1X31C

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sarcosine oxidase alpha subunit
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
total genus 51
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1x31C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1x31C01
1WSVA 3A8JA 3TFHA 1WOPA 3ADAC 3GIRA 1XZQA 5L46A 1V5VA 1PJ7A 1YX2A 3TFJA 3GEEA 1WOSA 3GEIA 3TFIA 1VRQC 4PAAA 1WOOA 3TTGA 3A8IA 2GAGC 1WORA 3AD7C 4P9SA 4PABA 1XZPB 3AD9C 1PJ6A 1XZPA 3AD8C 3A8KA 1VLOA 3GEHA 1WSRA 3GSIA 1XZQB 1X31C 1PJ5A 2GAHC
chains in the Genus database with same CATH superfamily
4ECZA 3NBPA 3K59A 2R7QA 4Y52C 4TY8A 3H90A 2KM8C 4A47A 3U02A 2FHJA 2QA1A 2UXDF 2QO3A 1X4BA 3J7YU 3DRRA 5DG8A 4K4XA 1R0AB 3NNAA 5L1KA 1XR5A 3QAUA 1LWFA 4A3BK 1KHWA 3M6VA 1SMYA 1NK0A 2J7UA 1AUDA 3MEDB 4OI1A 1HNXF 3CW2C 1S1WA 4ED8A 2CQPA 3IAM9 2CFAB 1FE0A 2XYHB 5AE2A 1UWAA 3OFFA 5J1NA 1TQLA 2HURA 2BW2A 2OFHX 3NNCA 1EH1A 3GTJC 2KL8A 1PC4A 4P73A 3EXCX 3KLVA 2KHCA 1WI6A 2PMWA 1RWVB 4P7TA 1NHKL 2N3OA 3SQOP 1S5ZA 2V8VA 3V6KA 3ENQA 1WUUA 4ENOA 1OYDA 1Q7YT 1D9FA 2QLBB 2VDIA 4CI0B 1QJHA 3Q2TC 4KMDA 2FVPA 3QAEA 3S2DK 4EK2A 2IDEA 1C1BA 1NJWA 4EMDA 2WB4A 4WXOA 3G71S 1S1VB 1JJ2R 1DTTA 1XMQF 1R0CB 2GAHC 1YITS 2O66A 2R92A 4JP8A 4DL2A 2OEKA 3KHLA 4ED6A 2CPZA 2OEJA 2DIVA 3VAFA 3H0GA 4E8UA 2JLGA 1I94F 2Y1LB 1VYAA 1JLBB 1RT1B 4QWDA 3CCES 3X3UA 2ROEA 4UF4A 2CJ9A 1HW9A 2PD1A 1F0XA 4I64A 1XNRF 5C4JC 1ITPA 2KFZA 3GFHA 4IR1A 3KUEA 3J80Y 4DG1A 2AJQA 1X5TA 1NK7A 4U6PA 2LVWA 1Z2ZA 2Z4PA 5JVHQ 4A8KA 4LK1A 2CDRB 2R92K 1X0FA 2UVUA 4CM2A 1FI4A 2V9KA 3R7BB 1FF2A 3GTPC 1VRQC 1NDLA 2QLWA 3CULA 1MROB 3M8PA 3TZZA 2YH0A 2PO4A 3E3XA 2K3IA 3JS9A 2NUHA 1U6ZA 4I67A 1GK8A 4XDDA 1LWXA 3CO0P 4IG0A 5D3GB 3JSYA 4F7VA 3TFJA 2ZJPQ 4P2XA 1S12A 2W2PP 3IGNA 1YTYA 3RB3A 3UE2A 4EU0A 4K0KJ 4IRDA 2JA7C 3D1OA 4I4BA 1HBNA 4ECVA 2XI2A 1JJCB 3QGHA 4LF2A 3CJ8A 3PZPA 1Y7PA 2JLEA 5KAKA 3DCAA 2L9DA 2KT2A 2VQEJ 3A13A 1KR4A 1TVRA 4PWDB 3SQGB 1V9OA 3NOGA 3BO4A 4DV1J 1N56A 5L9XA 3H8YA 3TZWA 4I7FB 2VFUA 4NLRA 1T0TV 3K5PA 2HVZA 1IUJA 3ILIA 4WBFA 2VODA 2CQCA 4DDQA 2RKIA 1KBRA 4H4OB 2W25A 1S9GA 4M5IA 2JC0A 3EMTA 1DFDA 2MKJA 1S1UB 1NEEA 4AQYF 2VUMK 2OPPA 2HFNA 4L76A 1OPIA 3FK4A 1LWEA 2OPQA 1Q8KA 1EETA 2DO0A 4J91A 3VQSA 2HHUA 5IYCK 2XSFA 1NSKL 1UPPA 5D6GA 4MK9A 3HHKA 2RDDA 3UN3A 2YNFA 1SUQA 4R0JA 2OP5A 2RJZA 3MEKA 2E7VA 2RRAA 2FZKB 2D7SA 4PQUB 2Y0SD 2V5HG 3G8QA 1Y11A 2DD8S 4NLTA 2RAQA 2JFDA 2B51A 2IAJA 4I6YA 3FOFA 2ZBPA 1OPZA 2RNEA 4BKWA 2GIRA 1KSPA 3MXHP 3BO3A 3BBFA 4HKQA 1WTFA 4C3HC 3GTMC 2HEKA 1SJ4P 2NS1B 1BE4A 1N34J 3MAQA 1WHWA 1AROP 4LRBA 1OWXA 3BQ2A 2BR0A 2Q1LA 5DM7Q 1FXDA 4ZLPA 4IFVB 3FEXB 2F8EX 2OTJS 1ICEB 4DR7F 1PSDA 2A6MA 1X60A 1HBUA 3I96A 2HYIB 4RW4A 4A8YA 2MQMA 4DR6J 2LU1A 4B3MF 4DPTA 2O5IA 1GX6A 4O3RA 2COLA 4C3JC 2WZ1A 4JI5J 5GAHI 1LXNA 4F4XA 2UV8G 3F0NA 3F41A 3KKFA 4Y6IA 3E01B 5DDPC 2UP1A 4ED5A 3TTGA 2KXFA 2DNQA 1PJ6A 4HDGA 1VQ5S 3M8QA 2ZUGA 2W9BA 3QATA 1LW0B 2DHAA 4DI6A 3GTLA 2O3DA 4DF4A 4KBIA 4QR1A 1HKAA 3KNAA 3ZNUA 1ACMB 3UCZP 2CQGA 4WXWA 5T7LA 1AFIA 4EO6A 1WCMK 4K4TA 3OTEA 3LAPA 3LA0A 4DSEA 4OMFG 4WFYA 4DLGA 3UNGC 3I56S 4Q4ZA 1NLKL 2LQ8A 4OYWA 1I6JA 1LFWA 4M5MA 3CDUA 2XO6A 2QLFB 3J7YI 2VB6A 2GCFA 3RB4A 4WF9Q 4FVMA 1XTZA 4BBRK 3V81B 2FHMA 2ZE2B 4A3CK 2V9WA 3W2WB 2GSNA 2R8KA 1NJZA 4M5LA 2JH3A 4WE1A 1CG2A 3GP9A 3CCVS 1TK0A 4H4KA 2LA6A 4KC6A 5BXIA 3VR1A 2E1AA 2VQFJ 3W3SA 2CVIA 2MJNA 2VHGA 3R8YA 3QMQA 3R6GB 4ZPBA 1OYEA 4LFBJ 2VL1A 3HHLD 3W7BA 1PCAA 1A9NB 3A4TA 3LPYA 1IVZA 1FKOA 4ID5B 4Y7NC 1DHMA 4DMZA 4ECWA 5C42B 5CA5A 4DFPA 1XNQJ 4J3NA 4K4VA 2D6FC 4NXNF 4XSXA 4I6AA 1VRUB 4UOGA 2IBKA 3TFHA 3BR9A 4C2MC 2M88A 4BXXK 5DLGA 4OJ3A 3IS9A 5IS2A 2OPSB 4NL5A 4MIBA 3UDLA 4FYDA 3CCRS 1FVQA 1XIQA 1N33F 5D8HB 1NSPA 3QT6A 3B54A 4ANCA 1HQUA 3MM6B 3L7UA 4DR1F 4EGLA 3FKIC 3CXCR 3K7AC 2H48B 2W9CA 3H0PA 1QY7A 4AL6A 3HOYK 4KB4A 1OS5A 1APSA 3D68A 1FRIA 1CJUB 3BDEA 1HPZB 3TAQA 1WSRA 1TKXB 2BABA 3RZOC 2GQ2A 1BUXA 5JXSA 3VTIA 3BF4A 1NRKA 3RB0A 1F3FA 3CDBA 1KN6A 1O27A 2DRAA 4QJVB 1S99A 4U7CA 5KFJA 4A46A 3PJXA 3QRQA 3Q8QB 4ELUA 4PR6A 4WP3A 3QX3A 3CCJS 3LP0B 4DUZF 1VR6A 3W5YA 4TY9A 1ZYRA 3BGRA 3CJRA 5E33A 2CYYA 3BREA 4WZMA 3VF0B 5F8LA 3IO1A 2CPYA 2G2ZA 3I87A 2CQDA 2DNGA 3VAIA 5D0GA 1S97A 2MMYA 2ZWOA 4R5PB 3M2RB 4B3OB 4CCHA 4N77A 3OXFA 3T41A 2WTFA 4ELVA 1U2RA 5ETOA 1S1TB 2HBQB 1WC6A 1Y10A 2DXDA 4OHYA 1VC6A 2ZFZA 3CNQP 4DV2F 4QW9A 1KNZA 3JTOA 2J8SA 2XZWA 3GTOC 2LXFA 4I6WA 2VA2A 3MEEB 3HKZL 2HFZA 2K2PA 3ILOA 1GMVA 1RWWB 3JQKA 3PW5A 4LF9J 5KFLA 2IFXA 4ZVFA 4E98A 1BHNA 1LWCB 2KB2A 4O3SA 3ILJA 1HBMA 1W25A 3CEDA 3G8SA 2WRMA 4GKJF 3IBWA 4HHUA 2F1FA 1WG4A 3KLHB 2Z0GA 4IFYB 3K5MA 3HDSA 4EEYA 4A3JC 4Y2MA 2NXCA 4U95A 2PA8L 4U67Q 2RE1A 2QV6A 3DMJA 1NK5A 2B8PA 4R8UA 4OI0A 2BKNA 3GFYA 4A3KC 4F3QA 3PW4A 2MGZA 5EWEA 2VBXA 1PILA 4KHPF 1TWFA 2C2RA 1VOMA 2OHDA 2R7XA 4OX8A 5DQIA 1TWHC 2PMHA 1R9TC 2HFUA 2XMJA 4DU7A 2RU9A 2GFFA 3PJWA 3NOCA 1JXLA 4KT0C 4FYVB 4RR5A 2P5MA 2YWGA 3NL0A 3KLGA 1U1MA 2EBBA 4C48A 4DL5A 3GJRB 2PI5A 3MM7B 1JNZB 9ATCB 1WHVA 2A6HA 5KFQA 4RJVA 2F65A 2P5VA 2FQOA 2ZZNA 2NVTK 4Q5VA 2WONB 4Y0FA 2LXUA 2J9DA 1KONA 4PUOB 3CSKA 1U1OA 3LF0A 4YB7A 3R7NB 3I32A 1FE4A 4LSLA 2LDYA 4EO8A 4OYXA 4F3MA 1XK8A 2JVRA 2DGVA 5J2QB 1G51A 1TFYA 2HHHJ 5DJBA 1IKXB 5KT5A 3V5RA 2E9TA 2AP6A 4CYUB 3OL8A 2DJWA 3MEGB 2WB1D 4JV1A 1UWBB 1IJEB 2E5JA 2UUBF 2Q6CA 1SC4B 2DVIA 5RUBA 3NRBA 4ILRA 5DDQC 3ULHA 4GKKJ 2KT3A 1QE1B 4GZYA 4O3NA 2BE5A 2WVEA 3DRYA 4B9LA 2NVQK 4GC6A 2V68A 4OYOA 1DQ9A 4X4UA 3DGPB 2NZCA 2CPDA 1VIOA 3LAMA 2V6TA 1MWYA 3TYTA 1TL1B 4DV7J 3TJ9A 2G2YA 4C8YA 1H74A 2A6EA 3KK3B 4G0VA 1NM2A 4RWXA 1MNEA 3OLBA 2VV5A 4BY1K 3GU0A 2KYXA 1SKWA 2XS2A 2VFTA 2I8EA 1JJ4A 2DPJA 2O01C 1R31A 1SC6A 4RX6A 2A2DA 5KFXA 4X64J 2AYBA 1Y5NB 3QO9B 4A3BC 3K57A 4DR3F 5M3FK 5ETSA 1JLCB 3TAMA 5IM0B 4C98A 5CAAA 2JA5A 5D4PA 4QYRA 3VAJA 2R7SA 4PZVA 2DH7A 4HLBA 2RU3A 2GHPA 2ATCB 2P8IA 1K47A 5I3PA 2XQCA 1I3OB 5ETRA 3R5BA 1T3NA 4DLEA 3PHEA 5IP7K 1SFOA 4P74A 5CYQB 3G82A 5GAGU 4F4AA 5F3ZA 3KJNB 1XR7A 3AB4B 1S0MA 1K73T 1M5VC 1XC9A 1AYEA 4G1QA 4M95A 2RQKA 3PO4A 2V6SA 2QLXA 3FDSA 1RHQB 3IP0A 2ZKTA 3S1NK 2VH7A 1H72C 2NXEA 3LWLA 4M1XA 1IKYB 3S2DC 4ZPWR 4KGXB 3O1LA 3VGVA 1IBMF 4B9MA 6FD1A 2Z2YB 4OIXA 1X7VA 1B3TA 2AEMA 4NWBA 3V2UC 4QWEA 4H4MB 4KQZA 4J9MA 4FF4A 5A2QU 4USHA 2P9EA 4KTQA 1R8PA 1WDTA 3ITHA 1GH8A 4JI2F 1U1LA 2ZH7A 5IORA 3CCTA 4OYBA 4F2SA 2AX0A 3M32B 1OIAA 1EARA 4MAKA 1VQLS 2R8HA 2N4DA 2GGPB 3GYXB 1YRUA 1CPZA 4OIPA 2R92C 3DLKA 4RW6A 1WEXA 2Q66A 1G1XA 3KK1A 2M3DA 4KPCA 2E5LF 1NB7A 3MHYA 4RUBA 1HQMA 5J1PA 2IMOA 3SV4A 3T5JA 3MM8B 4KB7A 3PM9A 2XGQA 3JB9k 2XNRA 5BYQA 3KMQA 3VWSA 2V4JB 1JQGA 1TV6A 3GIIA 5G0RA 4BC9A 3GV7B 2IRUA 1B0TA 3I4MK 3H5UA 1Q86T 1FA0A 3DOKA 3PG9A 2CNNB 3CC7S 1PYSB 1JLQA 5C44K 4MEXA 2IM0A 4DEZA 1DCOA 4L75A 4EYIB 2D1CA 3MM9B 1X4GA 5FDLA 1WELA 4XSZA 2M4MA 4X65J 4J9OA 2CVEA 2MY8A 1WKKA 3M7VA 3MM5A 4GFQA 3KK2A 3VCDA 1AW0A 4FBTA 1ZA2B 1VQSA 2BEFA 3FRZA 1TELA 5LXRA 3D5MA 4ZVPB 3W8PA 2GIFA 3MMAA 4LF5F 3V6DB 2B63K 2RRBA 2VUMC 2Z56B 1BQNA 3MPUB 1A6LA 3HOXK 5DQGA 2BJ3A 1HD0A 4U8YA 2X51A 1FD8A 3AA9A 5KFSA 1I6HC 3FOEA 2G1DA 3C16A 3P6YC 1EP4A 4PG8A 1FXRA 3RG6A 1VBKA 4MJKA 3T9NA 3OR1B 2FHKA 2ZWPA 2IC3B 3VZHA 2WVFA 2BUNA 3MECB 1HWJA 2Z2ZA 4KIAA 3O3LA 4QR2A 4QR0A 3ZFVA 3C46A 1T05A 5D4OA 4Q2LA 1SIWB 3MDFA 1U0HB 2EKNA 3H20A 4NMXA 3GR1A 4C9DA 3H3VD 4CO5A 8RUCA 1ELOA 1X4FA 3FZ2A 5IOSA 3JYTB 1J6VA 3EGVA 1B4BA 5CD4A 2E1MC 1SPBP 4J5OA 2CNLB 4J9VA 1PYOB 1TAQA 4J9KA 3UFCX 1DZ5A 2WK4A 4FS2A 2HRYA 2ILYA 3B4DA 1OY6A 2VFRA 1U47A 2PMZL 1P6TA 1RE1B 5ETNA 1EFWA 1F5CA 2BE2A 4ZS6A 4CIOA 5LXYA 4ZK7M 1J2VA 3DXJA 2ZVIA 4F04B 4LT6A 1CULA 1XZPA 3K17A 4NZ7A 3DLGB 2FJBB 2KFYA 3G6XA 2CWKA 2DGWA 2MSTA 4XPCA 2VG7A 1RTDA 2B56A 1U49A 3F56A 1USMA 5GAEU 2MQNA 2OJ3A 4DSKA 4ECUA 3M3YK 1WCMC 1UFKA 4CTAB 5H1SV 4ECYA 1PBAA 1UVKA 5J2MA 5IZHA 4HDHA 2XZTB 3IXQA 3RZAA 1FJCA 3PX4A 2LEPA 4M1KA 2NVXA 1RT6A 4LIRA 1ZM2A 4A3EK 1IKVA 2MZ1A 4NZ6A 4CQ1A 4BBRC 4ZIVA 3CJQA 1AT1B 2HHWA 4LR7A 4DL6A 5DETA 4A3CC 2QTWA 4WP9A 4JI4F 4Y3CA 5CD4H 3FMBA 2LU2A 3MUMP 1GMUA 2VG5A 3BSOA 4KAIA 2XO7A 1U48A 3T1YF 1QVGR 3NUHA 2YKOA 2G1HA 3EICA 3KLFA 2VPZB 1KQ4A 3CPWR 4UZCA 4ZP7A 1QSSA 1RA6A 3IGVA 1C4CA 3ONQA 2UUCF 1N6QA 2YNIA 5J2PA 2D3ZA 1SI9A 4FDFA 4YFKA 5GAGI 5KG4A 3MR6A 3PIOQ 3WX4A 3BM7A 1H98A 4DFJA 4I2PA 3DXSX 1SVDA 1UJ5A 2K1RB 3EGZA 2XLJA 1K8AT 3S1QC 1O5JA 4HVZA 5B0BA 1SC3B 3GYGA 2Q3PA 2W7VA 4X2BA 4BXXC 4HHHA 1GQEA 2AJ0A 2WSCC 3L9ZA 1EAYC 2Y1IA 5E68A 2JEGA 3VAMA 3G4AA 4KO0A 3HHLA 1YBUA 1W2IA 3HVWA 2XG8A 2CZVC 3LP1A 3WX8A 1M90T 1RT4A 3HX9A 5A8RB 2KJVA 4OINA 1T9WA 3TFIA 4USMA 1H2TZ 2JFKA 3RBDA 1T8EA 5HMYA 1P9YA 3SZYA 3W60A 4JYAF 3I5CA 2AEFA 4Q7AA 4KARA 1Y0HA 3M8YA 3HOYC 2E5HA 5EDWA 1I3QK 1JMTA 5HK4A 4L73A 3FCHA 4DUTA 1KOHA 1N0UA 3EQLA 1HQ2A 1NU4A 2KJWA 4KFBB 1N52B 1Y1VA 3OJUA 3FBBA 4DBQA 5HLFB 3HVTB 2OPRB 1RAIB 1U1PA 2XMAA 4YR2A 1NPKA 1JB0C 3QLHA 2E2HK 2Q79A 1KVKA 1ZZNA 1HNVA 1VJWA 1T9XA 1RB0A 3L4BC 4LIWA 2QL5B 5T14A 5C3EK 4MEYA 4AH6A 4J9SA 1RYSA 1TAUA 1XBWA 3C6TA 5LSRA 1FX2A 1GXTA 5AXKA 2D9PA 4O44B 1YDLA 5HJXA 5D4DA 4ECXA 3W9HA 1ZXOA 2YKMB 3DOMB 2ZH1A 5FJ4A 1Y1VK 1IBLJ 4ZN1A 1I1GA 3HHDA 5KFEA 3BGLA 4TU8A 2ZNYA 3WQPA 1GEHA 5C2CA 3TEHB 5HVHA 2HNZB 3IWXA 5D0RA 3HCXA 4NXMJ 1VH2A 1N5SA 5IFMA 2L9NA 3M4OK 2NVYA 4RW9A 2O1PA 5K14B 4I2QB 2L48A 4JI8F 3BB5A 4CT9A 2XNQA 2OSQA 3OQ2A 4ZA1A 5KT2A 1F2GA 2GC8A 3CD0A 1YRTA 4ATNA 4URSA 1BLUA 4JI7J 4JI6J 3PX0A 1TWCC 9RUBA 1YQHA 2DPIA 3R97A 3M9MB 3KG4A 2CPFA 4I56A 2PHCB 4NYZA 3B8HA 3KUGA 2OLWA 4DV0F 4DWIA 4P2MA 3V6HA 1RKJA 2QA4G 3A8KA 2PFDA 4BLBA 5IV3A 1X9WA 3TUIC 4OJ1A 4DZ6A 1QVFR 1T9VA 1YGYA 4ZJOA 1RT7B 3IAS9 4A3IC 2HQFA 3K8VA 4Y2CA 1ZAXA 3DI6A 1Y1WA 1HNZJ 2EC0A 2MHNA 1SJ3P 1UV7A 1SJQA 1VQPS 4USTA 3BPDA 3KDNA 3NWGA 4DFMA 5IYDK 4HACB 1JK9B 4F67A 4C3IK 3HOVC 5HP1B 5B09A 1YJ9S 3BKTA 4FPIA 3FBEA 2MQ8A 4K0KF 5LSLA 2I0XA 5E3CA 3EVOA 3MMCA 3PJ9A 5BR8F 3PX6A 3BBCA 3IWNC 2KT5A 4QPXA 1JKHB 2W4DA 2FVCA 2LMIA 3DLBA 3RBZA 4HHJA 2FVQA 3NBPB 4IDKA 3UO0A 1N36F 4PKDB 4KRWA 4TY8B 4ID8A 1Q79A 5KFFA 1FJGJ 2FLPA 3AD7C 1CVJA 4WJ3M 4U8VA 3DRRB 3SV3A 4F25A 3GTQK 2NVTC 4GO7X 3NGKA 2B9XA 4DUYF 1NH7A 1FDDA 2VDHA 4AUKA 2KTQA 5MAOA 1SJ1A 1QAJA 1LWFB 2HZAA 1EQMA 2IRYA 4C8OA 3GJSB 3A3PB 2QSWA 3N28A 4K7QA 1S1WB 2V67A 3H2LA 1HYSA 3EJMA 1S6PA 1JXVA 2W24A 4LBHA 2KU7A 5GAEI 2O67A 4U9RA 5U47A 1HI0P 4F3OA 5HROA 3Q24A 3CUNA 5DS7A 4TU7A 1OSDA 2M70A 4WFBQ 1FDBA 3NGRA 4P75A 2UUTA 2LEBA 1Q0NA 4X4PA 2MLZA 4OYZA 3V4MA 3CB4A 4MKYA 3UWTA 3PV8A 2BX6A 3PKMA 2FVSA 2YKPA 4NLYA 3OVSA 1UFLA 2NVQC 4K4ZA 1C1BB 2MKCA 1H38A 3C14A 4B9NA 4G7ZA 4W98A 1CJKA 1X4CA 4NCGA 1DTTB 5HQMA 4PYAA 4X4TA 5C4XK 2MLXA 4V1Ak 3FFIA 3CMAS 2DTJA 2QFIA 3JQMA 3HD1A 2OI2A 4BY1C 4MKVA 5C7PA 4MQ9A 1K83K 2XM3A 1S6OA 4WILA 2AZ3A 1VQYA 5F41A 4NOIA 1T9TA 4NRTA 2R2SA 4DR6F 3POTA 4RPFA 2FLLA 2HFVA 4M8LA 4OV6A 1NXIA 4DG1B 1AFJA 1D8ZA 4LF1A 1HNWF 4NASA 3JSTA 2IYGA 4NLWA 3PO5A 3K7RA 2VOOA 5KG3A 2LECA 4GMKA 3FUYA 3ZZZA 4A3GK 2D3OR 4DR4F 4KJIA 5E2QA 2F40A 1ZQ1C 3M8PB 2KG0A 5IP7C 4ZPAA 