1X31C

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords Sarcosine oxidase alpha subunit
total genus 51
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1x31C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1x31C01
3AD9C 3GEEA 3TFHA 4PABA 3ADAC 4PAAA 2GAGC 3GIRA 2GAHC 1VLOA 3GEIA 1PJ7A 1XZQA 1WSVA 1PJ6A 4P9SA 3GEHA 1XZPB 3A8KA 1XZPA 1V5VA 1WOOA 1XZQB 5L46A 3TFJA 3AD8C 1WOSA 1WORA 3A8JA 1PJ5A 1WOPA 1WSRA 3TTGA 3AD7C 3A8IA 1YX2A 3GSIA 3TFIA 1X31C 1VRQC
chains in the Genus database with same CATH superfamily
3MHYA 2FQTA 4K4TA 4RW9B 4LVOP 2HHHF 2QLBB 3DLEA 2E9TA 3MDFA 4CO4A 3QRQA 3N6LA 1I94F 4DR4J 3G6XA 3AXMA 4QYRA 3BKUA 4DSLA 1IR1A 1HHTP 2XCQA 2MKHA 4X64F 4C8ZA 2VUGA 1R6YA 3FMBA 1A9NB 4JP8A 3V4GA 3NMAA 2O5DA 8RUCA 3KJVB 2VJVA 4OYZA 3TA1A 3KKFA 4FXWA 3TAMB 4ZVFA 4KC6A 4LSLB 3G4AA 2MYFA 1D8ZA 2R8HA 3UDEA 4YY3F 2ZNZA 4B02A 3QT5A 2XWYA 1R9TC 3MURP 2IHR1 4EO6A 1HNXF 4LRAA 3A1YG 1Z4UA 4HHUA 3OV7A 3R6GB 1RT1A 2J5AA 5LJ3Y 3ELHA 5KG6A 4O44A 3FKIK 4LVNP 4DCPB 3AJ1A 1X8DA 4LOWA 1WC4A 3MM6B 1TKZB 1H0HB 1DJ0A 4MT1A 2XCPA 1FFGB 3V6DB 1R27B 1YZ6A 5A8RB 2NSBA 2R4FA 2NPFA 1HR0F 1QUVA 3DI6A 5ETSA 4LQ9A 2B7CB 4WJ3M 2VPXB 3M8WA 4GKKF 1X5SA 1ZTTA 3W9JA 5K9FA 3VVTA 3IRXA 4M5KA 1KR4A 3FDSA 1TL4A 4R8UB 3KLVA 3CCES 4Z7YA 1IXKA 4R0JA 4LJZA 1Q86T 2DGSA 2QFJA 2CFXA 4LSNB 1MN7A 2AQ4A 1M1HA 4GVLA 4ZHRB 3MI7X 1HPZB 3OLAA 4LLGA 1I3QK 4AL7A 1NMEB 2RQKA 1YNNA 3EZUA 3P3DA 2CZ9A 1SH0A 4QR2A 1M0SA 2YNFA 1V3SA 3TX0A 3O1LA 3W65A 1KN6A 2DH7A 2W2OP 3W5XA 3HVAA 1FEEA 4USJC 3ZZZA 3IGVA 3R27A 1BQXA 4A3CC 2GJFA 4ETZA 1O2BA 4QIVA 3JSTA 1KTVA 1UVJA 3LW5C 1Z1ZA 1S59A 3PACA 1RT5B 2NYIA 3QQCD 1VISA 5ETLA 4KMHA 1D1UA 4NA2A 5E3AA 2C2MB 4USTA 3LAMA 4K4YA 1ZM3A 1OO0B 5KFVA 3OTOF 1TKXB 1DCOA 1RHUB 7AT1B 1S0VA 3QIPB 4KQZA 3BSNA 4RMFA 2DNNA 2G9OA 1N33F 3PG9A 4B9VA 1VR6A 4PQUA 1SVDA 1JKHB 2RDIA 4ZCLA 2MZQA 2CG8A 3D4JA 2M8HA 1NK8A 3MM8A 2FQQB 5IQQA 5MAOA 3BEGB 3I0RA 4FKYA 3DDKA 4A3GK 4LJMA 4DSIA 3WX8A 3MPWA 4NLOA 1MWYA 3GJSB 2QSFA 1VBXA 4CYUA 2DYAA 3UN5A 2RNEA 2ZHOA 1XR7A 3HHKA 4KKOB 3W8GA 4PG4A 2RAQA 4N47A 5LT5A 3OW2R 6AT1B 5DG7A 1YJWS 4W98A 2L9NA 4FN5A 2CZVC 2V6AA 4PPDA 3OL8A 2RQMA 2HFZA 3L9ZA 2EC0A 2E2JC 2DITA 3MCMA 2PMWA 2ZOGA 1JOEA 3AB4B 1P1LA 2LLZA 1SKSA 1S9FA 3FHZA 2IM1A 3GDZA 3BN7A 1VQLS 4MK7A 3I32A 4ZCKA 1UVIA 3QJPA 2V8DA 2Z2LA 3A8EA 3D3BJ 4OI3A 1DLOB 3N01A 2RJZA 1VBYA 1H3DA 4O3OA 3E3XA 3GFHA 1XNRF 3M8PA 5GVQA 1O25A 3QLHB 4TLRA 1UVMA 2JX2A 4NLUA 2AJ4A 5IWAJ 5C3EK 3A8IA 2C42A 1JLBA 1T02A 3NWRA 4G1IA 1VQ9S 4V19X 1GAOA 1KFSA 3W61A 2LXUA 1EETB 2Y1JA 2BXJA 3DN9A 3MAAB 4MKAA 4DLEA 1USMA 4M5DA 3VAJA 1T05B 5KFCA 5HQLA 3CJQA 1FNXH 4WE1B 1Y1VK 3UQSA 2DXFA 4ECXA 4KR0B 1CQNA 1Q8BA 3HJVA 4J9OA 2AV5A 3I31A 1DAXA 1WOSA 1I50A 2E2HA 4J9SA 4KC5A 1JLGB 1RAEB 1NDKA 1RHJB 4DF4A 2HZVA 2V8VA 3R97A 3Q8SB 4YB6A 3QAEA 2IAJA 4JBCA 3DOLB 4NCBA 3X1LB 4B3RJ 2YNHB 2J0WA 2HFNA 2ALZA 4QIWL 2CQGA 2DO4A 3HHNB 3CWJA 2OGUA 1TL7B 3JQJA 4WFXA 2R7WA 1SL1A 3EXCX 3MR7A 4ELUA 3Q8RB 3LWLA 4LF2A 2FLPA 2KO1A 4KN4A 3VZIA 3BKFA 3AD8C 3M1VB 1WACA 1R8CA 1D0EA 2RF2A 3DNCA 3U02A 3CCRS 3GIJA 4G1QB 3OTOJ 1HNWJ 3D0IE 3QT7A 4KHPJ 5H9FK 3BREA 3CIMA 4IDKA 1ISEA 2FJBB 2YWKA 3T1AA 3IWNC 4OQJA 1RCXB 5BYSA 2LKZA 4TU9A 3A3NB 2F7VA 1UFWA 4QPTA 4B9LA 1VBKA 4BC9A 1DRZA 2IDEA 3D1HA 1N5VA 3VGVA 2VJUA 1RT4A 4DR7J 4OZ5A 5M2UA 3W63A 2OPPA 4P71A 2IC3A 2HRUA 3AHPA 4RLEA 3H5YA 2OMLA 1JLAA 4KHRA 2NYHA 2E7XA 5C4JC 2V8GA 4QYZJ 2AYGA 2FGCA 1YRUA 2AP6A 1XC9A 2YVSA 1HIYA 2EG1A 3R5GA 3HT3A 2GC8A 2MGZA 3CF5Q 2CQ2A 2CNNB 1TL1A 2V6TA 2BR0A 2CWXA 1SV5B 3JB9k 2ADBA 2B63A 4TXSA 1UVLA 1TWGA 1GEHA 3OHBA 1LW0B 2KXNB 1LWEA 3L09A 4J9VA 3SCJE 3QWPA 3RBXA 5KFPA 1T3NA 3BR9A 4LR8A 2FGOA 1CPZA 2NS1B 2K06A 1LK5A 2OPQB 2MSSA 4A93K 3V4MA 1OJ4A 2HK3A 3GTMA 2W25A 2NZCA 4V19J 1U8WA 4ICLA 2VG5B 2FHKA 1Q81T 1N6QA 1UAWA 5JFEA 2VPWB 4PWDA 2P2CB 4GZYA 4ZA1A 1DQ8A 1GH8A 4QJVA 4NXNF 1JLAB 3MTKA 5LSOA 5D77A 3O3LA 3DLLQ 2XLJA 4F0HA 3QZ7A 2IRXA 4K4WA 5FDLB 3SQOP 4A3GC 5J1NA 5DDQC 1WC6A 4DV4J 2MQPA 3CDAA 4QU7A 1RT1B 1U1OA 4BY7K 2GQCA 4KIAA 1DQAA 4GTBA 3ILLA 2R3VA 3SCKE 2KRBA 2VICA 3HDSA 2X1BA 3GG1A 1RTJB 3GYGA 3GZ7A 3HKZL 2JA8K 4WTOB 1SIWB 1I6HC 1GMVA 2ZJQQ 4L72B 2HQ3A 2CG4A 3VAFA 3CT9A 4ZS6A 3R6LB 4F04B 2GX8A 2EK1A 3M2VA 2BOPA 4JI1F 1V3RA 1TWAK 5IYBK 4RW6B 3HOWK 5IT9Y 2UU9F 1CJVA 1S57A 1H7XA 1N8RT 1IQZA 3OEPA 2Y3YA 2CPDA 4IFYA 1VJWA 3NS7B 5I3PA 5KFUA 1RXOB 4P6QA 2FLLA 2EFGA 3J7YU 3ILJA 3G4CA 2G2ZA 3AB2B 2V4JA 1FKPB 4WFBQ 4PXBA 2KHCA 2CPHA 1N0UA 2CJKA 4PAAA 2E44A 3C16B 3ICLA 4AYBD 1QSYA 3T6JA 2WBRA 4N7TA 2J7KA 3ENVA 2DGVA 3KYLA 3KUHA 4H4MB 2GVDA 2I1RA 5IXUA 5FIIA 2W9CA 1T03B 5ETMA 1RT5A 2QTWA 5C5JA 2HPUA 5GAHU 4ZVGA 4F3MA 4ELTA 5HQMA 1P9QC 1N34J 4DZDA 1S1XA 5KFSA 2HFOA 4KHPF 2XHWA 1RTHA 1LNQA 2YTCA 4FYYB 2Z2MA 4Y2KA 4WZQA 1GXUA 3PX6A 1SFOC 1EQ0A 1NPKA 2HVEA 3MEGA 4B3OA 1NKEA 5E3RA 3OR1B 3S7RA 2B7BB 4UOCA 4JV5F 1WORA 2BE2B 3K57A 3D66A 2DIUA 2DRDA 2OEKA 3K5NA 4DV1F 2HNDB 1JLQA 1JIHA 4BY7C 3RB4A 1U47A 3DU5A 2FJVA 3M2RA 5A0YB 3VV2B 3JSBA 2BE5A 2HGMA 2RS8A 3WC0A 2FYXA 1JLFA 2FY8A 2G2YA 3VGUA 1ULRA 1NK6A 5CABA 3CGIA 