2D7S A;  3VF0 B;  4ICL B;  5A8K B;  3WOD A;  5JVO A;  3PW2 A;  2OSR A;  4JI5 F;  4LSL B;  2C22 A;  4ED6 A;  1YQH A;  4NWB A;  4CLZ A;  3WHI A;  3IM8 A;  4RO0 A;  3DDK A;  1RCO B;  3HVW A;  3T3F A;  4DR7 F;  3GE9 A;  3I4N C;  1H7W A;  4UQT A;  2I5J A;  2E2J K;  2KTQ A;  4C6A A;  1G2E A;  5EGE A;  1OIA A;  5AXM A;  1X0F A;  2YNH A;  4NML A;  4K4V A;  3ISN C;  2YX4 A;  4OMF G;  1NK5 A;  5A8W A;  2O5J A;  3NNA A;  3T5K A;  4OZN A;  4N7T A;  3G6X A;  3FBC A;  2R2S A;  2CPJ A;  5KG2 A;  3MED B;  1M5S A;  1UPM B;  4IQM A;  5DQG A;  1AA1 B;  4BKW A;  1U2F A;  2DY1 A;  1QAI A;  2WOM B;  4OIR A;  2G2Y A;  3I55 S;  4CM0 A;  1YJV A;  1C2P A;  3FZB A;  1XMO F;  1K83 A;  1NB7 A;  3PEH A;  3EXY A;  2FC8 A;  2HS3 A;  2JL9 A;  2Q43 A;  4RUB A;  1GTE A;  3CB4 A;  3DMJ B;  2CQB A;  4WPA A;  1NK8 A;  1JWW A;  2W4P A;  2M8D B;  2R92 K;  4H4K C;  4YDD B;  1RBO B;  3MM9 A;  4TQR A;  3T6B A;  3BPS P;  4ZA1 A;  1XBW A;  2QLJ B;  3OXL A;  1EQM A;  1W25 A;  3PFE A;  2RQM A;  3OR1 B;  3MEG A;  3QJP A;  2XY5 A;  1RCX B;  1S48 A;  4IG3 A;  4QJV B;  4K5R A;  1U2C A;  3QRR A;  2ZHB A;  4LFC F;  3MEG B;  3CDW A;  4KAI A;  4ZVQ B;  5HLF B;  2HBR B;  2L41 A;  4OLP A;  3C14 B;  2QZ8 A;  4BLA A;  4EBE A;  5HMY A;  4FZB A;  1S6P A;  3DLB A;  3HK2 A;  4QIW L;  3QAT A;  3CSK A;  2ZC4 A;  3B82 A;  3OVS A;  1HD1 A;  2K1R B;  2WW4 A;  2J76 E;  2XMK A;  4ED5 A;  4F2S A;  2XCA A;  1SL2 A;  3ITH A;  4LRC A;  1QE1 A;  5IXU A;  4CO0 A;  1F5A A;  2FLN A;  1R8P A;  2HHX A;  3PHE A;  4QWE A;  2G4B A;  1LEO A;  1VHF A;  5ETP A;  1LW0 A;  1N4L A;  3Q3Q A;  1WI6 A;  4H4O B;  1YBU A;  3R2D J;  1ZAX A;  2CUY A;  3IAM 9;  4QWA A;  1FRJ A;  2PA8 L;  1T9X A;  2IHR 1;  3B4D A;  2Q1L A;  3KLH B;  3LF0 A;  4LRF A;  2I5J B;  1XNR F;  2IBO A;  1HIY A;  1RT1 B;  1HHS A;  2W9B B;  4Y0F A;  3AHP A;  4KAW X;  3AFG A;  2F8E X;  4JI6 J;  3IMQ J;  5TJ3 A;  1Q16 B;  2DNM A;  1VK8 A;  3MD1 A;  2W9C A;  4ED2 A;  3UI3 A;  1JVI A;  4ZOS A;  4FXD A;  1I6V A;  2W7A A;  3QGP A;  3G8Q A;  1RWW B;  2DO4 A;  5KG4 A;  1N0V C;  2PPB A;  4OX9 J;  1RA6 A;  4JI3 F;  5L9X A;  2IDL A;  3GTQ K;  1FDD A;  3PHT A;  4ZCM A;  2GA7 A;  3HOW C;  4IR9 A;  1GT8 A;  2C2K B;  4RBT A;  3WQP A;  1X4F A;  5HQL A;  2QA4 S;  1CJK A;  2F9J A;  3EZ5 A;  1VI7 A;  1KEK A;  2DCU B;  1WOR A;  2DYA A;  3EGW B;  1NK4 A;  1NPR A;  4ILL A;  1FCA A;  2RDJ A;  2N3L A;  4ZLJ A;  1JX4 A;  3V6D B;  1IR2 A;  4ZP6 A;  1TP7 A;  3SCI E;  5CAA A;  2MQN A;  2JA5 A;  