1U1QA 2H5IB 4LUBA 4WIQA 2F8HA 2X7IA 3QQCD 4IG0B 3OHBA 5KFNA 4C3KA 4K2JA 4KHMA 1H2VZ 1QM9A 1IQZA 3TJAA 1NPRA 2XGPA 2M8DB 4PXBA 5LMNF 1ZOTA 3S1NC 2ZEJA 1HBNB 1RT5A 2RMLA 4C8MA 3HO1A 4YR0A 5FLXY 1YHQS 3TI0A 2XWYA 2MLYA 4KMUA 4O2DA 5F0WA 2Y8WA 1TVRB 4MIAA 2RQMA 1RJJA 4L3NA 2VUGA 4J7CA 4FNIA 1Q81T 3Q8PB 1VGYA 1UP1A 1Y9OA 1WQFA 1G7CB 1UVMA 1CJTA 4IH6A 2J0XA 2ADBA 2OTLS 1F5BA 4DV5F 1WTBA 3QRPA 3W5XA 2UXCJ 1NHUA 3GTKK 1Q5VA 1Q7LB 1R7IA 3M1VA 2KZZA 2RKIB 1URNA 1S9GB 5E0OA 2F8MA 1YRXA 2NQPA 1SL1A 1JXEA 1H3DA 1ROFA 2EK6A 1TKTA 4MIWA 4LFBF 2OPPB 1T3OA 1U02A 1LWEB 2OPQB 1EETB 1SH0A 2MKYA 4UOCA 4UZBA 3SZ2A 4PG5A 2DY1A 3N3YA 2FZCB 3U1NA 1XNQF 2CPJA 3CCUS 3RR8A 2YNFB 3C66A 3OTBA 5AXMA 1WC0A 3D28A 4YDXA 1SUQB 4PXCA 1R8BA 3CJKA 4TLRA 4IOAQ 4AD6A 4WKYA 4DXLA 4LR9A 2HVHA 4KR0B 2C2MB 5M2RA 2XSJA 1NH8A 2PC6A 2IAJB 4QPTA 3K2YA 3G96A 4K4WA 4ZLJA 2HMIA 2FY8A 1VQNS 3M8ZA 3I4MC 1X4DA 3T9ZA 4X6AK 1RAEB 2Z58B 2E1RA 3LH2S 2VPXB 1YNJA 1S7IA 1JLEA 3R5DA 3D6FB 2JA6A 2ZD1A 2IRXA 3I6PA 8AT1B 5SZTA 2DO4A 2ZC3A 2V2VA 2XI3A 1NCLA 5CCLA 3Q0AA 4NX9A 1HBUB 1KS2A 2LCWA 3CJTA 4EZ6A 2FB0A 4NEZA 1R8AA 3K5LA 3GTYX 4N7TA 2DRDA 2APOA 3LO3A 3KG0A 2OD4A 2QYCA 2HFSA 2R7ZA 3SFUA 2AGOA 2Y1RI 3S14C 3ZZPA 1FKAF 4IOCQ 2B63C 2GHVC 2K3KA 1S77D 2JA6K 4WJ4A 1HHSA 3S17K 3M8QB 2W9BB 4B08A 3H59A 2R93K 2WW8A 3P96A 4C0BA 2GSUA 1MW7A 2UXDJ 1GTEA 2OIHA 1UA1A 1U1RA 3OL9A 5T7LB 1Z1ZA 1TFWA 5E3QA 2ZC4A 2XMMA 3M30A 2HHPA 4CLPA 3E2EA 4ED7A 2C2KB 2BW7A 2P9CA 1NSAA 1KLNA 3HM9A 3BEGB 5K8PA 4A8QA 4O0NA 4A3LK 1O26A 1JIHA 2CRLA 2UXBF 3I9ZA 1RHRB 2XMWA 2IBOA 4HL9A 2GMHA 1U6BA 1S10A 2HHVA 4RNHA 5KT6A 3BKFA 1TR0A 1YJVA 1L5UA 2BV3A 3OVAA 1F9HA 3CJ2A 5CHPA 4A3MK 1GMWD 4WE1B 4BS2A 2A6OA 2DHGA 2EW9A 1RGVA 3HP6A 2HGMA 1W2BR 5IOTA 1QSYA 1R6VA 2VC1A 1FNMA 3PYFA 4OI6A 5HBMA 4DV6F 1TTHB 1WC5A 3KJFB 4Y00A 3X1LB 2JDJA 3DLJA 2C3PA 4XAKA 4M5HA 3RBEA 3PHTA 4OYPA 1FKOB 3S2HK 1XMQJ 2BXJA 5CHCB 2RIJA 2HNYA 4J90A 1UMJA 2JX2A 4N56A 2HHSA 3VHQA 3MMJA 1EZZB 4A3DK 4ZP8A 2C3UA 4ANEA 3PRDA 2I38A 3IS9B 4X62F 4MFBA 1WG5A 3M3YC 1XNRJ 2E2IK 2I1RA 4F4WA 1V3SA 4OLOA 4ZN3A 4M5NA 2MXYA 3BQ1A 3S1MK 3CMQA 3HOZK 3M9OB 3HPOA 2ZUFA 1M5OC 4ETZA 4JI3F 1TP7A 2M9KA 1HQUB 2WSEC 4A3EC 2ZJQQ 3W5ZA 3R3TA 2VJUA 2RILA 4ZMMA 3J7Z5 3QZ8A 5ADZA 4F0HA 3PFEA 5AJ3F 3K89A 3CCQS 2W9CB 5F9LA 2XCOA 2AKWB 1T94A 3D3CJ 3N6MA 1RABB 2DYAA 1CS4A 3AD8C 3UI3A 3G4CA 1T9UA 4CLUA 1X31C 4USKA 1IR0A 1OY9A 5M3MK 3GB0A 1VLYA 2KZMA 1SBRA 3WIUA 3P4UB 4AXJA 2ILZA 3Q3QA 5KT7A 2BE7D 2V50A 3TARA 3GIMA 5BYRA 3S6EA 1I50A 4DCPB 1D0EA 1KVJA 1U0SA 2EFVA 3FQKA 2QMXA 3N0CA 4NYPA 4KGMA 3BGRB 1FVSA 1QD1A 5FIIA 1RA7A 2BE9B 3H98A 4KDDA 3CCSS 2K8GA 4YS2A 2J0WA 3SCJE 1GE9A 5HL7Q 3BGOP 1H0HB 3KDOA 5LSOA 4GTAA 2MSSA 5HSPA 4OLPA 2LQJA 2QIFA 3TUJC 1CLFA 1IM6A 3BSCA 4B3RF 3VAGA 4AQYJ 2ZOMA 1XERA 1L3TA 2K7JA 1KEKA 4ED2A 1FX4A 4UOFA 3IRXA 1RI7A 4HH0A 1MU2A 5GADI 1P1TA 3T6BA 4ZHRA 1K44A 3HHNB 5F8JA 3R5JB 2EFOA 2W9AA 2WB1L 4U7UD 3PNIA 3OR2A 1DY3A 3CWJA 2R7RA 3DYAA 2VA3A 2IJNA 3OSPA 1I3QC 4BY7C 1FJ7A 3I5AA 2Y3YA 4DL0C 4ES2A 2IVMA 2J0QD 2HRUA 4LRDA 4MKAA 1HBMB 4UOHA 3RW7A 4IR9A 1PAUB 5IP9C 5H9EJ 2HGLA 4LFCJ 4URGA 3S1RK 2E2HC 3S16K 4RWWA 4CRJA 1OSCA 1AB8A 4KC5A 3PEJA 3ZNJ1 1J5OA 3TQ1A 1ZTWA 1FD2A 1WDDA 2VD3A 2YNGA 4YY3F 5C3EC 4CLZA 2LYVA 1YBTA 3DMJB 2VG6A 4R8UB 2J6TA 2LA4A 2R7WA 4HT7A 4O3OA 5A8WA 4RNMA 2B7CB 1W26A 3SDEA 3HLUA 2MGZB 2PIIA 3PCOB 3EPGA 2WHOA 1SV5A 4DS4A 1RHMB 1EQ0A 2E66A 2OO4A 3R6LB 3NMAA 3B82A 1Q53A 5D15A 1KQSR 3M6XA 4PPZA 4UQGA 1RU1A 3M4OC 3OLAA 3KLGB 3P3DA 5K8OA 3PYDA 3KHGA 3CQZA 2GJIA 3VZIA 3T5KA 2NYHA 2ZH5A 1Q5YA 4EI2A 2ZJRQ 4IKAA 4EBCA 2IVFB 2Y1JA 1FWPA 2L3MA 1RBLA 4OX6A 1TWAK 1RK8A 2ZDOA 4ALZA 2IA6A 2R9LA 2H3EB 4OZLA 1SQEA 3N4WA 2GV1A 2QL9B 4DSIA 2MZSA 3MMLB 1B4SA 2HVEA 2FLNA 5C24A 4HEA9 4LSLB 1IBKF 4NE9C 1IN0A 2EBEA 3EUNA 1IW7A 3RBXA 5GMKa 4N5SA 8ATCB 3Q23A 1URRA 2B5JA 4X4NA 1SJFA 2MHEA 3LP2A 1T95A 2UVWA 2NXJA 2GO8A 3S7RA 2BRLA 2N3LA 3UD5A 5J1EA 1J5EF 5IYDC 3MFIA 2VBWA 4Q0BA 2N7YA 3MMBA 1C2PA 4C3IC 2JEIA 4JI1F 4CO0A 3KG1A 1C0TA 4ZLNA 5DGBA 2KYZA 1IJFB 4O4GA 5KG1A 1H7XA 3N6NA 3OPFA 3M05A 2YH1A 3DLLQ 2GS8A 4CWBA 2W4PA 5ETPA 2L9WA 3FEZA 4Q5SA 5M5WK 1EHWA 3H5YA 1X4HA 4KV8A 3OD2A 2HVDA 2Z8QA 2CUYA 5E3PA 1RWOB 5C5JA 2A68A 4KE5A 4XCHA 2ZH8A 4LMZA 2GQCA 4ZVSB 2EC2A 1X9MA 3UNYA 2QSFA 3H7HB 1RLDA 3CC2S 3MOZA 3GTQC 4BCAA 2HWIA 3W63A 5IXUA 2R8GA 3OFEA 5T41A 3CO9A 1XXAA 1G4CA 4RKUC 2RRNA 1N33J 1ZPWX 3TAMB 2XMTA 4ELTA 2CQHA 2QA4S 4ECTA 4LOWA 3QFWA 1UKUA 4DR1J 3GG1A 3W64A 1XXCA 2BDPA 4Y52K 3J7A1 4C8ZA 2ZUAA 4RUAA 1L3UA 1RWXB 2EFNA 3QWUA 2R3VA 5K8MA 3GYNA 4CO1A 2F4VJ 1PBUA 3GTJA 4TU9A 4KH1B 1RTHA 3TOQA 4TLQA 3L09A 3Q8SB 3G82B 2I2YA 2ASLA 2BKOA 2J9DE 4J9LA 2HS0A 3E51A 3W62A 1B70B 1RU2A 5B0CA 3S01A 4G1QB 3US5A 1ULRA 4KN7A 3GSDA 1BGXT 2UU9F 4QYZK 4OZJA 1OMSA 4N41A 1YZ7A 4RW8A 2NREA 4ZOSA 4KPYA 5ETKA 2RHSB 1RAJA 5KFZA 3RB6A 3EPIA 3C15A 4NA3A 4DUZJ 1HNIA 3AJ2A 2WOMA 3WBZA 3QNWB 4F0KA 2J76E 4GTBA 5C4XC 4B3TF 3Q22A 4KGVB 4RUHA 3M2VA 4O4RA 5DDRC 1A7GE 4LF8J 3ZZYA 3H0GK 4C3MA 1RT2A 1K83C 1PAEX 2R7TA 2DR9A 3AH5A 4G7HA 3JAMU 4RO0A 3ITHB 1FERA 1FRLA 3PFOA 2R42A 3J81U 1VQ7S 4CLKA 4GTCA 4FVCA 4GRSA 1FRMA 5HAOA 4DV2J 1R8HA 3NCRA 1FEEA 4WK1A 3MUVP 1PO6A 1O25A 2KI2A 2M0GB 3PXGa 4RNFA 4X4OA 3DLKB 4RW6B 4O0IA 3U1MA 4A3GC 1UPMB 2PA8D 3SIPB 4ZDNA 3H3VL 3KK1B 3A3OB 2ZH3A 4Y34A 4LSNA 4BWJA 2OMOA 3GTPA 5CCMA 2GZOA 3OTOF 2C28A 4MK8A 3CJ0A 4JV2A 3I4PA 4ITSA 2OAUA 2MEWA 5A0YA 2EG2A 2ADCA 4B9VA 5HANA 4GKJJ 1VGXA 1UEUA 2DISA 2MJUA 2R7UA 2FGCA 2RH6A 2JA7A 5EUHA 1TV6B 5G0RB 4IRKA 3ISND 2AD9A 2AEJA 3L4JA 2A2CA 1TUGB 1U1NA 2HBRB 3DOKB 2EG1A 1P27B 3UN5A 3PYEA 2F5GA 3HXAA 1JLQB 3WIVA 4KB2A 4G1IA 3DFEA 3GTPK 1C0UA 3EM1A 3G9CA 2HBYB 5FDLB 2VPWB 4MH8A 1NO8A 5BYSA 3VAHA 1RAAB 4RL1A 3MM5B 2RVJA 5D77A 4KHPJ 4YEAA 1F6TA 3GTKC 3KK2B 1H2UX 3UR3C 4CZCA 3BSAA 4TNOA 3HJVA 4PYDA 1U26A 4DX7A 4G3IA 1NSQA 4KHRA 4WIIA 1AB4A 2VFVA 1TZ0A 2V8DA 3MMAB 4QWCA 1N48A 1BQNB 2DEJA 2YNHA 3AA8A 3FCWA 2NR0A 2E1CA 1WI8A 1WF2A 4LSZB 2FGOA 3NXZA 2KDOA 3C16B 3BYRA 4HYKA 1EP4B 3GIKA 1M1GA 3EDRB 2OH2A 3T6JA 2EFQA 1X5SA 2H65B 4WFAQ 2HQIA 1RSCA 3VGSA 2Q43A 5I4MA 1PIEA 1CJVA 4N8NA 3J7ZT 1GAOA 1VHFA 4M5KA 4WCEQ 3OJSA 3ZZTA 4RNNA 5KG5A 3NY0A 4CH7A 5F8MA 1TL3A 1SH3A 2IM1A 3SI8A 5B0DA 3ILLA 3GILA 4YDDB 1T05B 1WC1A 3PO3C 3M6UA 3GTMA 4X6AC 1VJEA 1AUSL 2B6AA 3K5NA 4D3HA 1B7YB 2F9JA 2HK3A 5HQLA 1C1CA 4EBDA 5IT9Y 3GV5B 2UUBJ 2V2QA 3S0XA 4G1PA 1QTMA 2J9EA 4K4SA 4C0OC 1A0OB 3D4JA 4Z7CA 1O0PA 4B3SF 1HMVA 1SH2A 4OZNA 2ASDA 2RUGA 2MZRA 1M5KC 4FXWA 5KFHA 2BKPA 1YSJA 4XDCA 2BE2B 2HAIA 4C3HK 5HN0A 1UAWA 2AHOB 1FTCA 1IKWA 4LF4F 1RWPB 1T11A 1XMOF 2JA6C 5F8NA 1KFSA 3S17C 1CULB 1XZPB 2R93C 4LJMA 1WACA 5TJ3A 3GTLK 1RTDB 2VG7B 3G6VA 4BBSK 4NA1A 1Y5IB 1XQIA 2HQCA 4NYOA 1EB0A 4F2RA 4XO0A 3PW2A 4C3JK 1UA0A 3AOBA 2ZZTA 1FRHA 5A6PA 1N0VC 5J2MB 3KLIA 5AE1A 2BJDA 4OX7A 3QZ7A 3KUHA 1LK7A 1RT6B 2ZH4A 1W7WA 1IKVB 1F93A 2X1GA 3BBBA 2ZVSA 1KQFB 3M8WA 2CPEA 5KG7A 4W92B 1BDFA 5KT4A 2P8TA 3I4HX 2WVDA 1X8DA 5KFCA 1WF0A 1EX8A 2BACA 2DHHA 3PW0A 4JI6F 2VG5B 1NZ8A 3GDZA 3PDNA 2QN6B 1UW4A 2HNDA 3KLFB 3CCLS 2VJVA 5EX3A 1UTAA 3SCLE 4ZVRB 1TMMA 3IWLA 1EI6A 2GVDA 4XLNA 4X66F 3A12A 4ICLA 5L1IA 3VVUA 2QYGA 3TNVA 3AQPA 1N6QB 1IBMJ 2YNIB 5J2PB 1FDNA 2G0JA 4I68A 1DRZA 2GO9A 4RNOA 1J6XA 2DHSA 3TX8A 4F36A 1GMWA 3TA1A 3GZ7A 2NUUG 5M5YK 4I2PB 3IR6B 2LQ9A 4LFAF 2LKZA 2KHDA 1B64A 1P1LA 1DD5A 1O6XA 1NJIT 1O29A 5A8KA 3TX0A 2C3MA 4A3DC 3DHXA 3NGDA 1TL5A 4C2MA 3BZQA 2P9GA 2EI5A 3G4SS 4JI2J 2VBYA 4C11A 1TMJA 4F26A 3NG8A 4JBCA 4ZITA 2E2IC 2BVZA 4KO0B 3S1MC 3HHLB 3LP1B 2YY3A 4ZJQA 4ZLLA 4UUWA 1RT4B 2MYFA 4DS5A 3T1HJ 5IC4B 3HVAA 4OI2A 1XWLA 2KWAA 4K8RA 3EDQB 5B7WA 3TEGA 1VC5A 2CQBA 2Y3PA 4C3LA 4A3FK 3FKIA 2DEIA 3U27A 3JSMA 4DZDA 3W61A 4NLDA 1FJGF 1N5YA 4PXEA 1RKIA 3N79A 4DN9A 2HLTA 4IQMA 1DBDA 3LUYA 4OZ0A 3O44A 2C3OA 1S4EA 4FS1A 4P5BA 3BQ0A 1PG5B 3CC4S 1TL7A 1C4AA 1DJ0A 3QLHB 1HNVB 1HR0F 3KOAA 2V69A 3CIMA 3VALA 5IT4A 2C2ZB 3EXYA 1KQKA 2GA7A 3L4KA 3H2VE 2XHCA 3C6TB 1JLFA 5IV4A 2WSFC 2HWHA 3NS7B 1X9SA 4DL4A 2Z57B 4LF7J 2HHXA 3D9BA 5ITHA 5KFPA 2L41A 1IL2A 4KM9A 1UEKA 5EGHA 2BJEA 2EFGA 2YKNA 3MCMA 1RWKB 1X0PA 1F60B 4MYTA 4MYUA 2V4QA 3IR7B 2OSRA 1HL6A 4KSEB 5JVOA 4LF5J 2WCXA 3UCGA 4RW9B 3VVTA 1XXBA 5IQQA 3ZTOA 1KC8T 3A8JA 1ZM9A 1UVLA 3EZUA 2YQ1A 3E8OA 3TZXA 1PGZA 3GTOA 4DPWA 4OJHA 2HPUA 4YHHF 5DZ7A 4F0MA 2EXUA 4ED4A 2JZ5A 1Y3KA 4LVOP 4UY85 3MOJB 3TUPA 3FGVA 2XYPB 3D6MB 2RSQA 2ABYA 4WYLA 4JV5F 1XR6A 2J5AA 4GVBA 5FLMK 3B6BA 3NLCA 3I5BA 1KD1T 2H4WB 4FZVA 1RAFB 2LP4A 4EYHB 2VASA 3I31A 3FEYB 3GE9A 2QMUB 2XLIA 3S1RC 1RACB 3PRVA 1B7FA 4BDPA 3S16C 2GJ2A 3D1QA 4RUCA 5M2UA 4Q43A 4FYYB 4JB8B 2W2MP 1UVIA 3V4IA 2QX0A 4C0HA 3DI6B 2E44A 3NNHA 5CZVA 3C2PA 3KJVA 1U8WA 5I3UA 2X3DA 3I55S 4LF6F 4P52A 2FJEB 4Y2KA 1E6VA 2CQ3A 2CQ4A 2JA8C 1TWFK 2MDAA 4USUA 3CD5A 2F9DA 1TWHA 1R9TA 3MMCB 3S1TA 4RLEA 1REVB 2H4YB 3P45B 1WJ9A 2YBVA 1JLGA 2G4BA 3CVKA 4ETXA 4U7UK 2GIQA 1WIHA 4HH1A 4IDKB 4P2SA 1ZH5A 2I5JA 3NCQA 2MQPA 3DRSA 1DURA 2NXNA 3LW5C 5L9NA 4FNHA 2CZ9A 1VQ4S 3G87A 5KFOA 1TWAC 4G6VB 2VBZA 3GIRA 3I0RA 1HHTP 2UXCF 2MTLA 5L8RC 1QAIA 3QJJA 3K8WA 1ZYQA 5FD1A 3GJTB 1JLAA 4OI3A 1BMQB 2ZH2A 1HYSB 1IR1A 1OO0B 1S6PB 5GMDA 3BN4A 1UZHA 2L08A 3OT9A 5CJ9A 1N5VA 4DPUA 2FVRA 3DDIA 1I6VA 5KOXA 5HROB 4RU9A 3AODA 3TAPA 3HT3A 2N7CA 5KFVA 1X4EA 3JSBA 4IRCA 2RH3A 2EVZA 3T1YJ 1ZBSA 2DGOA 4J9UE 1LW2A 1XPPA 2EBGA 4LRFA 2FQQB 2FPHX 2UVRA 2GAGC 1IE0A 3SCIE 1FWKA 4JK1A 3ERED 3ZO7A 2DR6A 1F2HA 4ZVUB 2UUCJ 4LQ3A 1RU0A 3C14B 3NS6A 2B9WA 3RYLA 1CJKB 3ICLA 4NCGB 7FD1A 4AFFA 5CH7B 3GMGA 4A8MP 1C0AA 3ZTQA 3FFIB 5C25A 4X84A 1RWMB 2QL7B 4QW8A 1VQ9S 1H73A 1U2FA 5J2NA 3CE8A 2SXLA 3EZ5A 4OX9F 4QQBA 3P5TL 1IM4A 4ILDA 3MPDA 4P72A 3PEHA 3QJLA 3POTB 2GVZA 1CQNA 5LMUF 1YX2A 1FDAA 3AH6A 1KRPA 4PEOA 4DR5J 1YLXA 2JA5K 4NLSA 4F8RA 1BQMA 1VJQA 2DXFA 3EE3A 2B4OA 2K06A 5B0AA 1PJ7A 4JYAJ 1DCPA 4J9NA 1NBEB 4DQQA 3B78A 4DV3F 2BQUA 4J9PA 3P8BB 1SFOK 2DNYA 3FRYA 1MG7A 2VF3A 3ZC4A 1U45A 1WC4A 4NCAA 2GNKA 2OKQA 3IR5B 4EUVA 2VICA 2PEBA 2ZM6J 3N01A 4GC7A 2R2UA 3EVMA 2UUAF 1U2CA 1RT5B 3W65A 1MWZA 1YBAA 5JVGQ 1RCXB 3QRRA 2IM2A 1KTVA 3FHZA 2X1FA 2W4CA 3UQSA 3O2IA 2BZ2A 4WFNQ 1L3KA 2DNOA 2KN4A 1JJHA 4QU7A 2KVQE 2DY9A 3OTCA 4LRAA 2P2CB 4RBTA 2N4CA 4URQU 1CJTB 3BSNA 1JOEA 3H0GC 3DLEA 3AY0A 4DPOA 2KXNB 4V19X 4PABA 2JL9A 4X4QA 1EJ7L 3D0HE 2V6AA 2IJRA 3M1VB 1NK8A 2ZBCA 2D69A 5KFUA 3A3NB 1RT3A 4UUXA 2CAJA 2QJ3A 2Y8YA 1TKTB 4JI8J 4IOBA 2UUWA 3DU6A 6AT1B 1YJNS 1ZM4A 1E6YA 5L38A 3CD6S 1QDUB 1GNKA 4IH7A 5IWAJ 3MD1A 3HOWK 1HQEA 2VIHA 3L3CA 2ZUEA 3C6UA 2RQ4A 3CJKB 3W9JA 2RT3A 3NAHA 4DV0J 4OV1A 3M2UA 2FLOA 1VRTA 1P8GA 4IQXA 2NZ4A 3SMZA 4CNYA 1VQ6S 2V8GA 2XSJB 1R3NA 1YK9A 4JI0J 1R43A 4ZPVR 4X4SA 1NKBA 4K59A 2AGQA 2HMIB 2E7XA 3LTOA 2J8AA 1RHUB 2P6SA 1XJWB 2CNOB 1SQGA 2LLZA 1TK5A 3DRPA 4QU6A 3MR5A 3HZGA 1JLEB 2ZD1B 3UPFA 3IFEA 1YG0A 2KG1A 3KXDA 5FJ8K 3FC9A 2RUSA 3UCUP 5IYCC 1IQ0A 1F1BB 1IWGA 4E2FB 4OI4A 2ZBQA 4QWBA 2A1BA 1Z4UA 1DLOA 2GHWA 1ZBTA 5BR8J 3EWGA 2BOPA 2CFXA 1M5HA 4DSJA 4DQSA 1FKPA 