3CTRA 2AYEA 1M5VC 1FRXA 3LPEA 4G3IA 4WIQA 1BLUA 4QU6A 3L7PA 3OD2A 3CC2S 2LDYA 4TQSA 3KUEA 2ZHAA 2ZH8A 1X5PA 3FSIA 1FFSB 3H59A 4AL6A 3NAIA 5CZXA 3OPFA 3J81j 4GTFA 2GW8A 1WF0A 2EFOA 2IJRA 5HVFA 2OUGA 3MCNA 2HZCA 2QMXA 3K7AC 1RT6B 1CC7A 1RISA 2CQ4A 1NK5A 2R7TA 5A2QU 1R0AB 4B9SA 3S16K 4E0DA 5E5NA 2RDJA 2LU2A 3M2RB 1WG1A 4NLYA 3QO9B 1S12A 2BUNA 2AEMA 4ZP7A 4DX8H 4PRFA 2EKNA 4CLZA 3CMQA 2B4VA 1JXEA 2M70A 2XGPA 1NB2A 3KTQA 3P45B 5ETPA 1C1BB 3DLBA 4DQIA 4ANEA 4N8NA 1CS4A 3P96A 1UMJA 4K7QA 4P52A 3H2UB 3N0VA 3PNIA 2X3GA 3DGVA 2H65B 5THWA 3C15B 2MQMA 2DR9A 1C4CA 4C3IK 4C0HA 1RA7A 3PCOB 2MEWA 3ETMA 3TZXA 3K8WA 1AROP 1N5YB 3RB3A 2CJXB 3FJ2A 4IQXA 5FLXY 3R2CJ 4OX9J 1O29A 9RUBA 3ITHA 2ZOFA 2I9SA 1RT3B 1FI4A 2VBZA 2KTQA 1NXIA 1SC6A 3SZYA 1QJHA 1CULB 2J76E 3G82A 2AX0A 4G1PA 2HWIA 4B9MA 2GHVC 3OVSA 3CB4A 5T7LB 4DDFA 1NJZA 4FZBA 2JEIA 4LBHA 2NCKL 4KO0A 1PYSB 3NGTA 1JNRB 4AE5A 1H73A 2DPJA 4FXDA 4X4NA 1L3SA 4DPOA 4FYWB 2BM0A 2DK2A 1ZPVA 4NL5A 4P72A 3GFXA 3DDIA 5HMZA 3MPVA 4K50A 4BWJA 3U7JA 2DNZA 1FE0A 5M2PA 1TWHA 2G1HA 5LMNJ 2Z8QA 3W2VA 2Y3PA 1K0VA 3MM9B 2VG6B 3S14C 3ISNC 4N77A 2OFGX 5KG4A 3Q8PB 2HLTA 3GQCA 3OSPA 3T9ZA 1OIAA 3CQZK 3SZZA 2YNIB 5EWEA 2FHJA 4MYTA 3FUYA 4WBFA 4OYMA 2WB4A 3QSYB 3Q3QA 2VA2A 1LW2A 3V6HA 3BN4A 2XM3A 4IRCA 3HHLA 3CCTA 1PJ5A 4ZP8A 1WEXA 4WP3A 2FVRA 1T95A 3ILIA 2HS4A 1M1KT 4LFAF 5E3PA 3HZGA 4RNFA 4ZPBA 1JKHA 5AJ3J 5IV4A 3RZDK 2MXYA 3L7OA 3CULA 1U1NA 1O5JA 1B0PA 4P74A 3M32A 4CLPA 1ZS6A 2YWFA 3FZBA 3MOZA 3M8ZA 4KB4A 3F56A 2IMWP 4G0UA 1F2HA 2HYIB 5K14B 4MJKA 3QNWB 3BGUA 4X4PA 2DTJA 4MYUA 1WG5A 2A68A 5KG2A 2OTLS 3S2HK 3NCPA 4B3MF 3SV4A 5C25B 3JQMA 1R9TK 3JXOA 4IH7A 3WZ0A 4U96A 4OFZA 2AYBA 2YNIA 2BOAA 4IFVB 2VUMC 4NLPA 2JJ4D 3R3TA 2PFFB 2J8AA 2D74B 3C6TA 4EYIB 1VIOA 3DDNA 2V4QA 2P5MA 4GTLA 4C97A 4WTYA 3UWTA 1J5EJ 3S14K 4Y52C 2BRKA 1RZMA 3CQZC 2IVFB 2YH0A 2YU9K 3THTA 2XI3A 3PKMA 3GTPK 1KVKA 4HACA 1NDPA 1YHQS 4KARA 3VAIA 2JVRA 4PG8A 1WKKA 1RU0A 1IBKF 1VIXA 5K14A 2EI5A 1FKOB 2MLZA 4RW6A 5KFNA 1ZM2A 5FD1A 4FNIA 3WBZA 1KQGB 5M5XK 2NQPA 2Y8WA 4JUZA 4OHXA 2Z58B 4NI2A 2JA6K 3CJ8A 3FKIA 1K44A 5D78A 1OPIA 2R7QA 2FHMA 1MG7A 3SSSA 1QVGR 2E9ZA 2AYMA 1LEOA 4ED1A 1FDDA 1MWZA 3MUVP 2ZC3A 1R3NA 3DLHA 1H72C 2IMOA 4NE9C 1PCAA 4XIUA 1I94J 4GVBB 1EX8A 5A8KA 3PXGa 9ATCB 3R9LA 3UVJB 1USOA 2V6UA 3ZTOA 3LPXA 1Q8LA 4M5GA 2ZH3A 3G96A 4AUKA 3T5KA 1SQFA 3MM7B 2DNHA 3C2PA 3BQ1A 1UV7A 1D9AA 1TAUA 4F02A 4BS2A 2ROPA 3PW7A 2P5VA 2RQ4A 4F3QA 2MHNA 2JLGA 3BYPA 3ZC4A 2UUCJ 5IV3A 3BPSP 3GEIA 4LREA 3DRRB 2JEFA 2XCRB 2W2QP 4B3SF 1HD0A 4MH8A 5F8MA 4RU2A 1V6HA 3TAQA 3HJFA 3FKBA 4M63A 1YJNS 2H4WB 1AB8A 1IQ0A 3TX8A 4FYDA 4I56A 1HR0J 2PD1A 2QZ8A 1PYTA 4WXWA 5K20B 1SI9A 2VIHA 3S1RK 5ETRA 1XZPA 2ZWOA 2PMZD 3QZ8A 4JV2A 1BQMA 3C19A 2B6AB 4KAIA 3CCWA 2HW3A 1EKSA 2ZVSA 1J27A 1U48A 2RT3A 1WHWA 3TAMA 2ZH7A 4OIPA 1IBKJ 2FVCA 1H38A 2H9ZA 3KWMA 3NCRA 5FLMK 3FEZA 4JI1J 4DPXA 2U2FA 4XPCA 1GT8A 5M5YK 3SQGA 5B09A 3HHDA 1U1MA 4TU8A 2VFTA 3GTYX 4OL8A 4OI6A 4DL0C 5HMXA 1ZVUA 3CCUS 2XSFA 4A4JA 2RH3A 1NK9A 2OO4A 3H42A 2JC1A 3IP0A 3G71S 2DR5A 4Q0BB 3JAMU 3R5CA 3FBCA 1UP1A 2ZH6A 5DRKA 1LWEB 1XXAA 4RL1A 1DTTB 3HZEA 3GJTB 2YPYA 4P75A 4P2MA 1VRUB 3RGIA 1REVB 1SC1B 4O3NA 3PM9A 1KLNA 2F9JA 1PC5A 5J2PA 4A3KK 4Q45A 3M6UA 3HULA 1TVRB 3D6FB 3FEYB 2JH3A 4JI2F 1DHMA 2MLXA 3IRXB 5KFFA 1WKJA 2FC8A 4LSZB 1DCPA 1HARA 3GFYA 5KG5A 2KG1A 1XNQJ 3HM9A 3R7NB 2OKQA 4DPTA 4IQMA 4ZLJA 1YITS 3IGNA 4PEOA 3RR8A 4ZVOB 4I2PA 2DBBA 2DNMA 2GAHC 5IC4B 1UCNA 3NWGA 3PX4A 3DGPB 4DV6J 1GMUA 1CEZA 2IVYA 4YP3A 4RUAA 3HLUA 3HVWA 1DTTA 3ZFVA 3RU0A 2YWHA 3W8PA 3GEEA 4HLBA 1K9MT 5D0RA 1OSCA 4JI3J 3CD0A 1GMWD 3CCSS 4NZ7A 4Y7NC 3JSRA 3DXSX 2JOQA 3W3SA 4DV6F 3OR2B 2RMLA 2FVSA 4CCHA 3S01A 1FFWB 2KKHA 1CG2A 5IT9U 5IP9K 5ETVA 4ED7A 1K83A 2I2YA 2ZKTA 4BBSC 3OUYB 5B0AA 2MZTA 4C45A 1NZ8A 5B0GA 1HBOB 2X51A 4XDCA 2QLFB 4C3MA 4HH1A 4CP5A 4U8VA 3KDOA 1Y0HA 1HNXJ 2IPOB 4C11A 3WODA 1N5TA 2CIMA 4JI8F 2HNZA 3MM8B 1MU2B 3PRDA 4LSLA 2C3OA 3HD2A 3BDPA 4ALZA 5JMNA 1U7LA 1MMDA 4OV1A 5I3UB 4QPXA 2YQ0A 4RBVA 3KJQB 4ZK7M 3ZZ0A 1TKTB 3H0PA 2VB6A 5LOQA 1ROFA 3GTLA 1VOMA 3CDUA 4DEZA 4DN0A 5IYDC 5F8LA 4TY8B 3SSQA 3I6PA 2F4VF 1Q82T 4CWBA 2HHHJ 1S79A 2YXLA 2EBEA 4ICLB 3NY0A 4EU0A 3LP1A 4A8YA 1GTEA 2VG5A 4V1Ak 2DJWA 2FZKB 2PA8D 2W2PP 3OR1A 3EX7B 5F9LA 4QJVB 3UCUP 1U2CA 1RDRA 1RGVA 2W7OA 2RRNA 3AJ2A 3HFVA 5J2MA 1S1UA 3PYDA 2B4OA 2NVYK 3MPDA 2YH1A 1HLWA 2J9DE 2MQNA 4W92B 3HI9A 4ITSA 3N3YA 1TP7A 3NGDA 4MAKA 2D3ZA 5D4OA 4DUZF 3S2DC 3A12A 1IKWA 1X9MA 2QE5A 2VOPA 5D6GA 1N34F 3TJAA 5BR8J 4DX6A 2HLUA 1WHYA 1Y1VC 5F8NA 4KASA 4J3NA 2BE9B 1VQ8S 1RHRB 4XSXA 3KG1A 1RT7A 4DOZA 3DXJA 4F0MA 1OYEA 3A4TA 1T11A 2RE1A 1HQMA 1TWCA 1M5KC 2QA4G 3TANA 3RZAA 1OSDA 5B7WA 3M2VB 4WK1A 1SBRA 1HQUB 2F9DA 2C2ZB 2GGPB 1ZXOA 1HWKA 3V81B 3FCVA 1CJVB 4KATA 3BGLA 1TWAC 2HS3A 3BH7B 3V4IA 2PPBA 5HP1B 2LA6A 1WEZA 2PMHA 2ZZMA 5ADZA 2E5JA 2LEAA 4PABA 1L0WA 2D3OR 1JXLA 2XSJA 3M6WA 2J6SA 2LXIA 1EQMA 2R93K 2DR7A 4LRFA 1SKWA 4NI2B 4A3IC 4RNOA 3QX3A 5KFJA 1Y9OA 3ADAC 1QSLA 4KKOA 1Y4ZB 3US5A 1ZTWA 3FGVA 2LQJA 1WD6A 4YUDA 3UDCA 2NVXK 1DARA 2CPJA 