1ZA2 B;  1S99 A;  4B3T F;  1LOU A;  4PG5 A;  2UV8 A;  2DEI A;  4KIA A;  1JQG A;  2OEL A;  3G86 A;  1F7U A;  5KT5 A;  4OHY A;  4X6A C;  2UUT A;  4B3O A;  3SFU A;  1D3W A;  4O0I A;  5F8J A;  4CLK A;  4DV2 F;  1H0H B;  3HJV A;  5HQ8 A;  1WKK A;  3DM2 B;  4MFB A;  1GMU A;  2DH7 A;  1HNI B;  4AT1 B;  3AAW B;  2ZHO A;  2DNH A;  1I3Q C;  2COL A;  2FQO A;  3JXO A;  1MU2 A;  3HI9 A;  2GJI A;  2HWT A;  4KN4 A;  5E5N A;  3PCO B;  3HT3 A;  1SKR A;  1N52 B;  5M5X K;  3MMC A;  3QWP A;  1VFJ A;  3AD8 C;  4ECX A;  4QCL A;  2RS2 A;  4LT6 A;  4Y2C A;  2MKI A;  3H0G K;  4A3G K;  1HLW A;  2HHW A;  4AL6 A;  2M52 A;  1RT7 B;  1YJW S;  4XDD A;  4U7C A;  1FWL A;  4DQQ A;  3VQS A;  3WC2 A;  4M63 A;  2JLF A;  1H6K X;  3LWL A;  2AMC B;  2LA4 A;  1KQK A;  2AYE A;  4NE9 C;  2IM0 A;  2Z2Y B;  2DD8 S;  3S15 K;  4FS2 A;  3VQT A;  4DFM A;  4P74 A;  1RI7 A;  4C2M C;  4O2D A;  4XLP A;  2D1C A;  1T11 A;  4DG1 A;  2B7B B;  3HFV A;  3O44 A;  3NWR A;  4QYZ J;  2DNR A;  1FES A;  4ZPW R;  4Q2M A;  1TV6 B;  4GFQ A;  3KUH A;  2MSS A;  4JV2 A;  1DLO B;  1RQ0 A;  1W26 A;  4OFZ A;  3D7S B;  2DRA A;  4X65 J;  3CE8 A;  1TWC K;  3UPF A;  4P73 A;  5D0H A;  1YRT A;  3CUL A;  1RUS A;  2QMW A;  1SQF A;  3M6W A;  3I31 A;  1HL6 A;  5DM6 Q;  1RT6 B;  1BGX T;  1W2I A;  3I6P A;  5IP7 C;  1R3N A;  3R7N B;  2BAN A;  4A3K C;  4NLQ A;  3TYT A;  4AYB L;  4BBR K;  4LFA J;  2MKH A;  1S0M A;  5K8N A;  1NPP A;  3KDN A;  2ZH8 A;  3MM6 B;  4CH7 A;  5F3T A;  4NCB A;  2VIH A;  3TAP A;  3PW4 A;  2KG1 A;  1WSR A;  3VGS A;  4F4X A;  1RLD A;  1YKW A;  2KHC A;  4IFY A;  4GC6 A;  1EP4 A;  3H5S A;  1LV5 A;  2CPY A;  4F8R A;  4IOC Q;  3M7V A;  1XMO J;  5HJY A;  3OHA A;  1FE4 A;  2ZH7 A;  3UNG C;  4R25 A;  2JLG A;  5IP7 K;  1HBN B;  1WCM C;  4G65 A;  4ZHR B;  3FKI A;  1AUS L;  2HVE A;  4EZ9 A;  3IWN C;  4F26 A;  2AYB A;  1ZOT A;  2B63 C;  2NXU A;  1PIE A;  4LBI A;  3O3L A;  4Q5S A;  2HYI B;  5FDL B;  3NNH A;  4ED8 A;  3THP A;  3BBF A;  2XSJ A;  1DTQ A;  1G3O A;  4OI2 A;  3OFH A;  1QD1 A;  2HMI B;  1TEL A;  1HW9 A;  2YU9 A;  4LFC J;  1YSJ A;  4ECR A;  4HVZ A;  2NUU G;  4F4Y A;  3DI6 B;  5JFE A;  4DUY J;  2EK1 A;  3S0X A;  1HI1 A;  2CFA A;  1S1X B;  1WQH A;  3NEK A;  1T03 A;  3OTB A;  3GTM K;  4XSX A;  3KG4 A;  1D09 B;  4OI1 A;  5D4N A;  3HXM A;  3OHB A;  5E3Q A;  1LFW A;  3R2C J;  3H3V D;  4Y2I A;  4DV0 J;  3CC7 S;  1FRH A;  3V6J A;  1Q53 A;  4RW6 A;  3MPW A;  2A2C A;  2LLZ A;  4U67 Q;  1HFE L;  5KT3 A;  5IC4 B;  4ANC