1N36J 1SCJB 3OEPA 3TR5A 2CADA 3OVBA 2VUMA 4A93K 2XTJP 5JMNA 3RGIA 1GFWB 4EWTA 2NPFA 4CLSA 4YUDA 2OELA 3RAMA 1KOOA 2B9EA 3QYYA 5HMWA 1S0NA 2CIMA 2LXIA 3BO2A 5D78A 2CXEA 2QLJB 4DUYJ 3W66A 1G6BA 3M30B 1GTHA 4HTIA 1IBAA 1RLCL 3HI9A 3MAAA 4A8FA 2YX4A 2VONA 3PR4A 2G9OA 3H5XA 2VPYB 3TA0A 4KASA 4KM8A 3SZZA 1GXUA 3FMWA 3OXLA 5B0EA 1TKDA 3L7OA 4A8OA 1MMDA 2O5DA 2N82B 4NA2A 1NDCA 4CDIA 3QJPA 4NCBA 2GMLA 2ZBIA 4K4YA 1I6HK 5KFBA 3FCVA 2HFOA 1YJRA 2YPZA 1F5AA 3D66A 3PR5B 3C8YA 4CO3A 5DRKA 4WP8A 5HBMB 2BANA 1HIYA 2HRTA 4PQAA 3OUYA 1UZDA 3ET6A 1OQ3A 3QSYB 2XWXA 3GV8B 3BDPA 4BHQA 4LFCF 1S76D 4KYZA 1WQHA 1U09A 3TVZA 4ED0A 2YX1A 4QOTA 2HNYB 2GMJA 3OHAA 2FZGB 1QLNA 2FIUA 1SQFA 3GTLC 4BBSC 1K0VA 5ETVA 4TVAB 3GPAA 4CLFA 4GTFA 2GX8A 3QIPA 3BYPA 2V8PA 2RGRA 4MFBB 2HAFA 1Q1KA 4EBEA 1WCMA 2DKOB 4DV4J 1HNWJ 3CTRA 3PY8A 3N9UC 4AXIA 2NLWA 2ROPA 4FYXB 2RS8A 2M52A 4M5GA 5F0UA 2NVXK 1BWVA 4DR2F 2JHEA 2QT7A 1VQOS 4DR4J 1FNXH 4UY8T 2P6TA 4NLQA 3GSIA 2RF2A 2J7WA 2BQRA 2CNKB 2DITA 1T03A 2FQTA 5CYMA 4DDFA 2F3JA 3LGHA 2Z30B 2V6UA 1SB6A 3BKUA 4OJGA 3LPXA 1DQAA 1CS4B 4Y2AA 3M8RA 1S9EA 1UETA 1MN9A 4H4KC 3LGMA 2XY7A 4ECQA 4F02A 2U1AA 5LMNJ 4WTYA 2I9SA 4Q2MA 4FPRA 1FXLA 1KLMA 4HI2A 2V34A 3LAJA 3OPKA 1CEZA 1WOOA 2YWFA 4L3KA 1YVFA 3W2VA 3OTDA 5I42A 1AXQA 3I0SA 2WVCA 2DXEA 3DN9A 4QIWD 4M5DA 1M0SA 2R7OA 2QZ8A 2FYXA 3HK2A 2WAQD 4DV5J 1JNRB 1FK9A 3FSYA 4GO5X 1KFDA 3D54A 2CJQA 3BN7A 3D2WA 4KKOA 4P9SA 4OIRA 3HSGA 3RR7A 4DJBA 3DU5A 4PG4A 3DOLA 2IA0A 3IRXB 3MPWA 3HOUK 1MU2B 4ZHRB 4A3FC 1FESA 2ZNZA 3S1QK 3DHWC 3KWMA 5EN1A 2CA9A 3OR2B 1AZSA 3AQOA 2AWZA 2LDIA 4FP9A 4OYAA 4NLOA 3DYAB 1RYRA 2RDIA 5KG0A 1T02A 4ZIWA 1R89A 1X5OA 2QMWA 1X4AA 2MPUA 2FTRA 1OQ6A 3G6YA 3RRHA 1V5VA 3RRKA 3ENAA 1HBOA 2HQDA 1BC6A 1NNDA 3IN5A 4K5RA 1J5OB 5F8HA 2JSXA 3KJQB 3T3FA 2YNGB 2PDAA 1RTJA 2VG6B 3KNGA 2YX7A 1WOSA 2RD5C 2F4VF 1TKZA 5A8WB 2XULA 2QFJA 5ETLA 3IA0A 4TYAA 3SDEB 4WK3A 3T02A 1LFPA 1SV5B 2W7AA 4RW7A 4RU2A 4QIFA 3HSDA 2NCKL 1K1SA 4OZ2A 1S6QA 5ETMA 3KLEA 4NOHA 3UVJA 4ZVOB 2YPYA 4DF8A 3EVWA 2WVBA 5THWA 1G3OA 3HSZA 3IG1A 3MCOA 4MTPA 5HVFA 1VMBA 2W01A 2NVYK 1JQWA 4K50A 1DTQA 4PRFA 1XN9A 2W7OA 2ZOGA 1RQ0A 2EFPA 1FRKA 3UN2A 4WKRA 1LOUA 1Z2LA 1TWCA 2F4FA 4LF8F 4ZP9A 4B9TA 2JLFA 3KHRA 4IG3A 4DSFA 1I51B 2B0GA 2WW4A 4MKBA 1QAXA 5FLMC 2HZVA 2BRKA 1MMNA 5C24B 4NI2A 2UXBJ 3M9NB 4USWA 2OD6A 4AYBD 1D9DA 2XC9A 3EGNA 1KP6A 5AXNA 1FHTA 1U24A 4GTDA 2EPIA 2C1EB 2B5JB 4USVA 5DG7A 2H51B 2DNLA 3LP2B 2QC3A 1TWCK 1UEVA 4YP3A 4ZCKA 1F9NA 5DQHA 2VQEF 3OREA 2XMVA 3DM2A 1Y1WK 2IY5B 4DV1F 5LOQA 1FWLA 5J1EB 2DNNA 5BJRA 2R2TA 2IIHA 4Y28C 1YCLA 1NAQA 5D0EA 4Q0BB 3MMBB 2DGSA 4DV6J 1S79A 1IXKA 4OHWA 1XZQA 1C0TB 1TWFC 4O4GB 2DR8A 4C4WA 2A69A 2DCLA 2A18A 3ISZA 4PWWA 2AGPA 5EGYA 4FXDA 4A3IK 2B3TB 1HWIA 4KV8B 6FDRA 1HLWA 5KG2A 2KM8B 3IM8A 4CH1A 3T1AA 5LT5A 3J80U 5E41A 4ZJLA 1UVJA 4X62J 2QG9B 3PO2K 2QEXS 3IC1A 3HOVK 1N88A 2KO1A 4AE5A 3FBCA 4ZKAA 5KFAA 3NWRA 4JI3J 3HVRA 2JWNA 1SJRA 4IYQA 2C42A 3LWMA 4P6QA 2EKYA 2HKEA 4HTJA 2YWWA 3ENWA 2J0SD 3QWPA 3OL7A 1VQ8S 2Y9HA 2V63A 3THVA 5AJ3J 3NEKA 4K4UA 3D0IE 1Q8IA 4G0UA 1N32J 3Q86A 2C2NA 1RTHB 1VDHA 5GMEA 3TP2A 1N34F 3GFXA 1YJTA 2DR7A 1RADB 2B7BB 2FD2A 2PN6A 4USIA 4A8SA 1TUVA 7AT1B 4PPDA 4Z2XA 3GJQB 1RTIA 2YWKA 3QGPA 5IOQA 4RW8B 2Y0SL 1HARA 3ZZOA 2M2BA 4JI5F 2AZ1A 3DDKA 4YMEA 3RUBL 3TVYA 3C15B 1XMBA 2HS4A 3A8IA 1S1XA 3L7PA 1HNIB 2WOMB 4PG7A 4JV0A 1PJ5A 2PEHA 4LQ9A 3R7SB 1N5QA 3A8EA 3M2VB 3G86A 5LL6d 2JC1A 1RT2B 3N0BA 1R27B 1YI2S 1B0VA 1RDRA 4F50A 1NUEA 1B4AA 1AA1B 4ZVGA 1NJYA 3LAKA 1R0AA 1RBAA 4OIQA 1ISEA 5KFIA 2A0FB 4B3RJ 4B9UA 2B4UA 5ETTA 1VC0A 1WC3A 1LKZA 2XEXA 4LK0A 3MEDA 1WKJA 2JA5C 4WU3A 2E29A 2CQIA 4ZVTB 5KTQA 3CDAA 4ZVEA 1DCHA 4YFXA 1UW9A 2CFAA 4FKYA 4LSNB 4BBYA 1HI1A 3T19A 4JUZA 2AJFE 1SFOC 4FXVA 2OFGX 4GTLA 2G2OA 1HA1A 5A0YB 4KY3A 5KFRA 5AXLA 4C8LA 1M5SA 2AQ4A 3SSQA 2C3YA 5GADU 2CG4A 2VQFF 5HQ8A 4ED3A 1RAOA 2ATLA 4QIEA 4O3QA 1GX5A 3EZOA 2BJ7A 2CQ1A 1YZ6A 1NK9A 2HZCA 4YY3J 4DQRA 2R7VA 1C0UB 4A48A 1S1VA 2I6WA 4MK7A 3QT8A 4KAWX 3SXLA 4NLGA 3R2CJ 5JUMA 5KG6A 4A4JA 2NPIA 5K20B 3QT5A 4R0EA 3ELHA 4OIOA 4OFZA 3CJ5A 3Q8VA 3DLHA 2RQCA 2PA3A 2ZFHA 5IT9U 3HD2A 1JLBA 1RT1A 2HBZB 2H9ZA 1RXOB 3H4BA 1QUVA 2Y0BB 4DCOB 1CBKA 2YNHB 2BM0A 1YJUA 2VZ9A 2E5GA 5K8NA 2MQQA 5B08A 3AFGA 3GIJA 1DAXA 4P71A 4XPEA 2EK1A 1H6KX 2FHOB 2XYGB 5C44C 4DL7A 3QGGA 3O8WA 4YB5A 1K1QA 4DSLA 2R2RA 2R4FA 3U7JA 3T5LA 3HOWC 3MD3A 1MROA 4J9QA 3FKBA 1BWEA 2OMLA 3RRGA 3RZDK 1S49A 3C3LA 3CT9A 2JNJA 5D3GA 4RW4B 5KFTA 1CJVB 3W8GA 2JRSA 1FRXA 5KFGA 1IBKJ 1EIYB 1HI8A 1TL3B 5HJYA 4CLWA 1TU0B 3T1HF 2B4VA 2ACMA 4RZRA 3TW0A 3BH6B 2Z2LA 4W90B 2V2KA 2XCAA 1FNOA 2RDJA 4QIVA 2B6AB 5CXTA 1C1CB 3GTGA 3D67A 3DC2A 3HOXC 2BJ9A 4PCQA 4PWDA 3SQGA 2RS2A 1RP5A 1J5EJ 3ENVA 3KTQA 2IDLA 4ZVQB 5LJ5Y 4DX8H 5HL8A 1YWXA 3H2UB 4JI1J 2FJVA 2MKHA 4DFKA 4I7FA 2GW8A 2JVOA 2AW0A 2PPBA 3CIZA 1HMVB 1ZZFA 2BM1A 4NLXA 2BOAA 1YNNA 2R7ZK 1OY8A 1O2AA 1HNXJ 4H4OA 4S0MA 3M4XA 3SSRA 1CC8A 1IKWB 1S1UA 2E2JK 2B63A 3GTGK 4A93C 5DDOC 2E9ZA 1KQGB 3FBFA 3GONA 2RHQB 3GLJA 3JAMY 2MKIA 2XLKA 3J81Y 3OW2R 1NMEB 4DQIA 1IR2A 4LF7F 2DGQA 2B8QA 1OJ4A 3T5HA 4LF9F 3ISNC 4LQYA 3K0JA 4DPXA 4DPYA 3KLIB 3UDVA 2FJWA 2FC8A 4PQUA 3UD3P 2H54B 5B0GA 2BMBA 2GSOA 2HSEB 3S14K 3QFHA 3VQTA 1VBXA 3MTKA 1D8YA 3R27A 5IOLA 1FO1A 5DGAA 5HO4A 4C97A 1NKEA 1HD1A 1ZAWA 3GEEA 3QSIA 2MQLA 2MZJA 1ZAVA 4NRUA 2M7SA 1UCNA 4IFVA 2HNDB 3HKWA 1VS3A 3LGNA 3HFZB 1I94J 1VCTA 2OEMA 1CQMA 2UU9J 3T00A 1TUWA 4HT5A 4CO4A 2GVDB 5A76A 4N76A 4W4MA 1I5OB 4WZQA 4ICLB 5CZXA 3WHIA 3CAGA 2KH9A 2QA2A 3IRWP 5M5XK 2W8LA 1LV5A 4OHVA 1WSVA 3R5AA 4B17A 1WHXA 3E01A 5EHHA 4B3TJ 2XBPA 1NHVA 1Q4RA 2DNPA 4Y2IA 3MURP 1FJEB 1RUSA 2V94A 4WWSA 3CF5Q 1V3RA 5CQGA 5A8KB 3CDEA 1LW0A 3THTA 2MY7A 3R1LA 3VA7A 1KKHA 4B02A 5C2GA 3TQEA 2CJAA 1BS2A 3NP5A 1M5PC 4LR2A 3Q8UA 2V4RA 3IM9A 4C11B 1N5TA 3IPJA 4C45A 4OZ3A 2B9YA 1SIZA 4A8WA 4IUFA 2WBMA 2NVXC 2CPIA 1S0OA 3NKYA 3RU0A 3BGUA 1QTNB 1DQ8A 4I0WA 1Q16B 2AIRB 3FVYA 4FBUA 1IWAA 2HIQA 3JSMB 1UJ4A 5IYBK 3CJ3A 3AXMA 4KGZB 3V81A 3OTOJ 4G0WA 5DO2A 2M5YA 5IT0A 1N5YB 2MQOA 2HHHF 2ZE2A 3R2DJ 2W2OP 3W2WA 2PT0A 4CNZA 4PWUA 3ZTSA 4C8NA 4FF3A 2CQ2A 4OZ5A 4UQTA 4KGKA 2LQ5A 1TL7B 3AOCA 4ED1A 3TO8A 2CQ0A 3RW6A 5EGEA 1L3SA 2KFNA 2HWTA 2DNZA 2MZQA 2W1BA 2ASYA 1WQGA 4GKKF 5F9NA 1EQRA 3HXMA 3HZEA 1BJTA 2BJ8A 1I50K 3S15K 3QIDA 1K9MT 5CYJA 2HW3A 5HVGA 1JLFB 3OL6A 4ID5A 4DV7F 2AF6A 4AL5A 3GEIA 1U6FA 2CDQA 1WF1A 2VC0A 5C42A 3EX7B 3NS5A 4YB1P 3K58A 2KRRA 1NKCA 5KFYA 5GVQA 3J81j 1VRUA 4LBIA 2YKNB 5DLFA 2UVVA 2YKAA 4YQWA 2OPSA 3PIPQ 3R5GA 1GT8A 4X64F 2JOQA 3HHLC 1S4FA 1RBOB 1S57A 4GVLA 5H9FJ 2ROGA 2PE8A 2CWXA 3H25A 4FZBA 3NMRA 3BH7B 3I9V9 3GCWP 3OV7A 2XMKA 2D74B 4IO1A 2HIYA 2YU9A 3HOUC 3MM6A 2ZZMA 5E7OB 3CCWA 2VKZG 4KMHA 4OHZA 4L72B 1WKLA 3SEOA 4CM0A 3N5BA 1HWUA 1SKSA 3NGTA 1QUPA 4DR7J 4QWAA 1O2BA 1F7VA 2BQ3A 4I1TA 5AE3A 1CJUA 2JJ4D 1I3QA 3G2XA 2CJBA 4GVBB 1HPZA 1Y1VC 4NPOA 3Q8YA 4B3MJ 1TKXA 2CJXB 3KHHA 4HI1A 1EKSA 5TMCA 3DDNA 3KFWX 2YU9K 4DR5F 2E2HA 3I4NK 2QRRA 4QJVA 3TVKA 3RAXA 3O6QA 3BJYA 3GEHA 3R9LA 4LRCA 1O24A 4LLGA 1CSJA 4P5AA 3V4IB 1TWGA 1GXLA 3LP0A 1SKUB 3ZTPA 1WD6A 2ERRA 3KJVB 3S8SA 5I3UB 4FM9A 4BY7K 2H5EA 1VI7A 2D3UA 4TQSA 1E6VB 2X1BA 2KVIA 5E5NA 4PG6A 4B9SA 1B0PA 1NK6A 4B3SJ 2ZM6F 5IP9K 4R5PA 2FDNA 3J7AN 3M2RA 4B3OA 1ZS6A 3C19A 4TYBA 3MGJA 3Q8RB 1JLGB 3HJFA 4LF4J 2NVYC 1XMOJ 1S1TA 2R8JA 1YJWS 3CQZK 1TWGK 3IMQJ 2I5JB 4TN2A 4ER8A 1NZAA 3TUZC 3DRSB 4Y65A 4OYMA 4K5SA 3MEEA 1ZA1B 2EEYA 5M2PA 1WOPA 3I0RB 3NAIA 1FEHA 4RMFA 1LWCA 1VQKS 4P7VA 2O5JA 1RAGB 1JLAB 3TZYA 3D1HA 3I82A 3ZTRA 3V4GA 3BGFA 1SXLA 1U7LA 4KN4A 3MTJA 1S9FA 5EWFA 2ALZA 3D0GE 5K9FA 3BP3A 5KT3A 3KLHA 3BV8A 4IFYA 5SUHA 1INNA 2XHWA 1WG1A 3K5OA 1PKUA 3MI7X 1TK8A 4Q45A 4CLTA 1V6HA 1LW2B 1Y1WC 4NXNJ 2E1PA 5IWAF 3ETOA 2JEFA 4Q8EA 3R1HA 2HHTA 3IBCB 2FHJD 4X65F 4X66J 3OFGA 1T9YA 4YFNA 3L95X 2IMWP 1V3ZA 4JI0F 1L0WA 1DARA 3PKYA 2CZ4A 2MZTA 1FFGB 5ETQA 4FF2A 2U2FA 2DHXA 3BUEA 4LFAJ 5C25B 3H5SA 1HHQA 1HFEL 2DNRA 3MM7A 1XEZA 3MAHA 2IHR1 5J2NB 1R8CA 4UW2A 1B99A 3PO2C 3D7SB 2HGNA 3CJSA 3GTQA 1WWHA 4IO9Q 2GVZB 3UR0A 2WONA 3DGVA 4PUOA 2DBBA 5EX0A 2XCPA 5A6WA 2FJAB 3HFKA 1REVA 5LM7E 2W2NP 4UT4A 2QE5A 1BQMB 5HATA 1ZETA 1RCOB 3D6TB 3IBFB 4DU8A 5J2QA 1D1UA 4QBUA 2ZHOA 5EWGA 1IKXA 1Y4ZB 2CPXA 2YWEA 3FZBA 3HKZD 3GTJK 2KKHA 4R25A 2AJ4A 4LREA 3AXKA 3MCSA 2OGUA 4CYUA 2DNHA 3MEGA 3N5FA 4DX5A 4TXSA 1UWBA 4ES1A 3SYZA 2CPHA 3DNCA 2DR5A 2AJ1A 2YVSA 3HT0A 1QE1A 2AT1B 1HR0J 2CJKA 3JXOA 3MFHA 3DGPA 4V19J 2HK2A 3FNNA 2EWHA 3FSXA 4AL7A 1TL1A 1CC7A 3LPEA 1D09B 3F44A 1IQTA 3KK3A 5L1LA 3MR3A 1M1KT 3P5BP 3DLEB 3THPA 1FTRA 4QYZJ 3A1YG 4C7QA 5IQ6A 4YOEA 1K83A 3JTPA 3EGWB 3PVXA 3D3BJ 1G2EA 3GR0A 3PACA 4FYWB 4NZ0A 2NSBA 1MWQA 4ECRA 1RT3B 1TL4A 1UL3A 3QO9A 5C4JK 3JTNA 3U1LA 2ZOFA 3N0VA 3HMJG 5HMXA 3QBCA 1JLCA 4A8XA 5IM0A 4JOUA 4KH0B 1SC1B 2J6UA 1FFWB 4YHHJ 1E6YB 3WZ0A 2F7VA 3SCKE 2F63A 4CT8A 4QIGA 3FJ2A 1S48A 4WTOB 2DCUB 4OL8A 2V2ZA 1HQEB 3C6UB 1MN7A 3OSNA 4JV5J 3MPYA 3DKDA 2ZHAA 3M2UB 5CYQA 2BBEA 3ZZ0A 4X4VA 1VRTB 2A3JA 4ERDA 4LVNP 2AU0A 4Z37A 2MB0B 4MMOA 2QGFB 1HI9A 4DV4F 4CLYA 1Q8LA 5E3RA 4X4RA 2JA7K 2VOPA 3MR2A 5DG9A 1BXNA 1IKYA 2LQBA 1NB2A 2GQQA 3DRPB 4P2FA 3KMSA 5LJ3Y 3MF5A 2MKSA 3HFVA 3QGIA 3ZZRA 5IC6B 1D3WA 4H4MA 4LF6J 1WEYA 1VIXA 3CMES 1F9FA 1SKRA 4NLPA 2DNMA 1S59A 1JVIA 1DLOB 2DGTA 3GTKA 1BGWA 4OQJA 3GWCA 2YTCA 2XMUA 3D6HB 2D41A 2ZDPA 3VGTA 1P9QC 2DIUA 2HQ3A 4ZCIA 2VKRA 3M32A 1R6YA 1FKPB 3LQVA 4MT1A 1Q82T 3UD4P 4C6AA 4XTTA 3DXBA 1RWUA 2GGPA 1D9AA 4YR3A 2HQGA 2DGUA 1U4BA 2DK2A 4LBPA 1RHKB 4TKTA 3PW7A 1VK3A 2AYGA 1VFJA 2PGCA 2IVYA 4NEYA 1MSWD 1U8SA 4WU2A 5JFEA 2C22A 3G6ES 2XY6A 3MAAB 3RZDC 2HS3A 2MKKA 5CABA 3VAKA 1NK4A 2HLUA 3MM8A 3SBMA 1O28A 4CH0S 2KRBA 4USJC 2DRBA 1WNEA 4M5JA 2E9RX 1V5IB 2V4JA 3RAQA 4DN0A 4N8OA 3QT7A 2JEJA 2W2QP 1UVNA 2DH8A 4F4ZA 3G8TA 2G0IA 7FDRA 4QIWL 3GTMK 3AHPA 5A2QY 3CCZA 2WAQL 4GTEA 3SFGA 1PYTA 2E7WA 3TWZA 4Q44A 5KFKA 2E5IA 2K7KA 1RZMA 3MM9A 1YIJS 2NYIA 4DCJB 3ADAC 3O5TB 2BANB 3UDCA 3OUYB 1Y00A 2HHQA 1VK8A 1IBLF 3ET6B 4DR3J 4E0DA 2V8HA 5MLCV 2R7ZC 1Q95G 3PO3K 4NXMF 3ETMA 4A3LC 1JWWA 1FCAA 2RB7A 2CJYB 3FQLA 2E2JC 3WODA 4ZCLA 3V6DA 3GTGC 3Q2SC 2YKQA 1LQ9A 4PXDA 2R93A 5D4LA 4YN3B 3VGUA 2XY5A 2BJ1A 2AV5A 4BLGA 3CDWA 4OX9J 1KTQA 1NPPA 4XK8C 1FRJA 2ASJA 4CP5A 3QIPB 4DOZA 4JI7F 1ZTTA 4YB6A 4A3MC 1FT8A 4PAAA 2FUG9 3TRGA 2PSZA 4OYIA 1PC5A 5LMUJ 4Q8FA 3GQCA 3HULA 4I69A 3FSIA 1VBYA 3UW1A 5TMFA 5F3TA 2H1YA 2D3O1 3HSJA 3OR1A 3PYGA 3AOAA 1U25A 2IC3A 1KDNA 3TJ8A 3ZXWA 1RAHB 3MECA 4WFZA 4NMLA 2LEAA 1VBZA 1VLOA 2RF2B 2ZH9A 2BYCA 2CG8A 2HG4A 1T03B 1U0HA 5CYMB 4DV3J 3S2HC 2AYMA 5F8GA 2IM3A 2D9OA 4DQPA 1VISA 2ALYB 4DX6A 3JYTA 3N6LA 1S9EB 1IS1A 1H7WA 4G7OA 4ANDA 1HNZF 2G13A 1S72S 3WDOA 1HW8A 4BLAA 4BWMA 2V0NA 4CLLA 3BR8A 3JSRA 1BD6A 2UUAJ 1KLMB 4J9RA 4U96A 3BPSP 2YQ0A 4C8KA 4OZ1A 5F8IA 3HOZC 3W1YC 3VV2B 3W2VB 5I42B 1U1KA 4ZCMA 2ZH6A 1QAYA 3I0SB 3MR7A 5G4DA 2AX1A 1S7HA 4M5DB 4Y7NK 3MCNA 2POKA 5B0FA 1Q8BA 3CJ4A 4G65A 2ZHBA 3OFHA 2VU5A 2J7KA 1S0VA 3DLGA 2FJXA 