2DGWA 3D6MB 4HDGA 1NHVA 2ZD1B 4A3BK 3LO3A 5ETNA 2DB1A 3GTLK 4P2XA 2DNQA 1GMWA 3ZTPA 2Z57B 5A76A 3VAKA 2MPUA 4UW2A 3PVXA 2PDAA 2LVWA 2UV8G 4ZCIA 5ETTA 3FBEA 3M1VA 2VFSA 2QA1A 1KC8T 2FD2A 1RBOB 1QE1A 3B4DA 3R5DA 2RSQA 4FYVB 3S6EA 3KLGB 1B0TA 2Q66A 5C4JK 2UVUA 2FC9A 1VQNS 2N4CA 2RDDA 2RRAA 3GTGK 4CH7A 3GFZA 2MSTA 5CCMA 1LV5A 3AH5A 3L4BC 5LJ5Y 2L48A 4DR3F 1RT4B 2BDPA 2BJDA 3OVAA 1RADB 2F8EX 3BQ0A 1JLFB 3KNGA 3L7UA 3HX9A 4LFCF 2AHOB 2ZITA 4TYAA 2WK4A 4IR9A 4OJHA 3QFHA 2NREA 4DCOB 3EZOA 1F5AA 3S0XA 4WFYA 2DNLA 1RWOB 1S99A 3C16A 5E68A 4DG1B 2UXDF 3Q2TC 5ITHA 2GV1A 1M5SA 3MM5B 2YKMB 2DHHA 2GVDB 2VFUA 5DETA 1R89A 3HT0A 3J80Y 2HIYA 2IM3A 2UUBF 4UZBA 2AMCB 4M5JA 3T5LA 1MROA 1NPPA 5FDLA 1S1XB 1N54B 1N36F 3HFKA 1WF1A 1I3OB 3CJKA 4A8MP 3F44A 3LF0A 4ECVA 5GMKa 4AQYF 1TL7A 1BGXT 4ANDA 4RU9A 1IKYA 2AJQA 2RU9A 3ZNUA 4C8YA 3O2IA 1S9EB 4USMA 3D68A 1Y1WK 4N5SA 2XZDB 5AE3A 3PRBA 1FXRA 3VQSA 3GEHA 2MQ8A 2D9OA 4KTQA 4CH1A 4W4MA 1HWUA 3D54A 5A8WB 1GX5A 1DY3A 2AZ3A 2VU5A 4KBIA 2HHUA 1B64A 3H3VD 4OZ1A 2M5YA 1U45A 1SC4B 1TK0A 2R8GA 1FXDA 4OJGA 4DPUA 4OZ3A 4CO5A 2E1CA 4DX5A 1Q16B 3F41A 1HWLA 3QRRA 1U09A 4DL2A 2YU9A 3C8YA 1VRQC 4Z7CA 3GTPA 2M3DA 1T9VA 4NLGA 4CI0B 1UZDA 3K17A 1EARA 4YB7A 2QC3A 2VASA 1TAQA 4ATNA 3KLEB 1JLGA 3AJDA 4KAWX 2DR6A 4USHA 3BB5A 5KTQA 4HVZA 4Q44A 3NS5A 1Q5VA 2GQ2A 1FKAF 2BQ3A 5C44C 3O8WA 3D0GE 4WKYA 2P8TA 3VAGA 2G0IA 4QWBA 3W2WB 2A6MA 3LH2S 4IFYB 4NOHA 1S7HA 2I6WA 3FMWA 1YG0A 1JJ4A 5ETKA 3VZHA 1FRIA 4KRWA 4FS2A 1TFWA 2CPZA 4OI4A 1T03A 2YKAA 1U0SA 2PHCB 1WDDA 5GAEI 3Q0AA 2HHPA 5KFMA 1IQTA 1T8EA 2E5HA 5KFIA 1VRTB 2HIQA 3NGRA 2XY6A 4XAKA 1EP4B 4XDDA 1PAUB 3D28A 2FZCB 4C98A 3MECB 2QYCA 4GMKA 4NMLA 2JC0A 2J9CA 1XNRJ 4CRJA 5EGYA 2BJ8A 2VQEF 3VAMA 4NXMJ 3KOAA 3PIPQ 2VF3A 1NZAA 1G1XA 2AJ0A 2GSOA 3D6HB 5B0CA 2C22A 2XS2A 4J37A 4OX9F 3C6UB 5I3UA 1RWMB 2HBZB 1DQ9A 2A0FB 5A8KB 1HBUA 4YFUA 5HVGA 1FJGF 2NXCA 1AZSB 2UU9J 2E2JK 1UETA 2NVXA 3NRBA 3B8HA 2LECA 1X31C 3GR0A 2ZWPA 4OV6A 4JI0F 1K83C 2R7ZA 4IG0A 2LDIA 3V6KA 2YWGA 2PO4A 4DWIA 3DU6A 3GTQK 5MLCV 2B63C 2GHPA 2MY8A 2JRSA 1N0VC 2QL7B 2VH7A 3CCQS 4LK1A 1EETA 2NVQC 1BC6A 1KOHA 1TFYA 4JK1A 3KK3A 3LALA 2XYPB 4A93C 4EBDA 1T9YA 5C4XC 2HNYB 4NRTA 2K1RB 5KFZA 2JWNA 2VD3A 5IOQA 5A6PA 1I6JA 2JVOA 2KI2A 1P6TA 3LP2B 3FNNA 2ZH9A 1VQPS 2D3O1 5DM7Q 5RUBA 1F5CA 4CLFA 3NUHA 4HT7A 4C3JK 4IFVA 4PWUA 3FSXA 3G6YA 1AW0A 2D3UA 1XZPB 3SMZA 4PWDB 1ACMB 1Y3KA 3I4PA 2L9DA 3M2UB 3Q8YA 4LF7J 4XO0A 1B4BA 1K8AT 1PJ7A 2X1GA 4OIRA 3FBFA 1JK9B 2DKOB 4I7FA 4BCAA 4ETXA 2XQCA 4HACB 2N82B 1HHSA 5DG8A 2ASDA 1UWAA 5TJ3A 2BV3A 3KK3B 3IS9A 2VBWA 2QMWA 2BKOA 4JI7F 1J2VA 4PPZA 2EFPA 3WC2A 1CJUA 2XMTA 1AB4A 1URNA 3BGRB 1FERA 4EI2A 4DV7F 3PO3C 2DHGA 1OY6A 1FRLA 4NLTA 1VQ7S 3VR1A 4NLXA 1FNOA 3N4WA 3ZTRA 3I0SB 2XMJA 1RTZA 5C24A 3T19A 3MFHA 3ULHA 1TWHK 2V2KA 1B4AA 3QIDA 2ACMA 1WHVA 1SXLA 3RBDA 4RUHA 4ZVHA 4OYIA 5HAOA 3TUZC 4OHWA 2YNFB 3MFIA 1B70B 5EUHA 2GJIA 4A3EK 4L3KA 2A18A 1UVNA 3UO0A 4C3JC 1NJYA 4X84A 2GFFA 4ZN1A 4IG3B 4NLSA 3AA8A 4P7VA 4YQWA 2OIHA 3KG4A 2KWAA 3CJ3A 3SFUA 4CO2A 3O5TB 4MIAA 1XQIA 1E6VA 4R5PA 3N6MA 1LWXA 2UUWA 2ZNYA 1UJ4A 1ZAVA 3HHEA 2KM8C 2PSZA 4KMUA 3MR6A 5IYCC 5ETQA 4DL5A 3KJVA 3D67A 4WZMA 2XNRA 4BHQA 2BEFA 4KHMA 2LP4A 1FKOA 4HT5A 3MZIA 2YKQA 1WOOA 5L46A 1WF2A 4QIEA 3I0RB 4ELVA 2M2BA 1R43A 4ERDA 3IBWA 3T02A 4WFZA 3W9HA 4ED8A 2H54B 1REGX 3PEJA 1QVFR 4GTEA 3DI6B 4C8MA 2C2KB 4Y34A 4O3PA 4DV1J 1PAEX 1FEHA 4EZ9A 4MFBA 1GQEA 4DR4F 1M1GA 4P2FA 1DBDA 2EFVA 1IS1A 1E6VB 3S1MK 1TU0B 4DSJA 2GNKA 4LF5J 2IFXA 4J9MA 2I38A 3JS9A 3CC4S 1EJ7L 4OJ3A 3HO1A 2CZ4A 4DN9A 2V2QA 1H2TZ 4FP9A 2OPSA 3H4DA 1NRKA 3AOAA 5J2NB 2WSCC 2DNGA 1S6QB 2DEIA 3CAGA 2POKA 3PR4A 4OI1A 1GX6A 4R0EA 5KFAA 2HFSA 4FZVA 4IR1A 4OHZA 1BWVA 3CIZA 1ZOTA 4GTCA 3JTNA 1RWXB 1Q7YT 4UQGA 1UL3A 2KB2A 5EHHA 4W90B 4Z2XA 4JI8J 4ED5A 2KU7A 1IKXA 4F4KA 2PEBA 3LTOA 5EN1A 3SBMA 1N48A 1GFWB 2WONA 3R5BA 4DSFA 2KXFA 4WE1A 2BA9A 5HK4A 3GCXP 2J0SD 3DMJB 3OXGA 3THPA 3T5HA 3DOKA 2LA4A 2W4DA 3PHTA 2VUMA 1V5VA 1VQ6S 2VFVA 2W7VA 2WSEC 1J98A 3JQKA 4GO5X 4ILRA 2WBMA 3UR0A 1ZYQA 2V94A 2WHOA 3DRPA 2YY3A 2UVWA 1R0CB 3MCOA 4ZPVR 5B0EA 1HYSA 4ILLA 3QIPA 3ENAA 3HXMA 3HSJA 2Y1RI 3SV3A 3KFWX 5HBMB 3TNVA 1J5OB 1SC3B 4H4KC 3GIRA 1YJ9S 5D15A 2ZUEA 4C3HC 3SIPB 2HQGA 3DOMA 4C7QA 4O4RA 1KBRA 4JI7J 4A3JK 3W2WA 1XMBA 1U0HB 1FXLA 1EK8A 4B3OB 5HATA 3S15C 3HF5A 4Y2IA 3IMQJ 4WU2A 5EWFA 1LXNA 4HHJA 1XJWB 1XZQA 3K5MA 5F8IA 3AXKA 1FRJA 1DD5A 2IBKA 1JLQB 4KM9A 2K3IA 3H5XA 1VCTA 2JA7K 2UVVA 4A8SA 1MU2A 5M3FK 4O3QA 3FK4A 3A13A 3RUBL 4NCGB 2F4VJ 2FTRA 4CH0S 3CVKA 4ZN3A 1RK8A 1RI7A 3NNCA 5A0YA 3GTGA 2J7UA 4DV2J 3NCQA 1OY9A 1NK4A 1WQFA 2RUSA 5HBMA 1J5OA 3KLHA 4NZ6A 5F0UA 3UR3C 1RE1B 2GCFA 3PJXA 2UXCF 2JLFA 1TL3B 3AH6A 1C2PA 1N36J 1FX2A 1VMBA 1JLCA 3I5CA 2VZ9A 1BQMB 1RAOA 4DFMA 2JA5A 3ZZUA 4DV0F 4WP8A 2KN4A 2Y1LB 2R2UA 1SV5A 4BBRC 1C0UB 1QE1B 1L3VA 1RAAB 2WZ1A 5HROA 2LQBA 4K5RA 3GE9A 2IVMA 2JNJA 4DR6J 4A3JC 2CQ0A 5E3QA 3TOQA 4AQYJ 2BJEA 3KXDA 5IFMA 4LIRA 2VUMK 1HQEB 3CDBA 3TVYA 5B0BA 5HVHA 1R6VA 4C8KA 2YNHA 2MKSA 4KGMA 3MWBA 4WPAA 3E01A 4J9KA 2OTJS 3OL9A 3POTA 1CJTB 