A;  2FHO B;  2UXC J;  4WU2 A;  5CYQ A;  1XK8 A;  2MMY A;  3T9N A;  1XXB A;  2E5H A;  1NK6 A;  1CBK A;  2ILY A;  5I3P A;  4LVN P;  3TZW A;  1URN A;  2WB1 D;  3SZY A;  4G0U A;  1WHW A;  1DUR A;  3W61 A;  3I56 S;  1QAX A;  2LDY A;  4I2P B;  3SMZ A;  1EAR A;  2HBY B;  4TY8 A;  2EEY A;  2R7X A;  4DUZ F;  1M90 T;  2IA0 A;  2XLJ A;  5CH7 B;  2GAH C;  1JLB A;  5MAO A;  5CYM B;  3ZZ0 A;  3QAU A;  1IW7 A;  2GMH A;  4OX9 F;  2AW0 A;  3R5J B;  1EKS A;  3ITH B;  2RH3 A;  4PQU B;  1TWH C;  2RQK A;  3AB4 B;  3M1V B;  2V8D A;  3KLI B;  3OL9 A;  3RB4 A;  2QFI A;  2LCW A;  4C3H C;  4JOU A;  4CLT A;  5GAH I;  3D68 A;  4UW2 A;  5TMF A;  4LF2 A;  4A3B K;  2R92 C;  3HKZ D;  3BR9 A;  3O8W A;  5IFM A;  4DR1 J;  4DL7 A;  4DR3 J;  2B56 A;  1RAO A;  4X64 J;  1RTZ A;  4A46 A;  3D5M A;  1VQP S;  1S0O A;  5T7L B;  2DJW A;  3FBF A;  4CCH A;  1QE1 B;  3LPY A;  4MKY A;  2JA5 K;  3K5P A;  4BWM A;  2M8H A;  1JQW A;  4M5G A;  2XMM A;  4XLN A;  3HSZ A;  3SV3 A;  4ES3 A;  2HG4 A;  4ZDN A;  1F7V A;  2MJN A;  3BEG B;  4NCG A;  1OY8 A;  2NVT K;  4DV1 F;  3CVK A;  5J1E B;  4TLQ A;  1T8E A;  2YU9 K;  1RU1 A;  3R8Y A;  1KN6 A;  3NL0 A;  1SJ1 A;  2DNN A;  2HND A;  4HKQ A;  3TVY A;  4USI A;  4LIR A;  1WIH A;  4LBP A;  4KY3 A;  3CJS A;  2F4V J;  5DG8 A;  4DL5 A;  1X9W A;  2XLI A;  1SKU B;  4M5N A;  3KLF B;  1U1L A;  2LXU A;  2UVR A;  4LR8 A;  1GH8 A;  1TR0 A;  1UA0 A;  1G1X A;  4KV8 B;  1X4C A;  4P2X A;  3DLE B;  5KFA A;  2HFV A;  3TFH A;  2CIM A;  4O3P A;  1RGV A;  4WKY A;  4AYB D;  4LQ9 A;  3D1O A;  3T41 A;  4J3N A;  1UV7 A;  4M5D B;  1RAF B;  3TOQ A;  2X3G A;  2A6E A;  4IYQ A;  2MY7 A;  4ZLP A;  1RP5 A;  1ZZF A;  3MMC B;  2B9Y A;  1H2T Z;  1PAE X;  1RHU B;  5ETO A;  3R5D A;  3KJQ B;  1EI6 A;  4QIF A;  2W01 A;  1EIY B;  1NSA A;  4C0O C;  1ZZN A;  3PAC A;  4LFA F;  3BO3 A;  3AXK A;  5HJX A;  5GAD U;  2UXD J;  3NCP A;  3S1T A;  3TJ8 A;  3EX7 B;  2LEP A;  2C3M A;  1YHQ S;  3QSI A;  2J0Q D;  4PQA A;  2R8G A;  1S4F A;  3DLK A;  3MM8 B;  1KRP A;  4LK0 A;  5JMN A;  5B0F A;  5M2P A;  4QBU A;  1BDF A;  5HRO B;  3N9U C;  1T05 A;  2GHW A;  2POK A;  4ANE A;  1ZET A;  1QLN A;  2QSF A;  1FO1 A;  3H0G A;  1TWC C;  2O5I A;  2N82 B;  2GO8 A;  1AUD A;  2CRL A;  3ZZU A;  1WHX A;  1YTY A;  1LXN A;  3ZZO A;  2Q66 A;  3M9N B;  5HL7 Q;  3TP2 A;  3MPD A;  4KM9 A;  4RNO A;  3TW0 A;  3HHK A;  4UF4 A;  4IG0 A;  1DAX A;  3OW2 R;  1UVI A;  1JLQ B;  2EFP A;  2K1R A;  2ABY A;  1D0E A;  2YKM A;  5KOX A;  4DDQ A;  2Y1I