2E5LJ 1SL2A 2DNKA 2C2OB 1FK9B 3WC2A 4C2MK 3Q83A 1LEOA 1HWLA 3UDEA 4KKOB 1KVIA 1UFWA 4CTAA 3EYZA 1Y3JA 3B4MA 2E2IA 4AYBL 4ECSA 4N47A 2FC9A 5D4NA 4D3GA 1M1HA 2DH9A 2UZAA 3DOLB 4RBUA 1O8BA 3W9IA 5KFWA 3V6JA 3M6WA 4WYWA 3P49B 1ZM3A 1RISA 2DGXA 3FKIK 1F3VA 5IYBC 3LOUA 2IYIA 3K7AK 4ZVHA 5L39A 1AZSB 5L46A 1ZVUA 2W8KA 1EKRA 1R0BG 4XLPA 1USOA 2AJ2A 3BP8C 1RWNB 5KFDA 2ZITA 5JJBA 2W7PA 2DB1A 3RJMB 3HHEA 1MMLA 2A10A 3AB2B 3RZOK 3NCPA 4QCLA 1N54B 3CD7A 1HBOB 4YFUA 4HR2A 2YWHA 5DM6Q 1I50C 3S15C 2CKWA 4L74A 2HVIA 2X3GA 4DHVA 2IJFA 1RTJB 3Q89A 2FJDB 1N32F 2XZDB 3MPVA 1TKZB 5I3QA 5E3AA 1N4LA 3H4DA 3H40A 2ACYA 2K1RA 5AT1B 1WHYA 4WJBA 3OXGA 4M63A 5HMZA 2NSCA 4ZPDA 4RW7B 1O51A 1IBCB 4UTGA 4CO2A 1S6QB 3KLEB 3UVJB 1S6UA 1WORA 3JQJA 3IG1B 3AJDA 1RTZA 1YJ7A 4Z7YA 3LALA 4IH5A 2PMZD 4H54A 1DTQB 1ZPVA 2XS5A 5A8RA 5KOWA 4EFAC 5L1JA 1BY9A 5H9FK 3GTOK 1SL0A 5H9EK 3PRBA 2AMCB 1UJ6A 3GG0A 4FF1A 4ILLA 1F7UA 1VQMS 4IG3B 1MLAA 4F4KA 2DT9A 4NLUA 1QSLA 1FFSB 4TQRA 5DZ6A 4NI2B 3NGUA 1X5PA 4KFBA 1T7PA 3SSSA 3KYLA 1YKWA 5HLFA 4FKXA 3HVTA 2OPRA 2YU9C 4ES3A 1NDPA 3BS9A 3I4NC 4FN5A 4J37A 4ZPCA 1J98A 1K0TA 4A3JK 1EK8A 5K5MA 1Q78A 3MUTP 3DM2B 1LK5A 2WBRA 4P10A 3ZZUA 2VFSA 4GT9A 4O3PA 3RTVA 3M8SA 1HWKA 4O44A 2FY1A 4ZPTR 2XB2D 4KMAA 4A3KK 2PI4A 2YKMA 4L6V3 3DOMA 4ZP6A 1XZQB 4ZH4A 4F4YA 2ZBRA 1WEZA 3GFZA 3MZIA 3CCMS 2B4PA 1TWHK 1R9TK 4EZ9A 2G0CA 2HNZA 3GCXP 2YXLA 1RHJB 4QZVB 1F9EB 1VHIA 2BA9A 3CQZC 1TWGC 5K14A 2C2EA 4I2QA 3H42A 1O2FB 4K2XA 3QPIA 2J6SA 4O23A 4BC7A 4AT1B 5HI7A 1REGX 4JI4J 4DL3A 3AD9C 4KATA 2Z2MA 3DRXA 2AYEA 4OHXA 3WC0A 3LANA 3CGIA 1J27A 1TWAA 2CW0A 2JA8K 4M94A 3PTWA 4XIUA 3AJ1A 4NLVA 3AT1B 2NXUA 3OBIA 1KHVA 4DR2J 2H5JB 2ZKUA 3T01A 4WPAA 2M8HA 4LR8A 4LJZA 2LFVA 2PFFB 2XS7A 2B43A 2Q6BA 1LNQA 1RT7A 1NJXA 4YG2A 5GAHU 5KFMA 2R8IA 4WFXA 2J9CA 2C2DA 2IPOB 5FLXU 1LXJA 2YQ3A 1Y5LB 1JX4A 3R5CA 1KWMA 1RTIB 3TA2A 2OUGA 3NGSA 4HACA 5HP1A 2KXHA 3HF5A 1L3VA 4RBVA 2UV8A 3AAWB 3TANA 1BQXA 2GJFA 4ILMA 1S1XB 1J6WA 5D0HA 3F73A 2XCRB 2X1AA 2XCQA 1NDKA 1JKHA 3MWBA 1N8RT
chains in the Genus database with same CATH topology
1WSVA 3A8JA 3TFHA 1WOPA 3ADAC 3GIRA 1XZQA 5L46A 1V5VA 1PJ7A 1YX2A 3TFJA 3GEEA 1WOSA 3GEIA 3TFIA 1VRQC 4PAAA 1WOOA 3TTGA 3A8IA 2GAGC 1WORA 3AD7C 4P9SA 4PABA 1XZPB 3AD9C 1PJ6A 1XZPA 3AD8C 3A8KA 1VLOA 3GEHA 1WSRA 3GSIA 1XZQB 1X31C 1PJ5A 2GAHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSV A;  3A8J A;  3TFH A;  1WOP A;  3ADA C;  3GIR A;  1XZQ A;  5L46 A;  1V5V A;  1PJ7 A;  1YX2 A;  3TFJ A;  3GEE A;  1WOS A;  3GEI A;  3TFI A;  1VRQ C;  4PAA A;  1WOO A;  3TTG A;  3A8I A;  2GAG C;  1WOR A;  3AD7 C;  4P9S A;  4PAB A;  1XZP B;  3AD9 C;  1PJ6 A;  1XZP A;  3AD8 C;  3A8K A;  1VLO A;  3GEH A;  1WSR A;  3GSI A;  1XZQ B;  1X31 C;  1PJ5 A;  2GAH C; 
#chains in the Genus database with same CATH topology
 4ECZ A;  3NBP A;  3K59 A;  2R7Q A;  4Y52 C;  4TY8 A;  3H90 A;  2KM8 C;  4A47 A;  3U02 A;  2FHJ A;  2QA1 A;  2UXD F;  2QO3 A;  1X4B A;  3J7Y U;  3DRR A;  5DG8 A;  4K4X A;  1R0A B;  3NNA A;  5L1K A;  1XR5 A;  3QAU A;  1LWF A;  4A3B K;  1KHW A;  3M6V A;  1SMY A;  1NK0 A;  2J7U A;  1AUD A;  3MED B;  4OI1 A;  1HNX F;  3CW2 C;  1S1W A;  4ED8 A;  2CQP A;  3IAM 9;  2CFA B;  1FE0 A;  2XYH B;  5AE2 A;  1UWA A;  3OFF A;  5J1N A;  1TQL A;  2HUR A;  2BW2 A;  2OFH X;  3NNC A;  1EH1 A;  3GTJ C;  2KL8 A;  1PC4 A;  4P73 A;  3EXC X;  3KLV A;  2KHC A;  1WI6 A;  2PMW A;  1RWV B;  4P7T A;  1NHK L;  2N3O A;  3SQO P;  1S5Z A;  2V8V A;  3V6K A;  3ENQ A;  1WUU A;  4ENO A;  1OYD A;  1Q7Y T;  1D9F A;  2QLB B;  2VDI A;  4CI0 B;  1QJH A;  3Q2T C;  4KMD A;  2FVP A;  3QAE A;  3S2D K;  4EK2 A;  2IDE A;  1C1B A;  1NJW A;  4EMD A;  2WB4 A;  4WXO A;  3G71 S;  1S1V B;  1JJ2 R;  1DTT A;  1XMQ F;  1R0C B;  2GAH C;  1YIT S;  2O66 A;  2R92 A;  4JP8 A;  4DL2 A;  2OEK A;  3KHL A;  4ED6 A;  2CPZ A;  2OEJ A;  2DIV A;  3VAF A;  3H0G A;  4E8U A;  2JLG A;  1I94 F;  2Y1L B;  1VYA A;  1JLB B;  1RT1 B;  4QWD A;  3CCE S;  3X3U A;  2ROE A;  4UF4 A;  2CJ9 A;  1HW9 A;  2PD1 A;  1F0X A;  4I64 A;  1XNR F;  5C4J C;  1ITP A;  2KFZ A;  3GFH A;  4IR1 A;  3KUE A;  3J80 Y;  4DG1 A;  2AJQ A;  1X5T A;  1NK7 A;  4U6P A;  2LVW A;  1Z2Z A;  2Z4P A;  5JVH Q;  4A8K A;  4LK1 A;  2CDR B;  2R92 K;  1X0F A;  2UVU A;  4CM2 A;  1FI4 A;  2V9K A;  3R7B B;  1FF2 A;  3GTP C;  1VRQ C;  1NDL A;  2QLW A;  3CUL A;  1MRO B;  3M8P A;  3TZZ A;  2YH0 A;  2PO4 A;  3E3X A;  2K3I A;  3JS9 A;  2NUH A;  1U6Z A;  4I67 A;  1GK8 A;  4XDD A;  1LWX A;  3CO0 P;  4IG0 A;  5D3G B;  3JSY A;  4F7V A;  3TFJ A;  2ZJP Q;  4P2X A;  1S12 A;  2W2P P;  3IGN A;  1YTY A;  3RB3 A;  3UE2 A;  4EU0 A;  4K0K J;  4IRD A;  2JA7 C;  3D1O A;  4I4B A;  1HBN A;  4ECV A;  2XI2 A;  1JJC B;  3QGH A;  4LF2 A;  3CJ8 A;  3PZP A;  1Y7P A;  2JLE A;  5KAK A;  3DCA A;  2L9D A;  2KT2 A;  2VQE J;  3A13 A;  1KR4 A;  1TVR A;  4PWD B;  3SQG B;  1V9O A;  3NOG A;  3BO4 A;  4DV1 J;  1N56 A;  5L9X A;  3H8Y A;  3TZW A;  4I7F B;  2VFU A;  4NLR A;  1T0T V;  3K5P A;  2HVZ A;  1IUJ A;  3ILI A;  4WBF A;  2VOD A;  2CQC A;  4DDQ A;  2RKI A;  1KBR A;  4H4O B;  2W25 A;  1S9G A;  4M5I A;  2JC0 A;  3EMT A;  1DFD A;  2MKJ A;  1S1U B;  1NEE A;  4AQY F;  2VUM K;  2OPP A;  2HFN A;  4L76 A;  1OPI A;  3FK4 A;  1LWE A;  2OPQ A;  1Q8K A;  1EET A;  2DO0 A;  4J91 A;  3VQS A;  2HHU A;  5IYC K;  2XSF A;  1NSK L;  1UPP A;  5D6G A;  4MK9 A;  3HHK A;  2RDD A;  3UN3 A;  2YNF A;  1SUQ A;  4R0J A;  2OP5 A;  2RJZ A;  3MEK A;  2E7V A;  2RRA A;  2FZK B;  2D7S A;  4PQU B;  2Y0S D;  2V5H G;  3G8Q A;  1Y11 A;  2DD8 S;  4NLT A;  2RAQ A;  2JFD A;  2B51 A;  2IAJ A;  4I6Y A;  3FOF A;  2ZBP A;  1OPZ A;  2RNE A;  4BKW A;  2GIR A;  1KSP A;  3MXH P;  3BO3 A;  3BBF A;  4HKQ A;  1WTF A;  4C3H C;  3GTM C;  2HEK A;  1SJ4 P;  2NS1 B;  1BE4 A;  1N34 J;  3MAQ A;  1WHW A;  1ARO P;  4LRB A;  1OWX A;  3BQ2 A;  2BR0 A;  2Q1L A;  5DM7 Q;  1FXD A;  4ZLP A;  4IFV B;  3FEX B;  2F8E X;  2OTJ S;  1ICE B;  4DR7 F;  1PSD A;  2A6M A;  1X60 A;  1HBU A;  3I96 A;  2HYI B;  4RW4 A;  4A8Y A;  2MQM A;  4DR6 J;  2LU1 A;  4B3M F;  4DPT A;  2O5I A;  1GX6 A;  4O3R A;  2COL A;  4C3J C;  2WZ1 A;  4JI5 J;  5GAH I;  1LXN A;  4F4X A;  2UV8 G;  3F0N A;  3F41 A;  3KKF A;  4Y6I A;  3E01 B;  5DDP C;  2UP1 A;  4ED5 A;  3TTG A;  2KXF A;  2DNQ A;  1PJ6 A;  4HDG A;  1VQ5 S;  3M8Q A;  2ZUG A;  2W9B A;  3QAT A;  1LW0 B;  2DHA A;  4DI6 A;  3GTL A;  2O3D A;  4DF4 A;  4KBI A;  4QR1 A;  1HKA A;  3KNA A;  3ZNU A;  1ACM B;  3UCZ P;  2CQG A;  4WXW A;  5T7L A;  1AFI A;  4EO6 A;  1WCM K;  4K4T A;  3OTE A;  3LAP A;  3LA0 A;  4DSE A;  4OMF G;  4WFY A;  4DLG A;  3UNG C;  3I56 S;  4Q4Z A;  1NLK L;  2LQ8 A;  4OYW A;  1I6J A;  1LFW A;  4M5M A;  3CDU A;  2XO6 A;  2QLF B;  3J7Y I;  2VB6 A;  2GCF A;  3RB4 A;  4WF9 Q;  4FVM A;  1XTZ A;  4BBR K;  3V81 B;  2FHM A;  2ZE2 B;  4A3C K;  2V9W A;  3W2W B;  2GSN A;  2R8K A;  1NJZ A;  4M5L A;  2JH3 A;  4WE1 A;  1CG2 A;  3GP9 A;  3CCV S;  1TK0 A;  4H4K A;  2LA6 A;  4KC6 A;  5BXI A;  3VR1 A;  2E1A A;  2VQF J;  3W3S A;  2CVI A;  2MJN A;  2VHG A;  3R8Y A;  3QMQ A;  3R6G B;  4ZPB A;  1OYE A;  4LFB J;  2VL1 A;  3HHL D;  3W7B A;  1PCA A;  1A9N B;  3A4T A;  3LPY A;  1IVZ A;  1FKO A;  4ID5 B;  4Y7N C;  1DHM A;  4DMZ A;  4ECW A;  5C42 B;  5CA5 A;  4DFP A;  1XNQ J;  4J3N A;  4K4V A;  2D6F C;  4NXN F;  4XSX A;  4I6A A;  1VRU B;  4UOG A;  2IBK A;  3TFH A;  3BR9 A;  4C2M C;  2M88 A;  4BXX K;  5DLG A;  4OJ3 A;  3IS9 A;  5IS2 A;  2OPS B;  4NL5 A;  4MIB A;  3UDL A;  4FYD A;  3CCR S;  1FVQ A;  1XIQ A;  1N33 F;  5D8H B;  1NSP A;  3QT6 A;  3B54 A;  4ANC A;  1HQU A;  3MM6 B;  3L7U A;  4DR1 F;  4EGL A;  3FKI C;  3CXC R;  3K7A C;  2H48 B;  2W9C A;  3H0P A;  1QY7 A;  4AL6 A;  3HOY K;  4KB4 A;  1OS5 A;  1APS A;  3D68 A;  1FRI A;  1CJU B;  3BDE A;  1HPZ B;  3TAQ A;  1WSR A;  1TKX B;  2BAB A;  3RZO C;  2GQ2 A;  1BUX A;  5JXS A;  3VTI A;  3BF4 A;  1NRK A;  3RB0 A;  1F3F A;  3CDB A;  1KN6 A;  1O27 A;  2DRA A;  4QJV B;  1S99 A;  4U7C A;  5KFJ A;  4A46 A;  3PJX A;  3QRQ A;  3Q8Q B;  4ELU A;  4PR6 A;  4WP3 A;  3QX3 A;  3CCJ S;  3LP0 B;  4DUZ F;  1VR6 A;  3W5Y A;  4TY9 A;  1ZYR A;  3BGR A;  3CJR A;  5E33 A;  2CYY A;  3BRE A;  4WZM A;  3VF0 B;  5F8L A;  3IO1 A;  2CPY A;  2G2Z A;  3I87 A;  2CQD A;  2DNG A;  3VAI A;  5D0G A;  1S97 A;  2MMY A;  2ZWO A;  4R5P B;  3M2R B;  4B3O B;  4CCH A;  4N77 A;  3OXF A;  3T41 A;  2WTF A;  4ELV A;  1U2R A;  5ETO A;  1S1T B;  2HBQ B;  1WC6 A;  1Y10 A;  2DXD A;  4OHY A;  1VC6 A;  2ZFZ A;  3CNQ P;  4DV2 F;  4QW9 A;  1KNZ A;  3JTO A;  2J8S A;  2XZW A;  3GTO C;  2LXF A;  4I6W A;  2VA2 A;  3MEE B;  3HKZ L;  2HFZ A;  2K2P A;  3ILO A;  1GMV A;  1RWW B;  3JQK A;  3PW5 A;  4LF9 J;  5KFL A;  2IFX A;  4ZVF A;  4E98 A;  1BHN A;  1LWC B;  2KB2 A;  4O3S A;  3ILJ A;  1HBM A;  1W25 A;  3CED A;  3G8S A;  2WRM A;  4GKJ F;  3IBW A;  4HHU A;  2F1F A;  1WG4 A;  3KLH B;  2Z0G A;  4IFY B;  3K5M A;  3HDS A;  4EEY A;  4A3J C;  4Y2M A;  2NXC A;  4U95 A;  2PA8 L;  4U67 Q;  2RE1 A;  2QV6 A;  3DMJ A;  1NK5 A;  2B8P A;  4R8U A;  4OI0 A;  2BKN A;  3GFY A;  4A3K C;  4F3Q A;  3PW4 A;  2MGZ A;  5EWE A;  2VBX A;  1PIL A;  4KHP F;  1TWF A;  2C2R A;  1VOM A;  2OHD A;  2R7X A;  4OX8 A;  5DQI A;  1TWH C;  2PMH A;  1R9T C;  2HFU A;  2XMJ A;  4DU7 A;  2RU9 A;  2GFF A;  3PJW A;  3NOC A;  1JXL A;  4KT0 C;  4FYV B;  4RR5 A;  2P5M A;  2YWG A;  3NL0 A;  3KLG A;  1U1M A;  2EBB A;  4C48 A;  4DL5 A;  3GJR B;  2PI5 A;  3MM7 B;  1JNZ B;  9ATC B;  1WHV A;  2A6H A;  5KFQ A;  4RJV A;  2F65 A;  2P5V A;  2FQO A;  2ZZN A;  2NVT K;  4Q5V A;  2WON B;  4Y0F A;  2LXU A;  2J9D A;  1KON A;  4PUO B;  3CSK A;  1U1O A;  3LF0 A;  4YB7 A;  3R7N B;  3I32 A;  1FE4 A;  4LSL A;  2LDY A;  4EO8 A;  4OYX A;  4F3M A;  1XK8 A;  2JVR A;  2DGV A;  5J2Q B;  1G51 A;  1TFY A;  2HHH J;  5DJB A;  1IKX B;  5KT5 A;  3V5R A;  2E9T A;  2AP6 A;  4CYU B;  3OL8 A;  2DJW A;  3MEG B;  2WB1 D;  4JV1 A;  1UWB B;  1IJE B;  2E5J A;  2UUB F;  2Q6C A;  1SC4 B;  2DVI A;  5RUB A;  3NRB A;  4ILR A;  5DDQ C;  3ULH A;  4GKK J;  2KT3 A;  1QE1 B;  4GZY A;  4O3N A;  2BE5 A;  2WVE A;  3DRY A;  4B9L A;  2NVQ K;  4GC6 A;  2V68 A;  4OYO A;  1DQ9 A;  4X4U A;  3DGP B;  2NZC A;  2CPD A;  1VIO A;  3LAM A;  2V6T A;  1MWY A;  3TYT A;  1TL1 B;  4DV7 J;  3TJ9 A;  2G2Y A;  4C8Y A;  1H74 A;  2A6E A;  3KK3 B;  4G0V A;  1NM2 A;  4RWX A;  1MNE A;  3OLB A;  2VV5 A;  4BY1 K;  3GU0 A;  2KYX A;  1SKW A;  2XS2 A;  2VFT A;  2I8E A;  1JJ4 A;  2DPJ A;  2O01 C;  1R31 A;  1SC6 A;  4RX6 A;  2A2D A;  5KFX A;  4X64 J;  2AYB A;  1Y5N B;  3QO9 B;  4A3B C;  3K57 A;  4DR3 F;  5M3F K;  5ETS A;  1JLC B;  3TAM A;  5IM0 B;  4C98 A;  5CAA A;  2JA5 A;  5D4P A;  4QYR A;  3VAJ A;  2R7S A;  4PZV A;  2DH7 A;  4HLB A;  2RU3 A;  2GHP A;  2ATC B;  2P8I A;  1K47 A;  5I3P A;  2XQC A;  1I3O B;  5ETR A;  3R5B A;  1T3N A;  4DLE A;  3PHE A;  5IP7 K;  1SFO A;  4P74 A;  5CYQ B;  3G82 A;  5GAG U;  4F4A A;  5F3Z A;  3KJN B;  1XR7 A;  3AB4 B;  1S0M A;  1K73 T;  1M5V C;  1XC9 A;  1AYE