4PXDA 1TKDA 2B9EA 2BE7D 4X65F 4Y52K 2K1RA 1C0TA 4PXCA 2H5EA 2PEHA 4J9LA 4TYBA 4NRUA 2DD8S 4ZPTR 3SZ2A 2E2IC 3PJWA 3IRWP 1KWMA 3RYLA 4UQTA 4DR2F 1TWGK 4CIOA 4ILDA 2HQFA 6FD1A 1ZYRA 4KGZB 1B3TA 2NXNA 1HWIA 1SJQA 5CD4A 1HD1A 3G6ES 2ZBCA 2WAQL 3DRSB 4IDKB 4WU3A 3S15K 3G87A 5HROB 3G2XA 5U47A 1C1CA 1S48A 3VQTA 2KT2A 2XMMA 1XBWA 4KGKA 1VQOS 3TFJA 1HMVA 2XB2D 2OLWA 2BYCA 1S7IA 2Z2YB 4LBPA 2O3DA 2Y1IA 3ENQA 2QLXA 3NKYA 3RRKA 4N56A 3PZPA 5HP1A 3HD1A 5HJYA 4G7HA 2EKYA 3OJSA 1PILA 2HHSA 3FCHA 1M5OC 2BANA 4F0KA 2Q43A 3FQKA 2PMZL 2R8JA 1IN0A 2XMKA 4LR9A 4ZVQB 4CNYA 3T1YJ 4OYAA 1XTZA 1J6VA 2BW2A 3UE2A 4M5NA 4J7CA 2XO6A 2W7PA 1PO6A 1D9FA 2DEJA 5L1IA 3CQZA 2KFYA 2Y9HA 3T01A 4N41A 2KYXA 3BBFA 4NA3A 2Q79A 4KB2A 5IOSA 2FQOA 3ZZRA 3EVOA 4ECYA 3HSGA 4ILMA 3OUYA 5I42B 3RRGA 4A3DC 1U8SA 3T1HJ 1YQHA 3GR1A 4KT0C 4ZPWR 3CCMS 2XMWA 4JI5J 3HPOA 1RA6A 1R8AA 1TWCC 2HEKA 3MAHA 4C11B 4DL7A 5B0DA 2XO7A 5BR8F 2Z2ZA 3NLCA 1X4DA 1BGWA 3TR5A 3AQOA 2W7AA 3OPKA 3V81A 2AGOA 1ZAXA 5A8RA 4OLPA 2HKEA 2MTLA 3HHLD 3TTGA 1LWCA 2DHAA 3S17K 2JEJA 2K7JA 1T3OA 2Y0BB 4FPIA 4DSKA 4A8QA 1J6XA 1OMSA 2UUBJ 1N88A 4XLNA 3CJ0A 2C3MA 1UVKA 3EGZA 5KAKA 3U1LA 3ZZTA 2HZAA 3AY0A 4KB7A 3MMJA 4TVAB 1Y3JA 1Y00A 4AXJA 3H5UA 1HNVA 3MMAA 3IR7B 4OZ0A 1SJRA 1TVRA 1KQKA 3PO2C 3LA0A 2DRBA 5LMUF 2DH8A 1VBZA 3KHLA 2UUCF 4MFBB 4AT1B 3PW5A 2V69A 2RU3A 1RAHB 1IKVA 4Q8EA 4MMOA 4TQRA 3CJRA 1Q79A 1F5BA 4DU7A 2QG9B 2LCWA 4ZKAA 4A8XA 3BH6B 2FJWA 1VJEA 2RB7A 4CT8A 4ES2A 4I2PB 1LFPA 2FHOB 5KT2A 2QA2A 4CO3A 3PTWA 1QAIA 4NYOA 4F4AA 4WYLA 2OSQA 4F7VA 3A8JA 2EG2A 4ZVTB 4KH0B 5J2MB 4A8KA 5E7OB 2DNYA 3DLJA 1U2RA 1WELA 1KHVA 1O8BA 4U7CA 2L41A 1RAIB 5DG9A 1TWFK 5D0EA 5KFEA 2CFAA 1HNVB 4ECQA 2CJYB 2YX4A 1ELOA 4X64J 2I5JB 2GJ2A 2IM0A 2L9WA 1RWVB 2P9CA 1YCLA 3W5ZA 3RAQA 1F2GA 3FZ2A 3GCWP 5CAAA 3CCLS 5I4MA 3G8TA 2XULA 5L1KA 1NCLA 2WVCA 3H8YA 5GMEA 3W62A 1H74A 4EFAC 1NDLA 4LF1A 2B56A 4FM9A 1JVIA 3PJ9A 1B0VA 5DLGA 3L3CA 3H25A 4H4MA 3TFHA 1FTRA 3HKZD 1WHXA 4J9RA 2VDIA 3WIVA 4PR6A 2RKIA 5IP9C 2JA6C 4OYWA 4U7UK 2QN6B 5HMYA 2V50A 4FF4A 2B43A 3UDLA 1PIEA 2K8GA 1XWLA 2CQBA 2R7OA 4FYXB 1NKCA 1LQ9A 4D3GA 4M1XA 2MKKA 1LWFB 1N5SA 2DGUA 4DQSA 5AJ3F 1VC6A 4RW4B 1MLAA 2OPPB 2AJFE 3EDQB 4WXOA 1TL5A 4L76A 4ECSA 1Y7PA 1R0BG 4ZJOA 1BE4A 3I5AA 4J91A 4MQ9A 3OVBA 3RJMB 1X4BA 3IS9B 1UPPA 3DFEA 1QSSA 3ZO7A 1WC3A 3D9BA 4KH1B 2W01A 5TMFA 1RHMB 3IBCB 3FEXB 4P2SA 2NR0A 4A8OA 4X2BA 1X0FA 4CLLA 4F4ZA 4KFBA 4LK0A 3MUMP 2BJ3A 4JI2J 3DKDA 4ER8A 2ZE2A 2F8HA 2DR8A 3VWSA 5B0FA 3PKYA 4OHVA 4A3MK 4XCHA 4Y28C 2DO0A 1HBMA 1X7VA 4J5OA 1S10A 3DM2A 4DV5J 2E29A 3HOZC 3M3YC 1NK7A 4UUWA 1ZAWA 2R2TA 1S76D 1RP5A 4MEYA 1KSPA 1IWAA 3GJQB 4JOUA 3MD3A 2C1EB 3TI0A 4G0VA 2AGQA 5HL8A 2HS0A 1EH1A 3Q86A 5GAEU 3HSZA 2B9XA 1YJRA 4MIWA 2NUHA 3TEHB 3Q2SC 4UOFA 2EBBA 3GWCA 4X4RA 3C15A 4YEAA 4Q7AA 2QMUB 4NLRA 3IG1A 2MZ1A 5IORA 4E8UA 3MR3A 4LF4F 2QYGA 2CRLA 2ZH2A 3BGFA 4JV5J 2W1BA 5JJBA 2E5LF 5DZ7A 2HBQB 2EWHA 2YPZA 4RW8B 4TY9A 2FVQA 5JUMA 3H2VE 2ERRA 2LXFA 5G0RA 3K7RA 3CNQP 2GSNA 3WIUA 2V5HG 5FJ8K 2DGXA 1PSDA 3S17C 4KSEB 1VQ5S 5C25A 3I9V9 5GADI 4GKKJ 3I96A 2Q6BA 4RX6A 2ZZNA 3N5BA 1F9NA 1CJKB 1XR5A 1QUPA 2I0XA 3HVRA 2CPFA 5HO4A 1QLNA 1S9EA 1UEVA 3VCDA 1UFKA 1Q8IA 3AOBA 3EPIA 1N5QA 3R2DJ 4YHHF 1VQKS 4JI6F 3KHHA 5KFDA 5J1EA 5KOWA 1IJEB 2WAQD 3L95X 5EWGA 3I56S 3AQPA 5DDOC 2VG6A 3KLGA 1HQUA 1RT2B 1L3TA 1X60A 4A3BC 2H5JB 3P5BP 3ET6B 2ZDOA 3I55S 2GMLA 4M5IA 2W24A 2FJXA 3R7SB 3TARA 2CQCA 1MWQA 5EX3A 3VA7A 3D1QA 4K5SA 3RG6A 3PIOQ 1ICEB 2VC1A 4QBUA 1SFOA 4U7UD 2DNOA 4LQ3A 3JSMB 4H4OB 3H40A 3ENWA 4F25A 4A3IK 4Y2AA 3WHIA 4Q4ZA 3HK2A 5C3EC 4ZVEA 4K0KF 4DDQA 2V0NA 4HI1A 4OMFG 1N33J 1HW8A 2IM2A 5KFWA 3CC7S 1BXNA 2XLIA 2E2IK 3Q83A 3NBPB 1O28A 4ENOA 1G51A 4D3HA 1AFJA 2RILA 1TR0A 5D0GA 2KFNA 2VOOA 2V67A 4QWAA 2JL9A 3FBBA 1AUSL 1YSJA 3EXYA 5AXNA 2MQOA 4BXXC 2HBRB 4FNHA 1RTJA 2HHXA 3D3CJ 4Y0FA 1J5EF 1ZETA 3QRPA 4RR5A 4X65J 2W9BA 4DCJB 2XYGB 4XTTA 1VQMS 6FDRA 4RUBA 2HURA 2FB0A 2O5JA 2FDNA 4H4KA 3ZNJ1 4EO8A 2G13A 2JSXA 4TY8A 3TZZA 3TJ9A 1J6WA 4OZ2A 1IBCB 3TVKA 4YMEA 3THVA 2EC2A 3BUEA 3LP0A 2F8MA 3R5JB 1URRA 1WC5A 3GSDA 4MKVA 2Q6CA 1HI8A 2QA4S 4DV7J 2GA7A 2DGTA 3NAHA 4J9QA 5AXMA 1S1UB 2H5IB 3DCAA 1SJ1A 1I5OB 4ANCA 3Q8QB 2AD9A 4U95A 2E9RX 2PT0A 4DR7F 3M8YA 2HNYA 4FXVA 1QDUB 5H9FJ 4E2FB 1U25A 4EK2A 3JYTB 1C1BA 1P8GA 2HVIA 5D3GA 1IKWB 2C3PA 2FJAB 3FRYA 2OPSB 3KK2B 2HK2A 5J2NA 2WCXA 2DGQA 3BSCA 1KD1T 2QT7A 2HWHA 5JVHQ 2H51B 4KE5A 3U1MA 1C0AA 3TEGA 2OJ3A 1EAYC 3IAS9 1JLCB 4BXXK 3I9ZA 1HNZF 2HQIA 1HW9A 2MJNA 2ZUGA 1BQNB 2X7IA 3GILA 1A7GE 3J81Y 2AJ2A 1RTHB 4OJ1A 4X62F 2MB0B 4I67A 4I0WA 4BKWA 3HOUC 4KGVB 1WQHA 2ZFHA 2XI2A 1VC0A 4PCQA 2HRTA 2E7WA 1IM6A 3HHLC 2F4FA 4QOTA 2XZTB 1WTBA 1RWUA 4B3TF 4NA1A 2FJDB 2YWWA 3NOGA 1WSRA 3MEEB 3BSOA 1TUVA 2UV8A 4KV8A 3L4KA 3K58A 1GXTA 1AUDA 4USIA 4L74A 2HAFA 1FRMA 3DRPB 4P73A 1XPPA 2A6HA 2Z56B 3DRYA 1YX2A 2NSCA 4ZJQA 3K89A 2N3LA 3RZDC 4J90A 4YN3B 5F8JA 4DU8A 3EUNA 4Q5SA 8ATCB 1F7VA 2A2DA 2OPRA 4HR2A 4X66J 4ZIVA 2WOMA 5HLFA 1S1TB 4X4TA 4OX6A 2VV5A 4A3EC 3DRSA 2WSFC 1UWBB 2FHJD 4Y2CA 1WSVA 2L3MA 2P6TA 3CJSA 5IC6B 