A;  3GTM C;  2I0X A;  1I3O B;  2E1R A;  3LWM A;  2ZH3 A;  5J1N A;  3CWJ A;  3W9I A;  2RF2 A;  2XCQ A;  1WTB A;  3DRS B;  5HAO A;  4CO5 A;  3JST A;  4EZ6 A;  2FJA B;  4JYA F;  3LGM A;  1KVI A;  2HRU A;  1X4B A;  3HOX K;  1WWH A;  3DLH A;  1CS4 A;  2DRB A;  4LRA A;  3W9J A;  1MG7 A;  1JLC A;  2MKK A;  1F9H A;  5U47 A;  4M1X A;  2PMH A;  2W8L A;  4AQY J;  2A68 A;  4PXC A;  1S4E A;  2HHS A;  2JRS A;  1EP4 B;  1JLE A;  2DR9 A;  1TUV A;  1S77 D;  2R7O A;  5B0B A;  3OR2 B;  4KRW A;  3KJV B;  2A0F B;  2HUR A;  4P52 A;  1X5O A;  1EFW A;  3T1H F;  4GVL A;  2RUS A;  3ZNJ 1;  4QR2 A;  4MT1 A;  1PJ7 A;  3GEE A;  4ZVS B;  3GTQ A;  4ZN1 A;  4ZJO A;  1VC5 A;  2MHE A;  5J1E A;  2CA9 A;  2MPU A;  3KYL A;  3M30 B;  3K7A K;  3HVA A;  4IQX A;  5EHH A;  1Q79 A;  4V19 X;  5T14 A;  3GFH A;  5GME A;  1KD1 T;  2C3O A;  1RTJ A;  2IVY A;  3JTO A;  4OHX A;  2R7U A;  5G0R A;  3MED A;  1TV6 A;  2NUH A;  3MEE A;  5LMU J;  2M3D A;  1J98 A;  2J6T A;  5H9F K;  1SJQ A;  3RB3 A;  3MEE B;  5HVF A;  1I51 B;  5L1K A;  5DG9 A;  2WSC C;  1RTJ B;  2A1B A;  1O29 A;  3AA8 A;  2YPZ A;  4Y6I A;  2BRL A;  2QRR A;  1KLN A;  3CXC R;  1DCH A;  3MOZ A;  4Y2M A;  2OPP A;  3J7A N;  2VFR A;  1QUP A;  5DG7 A;  3G2X A;  1R8B A;  1F3V A;  4DFJ A;  3M2V B;  4EBD A;  3EZO A;  3QGH A;  1JNZ B;  3UVJ A;  4J9U E;  1P9Y A;  5J2P A;  1QVG R;  2X1G A;  5KFJ A;  2MKJ A;  3BKU A;  1FER A;  2U2F A;  4IO1 A;  4DR5 F;  1GXU A;  4DX5 A;  4DV3 F;  3FSI A;  2JA7 A;  4GVB B;  3N3Y A;  4DL6 A;  4KHR A;  3MF5 A;  1VS3 A;  3TWZ A;  4RU2 A;  5IM0 B;  2OTL S;  3SI8 A;  3H98 A;  2N7Y A;  2CAD A;  3GCX P;  2W2P P;  5ADZ A;  2CQD A;  2PEB A;  2A6M A;  3TJA A;  2P5M A;  4DHV A;  3SZ2 A;  1DCP A;  3NS7 B;  4DX8 H;  1BMQ B;  2CNL B;  4ZVG A;  1L3K A;  2RU9 A;  2H48 B;  1EX8 A;  2KFN A;  4IRC A;  2UVV A;  2NVQ K;  2ZZN A;  1LFP A;  1Y1W A;  4Y28 C;  2ALY B;  3GV7 B;  3OPF A;  3EIC A;  1GK8 A;  4YFU A;  1BQN A;  1UP1 A;  5CZV A;  4CNY A;  1F5C A;  4C3J K;  3D6T B;  2HHU A;  1NKE A;  5AE2 A;  2WBM A;  2DGQ A;  2H5I B;  3IR7 B;  1NME B;  2RQ4 A;  3E51 A;  2B8P A;  1VQ4 S;  4O3R A;  4KMH A;  2RJZ A;  2QN6 B;  2GZO A;  2RB7 A;  2JA6 K;  3UD5 A;  4O23 A;  1U8W A;  4A3J C;  1ISE A;  3NBP A;  4RW6 B;  2JA5 C;  3KG0 A;  5F8N A;  4CO3 A;  1Q7L B;  3FEZ A;  3K57 A;  3BH7 B;  4RU9 A;  3BB5 A;  1I94 J;  3DRY A;  2HAF A;  3ISZ A;  2VAS A;  1B64 A;  4URS A;  2F63 A;  2Y3P A;  4C8M A;  1RT4 A;  2Y3Y A;  4QU7 A;  1O0P A;  2KFY A;  5KT4 A;  4B9T