A;  4G1Q A;  4M95 A;  2RQK A;  3PO4 A;  2V6S A;  2QLX A;  3FDS A;  1RHQ B;  3IP0 A;  2ZKT A;  3S1N K;  2VH7 A;  1H72 C;  2NXE A;  3LWL A;  4M1X A;  1IKY B;  3S2D C;  4ZPW R;  4KGX B;  3O1L A;  3VGV A;  1IBM F;  4B9M A;  6FD1 A;  2Z2Y B;  4OIX A;  1X7V A;  1B3T A;  2AEM A;  4NWB A;  3V2U C;  4QWE A;  4H4M B;  4KQZ A;  4J9M A;  4FF4 A;  5A2Q U;  4USH A;  2P9E A;  4KTQ A;  1R8P A;  1WDT A;  3ITH A;  1GH8 A;  4JI2 F;  1U1L A;  2ZH7 A;  5IOR A;  3CCT A;  4OYB A;  4F2S A;  2AX0 A;  3M32 B;  1OIA A;  1EAR A;  4MAK A;  1VQL S;  2R8H A;  2N4D A;  2GGP B;  3GYX B;  1YRU A;  1CPZ A;  4OIP A;  2R92 C;  3DLK A;  4RW6 A;  1WEX A;  2Q66 A;  1G1X A;  3KK1 A;  2M3D A;  4KPC A;  2E5L F;  1NB7 A;  3MHY A;  4RUB A;  1HQM A;  5J1P A;  2IMO A;  3SV4 A;  3T5J A;  3MM8 B;  4KB7 A;  3PM9 A;  2XGQ A;  3JB9 k;  2XNR A;  5BYQ A;  3KMQ A;  3VWS A;  2V4J B;  1JQG A;  1TV6 A;  3GII A;  5G0R A;  4BC9 A;  3GV7 B;  2IRU A;  1B0T A;  3I4M K;  3H5U A;  1Q86 T;  1FA0 A;  3DOK A;  3PG9 A;  2CNN B;  3CC7 S;  1PYS B;  1JLQ A;  5C44 K;  4MEX A;  2IM0 A;  4DEZ A;  1DCO A;  4L75 A;  4EYI B;  2D1C A;  3MM9 B;  1X4G A;  5FDL A;  1WEL A;  4XSZ A;  2M4M A;  4X65 J;  4J9O A;  2CVE A;  2MY8 A;  1WKK A;  3M7V A;  3MM5 A;  4GFQ A;  3KK2 A;  3VCD A;  1AW0 A;  4FBT A;  1ZA2 B;  1VQS A;  2BEF A;  3FRZ A;  1TEL A;  5LXR A;  3D5M A;  4ZVP B;  3W8P A;  2GIF A;  3MMA A;  4LF5 F;  3V6D B;  2B63 K;  2RRB A;  2VUM C;  2Z56 B;  1BQN A;  3MPU B;  1A6L A;  3HOX K;  5DQG A;  2BJ3 A;  1HD0 A;  4U8Y A;  2X51 A;  1FD8 A;  3AA9 A;  5KFS A;  1I6H C;  3FOE A;  2G1D A;  3C16 A;  3P6Y C;  1EP4 A;  4PG8 A;  1FXR A;  3RG6 A;  1VBK A;  4MJK A;  3T9N A;  3OR1 B;  2FHK A;  2ZWP A;  2IC3 B;  3VZH A;  2WVF A;  2BUN A;  3MEC B;  1HWJ A;  2Z2Z A;  4KIA A;  3O3L A;  4QR2 A;  4QR0 A;  3ZFV A;  3C46 A;  1T05 A;  5D4O A;  4Q2L A;  1SIW B;  3MDF A;  1U0H B;  2EKN A;  3H20 A;  4NMX A;  3GR1 A;  4C9D A;  3H3V D;  4CO5 A;  8RUC A;  1ELO A;  1X4F A;  3FZ2 A;  5IOS A;  3JYT B;  1J6V A;  3EGV A;  1B4B A;  5CD4 A;  2E1M C;  1SPB P;  4J5O A;  2CNL B;  4J9V A;  1PYO B;  1TAQ A;  4J9K A;  3UFC X;  1DZ5 A;  2WK4 A;  4FS2 A;  2HRY A;  2ILY A;  3B4D A;  1OY6 A;  2VFR A;  1U47 A;  2PMZ L;  1P6T A;  1RE1 B;  5ETN A;  1EFW A;  1F5C A;  2BE2 A;  4ZS6 A;  4CIO A;  5LXY A;  4ZK7 M;  1J2V A;  3DXJ A;  2ZVI A;  4F04 B;  4LT6 A;  1CUL A;  1XZP A;  3K17 A;  4NZ7 A;  3DLG B;  2FJB B;  2KFY A;  3G6X A;  2CWK A;  2DGW A;  2MST A;  4XPC A;  2VG7 A;  1RTD A;  2B56 A;  1U49 A;  3F56 A;  1USM A;  5GAE U;  2MQN A;  2OJ3 A;  4DSK A;  4ECU A;  3M3Y K;  1WCM C;  1UFK A;  4CTA B;  5H1S V;  4ECY A;  1PBA A;  1UVK A;  5J2M A;  5IZH A;  4HDH A;  2XZT B;  3IXQ A;  3RZA A;  1FJC A;  3PX4 A;  2LEP A;  4M1K A;  2NVX A;  1RT6 A;  4LIR A;  1ZM2 A;  4A3E K;  1IKV A;  2MZ1 A;  4NZ6 A;  4CQ1 A;  4BBR C;  4ZIV A;  3CJQ A;  1AT1 B;  2HHW A;  4LR7 A;  4DL6 A;  5DET A;  4A3C C;  2QTW A;  4WP9 A;  4JI4 F;  4Y3C A;  5CD4 H;  3FMB A;  2LU2 A;  3MUM P;  1GMU A;  2VG5 A;  3BSO A;  4KAI A;  2XO7 A;  1U48 A;  3T1Y F;  1QVG R;  3NUH A;  2YKO A;  2G1H A;  3EIC A;  3KLF A;  2VPZ B;  1KQ4 A;  3CPW R;  4UZC A;  4ZP7 A;  1QSS A;  1RA6 A;  3IGV A;  1C4C A;  3ONQ A;  2UUC F;  1N6Q A;  2YNI A;  5J2P A;  2D3Z A;  1SI9 A;  4FDF A;  4YFK A;  5GAG I;  5KG4 A;  3MR6 A;  3PIO Q;  3WX4 A;  3BM7 A;  1H98 A;  4DFJ A;  4I2P A;  3DXS X;  1SVD A;  1UJ5 A;  2K1R B;  3EGZ A;  2XLJ A;  1K8A T;  3S1Q C;  1O5J A;  4HVZ A;  5B0B A;  1SC3 B;  3GYG A;  2Q3P A;  2W7V A;  4X2B A;  4BXX C;  4HHH A;  1GQE A;  2AJ0 A;  2WSC C;  3L9Z A;  1EAY C;  2Y1I A;  5E68 A;  2JEG A;  3VAM A;  3G4A A;  4KO0 A;  3HHL A;  1YBU A;  1W2I A;  3HVW A;  2XG8 A;  2CZV C;  3LP1 A;  3WX8 A;  1M90 T;  1RT4 A;  3HX9 A;  5A8R B;  2KJV A;  4OIN A;  1T9W A;  3TFI A;  4USM A;  1H2T Z;  2JFK A;  3RBD A;  1T8E A;  5HMY A;  1P9Y A;  3SZY A;  3W60 A;  4JYA F;  3I5C A;  2AEF A;  4Q7A A;  4KAR A;  1Y0H A;  3M8Y A;  3HOY C;  2E5H A;  5EDW A;  1I3Q K;  1JMT A;  5HK4 A;  4L73 A;  3FCH A;  4DUT A;  1KOH A;  1N0U A;  3EQL A;  1HQ2 A;  1NU4 A;  2KJW A;  4KFB B;  1N52 B;  1Y1V A;  3OJU A;  3FBB A;  4DBQ A;  5HLF B;  3HVT B;  2OPR B;  1RAI B;  1U1P A;  2XMA A;  4YR2 A;  1NPK A;  1JB0 C;  3QLH A;  2E2H K;  2Q79 A;  1KVK A;  1ZZN A;  1HNV A;  1VJW A;  1T9X A;  1RB0 A;  3L4B C;  4LIW A;  2QL5 B;  5T14 A;  5C3E K;  4MEY A;  4AH6 A;  4J9S A;  1RYS A;  1TAU A;  1XBW A;  3C6T A;  5LSR A;  1FX2 A;  1GXT A;  5AXK A;  2D9P A;  4O44 B;  1YDL A;  5HJX A;  5D4D A;  4ECX A;  3W9H A;  1ZXO A;  2YKM B;  3DOM B;  2ZH1 A;  5FJ4 A;  1Y1V K;  1IBL J;  4ZN1 A;  1I1G A;  3HHD A;  5KFE A;  3BGL A;  4TU8 A;  2ZNY A;  3WQP A;  1GEH A;  5C2C A;  3TEH B;  5HVH A;  2HNZ B;  3IWX A;  5D0R A;  3HCX A;  4NXM J;  1VH2 A;  1N5S A;  5IFM A;  2L9N A;  3M4O K;  2NVY A;  4RW9 A;  2O1P A;  5K14 B;  4I2Q B;  2L48 A;  4JI8 F;  3BB5 A;  4CT9 A;  2XNQ A;  2OSQ A;  3OQ2 A;  4ZA1 A;  5KT2 A;  1F2G A;  2GC8 A;  3CD0 A;  1YRT A;  4ATN A;  4URS A;  1BLU A;  4JI7 J;  4JI6 J;  3PX0 A;  1TWC C;  9RUB A;  1YQH A;  2DPI A;  3R97 A;  3M9M B;  3KG4 A;  2CPF A;  4I56 A;  2PHC B;  4NYZ A;  3B8H A;  3KUG A;  2OLW A;  4DV0 F;  4DWI A;  4P2M A;  3V6H A;  1RKJ A;  2QA4 G;  3A8K A;  2PFD A;  4BLB A;  5IV3 A;  1X9W A;  3TUI C;  4OJ1 A;  4DZ6 A;  1QVF R;  1T9V A;  1YGY A;  4ZJO A;  1RT7 B;  3IAS 9;  4A3I C;  2HQF A;  3K8V A;  4Y2C A;  1ZAX A;  3DI6 A;  1Y1W A;  1HNZ J;  2EC0 A;  2MHN A;  1SJ3 P;  1UV7 A;  1SJQ A;  1VQP S;  4UST A;  3BPD A;  3KDN A;  3NWG A;  4DFM A;  5IYD K;  4HAC B;  1JK9 B;  4F67 A;  4C3I K;  3HOV C;  5HP1 B;  5B09 A;  1YJ9 S;  3BKT A;  4FPI A;  3FBE A;  2MQ8 A;  4K0K F;  5LSL A;  2I0X A;  5E3C A;  3EVO A;  3MMC A;  3PJ9 A;  5BR8 F;  3PX6 A;  3BBC A;  3IWN C;  2KT5 A;  4QPX A;  1JKH B;  2W4D A;  2FVC A;  2LMI A;  3DLB A;  3RBZ A;  4HHJ A;  2FVQ A;  3NBP B;  4IDK A;  3UO0 A;  1N36 F;  4PKD B;  4KRW A;  4TY8 B;  4ID8 A;  1Q79 A;  5KFF A;  1FJG J;  2FLP A;  3AD7 C;  1CVJ A;  4WJ3 M;  4U8V A;  3DRR B;  3SV3 A;  4F25 A;  3GTQ K;  2NVT C;  4GO7 X;  3NGK A;  2B9X A;  4DUY F;  1NH7 A;  1FDD A;  2VDH A;  4AUK A;  2KTQ A;  5MAO A;  1SJ1 A;  1QAJ A;  1LWF B;  2HZA A;  1EQM A;  2IRY A;  4C8O A;  3GJS B;  3A3P B;  2QSW A;  3N28 A;  4K7Q A;  1S1W B;  2V67 A;  3H2L A;  1HYS A;  3EJM A;  1S6P A;  1JXV A;  2W24 A;  4LBH A;  2KU7 A;  5GAE I;  2O67 A;  4U9R A;  5U47 A;  1HI0 P;  4F3O A;  5HRO A;  3Q24 A;  3CUN A;  5DS7 A;  4TU7 A;  1OSD A;  2M70 A;  4WFB Q;  1FDB A;  3NGR A;  4P75 A;  2UUT A;  2LEB A;  1Q0N A;  4X4P A;  2MLZ A;  4OYZ A;  3V4M A;  3CB4 A;  4MKY A;  3UWT A;  3PV8 A;  2BX6 A;  3PKM A;  2FVS A;  2YKP A;  4NLY A;  3OVS A;  1UFL A;  2NVQ C;  4K4Z A;  1C1B B;  2MKC A;  1H38 A;  3C14 A;  4B9N A;  4G7Z A;  4W98 A;  1CJK A;  1X4C A;  4NCG A;  1DTT B;  5HQM A;  4PYA A;  4X4T A;  5C4X K;  2MLX A;  4V1A k;  3FFI A;  3CMA S;  2DTJ A;  2QFI A;  3JQM A;  3HD1 A;  2OI2 A;  4BY1 C;  4MKV A;  5C7P A;  4MQ9 A;  1K83 K;  2XM3 A;  1S6O A;  4WIL A;  2AZ3 A;  1VQY A;  5F41 A;  4NOI A;  1T9T A;  4NRT A;  2R2S A;  4DR6 F;  3POT A;  4RPF A;  2FLL A;  2HFV A;  4M8L A;  4OV6 A;  1NXI A;  4DG1 B;  1AFJ A;  1D8Z A;  4LF1 A;  1HNW F;  4NAS A;  3JST A;  2IYG A;  4NLW A;  3PO5 A;  3K7R A;  2VOO A;  5KG3 A;  2LEC A;  4GMK A;  3FUY A;  3ZZZ A;  4A3G K;  2D3O R;  4DR4 F;  4KJI A;  5E2Q A;  2F40 A;  1ZQ1 C;  3M8P B;  2KG0 A;  5IP7 C;  4ZPA A;  1U1Q A;  2H5I B;  4LUB A;  4WIQ A;  2F8H A;  2X7I A;  3QQC D;  4IG0 B;  3OHB A;  5KFN A;  4C3K A;  4K2J A;  4KHM A;  1H2V Z;  1QM9 A;  1IQZ A;  3TJA A;  1NPR A;  2XGP A;  2M8D B;  4PXB A;  5LMN F;  1ZOT A;  3S1N C;  2ZEJ A;  1HBN B;  1RT5 A;  2RML A;  4C8M A;  3HO1 A;  4YR0 A;  5FLX Y;  1YHQ S;  3TI0 A;  2XWY A;  2MLY A;  4KMU A;  4O2D A;  5F0W A;  2Y8W A;  1TVR B;  4MIA A;  2RQM A;  1RJJ A;  4L3N A;  2VUG A;  4J7C A;  4FNI A;  1Q81 T;  3Q8P B;  1VGY A;  1UP1 A;  1Y9O A;  1WQF A;  1G7C B;  1UVM A;  1CJT A;  4IH6 A;  2J0X A;  2ADB A;  2OTL S;  1F5B A;  4DV5 F;  1WTB A;  3QRP A;  3W5X A;  2UXC J;  1NHU A;  3GTK K;  1Q5V A;  1Q7L B;  1R7I A;  3M1V A;  2KZZ A;  2RKI B;  1URN A;  1S9G B;  5E0O A;  2F8M A;  1YRX A;  2NQP A;  1SL1 A;  1JXE A;  1H3D A;  1ROF A;  2EK6 A;  1TKT A;  4MIW A;  4LFB F;  2OPP B;  1T3O A;  1U02 A;  1LWE B;  2OPQ B;  1EET B;  1SH0 A;  2MKY A;  4UOC A;  4UZB A;  3SZ2 A;  4PG5 A;  2DY1 A;  3N3Y A;  2FZC B;  3U1N A;  1XNQ F;  2CPJ A;  3CCU S;  3RR8 A;  2YNF B;  3C66 A;  3OTB A;  5AXM A;  1WC0 A;  3D28 A;  4YDX A;  1SUQ B;  4PXC A;  1R8B A;  3CJK A;  4TLR A;  4IOA Q;  4AD6 A;  4WKY A;  4DXL A;  4LR9 A;  2HVH A;  4KR0 B;  2C2M B;  5M2R A;  2XSJ A;  1NH8 A;  2PC6 A;  2IAJ B;  4QPT A;  3K2Y A;  3G96 A;  4K4W A;  4ZLJ A;  2HMI A;  2FY8 A;  1VQN S;  3M8Z A;  3I4M C;  1X4D A;  3T9Z A;  4X6A K;  1RAE B;  2Z58 B;  2E1R A;  3LH2 S;  2VPX B;  1YNJ A;  1S7I A;  1JLE A;  3R5D A;  3D6F B;  2JA6 A;  2ZD1 A;  2IRX A;  3I6P A;  8AT1 B;  5SZT A;  2DO4 A;  2ZC3 A;  2V2V A;  2XI3 A;  1NCL A;  5CCL A;  3Q0A A;  4NX9 A;  1HBU B;  1KS2 A;  2LCW A;  3CJT A;  4EZ6 A;  2FB0 A;  4NEZ A;  1R8A A;  3K5L A;  3GTY X;  4N7T A;  2DRD A;  2APO A;  3LO3 A;  3KG0 A;  2OD4 A;  2QYC A;  2HFS A;  2R7Z A;  3SFU A;  2AGO A;  2Y1R I;  3S14 C;  3ZZP A;  1FKA F;  4IOC Q;  2B63 C;  2GHV C;  2K3K A;  1S77 D;  2JA6 K;  4WJ4 A;  1HHS A;  3S17 K;  3M8Q B;  2W9B B;  4B08 A;  3H59 A;  2R93 K;  2WW8 A;  3P96 A;  4C0B A;  2GSU A;  1MW7 A;  2UXD J;  1GTE A;  2OIH A;  1UA1 A;  1U1R A;  3OL9 A;  5T7L B;  1Z1Z A;  1TFW A;  5E3Q A;  2ZC4 A;  2XMM A;  3M30 A;  2HHP A;  4CLP A;  3E2E A;  4ED7 A;  2C2K B;  2BW7 A;  2P9C A;  1NSA A;  1KLN A;  3HM9 A;  3BEG B;  5K8P A;  4A8Q A;  4O0N A;  4A3L K;  1O26 A;  1JIH A;  2CRL A;  2UXB F;  3I9Z A;  1RHR B;  2XMW A;  2IBO A;  4HL9 A;  2GMH A;  1U6B A;  1S10 A;  2HHV A;  4RNH A;  5KT6 A;  3BKF A;  1TR0 A;  1YJV A;  1L5U A;  2BV3 A;  3OVA A;  1F9H A;  3CJ2 A;  5CHP A;  4A3M K;  1GMW D;  4WE1 B;  4BS2 A;  2A6O A;  2DHG A;  2EW9 A;  1RGV A;  3HP6 A;  2HGM A;  1W2B R;  5IOT A;  1QSY A;  1R6V A;  2VC1 A;  1FNM A;  3PYF A;  4OI6 A;  5HBM A;  4DV6 F;  1TTH B;  1WC5 A;  3KJF B;  4Y00 A;  3X1L B;  2JDJ A;  3DLJ A;  2C3P A;  4XAK A;  4M5H A;  3RBE A;  3PHT A;  4OYP A;  1FKO B;  3S2H K;  1XMQ J;  2BXJ A;  5CHC B;  2RIJ A;  2HNY A;  4J90 A;  1UMJ A;  2JX2 A;  4N56 A;  2HHS A;  3VHQ A;  3MMJ A;  1EZZ B;  4A3D K;  4ZP8 A;  2C3U A;  4ANE A;  3PRD A;  2I38 A;  3IS9 B;  4X62 F;  4MFB A;  1WG5 A;  3M3Y C;  1XNR J;  2E2I K;  2I1R A;  4F4W A;  1V3S A;  4OLO A;  4ZN3 A;  4M5N A;  2MXY A;  3BQ1 A;  3S1M K;  3CMQ A;  3HOZ K;  3M9O B;  3HPO A;  2ZUF A;  1M5O C;  4ETZ A;  4JI3 F;  1TP7 A;  2M9K A;  1HQU B;  2WSE C;  4A3E C;  2ZJQ Q;  3W5Z A;  3R3T A;  2VJU A;  2RIL A;  4ZMM A;  3J7Z 5;  3QZ8 A;  5ADZ A;  4F0H A;  3PFE A;  5AJ3 F;  3K89 A;  3CCQ S;  2W9C B;  5F9L A;  2XCO A;  2AKW B;  1T94 A;  3D3C J;  3N6M A;  1RAB B;  2DYA A;  1CS4 A;  3AD8 C;  3UI3 A;  3G4C A;  