1I51B 1CC8A 4DPYA 2ZDPA 5C24B 1M5PC 4URGA 3OR2A 3JTOA 3G4SS 1UA1A 4P9SA 1RKJA 4R5PB 2QJ3A 3B78A 3H3VL 1FT8A 3OFHA 1UJ6A 2R92K 4S0MA 3BO2A 4OYOA 2EPIA 1FNMA 1SCJB 1G2EA 1F9FA 5FLXU 4DQPA 2H3EB 1QY7A 3HOYK 4KM8A 1SPBP 1SL2A 4I6AA 3IBFB 3CCJS 3IXQA 2RD5C 3FFIA 1NPRA 1E6YA 1K83K 1CS4B 1CVJA 3LP2A 4TKTA 3DM2B 3LUYA 1HI0P 3QGGA 3MM5A 2EXUA 1XMQF 1BD6A 5KFHA 1NUEA 3M30B 1NDCA 2NVQK 2WW4A 2E5LJ 4DG1A 1WUUA 1DZ5A 2JA7A 5DS7A 4YB1P 1ZM4A 1IJFB 5DQIA 1EIYB 1VHIA 4O4GA 4ZJLA 3QGIA 2MKIA 5H9EK 3IAM9 4C0BA 3M4OK 3W64A 3TZWA 2ATCB 3ITHB 4DS5A 2CJQA 1OPZA 2BRLA 3GTOA 1OQ3A 2HAIA 2KT3A 4F36A 1WCMK 4KJIA 4OYBA 1T9TA 3IWLA 1HNIB 3EVWA 1HBUB 1B4SA 1RAJA 3J81U 2BQRA 2BKNA 4F8RA 4FDFA 1I1GA 2HWTA 4FF3A 2PC6A 4Q8FA 5IT0A 5A2QY 4NASA 4L3NA 2XGQA 2ILZA 2NXJA 1XEZA 2WVBA 2ZJRQ 1DURA 1HBNB 1LWCB 4PG5A 4DV4F 1FTCA 3H4BA 5L39A 3C3LA 1YBAA 2E1PA 2ZH5A 1EZZB 1FJCA 4LF4J 2C2NA 1TTHB 4OZNA 4LF6J 3QFWA 4PYDA 4USWA 3S1MC 1UTAA 1UW9A 4L75A 1S77D 1IM4A 1U26A 4UT4A 2M0GB 4LR2A 4OIOA 2CVEA 2P6SA 3I4MK 4O4GB 1YRXA 4O44B 1FD8A 1WI6A 4MIBA 4YS2A 3W60A 3C14A 1JX4A 3VTIA 5HMWA 5KT6A 1FD2A 1TWAA 3D1OA 1S1WB 1IKVB 2FJEB 4NLWA 1JJHA 1S49A 3DMJA 2QV6A 3BPDA 4J9UE 3SCLE 1HL6A 2DCLA 4QR0A 4M5HA 4K4VA 1UA0A 1FHTA 3S16C 4QWDA 2AJ1A 1U1LA 5J1EB 4I68A 2CW0A 5AT1B 4EUVA 2BJ1A 1M5HA 1EB0A 5KFXA 3DOKB 4ZHRA 3JSYA 1HPZA 1DTQB 2CFAB 1Y11A 1TKTA 3N6NA 1Q53A 2XSJB 2JA6A 2VA3A 1PGZA 3LOUA 4DR1F 1DFDA 2YKNB 2E7VA 3BBBA 4EWTA 2AGPA 2DY9A 1IR0A 1V3ZA 1RHQB 1AFIA 3M4XA 1BWEA 3FKIC 2HG4A 5KT5A 2NPIA 4C3IC 1RKIA 5HN0A 2V8PA 4J9NA 4F4XA 1ZH5A 1WCMC 1VFJA 1JWWA 3BV8A 2KZMA 3LGHA 2ZD1A 3A8KA 3QT6A 3KNAA 3GJRB 3S1NK 4MK8A 1RWWB 3GTGC 2DXDA 5CYMA 2UP1A 4JB8B 4F2RA 3HVTB 1JNZB 5IQ6A 2FUG9 1VGYA 4ZIWA 5C42A 4IKAA 4G0WA 4L6V3 3GTMC 1D09B 1S1VA 2ACYA 2DHSA 4ZMMA 2DH9A 4UTGA 2APOA 1SQGA 3P49B 1VHFA 3PO4A 1CLFA 3EGNA 1TZ0A 4YR3A 5C2GA 4HEA9 3GYXB 5D4NA 1GK8A 2D6FC 1S6OA 4DJBA 4NCGA 2E1MC 2UXBF 3MMCA 2CNLB 2NZ4A 3ZZOA 1FK9A 3G9CA 4LFBF 5M5WK 2VG7B 2PA8L 4KFBB 2YX1A 2GIRA 2RRBA 1VQYA 1SH3A 2A69A 3FCWA 2LU1A 1KP6A 3CJ2A 3OL6A 5KT3A 4YOEA 1MMLA 1TUGB 4UOGA 4NLDA 1JXVA 3Q8VA 3KLIA 3NNAA 2V9KA 2F63A 1WC0A 8AT1B 4LF6F 2YKMA 2HVHA 2XWXA 3N0CA 2IC3B 2C2OB 1F9EB 2XLKA 4LF9F 1BUXA 4URSA 2HQCA 3D6TB 2GVZB 3GTJK 4NXMF 4G6VB 1EKRA 3MMCB 3CJKB 3UNGC 3UN2A 1MNEA 4CT9A 2DNRA 3ILOA 1S0OA 4WIIA 5IOLA 5LSRA 1BS2A 1UJ5A 2D41A 5A6WA 3PYFA 1KTQA 1CJUB 4OHYA 3GIMA 1QAXA 3V6DA 2ZM6F 2A10A 4ES3A 5CZVA 1O6XA 4KPCA 2VPZB 1KONA 1WTFA 4XLPA 4A3FC 1CSJA 5DO2A 3SSRA 5T41A 2R7XA 2XHCA 4I2QB 2FVPA 3MUTP 4DXLA 1QTMA 1T9UA 3MMBB 4OIXA 1K0TA 1D3WA 2ZOMA 4TN2A 3MM6A 5B08A 4DR5J 4NLVA 2E2HC 1HBOA 3PHEA 4EGLA 3NNHA 4G65A 4FS1A 1PYOB 4N8OA 1IR2A 3BKTA 2V8HA 4O2DA 2NVYC 2AF6A 3GB0A 5M2RA 1N56A 3UI3A 5HLFB 2KJWA 1P27B 1I50K 3UD4P 1IE0A 2QEXS 2EW9A 4LF7F 2CUYA 2B0GA 4R8UA 4ZLPA 1BY9A 4LMZA 4C2MC 4CDIA 1I6HK 1R7IA 2ABYA 3A3PB 4PG7A 2QSWA 2P8IA 1JMTA 1O51A 3PR5B 5JXSA 3MTJA 4AYBL 1UFLA 4DLGA 3TVZA 5F8HA 3BS9A 3DLGA 4LF5F 4EBCA 1N52B 2QGFB 3MMBA 3GTJA 2V2ZA 1AYEA 1YJTA 3TQEA 5KFOA 2OI2A 4NYPA 2O01C 1S0NA 5I42A 2N4DA 2C3YA 2YNGA 3H98A 4NYZA 1WIHA 3G6VA 1FDAA 2O66A 2JA7C 1L5UA 1YKWA 4DHVA 4KGXB 3PW0A 4ID5B 2B9WA 2G4BA 5E33A 4X6AK 1FJEB 3N0BA 1E6YB 2C2EA 3M3YK 3EYZA 3VGTA 2PE8A 4DR6F 1HHQA 1T7PA 4LQYA 2BW7A 4DV3F 4BY1C 3X3UA 2AT1B 1U49A 4NPOA 4BLAA 4DR2J 1LWFA 1HQ2A 4C8OA 2MKYA 5AXLA 1YBUA 4DQQA 1AZSA 4P10A 4P5AA 2RHSB 2ZH4A 2B8QA 1WDTA 3MEDB 3P8BB 4C3KA 1U1RA 4ZPAA 2ZVIA 3DLGB 1R31A 4E98A 4GO7X 2XS5A 3D2WA 2EK6A 3ZZYA 1X0PA 4PQAA 4CM2A 1G7CB 1RHKB 1TV6B 3J7AN 1IKXB 4O0IA 4ID5A 2JFDA 4UZCA 1RTIA 3Q89A 3GTOC 2OELA 3M05A 2GGPA 1INNA 4U9RA 1UEUA 2ZE2B 2IYIA 4DV2F 4I1TA 1HQEA 4X66F 4DL6A 3ONQA 2F65A 2OMOA 2HNDA 3ZZPA 1IW7A 3KJFB 4RBUA 3OQ2A 1C0TB 2BJ7A 4WFAQ 2CXEA 2MZSA 4WP9A 4QZVB 2YX7A 1Y5LB 2AEJA 2CJBA 5DM6Q 1LK7A 1Q5YA 4WK3A 1HYSB 1F1BB 1RTDA 4RJVA 3EICA 2B5JB 5AE1A 3NGSA 4CLKA 2BZ2A 4N76A 3OTEA 5K8OA 4XPEA 4ZLNA 4NWBA 2YKOA 1TK8A 1P1TA 3IM8A 4JYAF 4M1KA 1TV6A 1FWPA 2KL8A 1OY8A 4WJBA 1A6LA 4MK9A 3PFEA 1YTYA 4WCEQ 3RZOC 2CPEA 4M5DB 1VS3A 2Y0SD 3CJ4A 1ZBTA 4Y65A 3BGRA 1RWNB 2IAJB 3TO8A 3IR5B 5CH7B 4A3DK 2ROEA 4WF9Q 4U67Q 4NX9A 4ZPCA 4LBIA 5FLMC 2QRRA 4HTIA 1HI9A 1K1SA 4RW8A 5AE2A 1FDBA 5DQHA 4LRBA 2PFDA 2GIQA 5KFBA 1FKPA 4ECUA 1NM2A 3M8SA 2R9LA 2LEPA 3QJLA 3M8QA 2E66A 1VGXA 4K0KJ 3FQLA 1Z2LA 2D9PA 1H98A 5C2CA 4RNMA 1I6VA 3S1QK 3DOLA 1RYRA 5H9EJ 2GMHA 3MD1A 3WX4A 4P5BA 2OSRA 3ZTSA 4BLBA 2QL9B 3M8RA 3GTPC 5J2QA 4DS4A 2HGNA 2CAJA 2RHQB 4IG0B 1FE4A 2L08A 1B99A 5IM0A 3CO9A 1RBAA 3HOVC 4QIGA 4QIFA 3DLKB 2X3DA 2CQDA 2BBEA 1N5YA 4AH6A 5KG1A 3RW6A 3MOJB 2NVTC 3BYRA 2VODA 3T00A 2CDQA 4DV3J 2ADCA 2ZBPA 4RW9A 1V9OA 5E2QA 7FDRA 3T9NA 1CULA 2RS2A 1NH7A 4FF2A 3MR2A 1SKUB 1R8HA 3CMES 3UNYA 1KLMB 1KVJA 3HMJG 1XXCA 4BBRK 1X4AA 3EPGA 2RIJA 3IWXA 2YBVA 2JDJA 3RW7A 5KT7A 1U1QA 2DHXA 3W66A 5H1SV 2B3TB 3EWGA 5LM7E 3M2UA 2G0CA 1CJTA 2OP5A 5K8NA 2CWKA 2EFQA 5T14A 2GZOA 3RRHA 2DNPA 1XXBA 4DF8A 4ZH4A 1O0PA 1K47A 2XYHB 3ZXWA 4EEYA 3PRVA 4O3RA 5L1LA 3Q22A 4A3LC 4K59A 1RQ0A 5IP7K 2A6OA 2NXEA 2V4RA 2M9KA 4ED0A 4RZRA 3N28A 