A;  3K5O A;  4W90 B;  1TKT B;  4LF6 J;  2L48 A;  2RUG A;  1FVQ A;  3PX4 A;  4CZC A;  3CTR A;  2YTC A;  2DGV A;  1G7C B;  2CXE A;  1RBA A;  1RT5 B;  2IRX A;  1Z1Z A;  3NCQ A;  4U95 A;  3KLF A;  1VQY A;  1NRK A;  3GWC A;  5GMK a;  3BSN A;  2H65 B;  4KGX B;  2XNR A;  1F9E B;  2D3O 1;  4TVA B;  4CLS A;  1BQX A;  5DM7 Q;  2YQ1 A;  4Q43 A;  2MDA A;  3OTE A;  3HD1 A;  1J5E F;  1HQE B;  3CIM A;  2BUN A;  5L1J A;  1INN A;  3HMJ G;  1A7G E;  2VOO A;  4C9D A;  4YB5 A;  1PIL A;  1FI4 A;  1DTQ B;  2WAQ D;  4KV8 A;  2OPQ A;  3R5C A;  5GAD I;  4FPR A;  1F60 B;  2KHD A;  2VPZ B;  4USH A;  4YG2 A;  4USK A;  1N34 J;  4DS4 A;  3MZI A;  5GMD A;  2B7C B;  4C8L A;  3N6N A;  2DR5 A;  4RR5 A;  1Y1V A;  2IFX A;  2H51 B;  1LWF A;  3CGI A;  1XNQ J;  3VAK A;  2WW8 A;  1M5K C;  1WOP A;  2AIR B;  2K3K A;  5EWE A;  2G0I A;  3J81 U;  4I2Q A;  2RQC A;  1T3N A;  3KKF A;  2M0G B;  4KB2 A;  3HM9 A;  2P9G A;  2EBB A;  5EN1 A;  4L3N A;  2BQU A;  1O6X A;  5IWA F;  3JSB A;  4Y3C A;  5A0Y A;  1JJ4 A;  2ADB A;  3GYN A;  2D69 A;  2KT2 A;  2ZUE A;  4PAB A;  4LF5 F;  1TVR A;  1P1L A;  4YY3 F;  3MTK A;  1PYO B;  3T5H A;  3P5T L;  2CFX A;  1K83 C;  4LRD A;  4KTQ A;  1HYS B;  5E3A A;  3DLL Q;  5D3G A;  2JEI A;  1S1U A;  4WIL A;  1N34 F;  3CC4 S;  1HNX F;  5L1I A;  5E41 A;  5ETV A;  2R8I A;  4OZ5 A;  1CJU A;  4KMA A;  1YRU A;  3BDE A;  1CQM A;  3B4M A;  1R9T K;  3A3P B;  2CJX B;  4ZK7 M;  2Q3P A;  4KKO A;  3IBF B;  2YBV A;  5DQH A;  4B3O B;  4BBS C;  1S1W A;  3ETM A;  3CCV S;  1B4A A;  4D3H A;  4A8Q A;  3MM7 A;  2OHD A;  5KFV A;  1NM2 A;  2NZC A;  4QR1 A;  2CG4 A;  3K2Y A;  2PO4 A;  1IVZ A;  3T5L A;  4TY8 B;  4O3S A;  3VAL A;  2P9E A;  4CWB A;  5JXS A;  2NQP A;  3AQO A;  4PUO B;  1J6V A;  5KFH A;  1XJW B;  2XCP A;  4JI2 F;  3VZH A;  3QZ8 A;  1TL3 B;  1WC3 A;  4RUH A;  2NR0 A;  3W8G A;  1WEY A;  5D78 A;  2BR0 A;  1X4A A;  2XHC A;  4NLU A;  1WF0 A;  9ATC B;  3CCS S;  3N5F A;  3HO1 A;  4C8Y A;  1R8A A;  2XYH B;  1CJV B;  3I0S B;  3Q24 A;  4ID5 B;  4ED7 A;  1U0H A;  3ISN D;  3W9H A;  1U49 A;  5A6W A;  2MQO A;  1C4C A;  1TWG K;  1HAR A;  1EQR A;  4P2F A;  1U02 A;  2XY6 A;  4OI6 A;  2F9D A;  3W2V A;  2DKO B;  3E01 A;  4A3M K;  4HDH A;  4QW9 A;  2IAJ A;  3D9B A;  3HVT A;  2K2P A;  3VAM A;  4GTE A;  4HI1 A;  3GYG A;  1KC8 T;  1CJK B;  4X4S A;  2VG6 B;  5D0G A;  1U1O A;  3US5 A;  4TYA A;  4I67 A;  4ZS6 A;  3CCJ S;  3CAG A;  3QYY A;  5KAK A;  3MTJ A;  3FKI C;  3S14 K;  4P10 A;  2DR7 A;  4MK8 A;  