1T9U A;  4CLU A;  1X31 C;  4USK A;  1IR0 A;  1OY9 A;  5M3M K;  3GB0 A;  1VLY A;  2KZM A;  1SBR A;  3WIU A;  3P4U B;  4AXJ A;  2ILZ A;  3Q3Q A;  5KT7 A;  2BE7 D;  2V50 A;  3TAR A;  3GIM A;  5BYR A;  3S6E A;  1I50 A;  4DCP B;  1D0E A;  1KVJ A;  1U0S A;  2EFV A;  3FQK A;  2QMX A;  3N0C A;  4NYP A;  4KGM A;  3BGR B;  1FVS A;  1QD1 A;  5FII A;  1RA7 A;  2BE9 B;  3H98 A;  4KDD A;  3CCS S;  2K8G A;  4YS2 A;  2J0W A;  3SCJ E;  1GE9 A;  5HL7 Q;  3BGO P;  1H0H B;  3KDO A;  5LSO A;  4GTA A;  2MSS A;  5HSP A;  4OLP A;  2LQJ A;  2QIF A;  3TUJ C;  1CLF A;  1IM6 A;  3BSC A;  4B3R F;  3VAG A;  4AQY J;  2ZOM A;  1XER A;  1L3T A;  2K7J A;  1KEK A;  4ED2 A;  1FX4 A;  4UOF A;  3IRX A;  1RI7 A;  4HH0 A;  1MU2 A;  5GAD I;  1P1T A;  3T6B A;  4ZHR A;  1K44 A;  3HHN B;  5F8J A;  3R5J B;  2EFO A;  2W9A A;  2WB1 L;  4U7U D;  3PNI A;  3OR2 A;  1DY3 A;  3CWJ A;  2R7R A;  3DYA A;  2VA3 A;  2IJN A;  3OSP A;  1I3Q C;  4BY7 C;  1FJ7 A;  3I5A A;  2Y3Y A;  4DL0 C;  4ES2 A;  2IVM A;  2J0Q D;  2HRU A;  4LRD A;  4MKA A;  1HBM B;  4UOH A;  3RW7 A;  4IR9 A;  1PAU B;  5IP9 C;  5H9E J;  2HGL A;  4LFC J;  4URG A;  3S1R K;  2E2H C;  3S16 K;  4RWW A;  4CRJ A;  1OSC A;  1AB8 A;  4KC5 A;  3PEJ A;  3ZNJ 1;  1J5O A;  3TQ1 A;  1ZTW A;  1FD2 A;  1WDD A;  2VD3 A;  2YNG A;  4YY3 F;  5C3E C;  4CLZ A;  2LYV A;  1YBT A;  3DMJ B;  2VG6 A;  4R8U B;  2J6T A;  2LA4 A;  2R7W A;  4HT7 A;  4O3O A;  5A8W A;  4RNM A;  2B7C B;  1W26 A;  3SDE A;  3HLU A;  2MGZ B;  2PII A;  3PCO B;  3EPG A;  2WHO A;  1SV5 A;  4DS4 A;  1RHM B;  1EQ0 A;  2E66 A;  2OO4 A;  3R6L B;  3NMA A;  3B82 A;  1Q53 A;  5D15 A;  1KQS R;  3M6X A;  4PPZ A;  4UQG A;  1RU1 A;  3M4O C;  3OLA A;  3KLG B;  3P3D A;  5K8O A;  3PYD A;  3KHG A;  3CQZ A;  2GJI A;  3VZI A;  3T5K A;  2NYH A;  2ZH5 A;  1Q5Y A;  4EI2 A;  2ZJR Q;  4IKA A;  4EBC A;  2IVF B;  2Y1J A;  1FWP A;  2L3M A;  1RBL A;  4OX6 A;  1TWA K;  1RK8 A;  2ZDO A;  4ALZ A;  2IA6 A;  2R9L A;  2H3E B;  4OZL A;  1SQE A;  3N4W A;  2GV1 A;  2QL9 B;  4DSI A;  2MZS A;  3MML B;  1B4S A;  2HVE A;  2FLN A;  5C24 A;  4HEA 9;  4LSL B;  1IBK F;  4NE9 C;  1IN0 A;  2EBE A;  3EUN A;  1IW7 A;  3RBX A;  5GMK a;  4N5S A;  8ATC B;  3Q23 A;  1URR A;  2B5J A;  4X4N A;  1SJF A;  2MHE A;  3LP2 A;  1T95 A;  2UVW A;  2NXJ A;  2GO8 A;  3S7R A;  2BRL A;  2N3L A;  3UD5 A;  5J1E A;  1J5E F;  5IYD C;  3MFI A;  2VBW A;  4Q0B A;  2N7Y A;  3MMB A;  1C2P A;  4C3I C;  2JEI A;  4JI1 F;  4CO0 A;  3KG1 A;  1C0T A;  4ZLN A;  5DGB A;  2KYZ A;  1IJF B;  4O4G A;  5KG1 A;  1H7X A;  3N6N A;  3OPF A;  3M05 A;  2YH1 A;  3DLL Q;  2GS8 A;  4CWB A;  2W4P A;  5ETP A;  2L9W A;  3FEZ A;  4Q5S A;  5M5W K;  1EHW A;  3H5Y A;  1X4H A;  4KV8 A;  3OD2 A;  2HVD A;  2Z8Q A;  2CUY A;  5E3P A;  1RWO B;  5C5J A;  2A68 A;  4KE5 A;  4XCH A;  2ZH8 A;  4LMZ A;  2GQC A;  4ZVS B;  2EC2 A;  1X9M A;  3UNY A;  2QSF A;  3H7H B;  1RLD A;  3CC2 S;  3MOZ A;  3GTQ C;  4BCA A;  2HWI A;  3W63 A;  5IXU A;  2R8G A;  3OFE A;  5T41 A;  3CO9 A;  1XXA A;  1G4C A;  4RKU C;  2RRN A;  1N33 J;  1ZPW X;  3TAM B;  2XMT A;  4ELT A;  2CQH A;  2QA4 S;  4ECT A;  4LOW A;  3QFW A;  1UKU A;  4DR1 J;  3GG1 A;  3W64 A;  1XXC A;  2BDP A;  4Y52 K;  3J7A 1;  4C8Z A;  2ZUA A;  4RUA A;  1L3U A;  1RWX B;  2EFN A;  3QWU A;  2R3V A;  5K8M A;  3GYN A;  4CO1 A;  2F4V J;  1PBU A;  3GTJ A;  4TU9 A;  4KH1 B;  1RTH A;  3TOQ A;  4TLQ A;  3L09 A;  3Q8S B;  3G82 B;  2I2Y A;  2ASL A;  2BKO A;  2J9D E;  4J9L A;  2HS0 A;  3E51 A;  3W62 A;  1B70 B;  1RU2 A;  5B0C A;  3S01 A;  4G1Q B;  3US5 A;  1ULR A;  4KN7 A;  3GSD A;  1BGX T;  2UU9 F;  4QYZ K;  4OZJ A;  1OMS A;  4N41 A;  1YZ7 A;  4RW8 A;  2NRE A;  4ZOS A;  4KPY A;  5ETK A;  2RHS B;  1RAJ A;  5KFZ A;  3RB6 A;  3EPI A;  3C15 A;  4NA3 A;  4DUZ J;  1HNI A;  3AJ2 A;  2WOM A;  3WBZ A;  3QNW B;  4F0K A;  2J76 E;  4GTB A;  5C4X C;  4B3T F;  3Q22 A;  4KGV B;  4RUH A;  3M2V A;  4O4R A;  5DDR C;  1A7G E;  4LF8 J;  3ZZY A;  3H0G K;  4C3M A;  1RT2 A;  1K83 C;  1PAE X;  2R7T A;  2DR9 A;  3AH5 A;  4G7H A;  3JAM U;  4RO0 A;  3ITH B;  1FER A;  1FRL A;  3PFO A;  2R42 A;  3J81 U;  1VQ7 S;  4CLK A;  4GTC A;  4FVC A;  4GRS A;  1FRM A;  5HAO A;  4DV2 J;  1R8H A;  3NCR A;  1FEE A;  4WK1 A;  3MUV P;  1PO6 A;  1O25 A;  2KI2 A;  2M0G B;  3PXG a;  4RNF A;  4X4O A;  3DLK B;  4RW6 B;  4O0I A;  3U1M A;  4A3G C;  1UPM B;  2PA8 D;  3SIP B;  4ZDN A;  3H3V L;  3KK1 B;  3A3O B;  2ZH3 A;  4Y34 A;  4LSN A;  4BWJ A;  2OMO A;  3GTP A;  5CCM A;  2GZO A;  3OTO F;  2C28 A;  4MK8 A;  3CJ0 A;  4JV2 A;  3I4P A;  4ITS A;  2OAU A;  2MEW A;  5A0Y A;  2EG2 A;  2ADC A;  4B9V A;  5HAN A;  4GKJ J;  1VGX A;  1UEU A;  2DIS A;  2MJU A;  2R7U A;  2FGC A;  2RH6 A;  2JA7 A;  5EUH A;  1TV6 B;  5G0R B;  4IRK A;  3ISN D;  2AD9 A;  2AEJ A;  3L4J A;  2A2C A;  1TUG B;  1U1N A;  2HBR B;  3DOK B;  2EG1 A;  1P27 B;  3UN5 A;  3PYE A;  2F5G A;  3HXA A;  1JLQ B;  3WIV A;  4KB2 A;  4G1I A;  3DFE A;  3GTP K;  1C0U A;  3EM1 A;  3G9C A;  2HBY B;  5FDL B;  2VPW B;  4MH8 A;  1NO8 A;  5BYS A;  3VAH A;  1RAA B;  4RL1 A;  3MM5 B;  2RVJ A;  5D77 A;  4KHP J;  4YEA A;  1F6T A;  3GTK C;  3KK2 B;  1H2U X;  3UR3 C;  4CZC A;  3BSA A;  4TNO A;  3HJV A;  4PYD A;  1U26 A;  4DX7 A;  4G3I A;  1NSQ A;  4KHR A;  4WII A;  1AB4 A;  2VFV A;  1TZ0 A;  2V8D A;  3MMA B;  4QWC A;  1N48 A;  1BQN B;  2DEJ A;  2YNH A;  3AA8 A;  3FCW A;  2NR0 A;  2E1C A;  1WI8 A;  1WF2 A;  4LSZ B;  2FGO A;  3NXZ A;  2KDO A;  3C16 B;  3BYR A;  4HYK A;  1EP4 B;  3GIK A;  1M1G A;  3EDR B;  2OH2 A;  3T6J A;  2EFQ A;  1X5S A;  2H65 B;  4WFA Q;  2HQI A;  1RSC A;  3VGS A;  2Q43 A;  5I4M A;  1PIE A;  1CJV A;  4N8N A;  3J7Z T;  1GAO A;  1VHF A;  4M5K A;  4WCE Q;  3OJS A;  3ZZT A;  4RNN A;  5KG5 A;  3NY0 A;  4CH7 A;  5F8M A;  1TL3 A;  1SH3 A;  2IM1 A;  3SI8 A;  5B0D A;  3ILL A;  3GIL A;  4YDD B;  1T05 B;  1WC1 A;  3PO3 C;  3M6U A;  3GTM A;  4X6A C;  1VJE A;  1AUS L;  2B6A A;  3K5N A;  4D3H A;  1B7Y B;  2F9J A;  2HK3 A;  5HQL A;  1C1C A;  4EBD A;  5IT9 Y;  3GV5 B;  2UUB J;  2V2Q A;  3S0X A;  4G1P A;  1QTM A;  2J9E A;  4K4S A;  4C0O C;  1A0O B;  3D4J A;  4Z7C A;  1O0P A;  4B3S F;  1HMV A;  1SH2 A;  4OZN A;  2ASD A;  2RUG A;  2MZR A;  1M5K C;  4FXW A;  5KFH A;  2BKP A;  1YSJ A;  4XDC A;  2BE2 B;  2HAI A;  4C3H K;  5HN0 A;  1UAW A;  2AHO B;  1FTC A;  1IKW A;  4LF4 F;  1RWP B;  1T11 A;  1XMO F;  2JA6 C;  5F8N A;  1KFS A;  3S17 C;  1CUL B;  1XZP B;  2R93 C;  4LJM A;  1WAC A;  5TJ3 A;  3GTL K;  1RTD B;  2VG7 B;  3G6V A;  4BBS K;  4NA1 A;  1Y5I B;  1XQI A;  2HQC A;  4NYO A;  1EB0 A;  4F2R A;  4XO0 A;  3PW2 A;  4C3J K;  1UA0 A;  3AOB A;  2ZZT A;  1FRH A;  5A6P A;  1N0V C;  5J2M B;  3KLI A;  5AE1 A;  2BJD A;  4OX7 A;  3QZ7 A;  3KUH A;  1LK7 A;  1RT6 B;  2ZH4 A;  1W7W A;  1IKV B;  1F93 A;  2X1G A;  3BBB A;  2ZVS A;  1KQF B;  3M8W A;  2CPE A;  5KG7 A;  4W92 B;  1BDF A;  5KT4 A;  2P8T A;  3I4H X;  2WVD A;  1X8D A;  5KFC A;  1WF0 A;  1EX8 A;  2BAC A;  2DHH A;  3PW0 A;  4JI6 F;  2VG5 B;  1NZ8 A;  3GDZ A;  3PDN A;  2QN6 B;  1UW4 A;  2HND A;  3KLF B;  3CCL S;  2VJV A;  5EX3 A;  1UTA A;  3SCL E;  4ZVR B;  1TMM A;  3IWL A;  1EI6 A;  2GVD A;  4XLN A;  4X66 F;  3A12 A;  4ICL A;  5L1I A;  3VVU A;  2QYG A;  3TNV A;  3AQP A;  1N6Q B;  1IBM J;  2YNI B;  5J2P B;  1FDN A;  2G0J A;  4I68 A;  1DRZ A;  2GO9 A;  4RNO A;  1J6X A;  2DHS A;  3TX8 A;  4F36 A;  1GMW A;  3TA1 A;  3GZ7 A;  2NUU G;  5M5Y K;  4I2P B;  3IR6 B;  2LQ9 A;  4LFA F;  2LKZ A;  2KHD A;  1B64 A;  1P1L A;  1DD5 A;  1O6X A;  1NJI T;  1O29 A;  5A8K A;  3TX0 A;  2C3M A;  4A3D C;  3DHX A;  3NGD A;  1TL5 A;  4C2M A;  3BZQ A;  2P9G A;  2EI5 A;  3G4S S;  4JI2 J;  2VBY A;  4C11 A;  1TMJ A;  4F26 A;  3NG8 A;  4JBC A;  4ZIT A;  2E2I C;  2BVZ A;  4KO0 B;  3S1M C;  3HHL B;  3LP1 B;  2YY3 A;  4ZJQ A;  4ZLL A;  4UUW A;  1RT4 B;  2MYF A;  4DS5 A;  3T1H J;  5IC4 B;  3HVA A;  4OI2 A;  1XWL A;  2KWA A;  4K8R A;  3EDQ B;  5B7W A;  3TEG A;  1VC5 A;  2CQB A;  2Y3P A;  4C3L A;  4A3F K;  3FKI A;  2DEI A;  3U27 A;  3JSM A;  4DZD A;  3W61 A;  4NLD A;  1FJG F;  1N5Y A;  4PXE A;  1RKI A;  3N79 A;  4DN9 A;  2HLT A;  4IQM A;  1DBD A;  3LUY A;  4OZ0 A;  3O44 A;  2C3O A;  1S4E A;  4FS1 A;  4P5B A;  3BQ0 A;  1PG5 B;  3CC4 S;  1TL7 A;  1C4A A;  1DJ0 A;  3QLH B;  1HNV B;  1HR0 F;  3KOA A;  2V69 A;  3CIM A;  3VAL A;  5IT4 A;  2C2Z B;  3EXY A;  1KQK A;  2GA7 A;  3L4K A;  3H2V E;  2XHC A;  3C6T B;  1JLF A;  5IV4 A;  2WSF C;  2HWH A;  3NS7 B;  1X9S A;  4DL4 A;  2Z57 B;  4LF7 J;  2HHX A;  3D9B A;  5ITH A;  5KFP A;  2L41 A;  1IL2 A;  4KM9 A;  1UEK A;  5EGH A;  2BJE A;  2EFG A;  2YKN A;  3MCM A;  1RWK B;  1X0P A;  1F60 B;  4MYT A;  4MYU A;  2V4Q A;  3IR7 B;  2OSR A;  1HL6 A;  4KSE B;  5JVO A;  4LF5 J;  2WCX A;  3UCG A;  4RW9 B;  3VVT A;  1XXB A;  5IQQ A;  3ZTO A;  1KC8 T;  3A8J A;  1ZM9 A;  1UVL A;  3EZU A;  2YQ1 A;  3E8O A;  3TZX A;  1PGZ A;  3GTO A;  4DPW A;  4OJH A;  2HPU A;  4YHH F;  5DZ7 A;  4F0M A;  2EXU A;  4ED4 A;  2JZ5 A;  1Y3K A;  4LVO P;  4UY8 5;  3MOJ B;  3TUP A;  3FGV A;  2XYP B;  3D6M B;  2RSQ A;  2ABY A;  4WYL A;  4JV5 F;  1XR6 A;  2J5A A;  4GVB A;  5FLM K;  3B6B A;  3NLC A;  3I5B A;  1KD1 T;  2H4W B;  4FZV A;  1RAF B;  2LP4 A;  4EYH B;  2VAS A;  3I31 A;  3FEY B;  3GE9 A;  2QMU B;  2XLI A;  3S1R C;  1RAC B;  3PRV A;  1B7F A;  4BDP A;  3S16 C;  2GJ2 A;  3D1Q A;  4RUC A;  5M2U A;  4Q43 A;  4FYY B;  4JB8 B;  2W2M P;  1UVI A;  3V4I A;  2QX0 A;  4C0H A;  3DI6 B;  2E44 A;  3NNH A;  5CZV A;  3C2P A;  3KJV A;  1U8W A;  5I3U A;  2X3D A;  3I55 S;  4LF6 F;  4P52 A;  2FJE B;  4Y2K A;  1E6V A;  2CQ3 A;  2CQ4 A;  2JA8 C;  1TWF K;  2MDA A;  4USU A;  3CD5 A;  2F9D A;  1TWH A;  1R9T A;  3MMC B;  3S1T A;  4RLE A;  1REV B;  2H4Y B;  3P45 B;  1WJ9 A;  2YBV A;  1JLG A;  2G4B A;  3CVK A;  4ETX A;  4U7U K;  2GIQ A;  1WIH A;  4HH1 A;  4IDK B;  4P2S A;  1ZH5 A;  2I5J A;  3NCQ A;  2MQP A;  3DRS A;  1DUR A;  2NXN A;  3LW5 C;  5L9N A;  4FNH A;  2CZ9 A;  1VQ4 S;  3G87 A;  5KFO A;  1TWA C;  4G6V B;  2VBZ A;  3GIR A;  3I0R A;  1HHT P;  2UXC F;  2MTL A;  5L8R C;  1QAI A;  3QJJ A;  3K8W A;  1ZYQ A;  5FD1 A;  3GJT B;  1JLA A;  4OI3 A;  1BMQ B;  2ZH2 A;  1HYS B;  1IR1 A;  1OO0 B;  1S6P B;  5GMD A;  3BN4 A;  1UZH A;  2L08 A;  3OT9 A;  5CJ9 A;  1N5V A;  4DPU A;  2FVR A;  3DDI A;  1I6V A;  5KOX A;  5HRO B;  4RU9 A;  3AOD A;  3TAP A;  3HT3 A;  2N7C A;  5KFV A;  1X4E A;  3JSB A;  4IRC A;  2RH3 A;  2EVZ A;  3T1Y J;  1ZBS A;  2DGO A;  4J9U E;  1LW2 A;  1XPP A;  2EBG A;  4LRF A;  2FQQ B;  2FPH X;  2UVR A;  2GAG C;  1IE0 A;  3SCI E;  1FWK A;  4JK1 A;  3ERE D;  3ZO7 A;  2DR6 A;  1F2H A;  4ZVU B;  2UUC J;  4LQ3 A;  1RU0 A;  3C14 B;  3NS6 A;  2B9W A;  3RYL A;  1CJK B;  3ICL A;  4NCG B;  7FD1 A;  4AFF A;  5CH7 B;  3GMG A;  4A8M P;  1C0A A;  3ZTQ A;  3FFI B;  5C25 A;  4X84 A;  1RWM B;  2QL7 B;  4QW8 A;  1VQ9 S;  1H73 A;  1U2F A;  5J2N A;  3CE8 A;  2SXL A;  3EZ5 A;  4OX9 F;  4QQB A;  3P5T L;  1IM4 A;  4ILD A;  3MPD A;  4P72 A;  3PEH A;  3QJL A;  3POT B;  