2BQUA 2B4PA 1S0MA 2CPXA 4USKA 3PW4A 1LW0A 2UZAA 4P7TA 1NSQA 3OTDA 4F26A 1UPMB 3NEKA 4YFXA 4G7ZA 4JI4F 1N32F 1TWGC 5HJXA 2OD6A 2B4UA 1QAYA 4X62J 3PY8A 2KXHA 2R2RA 5EDWA 3IC1A 4B3MJ 1Y1WA 3I0SA 2M7SA 3LAJA 4ZLLA 3O44A 2VONA 1FWKA 3NL0A 2CNKB 5LMUJ 3S1QC 2R7RA 3BO3A 4C3LA 1TWFC 3BJYA 3TW0A 3S8SA 4GTDA 2HFVA 4A46A 5DDRC 2AU0A 4NMXA 3H7HB 4CNZA 3CXCR 3K8VA 4OINA 1NO8A 2DT9A 4C2MA 2KM8B 1T0TV 2LYVA 4OZJA 2RVJA 4IG3A 1AXQA 1RJJA 2K3KA 4A3CK 4LIWA 4RW7B 4CZCA 2M88A 3TAPA 4NOIA 2M52A 3T5JA 3BF4A 3GIIA 4RBTA 4XK8C 1ZM9A 4USVA 1YI2S 1EP4A 3R5AA 1S1TA 2XCAA 3MF5A 4DZ6A 3NGUA 3VHQA 2LQ9A 3OT9A 3F73A 4GKJF 3JSMA 3L4JA 4ZP6A 1T94A 4HL9A 3QYYA 2C2DA 3DYAA 3C6TB 3V5RA 3JTPA 2RKIB 3W7BA 4HDHA 3TUJC 1MROB 3SI8A 2RQCA 5IWAF 2J8SA 5F9NA 1KNZA 1PKUA 1U0HA 2NVYA 3V2UC 4F3OA 2V6SA 4O0NA 4HHHA 3HOXC 2E5GA 3TQ1A 3QGPA 1FDNA 5D4DA 1NSAA 1S5ZA 1NEEA 2JFKA 2ZEJA 2VQFF 1VJQA 2DCUB 4X4SA 2F5GA 1SJ4P 2ZC4A 3VALA 3OLBA 4DPWA 4CYUB 1WNEA 2NLWA 4LFBJ 4JI4J 3EVMA 4Q2LA 4NCAA 2OHDA 1EQRA 2H1YA 2P9GA 3SYZA 1XN9A 3P4UB 3B6BA 3GLJA 2BM1A 3QT8A 4U8YA 3AODA 1Q7LB 2HSEB 4M5MA 3U27A 2A1BA 3GSIA 3EE3A 3GYNA 1WWHA 4DV5F 2O67A 3TA0A 3W1YC 5KFQA 2DNKA 2E5IA 1IBMJ 2QLJB 3RAXA 2UVRA 4YHHJ 4B3TJ 3EGVA 1S6PA 2CA9A 3GG0A 1IBMF 4Q43A 1U6FA 2F3JA 3HHLB 1U6BA 3OFGA 2EVZA 4CLWA 4C0OC 1KDNA 2VL1A 1TMJA 1SMYA 3M9MB 4A47A 1C0UA 4IOBA 2GS8A 4NZ0A 4YR2A 3KK2A 1LOUA 5G4DA 4I7FB 2ZBRA 2CQ1A 1JLBB 2WONB 5FJ4A 4USUA 3IO1A 2MKJA 1IWGA 3W9IA 3TUPA 1U1PA 3ZTQA 1F3FA 1JQGA 4Y7NK 5DJBA 2HHVA 3QSIA 2W8LA 1NNDA 2KT5A 4F67A 1RAFB 1FA0A 3QATA 1RWPB 1FK9B 1XMOJ 4LF8F 2FLNA 1KHWA 5SZTA 2HHTA 2R7VA 2MJUA 2KVQE 4LFCJ 3WDOA 3S1RC 1L3UA 3WQPA 4R25A 3MECA 4GFQA 1NSPA 2HBYB 5KT4A 2DVIA 2JA5C 3I4MC 3SDEB 1S6PB 2GIFA 1S97A 2HRYA 3QO9A 2HFUA 5GADU 2HMIB 3NG8A 3HXAA 3ETOA 2CPYA 3BBCA 5KFRA 2IYGA 2WVEA 3PYGA 4DBQA 3D5MA 3DOMB 2ILYA 3KLFB 3DHXA 3MPUB 4LRDA 3OL7A 3LQVA 3OTBA 2PN6A 5KG3A 3CW2C 3CJTA 4ZOSA 2IY5B 1O24A 1TKZA 4K4XA 1OS5A 4DUYF 3UN3A 3GV8B 4WWSA 4G7OA 4K4SA 4X4QA 4C8NA 3KMQA 2CQ3A 3DRXA 1FWLA 2VHGA 2GHWA 5BXIA 1YRTA 2WOMB 1FO1A 2HVDA 1JLEB 4EMDA 5K8PA 4J9PA 1NBEB 2BANB 4RO0A 3FOFA 1TL3A 4NLQA 2DPIA 1HFEL 2RGRA 4NXNJ 2EEYA 3RAMA 1NK0A 3AA9A 2IRYA 3HOZK 5DQGA 1X9WA 3MAQA 1ZPWX 4K2XA 3K59A 4YFNA 1VQSA 1REVA 4F2SA 2MHEA 3I5BA 3BGOP 3I4NC 3LWMA 4ED6A 1RSCA 2ZFZA 3UPFA 1HBMB 1T9WA 1VC5A 3E51A 5KFKA 3LANA 5HQ8A 5JVGQ 1VK8A 3CD7A 4YB5A 3C66A 2JA5K 1SFOK 3AAWB 4MKBA 4OX8A 3MPYA 5LXRA 1PBUA 3DLEB 4OI0A 2GO8A 1FCAA 3S2DK 3CJ5A 4X4UA 3NOCA 4CM0A 4IOAQ 1DLOA 3CUNA 3TA2A 1AT1B 4I6WA 2XNQA 1H2VZ 1HNZJ 3QLHA 1RAGB 1B7FA 1TKXA 1KS2A 5HI7A 4QR1A 3D7SB 1LFWA 1KOOA 1SB6A 1SUQA 1F0XA 2CDRB 4AXIA 3M4OC 3IFEA 2J6TA 4PQUB 1UKUA 2VG7A 1KFDA 3M9OB 2QX0A 1MMNA 3M6XA 1U6ZA 1VLOA 2VBYA 2X1FA 1T05A 2BKPA 2R93A 5LSLA 1SJ3P 1W2IA 5C44K 5DDPC 5F0WA 3MM9A 1S4FA 3OJUA 2B6AA 2H4YB 3KLIB 4BLGA 1IBLF 4LF9J 4GRSA 1TWHC 5DZ6A 2R42A 5L1JA 4DV0J 1QM9A 1ZBSA 4IH6A 3GTKA 1AA1B 3JAMY 3N9UC 4DR1J 2WVFA 2IJFA 4EZ6A 1IBLJ 1QAJA 1HMVB 1OQ6A 3FVYA 5CYMB 2CVIA 5L8RC 4XSZA 2VKRA 4O23A 2QL5B 2COLA 1FVQA 1YJ7A 3GV7B 2C3UA 3PV8A 1TMMA 4ECTA 2MZJA 2B63K 1YBTA 3K0JA 2E1RA 2B51A 4PZVA 3UD5A 3G86A 2UXBJ 2PI4A 2C28A 4YDDB 4DL3A 3DXBA 2XMUA 1IBAA 3P6YC 3H20A 1BQNA 3OHAA 4G1QA 3G8SA 4F4WA 3V6JA 4DFKA 4CLYA 3VVUA 2OFHX 1RT2A 3Q8UA 3C14B 3GIKA 2Q3PA 4WILA 1S1WA 4C6AA 3B82A 5KG7A 4GC6A 1SKRA 3TWZA 4YFKA 1NAQA 1DTQA 1A0OB 4K4ZA 2VQFJ 4UY85 4H4OA 4CLSA 5D8HB 2CPIA 4L73A 1WQGA 2AX1A 3H90A 4WFNQ 2R92C 4X4OA 3TJ8A 3QGHA 1FRKA 1X4HA 2HHWA 1BMQB 4M94A 4DI6A 2KZZA 1I50C 1K1QA 2B5JA 1KRPA 3MMAB 3H0GC 3LAPA 4RW4A 1YNJA 4GKJJ 2XCOA 2V68A 4A48A 3KLHB 5K8MA 2F1FA 1PC4A 3KHRA 2LMIA 1FESA 3LAKA 4KMAA 3S1NC 3M7VA 2D1CA 3J7YI 1U02A 4QWCA 1UWBA 2QLWA 4ID8A 4C48A 3HP6A 3UVJA 2W9BB 1NJXA 2V9WA 4FVCA 5CQGA 4F4YA 1ZQ1C 2VQEJ 2WB1D 2FPHX 4PKDB 1NU4A 1S72S 2Z30B 1YDLA 2MDAA 2O5IA 1U2FA 2DIVA 1SQEA 2MQLA 4PG6A 1GE9A 4CO1A 1YGYA 5CXTA 3R7BB 1NJIT 4GVBA 3AT1B 5CYQB 5KFLA 4LSNA 1SL0A 4PYAA 1WJ9A 1UW4A 4DUTA 2J9EA 4QWEA 4DUZJ 3POTB 3K5PA 4A8FA 4EYHB 1W25A 3PO3K 3RB0A 2KVIA 2AIRB 3FFIB 2AZ1A 4QW9A 1P9YA 2DY1A 5D4PA 3RBEA 3FRZA 3GTLC 2OEJA 3K5LA 2XBPA 3A3OB 5SUHA 5D3GB 4TU7A 2M4MA 3K7AK 2WB1L 2R2SA 4YR0A 4DR5F 3HOUK 2I5JA 4ED4A 3LP1B 4BBSK 3DC2A 3IG1B 3CDEA 4OIQA 4DSEA 4RWXA 2V63A 3LGNA 4BWMA 1TWCK 3RB6A 2J0XA 3J7Z5 3CDWA 4HH0A 4X4VA 3GTOK 3CCZA 1KEKA 3EJMA 3OFFA 1KLMA 1Q8KA 1YK9A 2WVDA 3RTVA 2YQ1A 2X1AA 4ZP9A 4KYZA 1HWJA 5IYCK 4QCLA 5CJ9A 3GTQA 2ZJPQ 3H0GK 3I4HX 2VKZG 3SQGB 5F41A 1KQFB 4EBEA 3RBZA 2HMIA 4FVMA 3EM1A 4A3FK 3TRGA 4DL4A 1G6BA 4JI6J 5TMCA 1KQ4A 1CJKA 3G8QA 3SCIE 2VBXA 1RU2A 4ECRA 2ZUFA 3KLFA 1BHNA 2R7UA 4OLOA 2E2HK 2G0JA 2CKWA 4QW8A 1Q78A 2KDOA 5KOXA 2ZKUA 1QTNB 2BX6A 2IBOA 2FZGB 4DQRA 4UUXA 3OBIA 4DR3J 4KN7A 3TUIC 1RT3A 3O6QA 3HOYC 3EQLA 2XY5A 3ET6A 3GTQC 1SH2A 4IUFA 2DXEA 4YG2A 3E01B 2UUAJ 1XIQA 3FC9A 2AWZA 4LFAJ 1BDFA 2XMAA 2W4PA 1F93A 4C8LA 4CQ1A 1ZA1B 2IJNA 1TK5A 1WI8A 2GMJA 1OWXA 4NEZA 3MAAA 4TLQA 4KY3A 1Q0NA 5C4XK 4HTJA 3NS6A 1XK8A 2QIFA 3DGPA 1N32J 2YKNA 1QD1A 4I6YA 3M30A 2O1PA 5EX0A 4DMZA 4C2MK 2RUGA 5BYQA 