1LWX A;  3C15 A;  1EH1 A;  2CPX A;  2FY1 A;  4E8U A;  4ECS A;  3EJM A;  1RAH B;  1X5S A;  1VIS A;  4P2M A;  3TI0 A;  2JA6 C;  1M0S A;  2LYV A;  5ITH A;  4BLG A;  1QY7 A;  3DRR B;  2EBG A;  3G8T A;  3QID A;  1NSP A;  1IM6 A;  3GLJ A;  2GFF A;  5D4D A;  3O6Q A;  3ZO7 A;  2F65 A;  4G1Q A;  2NCK L;  5CD4 H;  1VRT B;  4EI2 A;  2VQE F;  1CJU B;  1Y9O A;  2K7J A;  4ZHR A;  2ASD A;  4ED4 A;  2AYG A;  3TTG A;  2HIQ A;  2QV6 A;  4LR7 A;  2GIR A;  3H5X A;  3PW5 A;  3EVM A;  2HAI A;  1UPP A;  3F0N A;  1S6U A;  4GZY A;  2XMA A;  2Z56 B;  1RWU A;  4U8V A;  5AT1 B;  4O3N A;  3RAM A;  5LJ3 Y;  2GVZ A;  3GTO K;  3GTL A;  1UVN A;  3Q8Q B;  1LXJ A;  1ZPW X;  1RZM A;  1Z4U A;  1SV5 B;  3M30 A;  3ZC4 A;  3HOV K;  1XIQ A;  2AJQ A;  2Z57 B;  2VF3 A;  2FIU A;  4KHP F;  3ETO A;  1O28 A;  4FF4 A;  4KBI A;  3G9C A;  3TO8 A;  2P6T A;  1Y3K A;  1RTI B;  4F0M A;  4DV4 F;  2FJB B;  3PYD A;  2X3D A;  1AW0 A;  4F36 A;  4FYY B;  4DG1 B;  5DLG A;  2Z2L A;  1RWV B;  1KS2 A;  1KOO A;  3DFE A;  2E9T A;  4X4V A;  5IP9 K;  3HOZ C;  1OPZ A;  3S1M K;  2ASY A;  4PWW A;  3U27 A;  2V2Z A;  3Q2T C;  3ZTR A;  4NXN J;  1Q78 A;  4K2J A;  1X4H A;  4GKK F;  3W64 A;  3D54 A;  3GTP A;  1NSK L;  3B6B A;  2XMV A;  2UU9 J;  2DGX A;  4RUC A;  3FJ2 A;  4RUA A;  1SC3 B;  2FGO A;  4J9M A;  2ZOM A;  3I5C A;  1NZA A;  2V4J B;  5C24 A;  4HAC A;  4LSL A;  2JA7 C;  5CYM A;  3CCT A;  4LF1 A;  3MAA A;  2BAB A;  3M2U A;  1IKY A;  1KOH A;  2CKW A;  2QMX A;  2DK2 A;  1NH8 A;  5DJB A;  2KYX A;  2YWE A;  2YQ3 A;  2Q6C A;  3O5T B;  1ZTW A;  5T41 A;  5LOQ A;  2HNZ A;  4ZP9 A;  3S1R K;  3G82 A;  4HHH A;  2NVX A;  1CC7 A;  1SJR A;  1UET A;  1VHI A;  1XER A;  1PBA A;  1VRQ C;  2VDI A;  1SFO A;  3H5U A;  2ZUG A;  3H2L A;  3C16 B;  4NLO A;  1HNV A;  1RKJ A;  2EI5 A;  3IG1 B;  1JJH A;  1RAG B;  2E9Z A;  1LW2 A;  4WJ3 M;  3S7R A;  2B9X A;  4XK8 C;  4DBQ A;  2BRK A;  2O3D A;  1TWA C;  2G1D A;  5C4X C;  5LL6 d;  4J9P A;  4MKB A;  4PWD A;  3KLG A;  1RK8 A;  4C3I C;  2XEX A;  2VV5 A;  4OHW A;  4O0N A;  3I4H X;  3JSY A;  4DQP A;  3R27 A;  3LP0 B;  4J9O A;  4BY1 K;  1PCA A;  3QT7 A;  4CTA B;  1IBK J;  4NLD A;  2EPI A;  1FTR A;  4RW7 B;  3NRB A;  2PEH A;  2ZNZ A;  4V19 J;  3TVZ A;  1AT1 B;  1KKH A;  2CPE A;  2LEC A;  2OKQ A;  2PII A;  4P6Q A;  1WEL A;  3GTL K;  1FDB A;  2DNZ A;  3CJ4 A;  1X4G A;  2MZJ A;  2HLT A;  2QE5 A;  4BHQ A;  2DY9 A;  5J2P B;  4WF9 Q;  3GTJ K;  2HPU A;  5K14 A;  2W9B A;  4IUF A;  1WCM K;  2ZBP A;  2UXD F;  