2GVZ A;  1CQN A;  5LMU F;  1YX2 A;  1FDA A;  3AH6 A;  1KRP A;  4PEO A;  4DR5 J;  1YLX A;  2JA5 K;  4NLS A;  4F8R A;  1BQM A;  1VJQ A;  2DXF A;  3EE3 A;  2B4O A;  2K06 A;  5B0A A;  1PJ7 A;  4JYA J;  1DCP A;  4J9N A;  1NBE B;  4DQQ A;  3B78 A;  4DV3 F;  2BQU A;  4J9P A;  3P8B B;  1SFO K;  2DNY A;  3FRY A;  1MG7 A;  2VF3 A;  3ZC4 A;  1U45 A;  1WC4 A;  4NCA A;  2GNK A;  2OKQ A;  3IR5 B;  4EUV A;  2VIC A;  2PEB A;  2ZM6 J;  3N01 A;  4GC7 A;  2R2U A;  3EVM A;  2UUA F;  1U2C A;  1RT5 B;  3W65 A;  1MWZ A;  1YBA A;  5JVG Q;  1RCX B;  3QRR A;  2IM2 A;  1KTV A;  3FHZ A;  2X1F A;  2W4C A;  3UQS A;  3O2I A;  2BZ2 A;  4WFN Q;  1L3K A;  2DNO A;  2KN4 A;  1JJH A;  4QU7 A;  2KVQ E;  2DY9 A;  3OTC A;  4LRA A;  2P2C B;  4RBT A;  2N4C A;  4URQ U;  1CJT B;  3BSN A;  1JOE A;  3H0G C;  3DLE A;  3AY0 A;  4DPO A;  2KXN B;  4V19 X;  4PAB A;  2JL9 A;  4X4Q A;  1EJ7 L;  3D0H E;  2V6A A;  2IJR A;  3M1V B;  1NK8 A;  2ZBC A;  2D69 A;  5KFU A;  3A3N B;  1RT3 A;  4UUX A;  2CAJ A;  2QJ3 A;  2Y8Y A;  1TKT B;  4JI8 J;  4IOB A;  2UUW A;  3DU6 A;  6AT1 B;  1YJN S;  1ZM4 A;  1E6Y A;  5L38 A;  3CD6 S;  1QDU B;  1GNK A;  4IH7 A;  5IWA J;  3MD1 A;  3HOW K;  1HQE A;  2VIH A;  3L3C A;  2ZUE A;  3C6U A;  2RQ4 A;  3CJK B;  3W9J A;  2RT3 A;  3NAH A;  4DV0 J;  4OV1 A;  3M2U A;  2FLO A;  1VRT A;  1P8G A;  4IQX A;  2NZ4 A;  3SMZ A;  4CNY A;  1VQ6 S;  2V8G A;  2XSJ B;  1R3N A;  1YK9 A;  4JI0 J;  1R43 A;  4ZPV R;  4X4S A;  1NKB A;  4K59 A;  2AGQ A;  2HMI B;  2E7X A;  3LTO A;  2J8A A;  1RHU B;  2P6S A;  1XJW B;  2CNO B;  1SQG A;  2LLZ A;  1TK5 A;  3DRP A;  4QU6 A;  3MR5 A;  3HZG A;  1JLE B;  2ZD1 B;  3UPF A;  3IFE A;  1YG0 A;  2KG1 A;  3KXD A;  5FJ8 K;  3FC9 A;  2RUS A;  3UCU P;  5IYC C;  1IQ0 A;  1F1B B;  1IWG A;  4E2F B;  4OI4 A;  2ZBQ A;  4QWB A;  2A1B A;  1Z4U A;  1DLO A;  2GHW A;  1ZBT A;  5BR8 J;  3EWG A;  2BOP A;  2CFX A;  1M5H A;  4DSJ A;  4DQS A;  1FKP A;  1N36 J;  1SCJ B;  3OEP A;  3TR5 A;  2CAD A;  3OVB A;  2VUM A;  4A93 K;  2XTJ P;  5JMN A;  3RGI A;  1GFW B;  4EWT A;  2NPF A;  4CLS A;  4YUD A;  2OEL A;  3RAM A;  1KOO A;  2B9E A;  3QYY A;  5HMW A;  1S0N A;  2CIM A;  2LXI A;  3BO2 A;  5D78 A;  2CXE A;  2QLJ B;  4DUY J;  3W66 A;  1G6B A;  3M30 B;  1GTH A;  4HTI A;  1IBA A;  1RLC L;  3HI9 A;  3MAA A;  4A8F A;  2YX4 A;  2VON A;  3PR4 A;  2G9O A;  3H5X A;  2VPY B;  3TA0 A;  4KAS A;  4KM8 A;  3SZZ A;  1GXU A;  3FMW A;  3OXL A;  5B0E A;  1TKD A;  3L7O A;  4A8O A;  1MMD A;  2O5D A;  2N82 B;  4NA2 A;  1NDC A;  4CDI A;  3QJP A;  4NCB A;  2GML A;  2ZBI A;  4K4Y A;  1I6H K;  5KFB A;  3FCV A;  2HFO A;  1YJR A;  2YPZ A;  1F5A A;  3D66 A;  3PR5 B;  3C8Y A;  4CO3 A;  5DRK A;  4WP8 A;  5HBM B;  2BAN A;  1HIY A;  2HRT A;  4PQA A;  3OUY A;  1UZD A;  3ET6 A;  1OQ3 A;  3QSY B;  2XWX A;  3GV8 B;  3BDP A;  4BHQ A;  4LFC F;  1S76 D;  4KYZ A;  1WQH A;  1U09 A;  3TVZ A;  4ED0 A;  2YX1 A;  4QOT A;  2HNY B;  2GMJ A;  3OHA A;  2FZG B;  1QLN A;  2FIU A;  1SQF A;  3GTL C;  4BBS C;  1K0V A;  5ETV A;  4TVA B;  3GPA A;  4CLF A;  4GTF A;  2GX8 A;  3QIP A;  3BYP A;  2V8P A;  2RGR A;  4MFB B;  2HAF A;  1Q1K A;  4EBE A;  1WCM A;  2DKO B;  4DV4 J;  1HNW J;  3CTR A;  3PY8 A;  3N9U C;  4AXI A;  2NLW A;  2ROP A;  4FYX B;  2RS8 A;  2M52 A;  4M5G A;  5F0U A;  2NVX K;  1BWV A;  4DR2 F;  2JHE A;  2QT7 A;  1VQO S;  4DR4 J;  1FNX H;  4UY8 T;  2P6T A;  4NLQ A;  3GSI A;  2RF2 A;  2J7W A;  2BQR A;  2CNK B;  2DIT A;  1T03 A;  2FQT A;  5CYM A;  4DDF A;  2F3J A;  3LGH A;  2Z30 B;  2V6U A;  1SB6 A;  3BKU A;  4OJG A;  3LPX A;  1DQA A;  1CS4 B;  4Y2A A;  3M8R A;  1S9E A;  1UET A;  1MN9 A;  4H4K C;  3LGM A;  2XY7 A;  4ECQ A;  4F02 A;  2U1A A;  5LMN J;  4WTY A;  2I9S A;  4Q2M A;  4FPR A;  1FXL A;  1KLM A;  4HI2 A;  2V34 A;  3LAJ A;  3OPK A;  1CEZ A;  1WOO A;  2YWF A;  4L3K A;  1YVF A;  3W2V A;  3OTD A;  5I42 A;  1AXQ A;  3I0S A;  2WVC A;  2DXE A;  3DN9 A;  4QIW D;  4M5D A;  1M0S A;  2R7O A;  2QZ8 A;  2FYX A;  3HK2 A;  2WAQ D;  4DV5 J;  1JNR B;  1FK9 A;  3FSY A;  4GO5 X;  1KFD A;  3D54 A;  2CJQ A;  3BN7 A;  3D2W A;  4KKO A;  4P9S A;  4OIR A;  3HSG A;  3RR7 A;  4DJB A;  3DU5 A;  4PG4 A;  3DOL A;  2IA0 A;  3IRX B;  3MPW A;  3HOU K;  1MU2 B;  4ZHR B;  4A3F C;  1FES A;  2ZNZ A;  3S1Q K;  3DHW C;  3KWM A;  5EN1 A;  2CA9 A;  3OR2 B;  1AZS A;  3AQO A;  2AWZ A;  2LDI A;  4FP9 A;  4OYA A;  4NLO A;  3DYA B;  1RYR A;  2RDI A;  5KG0 A;  1T02 A;  4ZIW A;  1R89 A;  1X5O A;  2QMW A;  1X4A A;  2MPU A;  2FTR A;  1OQ6 A;  3G6Y A;  3RRH A;  1V5V A;  3RRK A;  3ENA A;  1HBO A;  2HQD A;  1BC6 A;  1NND A;  3IN5 A;  4K5R A;  1J5O B;  5F8H A;  2JSX A;  3KJQ B;  3T3F A;  2YNG B;  2PDA A;  1RTJ A;  2VG6 B;  3KNG A;  2YX7 A;  1WOS A;  2RD5 C;  2F4V F;  1TKZ A;  5A8W B;  2XUL A;  2QFJ A;  5ETL A;  3IA0 A;  4TYA A;  3SDE B;  4WK3 A;  3T02 A;  1LFP A;  1SV5 B;  2W7A A;  4RW7 A;  4RU2 A;  4QIF A;  3HSD A;  2NCK L;  1K1S A;  4OZ2 A;  1S6Q A;  5ETM A;  3KLE A;  4NOH A;  3UVJ A;  4ZVO B;  2YPY A;  4DF8 A;  3EVW A;  2WVB A;  5THW A;  1G3O A;  3HSZ A;  3IG1 A;  3MCO A;  4MTP A;  5HVF A;  1VMB A;  2W01 A;  2NVY K;  1JQW A;  4K50 A;  1DTQ A;  4PRF A;  1XN9 A;  2W7O A;  2ZOG A;  1RQ0 A;  2EFP A;  1FRK A;  3UN2 A;  4WKR A;  1LOU A;  1Z2L A;  1TWC A;  2F4F A;  4LF8 F;  4ZP9 A;  4B9T A;  2JLF A;  3KHR A;  4IG3 A;  4DSF A;  1I51 B;  2B0G A;  2WW4 A;  4MKB A;  1QAX A;  5FLM C;  2HZV A;  2BRK A;  1MMN A;  5C24 B;  4NI2 A;  2UXB J;  3M9N B;  4USW A;  2OD6 A;  4AYB D;  1D9D A;  2XC9 A;  3EGN A;  1KP6 A;  5AXN A;  1FHT A;  1U24 A;  4GTD A;  2EPI A;  2C1E B;  2B5J B;  4USV A;  5DG7 A;  2H51 B;  2DNL A;  3LP2 B;  2QC3 A;  1TWC K;  1UEV A;  4YP3 A;  4ZCK A;  1F9N A;  5DQH A;  2VQE F;  3ORE A;  2XMV A;  3DM2 A;  1Y1W K;  2IY5 B;  4DV1 F;  5LOQ A;  1FWL A;  5J1E B;  2DNN A;  5BJR A;  2R2T A;  2IIH A;  4Y28 C;  1YCL A;  1NAQ A;  5D0E A;  4Q0B B;  3MMB B;  2DGS A;  4DV6 J;  1S79 A;  1IXK A;  4OHW A;  1XZQ A;  1C0T B;  1TWF C;  4O4G B;  2DR8 A;  4C4W A;  2A69 A;  2DCL A;  2A18 A;  3ISZ A;  4PWW A;  2AGP A;  5EGY A;  4FXD A;  4A3I K;  2B3T B;  1HWI A;  4KV8 B;  6FDR A;  1HLW A;  5KG2 A;  2KM8 B;  3IM8 A;  4CH1 A;  3T1A A;  5LT5 A;  3J80 U;  5E41 A;  4ZJL A;  1UVJ A;  4X62 J;  2QG9 B;  3PO2 K;  2QEX S;  3IC1 A;  3HOV K;  1N88 A;  2KO1 A;  4AE5 A;  3FBC A;  4ZKA A;  5KFA A;  3NWR A;  4JI3 J;  3HVR A;  2JWN A;  1SJR A;  4IYQ A;  2C42 A;  3LWM A;  4P6Q A;  2EKY A;  2HKE A;  4HTJ A;  2YWW A;  3ENW A;  2J0S D;  3QWP A;  3OL7 A;  1VQ8 S;  2Y9H A;  2V63 A;  3THV A;  5AJ3 J;  3NEK A;  4K4U A;  3D0I E;  1Q8I A;  4G0U A;  1N32 J;  3Q86 A;  2C2N A;  1RTH B;  1VDH A;  5GME A;  3TP2 A;  1N34 F;  3GFX A;  1YJT A;  2DR7 A;  1RAD B;  2B7B B;  2FD2 A;  2PN6 A;  4USI A;  4A8S A;  1TUV A;  7AT1 B;  4PPD A;  4Z2X A;  3GJQ B;  1RTI A;  2YWK A;  3QGP A;  5IOQ A;  4RW8 B;  2Y0S L;  1HAR A;  3ZZO A;  2M2B A;  4JI5 F;  2AZ1 A;  3DDK A;  4YME A;  3RUB L;  3TVY A;  3C15 B;  1XMB A;  2HS4 A;  3A8I A;  1S1X A;  3L7P A;  1HNI B;  2WOM B;  4PG7 A;  4JV0 A;  1PJ5 A;  2PEH A;  4LQ9 A;  3R7S B;  1N5Q A;  3A8E A;  3M2V B;  3G86 A;  5LL6 d;  2JC1 A;  1RT2 B;  3N0B A;  1R27 B;  1YI2 S;  1B0V A;  1RDR A;  4F50 A;  1NUE A;  1B4A A;  1AA1 B;  4ZVG A;  1NJY A;  3LAK A;  1R0A A;  1RBA A;  4OIQ A;  1ISE A;  5KFI A;  2A0F B;  4B3R J;  4B9U A;  2B4U A;  5ETT A;  1VC0 A;  1WC3 A;  1LKZ A;  2XEX A;  4LK0 A;  3MED A;  1WKJ A;  2JA5 C;  4WU3 A;  2E29 A;  2CQI A;  4ZVT B;  5KTQ A;  3CDA A;  4ZVE A;  1DCH A;  4YFX A;  1UW9 A;  2CFA A;  4FKY A;  4LSN B;  4BBY A;  1HI1 A;  3T19 A;  4JUZ A;  2AJF E;  1SFO C;  4FXV A;  2OFG X;  4GTL A;  2G2O A;  1HA1 A;  5A0Y B;  4KY3 A;  5KFR A;  5AXL A;  4C8L A;  1M5S A;  2AQ4 A;  3SSQ A;  2C3Y A;  5GAD U;  2CG4 A;  2VQF F;  5HQ8 A;  4ED3 A;  1RAO A;  2ATL A;  4QIE A;  4O3Q A;  1GX5 A;  3EZO A;  2BJ7 A;  2CQ1 A;  1YZ6 A;  1NK9 A;  2HZC A;  4YY3 J;  4DQR A;  2R7V A;  1C0U B;  4A48 A;  1S1V A;  2I6W A;  4MK7 A;  3QT8 A;  4KAW X;  3SXL A;  4NLG A;  3R2C J;  5JUM A;  5KG6 A;  4A4J A;  2NPI A;  5K20 B;  3QT5 A;  4R0E A;  3ELH A;  4OIO A;  4OFZ A;  3CJ5 A;  3Q8V A;  3DLH A;  2RQC A;  2PA3 A;  2ZFH A;  5IT9 U;  3HD2 A;  1JLB A;  1RT1 A;  2HBZ B;  2H9Z A;  1RXO B;  3H4B A;  1QUV A;  2Y0B B;  4DCO B;  1CBK A;  2YNH B;  2BM0 A;  1YJU A;  2VZ9 A;  2E5G A;  5K8N A;  2MQQ A;  5B08 A;  3AFG A;  3GIJ A;  1DAX A;  4P71 A;  4XPE A;  2EK1 A;  1H6K X;  2FHO B;  2XYG B;  5C44 C;  4DL7 A;  3QGG A;  3O8W A;  4YB5 A;  1K1Q A;  4DSL A;  2R2R A;  2R4F A;  3U7J A;  3T5L A;  3HOW C;  3MD3 A;  1MRO A;  4J9Q A;  3FKB A;  1BWE A;  2OML A;  3RRG A;  3RZD K;  1S49 A;  3C3L A;  3CT9 A;  2JNJ A;  5D3G A;  4RW4 B;  5KFT A;  1CJV B;  3W8G A;  2JRS A;  1FRX A;  5KFG A;  1IBK J;  1EIY B;  1HI8 A;  1TL3 B;  5HJY A;  4CLW A;  1TU0 B;  3T1H F;  2B4V A;  2ACM A;  4RZR A;  3TW0 A;  3BH6 B;  2Z2L A;  4W90 B;  2V2K A;  2XCA A;  1FNO A;  2RDJ A;  4QIV A;  2B6A B;  5CXT A;  1C1C B;  3GTG A;  3D67 A;  3DC2 A;  3HOX C;  2BJ9 A;  4PCQ A;  4PWD A;  3SQG A;  2RS2 A;  1RP5 A;  1J5E J;  3ENV A;  3KTQ A;  2IDL A;  4ZVQ B;  5LJ5 Y;  4DX8 H;  5HL8 A;  1YWX A;  3H2U B;  4JI1 J;  2FJV A;  2MKH A;  4DFK A;  4I7F A;  2GW8 A;  2JVO A;  2AW0 A;  2PPB A;  3CIZ A;  1HMV B;  1ZZF A;  2BM1 A;  4NLX A;  2BOA A;  1YNN A;  2R7Z K;  1OY8 A;  1O2A A;  1HNX J;  4H4O A;  4S0M A;  3M4X A;  3SSR A;  1CC8 A;  1IKW B;  1S1U A;  2E2J K;  2B63 A;  3GTG K;  4A93 C;  5DDO C;  2E9Z A;  1KQG B;  3FBF A;  3GON A;  2RHQ B;  3GLJ A;  3JAM Y;  2MKI A;  2XLK A;  3J81 Y;  3OW2 R;  1NME B;  4DQI A;  1IR2 A;  4LF7 F;  2DGQ A;  2B8Q A;  1OJ4 A;  3T5H A;  4LF9 F;  3ISN C;  4LQY A;  3K0J A;  4DPX A;  4DPY A;  3KLI B;  3UDV A;  2FJW A;  2FC8 A;  4PQU A;  3UD3 P;  2H54 B;  5B0G A;  2BMB A;  2GSO A;  2HSE B;  3S14 K;  3QFH A;  3VQT A;  1VBX A;  3MTK A;  1D8Y A;  3R27 A;  5IOL A;  1FO1 A;  5DGA A;  5HO4 A;  4C97 A;  1NKE A;  1HD1 A;  1ZAW A;  3GEE A;  3QSI A;  2MQL A;  2MZJ A;  1ZAV A;  4NRU A;  2M7S A;  1UCN A;  4IFV A;  2HND B;  3HKW A;  1VS3 A;  3LGN A;  3HFZ B;  1I94 J;  1VCT A;  2OEM A;  1CQM A;  2UU9 J;  3T00 A;  1TUW A;  4HT5 A;  4CO4 A;  2GVD B;  5A76 A;  4N76 A;  4W4M A;  1I5O B;  4WZQ A;  4ICL B;  5CZX A;  3WHI A;  3CAG A;  2KH9 A;  2QA2 A;  3IRW P;  5M5X K;  2W8L A;  1LV5 A;  4OHV A;  1WSV A;  3R5A A;  4B17 A;  1WHX A;  3E01 A;  5EHH A;  4B3T J;  2XBP A;  1NHV A;  1Q4R A;  2DNP A;  4Y2I A;  3MUR P;  1FJE B;  1RUS A;  2V94 A;  4WWS A;  3CF5 Q;  1V3R A;  5CQG A;  5A8K B;  3CDE A;  1LW0 A;  3THT A;  2MY7 A;  3R1L A;  3VA7 A;  1KKH A;  4B02 A;  5C2G A;  3TQE A;  2CJA A;  1BS2 A;  3NP5 A;  1M5P C;  4LR2 A;  3Q8U A;  2V4R A;  3IM9 A;  4C11 B;  1N5T A;  3IPJ A;  4C45 A;  4OZ3 A;  2B9Y A;  1SIZ A;  4A8W A;  4IUF A;  2WBM A;  2NVX C;  2CPI A;  1S0O A;  3NKY A;  3RU0 A;  3BGU A;  1QTN B;  1DQ8 A;  4I0W A;  1Q16 B;  2AIR B;  3FVY A;  4FBU A;  1IWA A;  2HIQ A;  3JSM B;  1UJ4 A;  5IYB K;  3CJ3 A;  3AXM A;  4KGZ B;  3V81 A;  3OTO J;  4G0W A;  5DO2 