1PJ6A 3NP5A 2MGZB 2DISA 3E8OA 1XERA 5EGHA 4HYKA 4QYZK 1TL1B 3GONA 2HVZA 1N6QB 2J9DA 4JI5F 3GU0A 2KHDA 2W9CB 3OFEA 1S6UA 4C3HK 2JZ5A 7FD1A 1VQ4S 3UDVA 4IO9Q 1VDHA 5HL7Q 1RABB 3Q24A 2YNGB 3MEKA 1FF2A 3HFZB 3AD9C 1GNKA 4DFJA 5IS2A 2KJVA 1SUQB 4C9DA 5G0RB 2EFNA 1GXLA 3QPIA 5DGBA 3NMRA 4B08A 2EBGA 4AD6A 4FF1A 2V34A 2CJ9A 1R8PA 2JA8C 1Y5IB 4ZPDA 1HBNA 1WCMA 4JYAJ 1KQSR 3DHWC 2JHEA 5E41A 2G2OA 1O26A 4IH5A 5IOTA 3HKWA 1HA1A 3HCXA 1PBAA 3FOEA 4Y3CA 1S9GB 4JI0J 5KFTA 4Y2MA 3FSYA 4U6PA 5IYBC 3HOWC 2VPYB 3I4NK 5IP7C 3CMAS 3I82A 3LGMA 2AKWB 4ZVRB 4QQBA 3CO0P 2CQIA 1JJ2R 1APSA 2GQQA 1WEYA 1O2FB 4ZDNA 4KMDA 3C6UA 4DUYJ 4RWWA 1W2BR 3KHGA 2ZH1A 3RR7A 1V5IB 4B3SJ 1IKYB 1XMQJ 4QIWD 3GTJC 1F6TA 1UEKA 1JJCB 2MZRA 3OXFA 1RT6A 4PUOB 2N7YA 4ED2A 2OAUA 2PGCA 5T7LA 2KFZA 3NBPA 2OH2A 4CTAB 3MR5A 5KG0A 3PW2A 5E0OA 1TUWA 1RT7B 5A8WA 1JB0C 2XG8A 2V4JB 3T1HF 5JVOA 3AFGA 5KFGA 4B3RF 1S9GA 3E2EA 3UFCX 1BJTA 1I3QA 1TWFA 3MEEA 3BZQA 2CQHA 4KDDA 4Q2MA 4Z37A 2PA3A 2IA0A 3M9NB 2OPQA 1YZ7A 1GTHA 1HI1A 1NH8A 4UF4A 1YJUA 2BJ9A 3R1HA 1NKBA 2I8EA 2RF2B 1X4EA 3GTKK 4M8LA 3MEGB 4I64A 5M3MK 1VK3A 2UUTA 2F40A 3SDEA 2BE2A 1FRHA 2FLOA 4CO0A 3GTMK 4JV0A 3M8QB 2OPRB 3K2YA 1IL2A 3IA0A 3HSDA 4GTAA 2A2CA 1G4CA 4C4WA 1L3KA 4FBTA 4CTAA 1FJGJ 3AD7C 1Y1WC 5ETOA 3HVTA 1YWXA 2ROGA 5GMDA 3SEOA 2WTFA 1Z2ZA 5CHPA 1Q1KA 1H7WA 4B9UA 3UCGA 4BC7A 4F50A 4I69A 3M8PB 4H54A 4AL5A 3KK1A 3DRRA 3MCSA 1TQLA 1RYSA 4OYXA 3M6VA 2CJAA 2KYZA 5DLFA 1X5OA 3PX0A 2CQPA 5GAHI 2UUAF 3MXHP 1Y1VA 2XY7A 4ZCMA 3KDNA 2Y8YA 2YKPA 4CLUA 2SXLA 4WKRA 2J6UA 3JYTA 1XR6A 1YIJS 1D8YA 3ERED 3BR8A 4IRDA 3ISND 1R0AA 5CYQA 3QAUA 4HKQA 2PIIA 1WOPA 5F3TA 4ZVPB 3NXZA 4IYQA 4BBYA 5GAGU 4Q5VA 1HKAA 1Q4RA 1IVZA 4M95A 5KFYA 4URQU 3B54A 4JI3F 1U4BA 3N5FA 1RACB 1FVSA 5LXYA 1B7YB 1NLKL 4B17A 2MQQA 2ASYA 3KK1B 3AOCA 3J7ZT 1R9TA 3J7A1 1Q95G 2VDHA 4OZLA 1IUJA 2HHQA 1G3OA 3EGWB 3PEHA 3TFIA 2VC0A 2GVZA 1YJVA 3T6BA 4ED3A 5I3QA 1YVFA 3N79A 3GV5B 2ZBQA 1EHWA 2RH6A 3GTKC 4B9NA 4Y6IA 1EFWA 3OSNA 4RUCA 2C2RA 2OD4A 4DFPA 3IPJA 5L38A 2GAGC 1D9DA 3B4MA 5J1PA 2IRUA 1VRUA 3T41A 4KPYA 2D7SA 5GAGI 2ZUAA 4B9TA 4ES1A 4UOHA 5J2PB 4GT9A 3D0HE 5L9NA 2YU9C 3Q23A 4I2QA 2ATLA 4A3MC 4LRCA 3PO5A 4CLTA 2MMYA 3QWUA 2YWEA 1NHUA 4DX7A 2CYYA 1RCOB 3I87A 1NB7A 3CD6S 3BM7A 4MEXA 1SIZA 3TP2A 2BABA 2XTJP 1O2AA 2AEFA 3SXLA 1RUSA 4RKUC 2G1DA 1MW7A 1U1KA 2K7KA 2NUUG 3ISZA 3G82B 2HQDA 2JLEA 3T1YF 3U1NA 1RTDB 1LXJA 3IM9A 3CSKA 4OI2A 4NEYA 1KVIA 2XEXA 1JLEA 4ECWA 4KO0B 2J7WA 2LQ5A 1S6QA 4PWWA 3PDNA 2M8DB 5E3CA 3EDRB 5F8GA 1FX4A 3RZOK 1X4FA 1KKHA 4GC7A 2JEGA 2ASLA 2A3JA 2KH9A 2ZHBA 4YDXA 3KG0A 2MLYA 5CYJA 2GSUA 2W8KA 2NXUA 4IRKA 5CHCB 1T9XA 3H0GA 1H2UX 3T3FA 2W2MP 1R8BA 3HOXK 3CCVS 1RB0A 4M5LA 2FIUA 1LW2B 1HNIA 1TELA 2BVZA 4JV1A 1O27A 1WKLA 2R8KA 3KLEA 1HNWF 1OYDA 1VLYA 4BY1K 3DYAB 3LP0B 2A6EA 2BACA 1ITPA 1F60B 2UXDJ 3QMQA 3NGKA 1FJ7A 2W9AA 4K2JA 1Y5NB 5BJRA 5F3ZA 1VRTA 2LQ8A 2HNZB 3BP8C 3PFOA 4YY3J 3CD5A 1NHKL 1LKZA 4AFFA 1M90T 4ZITA 4RNNA 1RWKB 4X6AC 2K2PA 1CQMA 3VGSA 2LFVA 1WG4A 2E2IA 3UW1A 4ECZA 5J2QB 2AW0A 3HOVK 4BDPA 2ZZTA 3TZYA 3BSAA 4Q0BA 5K5MA 1XMOF 4LF8J 2R8IA 1DCHA 5IM0B 3BP3A 2W4CA 5D4LA 2NVTK 2W2NP 4FKXA 4MKYA 3MEDA 4LT6A 4OYPA 1I3QC 3BO4A 5L9XA 3H5SA 3KUGA 2E1AA 1NSKL 2XMVA 5BYRA 4A3LK 3CE8A 2ZBIA 1W26A 2KRRA 2IDLA 3EZ5A 1RTIB 1SJFA 4HI2A 2R7ZK 1S4EA 4IOCQ 3K5OA 2MY7A 1X9SA 2MKCA 4WJ4A 2GO9A 1UZHA 5CA5A 5IYDK 1X5TA 3W5YA 1XZQB 4FBUA 3CEDA 5D0HA 2B9YA 3EMTA 3S2HC 2CNOB 1MN9A 3F0NA 5LMNF 2CADA 5IT4A 2V2VA 3MMLB 3IR6B 4A3KC 2B8PA 5DGAA 4RPFA 1Y10A 3KJNB 3SFGA 1JQWA 1NJWA 1RBLA 1YLXA 2DRAA 3BDEA 2VFRA 2YQ3A 1MSWD 4RNHA 5CD4H 2R7SA 3VF0B 4K8RA 4KV8B 3J80U 3OREA 1ZZFA 4PXEA 1C4AA 3GMGA 5C7PA 1VI7A 2U1AA 1RU1A 2IA6A 3KMSA 4OX7A 3CPWR 1CBKA 3PYEA 4WYWA 3UCZP 2LEBA 1F3VA 5CCLA 1U24A 3OXLA 4I4BA 1N4LA 4K4UA 2WRMA 1EI6A 2Z4PA 2Q1LA 2ZM6J 2KG0A 2ASJA 2Y0SL 3OTCA 2R92A 4Y00A 2XS7A 5IZHA 3H2LA 5EGEA 4PUOA 2DGOA 3VAHA 2J0QD 5LL6d 1F9HA 5AXKA 2D69A 1ZA2B 4O3SA 3BQ2A 2BMBA 1ZZNA 4TNOA 1XNQF 2OEMA 3R1LA 3V4IB 3TYTA 4MTPA 2XC9A 4FPRA 3GPAA 2N3OA 4LR7A 1F7UA 1PG5B 2H48B 2PI5A 3IN5A 3C46A 3MGJA 3UD3P 3M32B 1RLCL 2Z0GA 2QO3A 4IO1A 1K73T 4A8WA 2FY1A 2ALYB 3QJJA 5HANA 2N7CA 5C42B 4UY8T 5HSPA 2R93C 1S1VB 4RW7A 3PO2K 2IIHA 3MM7A 2QFIA 3GP9A 2XZWA 3R8YA 3DLKA 2UXCJ 1VYAA 1VH2A 1H6KX 2HGLA 2R7ZC 4ZVSB 1W7WA 2P9EA 1RLDA 2WW8A 3LPYA 4ZVUB 3QBCA 1C1CB 4LUBA 2NVXC 1WC1A 3W2VB 3P5TL 3S1TA 1X4GA 1X4CA
chains in the Genus database with same CATH topology
3AD9C 3GEEA 3TFHA 4PABA 3ADAC 4PAAA 2GAGC 3GIRA 2GAHC 1VLOA 3GEIA 1PJ7A 1XZQA 1WSVA 1PJ6A 4P9SA 3GEHA 1XZPB 3A8KA 1XZPA 1V5VA 1WOOA 1XZQB 5L46A 3TFJA 3AD8C 1WOSA 1WORA 3A8JA 1PJ5A 1WOPA 1WSRA 3TTGA 3AD7C 3A8IA 1YX2A 3GSIA 3TFIA 1X31C 1VRQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AD9 C;  3GEE A;  3TFH A;  4PAB A;  3ADA C;  4PAA A;  2GAG C;  3GIR A;  2GAH C;  1VLO A;  3GEI A;  1PJ7 A;  1XZQ A;  1WSV A;  1PJ6 A;  4P9S A;  3GEH A;  1XZP B;  3A8K A;  1XZP A;  1V5V A;  1WOO A;  1XZQ B;  5L46 A;  3TFJ A;  3AD8 C;  1WOS A;  1WOR A;  3A8J A;  1PJ5 A;  1WOP A;  1WSR A;  3TTG A;  3AD7 C;  3A8I A;  1YX2 A;  3GSI A;  3TFI A;  1X31 C;  1VRQ C; 