1YNN A;  4MKV A;  2YH1 A;  4C48 A;  1BWV A;  2MLY A;  2B63 K;  3L95 X;  4BY7 K;  4J91 A;  3AOC A;  5LMN F;  2OSQ A;  4IR1 A;  2UV8 G;  3CJR A;  1JIH A;  4HTJ A;  2ZUF A;  4F4A A;  2W4D A;  2OFG X;  1KDN A;  1EK8 A;  2MJU A;  4LF8 J;  5BYS A;  2KRB A;  2CQH A;  1C1B B;  2XUL A;  2YNG A;  4UST A;  2ERR A;  4YR0 A;  5DS7 A;  1YK9 A;  4X4N A;  1IKY B;  4P5A A;  3I0R A;  3TX8 A;  3BSA A;  4JV5 J;  2HRT A;  1S9G A;  1RDR A;  3RG6 A;  4M5D A;  4ZLL A;  1MN7 A;  2AX0 A;  4IO9 Q;  3FEX B;  5FLX Y;  3MUV P;  3C14 A;  3M8Z A;  3MR3 A;  2WK4 A;  3BSC A;  1N48 A;  4PZV A;  4FXW A;  1S97 A;  4ZCL A;  2FQT A;  3PKY A;  1T9W A;  3MCS A;  3CQZ C;  1TK0 A;  4NLY A;  3O1L A;  2YVS A;  3N0C A;  1B0P A;  2DO0 A;  2HFZ A;  2CJA A;  3Q89 A;  5T7L A;  4TU9 A;  2B4P A;  1SB6 A;  1HPZ A;  4QR0 A;  4K7Q A;  1HW8 A;  3KK1 A;  2GQ2 A;  2BA9 A;  5FLX U;  4J7C A;  4JYA J;  1K1Q A;  1Q1K A;  5C4J C;  2P2C B;  3LOU A;  3WBZ A;  1NLK L;  2VBY A;  5GAG U;  2QA1 A;  3THV A;  2HQD A;  4FDF A;  1H2V Z;  1AZS B;  1P6T A;  2E5G A;  1SJF A;  4NCG B;  4WFY A;  2E1M C;  2F8H A;  1CVJ A;  3FNN A;  1KVJ A;  2CWX A;  1NK0 A;  2NXC A;  3ENW A;  3MEC B;  3T1H J;  3PG9 A;  1RTD A;  3EM1 A;  5I42 A;  2HBZ B;  5A76 A;  1HMV B;  3JYT B;  1VLY A;  1UZH A;  2QLF B;  4ATN A;  2VU5 A;  1U2R A;  2YKN A;  3R6G B;  2R2U A;  3H2U B;  2RF2 B;  1SJ4 P;  4KHP J;  3QRP A;  5IYB C;  1Q8I A;  1Q82 T;  4JV0 A;  5AJ3 J;  2AJ2 A;  2QX0 A;  3PR4 A;  4QIG A;  1R9T A;  3LGH A;  3S1N K;  3TA2 A;  3LAK A;  2AD9 A;  4O3O A;  2Q6B A;  4ICL A;  4HT5 A;  3SSS A;  2ZZM A;  1TL1 A;  2CAJ A;  5IQQ A;  2HNY A;  1S1T B;  2E2H A;  4UTG A;  5F0W A;  3RB6 A;  4LBH A;  3JSM B;  4ERD A;  3EDQ B;  2BW7 A;  3UCZ P;  2AEM A;  4IDK A;  1EHW A;  3JQM A;  4HAC B;  4RW7 A;  1O27 A;  4WFX A;  1LK5 A;  1WDD A;  1NSQ A;  1EAY C;  3UD3 P;  1Y1V C;  3KNG A;  3BYR A;  4OX7 A;  4HH1 A;  4J9L A;  2VUM A;  1YZ7 A;  1VBX A;  4I6W A;  2OFH X;  3OBI A;  1USO A;  2WVE A;  4KAR A;  1MRO B;  1MML A;  2DNY A;  1ZQ1 C;  3KNA A;  3PYG A;  1X0P A;  4OX8 A;  4DQR A;  3HHL B;  5KG1 A;  1UJ4 A;  3MM8 A;  2RDI A;  1F2G A;  3D1H A;  4M5L A;  3D0H E;  1Y1V K;  1NAQ A;  5B0D A;  1XQI A;  4FYV B;  4EO6 A;  2HK3 A;  4FYD A;  1OJ4 A;  1RAA B;  4NXM J;  3HZG A;  2RKI B;  1U6F A;  4NRT A;  1SI9 A;  4ETZ A;  2GIQ A;  2HFU A;  4XDC A;  5LSL A;  2WSE C;  4RW4 A;  3W7B A;  5I4M A;  2N4D A;  2IDE A;  3GIL A;  3JS9 A;  4PCQ A;  2H54 B;  3DLJ A;  2IMO A;  2C2N A;  1EET B;  