A;  2M5Y A;  5IT0 A;  1N5Y B;  2MQO A;  2HHH F;  2ZE2 A;  3R2D J;  2W2O P;  3W2W A;  2PT0 A;  4CNZ A;  4PWU A;  3ZTS A;  4C8N A;  4FF3 A;  2CQ2 A;  4OZ5 A;  4UQT A;  4KGK A;  2LQ5 A;  1TL7 B;  3AOC A;  4ED1 A;  3TO8 A;  2CQ0 A;  3RW6 A;  5EGE A;  1L3S A;  2KFN A;  2HWT A;  2DNZ A;  2MZQ A;  2W1B A;  2ASY A;  1WQG A;  4GKK F;  5F9N A;  1EQR A;  3HXM A;  3HZE A;  1BJT A;  2BJ8 A;  1I50 K;  3S15 K;  3QID A;  1K9M T;  5CYJ A;  2HW3 A;  5HVG A;  1JLF B;  3OL6 A;  4ID5 A;  4DV7 F;  2AF6 A;  4AL5 A;  3GEI A;  1U6F A;  2CDQ A;  1WF1 A;  2VC0 A;  5C42 A;  3EX7 B;  3NS5 A;  4YB1 P;  3K58 A;  2KRR A;  1NKC A;  5KFY A;  5GVQ A;  3J81 j;  1VRU A;  4LBI A;  2YKN B;  5DLF A;  2UVV A;  2YKA A;  4YQW A;  2OPS A;  3PIP Q;  3R5G A;  1GT8 A;  4X64 F;  2JOQ A;  3HHL C;  1S4F A;  1RBO B;  1S57 A;  4GVL A;  5H9F J;  2ROG A;  2PE8 A;  2CWX A;  3H25 A;  4FZB A;  3NMR A;  3BH7 B;  3I9V 9;  3GCW P;  3OV7 A;  2XMK A;  2D74 B;  4IO1 A;  2HIY A;  2YU9 A;  3HOU C;  3MM6 A;  2ZZM A;  5E7O B;  3CCW A;  2VKZ G;  4KMH A;  4OHZ A;  4L72 B;  1WKL A;  3SEO A;  4CM0 A;  3N5B A;  1HWU A;  1SKS A;  3NGT A;  1QUP A;  4DR7 J;  4QWA A;  1O2B A;  1F7V A;  2BQ3 A;  4I1T A;  5AE3 A;  1CJU A;  2JJ4 D;  1I3Q A;  3G2X A;  2CJB A;  4GVB B;  1HPZ A;  1Y1V C;  4NPO A;  3Q8Y A;  4B3M J;  1TKX A;  2CJX B;  3KHH A;  4HI1 A;  1EKS A;  5TMC A;  3DDN A;  3KFW X;  2YU9 K;  4DR5 F;  2E2H A;  3I4N K;  2QRR A;  4QJV A;  3TVK A;  3RAX A;  3O6Q A;  3BJY A;  3GEH A;  3R9L A;  4LRC A;  1O24 A;  4LLG A;  1CSJ A;  4P5A A;  3V4I B;  1TWG A;  1GXL A;  3LP0 A;  1SKU B;  3ZTP A;  1WD6 A;  2ERR A;  3KJV B;  3S8S A;  5I3U B;  4FM9 A;  4BY7 K;  2H5E A;  1VI7 A;  2D3U A;  4TQS A;  1E6V B;  2X1B A;  2KVI A;  5E5N A;  4PG6 A;  4B9S A;  1B0P A;  1NK6 A;  4B3S J;  2ZM6 F;  5IP9 K;  4R5P A;  2FDN A;  3J7A N;  3M2R A;  4B3O A;  1ZS6 A;  3C19 A;  4TYB A;  3MGJ A;  3Q8R B;  1JLG B;  3HJF A;  4LF4 J;  2NVY C;  1XMO J;  1S1T A;  2R8J A;  1YJW S;  3CQZ K;  1TWG K;  3IMQ J;  2I5J B;  4TN2 A;  4ER8 A;  1NZA A;  3TUZ C;  3DRS B;  4Y65 A;  4OYM A;  4K5S A;  3MEE A;  1ZA1 B;  2EEY A;  5M2P A;  1WOP A;  3I0R B;  3NAI A;  1FEH A;  4RMF A;  1LWC A;  1VQK S;  4P7V A;  2O5J A;  1RAG B;  1JLA B;  3TZY A;  3D1H A;  3I82 A;  3ZTR A;  3V4G A;  3BGF A;  1SXL A;  1U7L A;  4KN4 A;  3MTJ A;  1S9F A;  5EWF A;  2ALZ A;  3D0G E;  5K9F A;  3BP3 A;  5KT3 A;  3KLH A;  3BV8 A;  4IFY A;  5SUH A;  1INN A;  2XHW A;  1WG1 A;  3K5O A;  1PKU A;  3MI7 X;  1TK8 A;  4Q45 A;  4CLT A;  1V6H A;  1LW2 B;  1Y1W C;  4NXN J;  2E1P A;  5IWA F;  3ETO A;  2JEF A;  4Q8E A;  3R1H A;  2HHT A;  3IBC B;  2FHJ D;  4X65 F;  4X66 J;  3OFG A;  1T9Y A;  4YFN A;  3L95 X;  2IMW P;  1V3Z A;  4JI0 F;  1L0W A;  1DAR A;  3PKY A;  2CZ4 A;  2MZT A;  1FFG B;  5ETQ A;  4FF2 A;  2U2F A;  2DHX A;  3BUE A;  4LFA J;  5C25 B;  3H5S A;  1HHQ A;  1HFE L;  2DNR A;  3MM7 A;  1XEZ A;  3MAH A;  2IHR 1;  5J2N B;  1R8C A;  4UW2 A;  1B99 A;  3PO2 C;  3D7S B;  2HGN A;  3CJS A;  3GTQ A;  1WWH A;  4IO9 Q;  2GVZ B;  3UR0 A;  2WON A;  3DGV A;  4PUO A;  2DBB A;  5EX0 A;  2XCP A;  5A6W A;  2FJA B;  3HFK A;  1REV A;  5LM7 E;  2W2N P;  4UT4 A;  2QE5 A;  1BQM B;  5HAT A;  1ZET A;  1RCO B;  3D6T B;  3IBF B;  4DU8 A;  5J2Q A;  1D1U A;  4QBU A;  2ZHO A;  5EWG A;  1IKX A;  1Y4Z B;  2CPX A;  2YWE A;  3FZB A;  3HKZ D;  3GTJ K;  2KKH A;  4R25 A;  2AJ4 A;  4LRE A;  3AXK A;  3MCS A;  2OGU A;  4CYU A;  2DNH A;  3MEG A;  3N5F A;  4DX5 A;  4TXS A;  1UWB A;  4ES1 A;  3SYZ A;  2CPH A;  3DNC A;  2DR5 A;  2AJ1 A;  2YVS A;  3HT0 A;  1QE1 A;  2AT1 B;  1HR0 J;  2CJK A;  3JXO A;  3MFH A;  3DGP A;  4V19 J;  2HK2 A;  3FNN A;  2EWH A;  3FSX A;  4AL7 A;  1TL1 A;  1CC7 A;  3LPE A;  1D09 B;  3F44 A;  1IQT A;  3KK3 A;  5L1L A;  3MR3 A;  1M1K T;  3P5B P;  3DLE B;  3THP A;  1FTR A;  4QYZ J;  3A1Y G;  4C7Q A;  5IQ6 A;  4YOE A;  1K83 A;  3JTP A;  3EGW B;  3PVX A;  3D3B J;  1G2E A;  3GR0 A;  3PAC A;  4FYW B;  4NZ0 A;  2NSB A;  1MWQ A;  4ECR A;  1RT3 B;  1TL4 A;  1UL3 A;  3QO9 A;  5C4J K;  3JTN A;  3U1L A;  2ZOF A;  3N0V A;  3HMJ G;  5HMX A;  3QBC A;  1JLC A;  4A8X A;  5IM0 A;  4JOU A;  4KH0 B;  1SC1 B;  2J6U A;  1FFW B;  4YHH J;  1E6Y B;  3WZ0 A;  2F7V A;  3SCK E;  2F63 A;  4CT8 A;  4QIG A;  3FJ2 A;  1S48 A;  4WTO B;  2DCU B;  4OL8 A;  2V2Z A;  1HQE B;  3C6U B;  1MN7 A;  3OSN A;  4JV5 J;  3MPY A;  3DKD A;  2ZHA A;  3M2U B;  5CYQ A;  2BBE A;  3ZZ0 A;  4X4V A;  1VRT B;  2A3J A;  4ERD A;  4LVN P;  2AU0 A;  4Z37 A;  2MB0 B;  4MMO A;  2QGF B;  1HI9 A;  4DV4 F;  4CLY A;  1Q8L A;  5E3R A;  4X4R A;  2JA7 K;  2VOP A;  3MR2 A;  5DG9 A;  1BXN A;  1IKY A;  2LQB A;  1NB2 A;  2GQQ A;  3DRP B;  4P2F A;  3KMS A;  5LJ3 Y;  3MF5 A;  2MKS A;  3HFV A;  3QGI A;  3ZZR A;  5IC6 B;  1D3W A;  4H4M A;  4LF6 J;  1WEY A;  1VIX A;  3CME S;  1F9F A;  1SKR A;  4NLP A;  2DNM A;  1S59 A;  1JVI A;  1DLO B;  2DGT A;  3GTK A;  1BGW A;  4OQJ A;  3GWC A;  2YTC A;  2XMU A;  3D6H B;  2D41 A;  2ZDP A;  3VGT A;  1P9Q C;  2DIU A;  2HQ3 A;  4ZCI A;  2VKR A;  3M32 A;  1R6Y A;  1FKP B;  3LQV A;  4MT1 A;  1Q82 T;  3UD4 P;  4C6A A;  4XTT A;  3DXB A;  1RWU A;  2GGP A;  1D9A A;  4YR3 A;  2HQG A;  2DGU A;  1U4B A;  2DK2 A;  4LBP A;  1RHK B;  4TKT A;  3PW7 A;  1VK3 A;  2AYG A;  1VFJ A;  2PGC A;  2IVY A;  4NEY A;  1MSW D;  1U8S A;  4WU2 A;  5JFE A;  2C22 A;  3G6E S;  2XY6 A;  3MAA B;  3RZD C;  2HS3 A;  2MKK A;  5CAB A;  3VAK A;  1NK4 A;  2HLU A;  3MM8 A;  3SBM A;  1O28 A;  4CH0 S;  2KRB A;  4USJ C;  2DRB A;  1WNE A;  4M5J A;  2E9R X;  1V5I B;  2V4J A;  3RAQ A;  4DN0 A;  4N8O A;  3QT7 A;  2JEJ A;  2W2Q P;  1UVN A;  2DH8 A;  4F4Z A;  3G8T A;  2G0I A;  7FDR A;  4QIW L;  3GTM K;  3AHP A;  5A2Q Y;  3CCZ A;  2WAQ L;  4GTE A;  3SFG A;  1PYT A;  2E7W A;  3TWZ A;  4Q44 A;  5KFK A;  2E5I A;  2K7K A;  1RZM A;  3MM9 A;  1YIJ S;  2NYI A;  4DCJ B;  3ADA C;  3O5T B;  2BAN B;  3UDC A;  3OUY B;  1Y00 A;  2HHQ A;  1VK8 A;  1IBL F;  3ET6 B;  4DR3 J;  4E0D A;  2V8H A;  5MLC V;  2R7Z C;  1Q95 G;  3PO3 K;  4NXM F;  3ETM A;  4A3L C;  1JWW A;  1FCA A;  2RB7 A;  2CJY B;  3FQL A;  2E2J C;  3WOD A;  4ZCL A;  3V6D A;  3GTG C;  3Q2S C;  2YKQ A;  1LQ9 A;  4PXD A;  2R93 A;  5D4L A;  4YN3 B;  3VGU A;  2XY5 A;  2BJ1 A;  2AV5 A;  4BLG A;  3CDW A;  4OX9 J;  1KTQ A;  1NPP A;  4XK8 C;  1FRJ A;  2ASJ A;  4CP5 A;  3QIP B;  4DOZ A;  4JI7 F;  1ZTT A;  4YB6 A;  4A3M C;  1FT8 A;  4PAA A;  2FUG 9;  3TRG A;  2PSZ A;  4OYI A;  1PC5 A;  5LMU J;  4Q8F A;  3GQC A;  3HUL A;  4I69 A;  3FSI A;  1VBY A;  3UW1 A;  5TMF A;  5F3T A;  2H1Y A;  2D3O 1;  3HSJ A;  3OR1 A;  3PYG A;  3AOA A;  1U25 A;  2IC3 A;  1KDN A;  3TJ8 A;  3ZXW A;  1RAH B;  3MEC A;  4WFZ A;  4NML A;  2LEA A;  1VBZ A;  1VLO A;  2RF2 B;  2ZH9 A;  2BYC A;  2CG8 A;  2HG4 A;  1T03 B;  1U0H A;  5CYM B;  4DV3 J;  3S2H C;  2AYM A;  5F8G A;  2IM3 A;  2D9O A;  4DQP A;  1VIS A;  2ALY B;  4DX6 A;  3JYT A;  3N6L A;  1S9E B;  1IS1 A;  1H7W A;  4G7O A;  4AND A;  1HNZ F;  2G13 A;  1S72 S;  3WDO A;  1HW8 A;  4BLA A;  4BWM A;  2V0N A;  4CLL A;  3BR8 A;  3JSR A;  1BD6 A;  2UUA J;  1KLM B;  4J9R A;  4U96 A;  3BPS P;  2YQ0 A;  4C8K A;  4OZ1 A;  5F8I A;  3HOZ C;  3W1Y C;  3VV2 B;  3W2V B;  5I42 B;  1U1K A;  4ZCM A;  2ZH6 A;  1QAY A;  3I0S B;  3MR7 A;  5G4D A;  2AX1 A;  1S7H A;  4M5D B;  4Y7N K;  3MCN A;  2POK A;  5B0F A;  1Q8B A;  3CJ4 A;  4G65 A;  2ZHB A;  3OFH A;  2VU5 A;  2J7K A;  1S0V A;  3DLG A;  2FJX A;  2E5L J;  1SL2 A;  2DNK A;  2C2O B;  1FK9 B;  3WC2 A;  4C2M K;  3Q83 A;  1LEO A;  1HWL A;  3UDE A;  4KKO B;  1KVI A;  1UFW A;  4CTA A;  3EYZ A;  1Y3J A;  3B4M A;  2E2I A;  4AYB L;  4ECS A;  4N47 A;  2FC9 A;  5D4N A;  4D3G A;  1M1H A;  2DH9 A;  2UZA A;  3DOL B;  4RBU A;  1O8B A;  3W9I A;  5KFW A;  3V6J A;  3M6W A;  4WYW A;  3P49 B;  1ZM3 A;  1RIS A;  2DGX A;  3FKI K;  1F3V A;  5IYB C;  3LOU A;  2IYI A;  3K7A K;  4ZVH A;  5L39 A;  1AZS B;  5L46 A;  1ZVU A;  2W8K A;  1EKR A;  1R0B G;  4XLP A;  1USO A;  2AJ2 A;  3BP8 C;  1RWN B;  5KFD A;  2ZIT A;  5JJB A;  2W7P A;  2DB1 A;  3RJM B;  3HHE A;  1MML A;  2A10 A;  3AB2 B;  3RZO K;  3NCP A;  4QCL A;  1N54 B;  3CD7 A;  1HBO B;  4YFU A;  4HR2 A;  2YWH A;  5DM6 Q;  1I50 C;  3S15 C;  2CKW A;  4L74 A;  2HVI A;  2X3G A;  4DHV A;  2IJF A;  1RTJ B;  3Q89 A;  2FJD B;  1N32 F;  2XZD B;  3MPV A;  1TKZ B;  5I3Q A;  5E3A A;  1N4L A;  3H4D A;  3H40 A;  2ACY A;  2K1R A;  5AT1 B;  1WHY A;  4WJB A;  3OXG A;  4M63 A;  5HMZ A;  2NSC A;  4ZPD A;  4RW7 B;  1O51 A;  1IBC B;  4UTG A;  4CO2 A;  1S6Q B;  3KLE B;  3UVJ B;  1S6U A;  1WOR A;  3JQJ A;  3IG1 B;  3AJD A;  1RTZ A;  1YJ7 A;  4Z7Y A;  3LAL A;  4IH5 A;  2PMZ D;  4H54 A;  1DTQ B;  1ZPV A;  2XS5 A;  5A8R A;  5KOW A;  4EFA C;  5L1J A;  1BY9 A;  5H9F K;  3GTO K;  1SL0 A;  5H9E K;  3PRB A;  2AMC B;  1UJ6 A;  3GG0 A;  4FF1 A;  4ILL A;  1F7U A;  1VQM S;  4IG3 B;  1MLA A;  4F4K A;  2DT9 A;  4NLU A;  1QSL A;  1FFS B;  4TQR A;  5DZ6 A;  4NI2 B;  3NGU A;  1X5P A;  4KFB A;  1T7P A;  3SSS A;  3KYL A;  1YKW A;  5HLF A;  4FKX A;  3HVT A;  2OPR A;  2YU9 C;  4ES3 A;  1NDP A;  3BS9 A;  3I4N C;  4FN5 A;  4J37 A;  4ZPC A;  1J98 A;  1K0T A;  4A3J K;  1EK8 A;  5K5M A;  1Q78 A;  3MUT P;  3DM2 B;  1LK5 A;  2WBR A;  4P10 A;  3ZZU A;  2VFS A;  4GT9 A;  4O3P A;  3RTV A;  3M8S A;  1HWK A;  4O44 A;  2FY1 A;  4ZPT R;  2XB2 D;  4KMA A;  4A3K K;  2PI4 A;  2YKM A;  4L6V 3;  3DOM A;  4ZP6 A;  1XZQ B;  4ZH4 A;  4F4Y A;  2ZBR A;  1WEZ A;  3GFZ A;  3MZI A;  3CCM S;  2B4P A;  1TWH K;  1R9T K;  4EZ9 A;  2G0C A;  2HNZ A;  3GCX P;  2YXL A;  1RHJ B;  4QZV B;  1F9E B;  1VHI A;  2BA9 A;  3CQZ C;  1TWG C;  5K14 A;  2C2E A;  4I2Q A;  3H42 A;  1O2F B;  4K2X A;  3QPI A;  2J6S A;  4O23 A;  4BC7 A;  4AT1 B;  5HI7 A;  1REG X;  4JI4 J;  4DL3 A;  3AD9 C;  4KAT A;  2Z2M A;  3DRX A;  2AYE A;  4OHX A;  3WC0 A;  3LAN A;  3CGI A;  1J27 A;  1TWA A;  2CW0 A;  2JA8 K;  4M94 A;  3PTW A;  4XIU A;  3AJ1 A;  4NLV A;  3AT1 B;  2NXU A;  3OBI A;  1KHV A;  4DR2 J;  2H5J B;  2ZKU A;  3T01 A;  4WPA A;  2M8H A;  4LR8 A;  4LJZ A;  2LFV A;  2PFF B;  2XS7 A;  2B43 A;  2Q6B A;  1LNQ A;  1RT7 A;  1NJX A;  4YG2 A;  5GAH U;  5KFM A;  2R8I A;  4WFX A;  2J9C A;  2C2D A;  2IPO B;  5FLX U;  1LXJ A;  2YQ3 A;  1Y5L B;  1JX4 A;  3R5C A;  1KWM A;  1RTI B;  3TA2 A;  2OUG A;  3NGS A;  4HAC A;  5HP1 A;  2KXH A;  3HF5 A;  1L3V A;  4RBV A;  2UV8 A;  3AAW B;  3TAN A;  1BQX A;  2GJF A;  4ILM A;  1S1X B;  1J6W A;  5D0H A;  3F73 A;  2XCR B;  2X1A A;  2XCQ A;  1NDK A;  1JKH A;  3MWB A;  1N8R T; 
#chains in the Genus database with same CATH homology
 1WSV A;  3A8J A;  3TFH A;  1WOP A;  3ADA C;  3GIR A;  1XZQ A;  5L46 A;  1V5V A;  1PJ7 A;  1YX2 A;  3TFJ A;  3GEE A;  1WOS A;  3GEI A;  3TFI A;  1VRQ C;  4PAA A;  1WOO A;  3TTG A;  3A8I A;  2GAG C;  1WOR A;  3AD7 C;  4P9S A;  4PAB A;  1XZP B;  3AD9 C;  1PJ6 A;  1XZP A;  3AD8 C;  3A8K A;  1VLO A;  3GEH A;  1WSR A;  3GSI A;  1XZQ B;  1X31 C;  1PJ5 A;  2GAH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...