3K5M A;  4ZPB A;  5IZH A;  2VZ9 A;  3W2W B;  3M32 B;  1NPK A;  3DOK A;  2XCO A;  4GTF A;  1SQE A;  2RIJ A;  2Y0S D;  1ZPV A;  5D4P A;  3PIP Q;  2LQ9 A;  1I6H C;  1UKU A;  2FDN A;  1MNE A;  1GE9 A;  5C42 B;  5FDL A;  5KFO A;  2RDD A;  4B9N A;  2HRY A;  2EC2 A;  2JJ4 D;  4J9Q A;  2DGT A;  1F1B B;  1YX2 A;  1KSP A;  1S76 D;  2V50 A;  4I6Y A;  3DC2 A;  2XI3 A;  5KFD A;  2PFD A;  2D3U A;  2GX8 A;  2FHM A;  3S16 K;  1U1M A;  2OI2 A;  4KPC A;  3ZTQ A;  3KHG A;  3Q8S B;  4DPU A;  2AZ3 A;  1DQA A;  4MYU A;  4ZVO B;  2LEA A;  3ET6 B;  3OUY B;  5I3U A;  1U24 A;  5F8H A;  1FX4 A;  4CLL A;  3KHR A;  1QM9 A;  3SDE B;  4CH1 A;  5M2R A;  4DZD A;  3CDA A;  3FOF A;  5IYC C;  5E0O A;  1U1N A;  1R0A B;  2YKP A;  3M05 A;  2DNP A;  4DXL A;  1KTV A;  3M8P B;  3GG1 A;  1SH2 A;  1GEH A;  3M3Y C;  3FOE A;  4MJK A;  4JI2 J;  4NOI A;  4TQS A;  1JJ2 R;  3AD7 C;  2GVZ B;  3S16 C;  1SVD A;  2I8E A;  3PEJ A;  1U1P A;  3DOL B;  2KYZ A;  4N47 A;  5C44 K;  4MAK A;  2B9W A;  1TKZ A;  2J8A A;  3J7Y I;  1Y1W C;  4NLV A;  1TFY A;  2YU9 C;  4CT9 A;  2EG1 A;  1FJ7 A;  2JA6 A;  2GCF A;  1XXC A;  1FK9 B;  4KE5 A;  4USU A;  3QT8 A;  2HGM A;  3HFK A;  1R6Y A;  3CCL S;  1IWG A;  1QJH A;  4OJ1 A;  3MDF A;  1WKL A;  2A6O A;  4OYP A;  5IYD C;  2IIH A;  3MPY A;  1S7I A;  3GJR B;  2MEW A;  3BKF A;  3F44 A;  2B63 A;  2MST A;  2YXL A;  2IAJ B;  2PA8 D;  3GTJ A;  3SQG A;  1L3V A;  3B8H A;  1C0U B;  5JVG Q;  2HKE A;  5HVH A;  1PO6 A;  2XCR B;  4QU6 A;  4I7F B;  2PMZ L;  1YJU A;  4OJH A;  3OTO F;  3IS9 B;  3SXL A;  2CG8 A;  2C3P A;  2DRD A;  3VGV A;  4LRE A;  3CDE A;  3RZO C;  2E7W A;  2H4Y B;  4PYD A;  4QOT A;  2H4W B;  4IRK A;  5E33 A;  3SQG B;  3TAN A;  2ZD1 B;  1H38 A;  2EWH A;  3K17 A;  4B9U A;  4FXV A;  1KFD A;  4LFB J;  4QIV A;  4LSZ B;  4LF5 J;  3HCX A;  4CO2 A;  4LQ3 A;  3DXB A;  4ZPD A;  4RPF A;  1R0B G;  4LRB A;  2DR6 A;  3VR1 A;  4YEA A;  3PX0 A;  3HSD A;  4CO1 A;  3IXQ A;  3AXM A;  4ALZ A;  3C46 A;  1AB4 A;  1P27 B;  3KOA A; 
#chains in the Genus database with same CATH homology
 3AD8 C;  1WSR A;  3TFI A;  1VRQ C;  5L46 A;  2GAH C;  1X31 C;  1YX2 A;  1PJ5 A;  1WOP A;  3AD9 C;  3GEH A;  3AD7 C;  1WSV A;  4P9S A;  3TFH A;  3GSI A;  1V5V A;  1XZP B;  3A8K A;  3GIR A;  3GEI A;  1XZQ B;  3TTG A;  3A8I A;  1WOS A;  1XZQ A;  1VLO A;  1PJ6 A;  1XZP A;  4PAA A;  1PJ7 A;  2GAG C;  3GEE A;  1WOO A;  1WOR A;  3ADA C;  3TFJ A;  4PAB A;  3A8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...