#chains in the Genus database with same CATH topology
 3MHY A;  2FQT A;  4K4T A;  4RW9 B;  4LVO P;  2HHH F;  2QLB B;  3DLE A;  2E9T A;  3MDF A;  4CO4 A;  3QRQ A;  3N6L A;  1I94 F;  4DR4 J;  3G6X A;  3AXM A;  4QYR A;  3BKU A;  4DSL A;  1IR1 A;  1HHT P;  2XCQ A;  2MKH A;  4X64 F;  4C8Z A;  2VUG A;  1R6Y A;  3FMB A;  1A9N B;  4JP8 A;  3V4G A;  3NMA A;  2O5D A;  8RUC A;  3KJV B;  2VJV A;  4OYZ A;  3TA1 A;  3KKF A;  4FXW A;  3TAM B;  4ZVF A;  4KC6 A;  4LSL B;  3G4A A;  2MYF A;  1D8Z A;  2R8H A;  3UDE A;  4YY3 F;  2ZNZ A;  4B02 A;  3QT5 A;  2XWY A;  1R9T C;  3MUR P;  2IHR 1;  4EO6 A;  1HNX F;  4LRA A;  3A1Y G;  1Z4U A;  4HHU A;  3OV7 A;  3R6G B;  1RT1 A;  2J5A A;  5LJ3 Y;  3ELH A;  5KG6 A;  4O44 A;  3FKI K;  4LVN P;  4DCP B;  3AJ1 A;  1X8D A;  4LOW A;  1WC4 A;  3MM6 B;  1TKZ B;  1H0H B;  1DJ0 A;  4MT1 A;  2XCP A;  1FFG B;  3V6D B;  1R27 B;  1YZ6 A;  5A8R B;  2NSB A;  2R4F A;  2NPF A;  1HR0 F;  1QUV A;  3DI6 A;  5ETS A;  4LQ9 A;  2B7C B;  4WJ3 M;  2VPX B;  3M8W A;  4GKK F;  1X5S A;  1ZTT A;  3W9J A;  5K9F A;  3VVT A;  3IRX A;  4M5K A;  1KR4 A;  3FDS A;  1TL4 A;  4R8U B;  3KLV A;  3CCE S;  4Z7Y A;  1IXK A;  4R0J A;  4LJZ A;  1Q86 T;  2DGS A;  2QFJ A;  2CFX A;  4LSN B;  1MN7 A;  2AQ4 A;  1M1H A;  4GVL A;  4ZHR B;  3MI7 X;  1HPZ B;  3OLA A;  4LLG A;  1I3Q K;  4AL7 A;  1NME B;  2RQK A;  1YNN A;  3EZU A;  3P3D A;  2CZ9 A;  1SH0 A;  4QR2 A;  1M0S A;  2YNF A;  1V3S A;  3TX0 A;  3O1L A;  3W65 A;  1KN6 A;  2DH7 A;  2W2O P;  3W5X A;  3HVA A;  1FEE A;  4USJ C;  3ZZZ A;  3IGV A;  3R27 A;  1BQX A;  4A3C C;  2GJF A;  4ETZ A;  1O2B A;  4QIV A;  3JST A;  1KTV A;  1UVJ A;  3LW5 C;  1Z1Z A;  1S59 A;  3PAC A;  1RT5 B;  2NYI A;  3QQC D;  1VIS A;  5ETL A;  4KMH A;  1D1U A;  4NA2 A;  5E3A A;  2C2M B;  4UST A;  3LAM A;  4K4Y A;  1ZM3 A;  1OO0 B;  5KFV A;  3OTO F;  1TKX B;  1DCO A;  1RHU B;  7AT1 B;  1S0V A;  3QIP B;  4KQZ A;  3BSN A;  4RMF A;  2DNN A;  2G9O A;  1N33 F;  3PG9 A;  4B9V A;  1VR6 A;  4PQU A;  1SVD A;  1JKH B;  2RDI A;  4ZCL A;  2MZQ A;  2CG8 A;  3D4J A;  2M8H A;  1NK8 A;  3MM8 A;  2FQQ B;  5IQQ A;  5MAO A;  3BEG B;  3I0R A;  4FKY A;  3DDK A;  4A3G K;  4LJM A;  4DSI A;  3WX8 A;  3MPW A;  4NLO A;  1MWY A;  3GJS B;  2QSF A;  1VBX A;  4CYU A;  2DYA A;  3UN5 A;  2RNE A;  2ZHO A;  1XR7 A;  3HHK A;  4KKO B;  3W8G A;  4PG4 A;  2RAQ A;  4N47 A;  5LT5 A;  3OW2 R;  6AT1 B;  5DG7 A;  1YJW S;  4W98 A;  2L9N A;  4FN5 A;  2CZV C;  2V6A A;  4PPD A;  3OL8 A;  2RQM A;  2HFZ A;  3L9Z A;  2EC0 A;  2E2J C;  2DIT A;  3MCM A;  2PMW A;  2ZOG A;  1JOE A;  3AB4 B;  1P1L A;  2LLZ A;  1SKS A;  1S9F A;  3FHZ A;  2IM1 A;  3GDZ A;  3BN7 A;  1VQL S;  4MK7 A;  3I32 A;  4ZCK A;  1UVI A;  3QJP A;  2V8D A;  2Z2L A;  3A8E A;  3D3B J;  4OI3 A;  1DLO B;  3N01 A;  2RJZ A;  1VBY A;  1H3D A;  4O3O A;  3E3X A;  3GFH A;  1XNR F;  3M8P A;  5GVQ A;  1O25 A;  3QLH B;  4TLR A;  1UVM A;  2JX2 A;  4NLU A;  2AJ4 A;  5IWA J;  5C3E K;  3A8I A;  2C42 A;  1JLB A;  1T02 A;  3NWR A;  4G1I A;  1VQ9 S;  4V19 X;  1GAO A;  1KFS A;  3W61 A;  2LXU A;  1EET B;  2Y1J A;  2BXJ A;  3DN9 A;  3MAA B;  4MKA A;  4DLE A;  1USM A;  4M5D A;  3VAJ A;  1T05 B;  5KFC A;  5HQL A;  3CJQ A;  1FNX H;  4WE1 B;  1Y1V K;  3UQS A;  2DXF A;  4ECX A;  4KR0 B;  1CQN A;  1Q8B A;  3HJV A;  4J9O A;  2AV5 A;  3I31 A;  1DAX A;  1WOS A;  1I50 A;  2E2H A;  4J9S A;  4KC5 A;  1JLG B;  1RAE B;  1NDK A;  1RHJ B;  4DF4 A;  2HZV A;  2V8V A;  3R97 A;  3Q8S B;  4YB6 A;  3QAE A;  2IAJ A;  4JBC A;  3DOL B;  4NCB A;  3X1L B;  4B3R J;  2YNH B;  2J0W A;  2HFN A;  2ALZ A;  4QIW L;  2CQG A;  2DO4 A;  3HHN B;  3CWJ A;  2OGU A;  1TL7 B;  3JQJ A;  4WFX A;  2R7W A;  1SL1 A;  3EXC X;  3MR7 A;  4ELU A;  3Q8R B;  3LWL A;  4LF2 A;  2FLP A;  2KO1 A;  4KN4 A;  3VZI A;  3BKF A;  3AD8 C;  3M1V B;  1WAC A;  1R8C A;  1D0E A;  2RF2 A;  3DNC A;  3U02 A;  3CCR S;  3GIJ A;  4G1Q B;  3OTO J;  1HNW J;  3D0I E;  3QT7 A;  4KHP J;  5H9F K;  3BRE A;  3CIM A;  4IDK A;  1ISE A;  2FJB B;  2YWK A;  3T1A A;  3IWN C;  4OQJ A;  1RCX B;  5BYS A;  2LKZ A;  4TU9 A;  3A3N B;  2F7V A;  1UFW A;  4QPT A;  4B9L A;  1VBK A;  4BC9 A;  1DRZ A;  2IDE A;  3D1H A;  1N5V A;  3VGV A;  2VJU A;  1RT4 A;  4DR7 J;  4OZ5 A;  5M2U A;  3W63 A;  2OPP A;  4P71 A;  2IC3 A;  2HRU A;  3AHP A;  4RLE A;  3H5Y A;  2OML A;  1JLA A;  4KHR A;  2NYH A;  2E7X A;  5C4J C;  2V8G A;  4QYZ J;  2AYG A;  2FGC A;  1YRU A;  2AP6 A;  1XC9 A;  2YVS A;  1HIY A;  2EG1 A;  3R5G A;  3HT3 A;  2GC8 A;  2MGZ A;  3CF5 Q;  2CQ2 A;  2CNN B;  1TL1 A;  2V6T A;  2BR0 A;  2CWX A;  1SV5 B;  3JB9 k;  2ADB A;  2B63 A;  4TXS A;  1UVL A;  1TWG A;  1GEH A;  3OHB A;  1LW0 B;  2KXN B;  1LWE A;  3L09 A;  4J9V A;  3SCJ E;  3QWP A;  3RBX A;  5KFP A;  1T3N A;  3BR9 A;  4LR8 A;  2FGO A;  1CPZ A;  2NS1 B;  2K06 A;  1LK5 A;  2OPQ B;  2MSS A;  4A93 K;  3V4M A;  1OJ4 A;  2HK3 A;  3GTM A;  2W25 A;  2NZC A;  4V19 J;  1U8W A;  4ICL A;  2VG5 B;  2FHK A;  1Q81 T;  1N6Q A;  1UAW A;  5JFE A;  2VPW B;  4PWD A;  2P2C B;  4GZY A;  4ZA1 A;  1DQ8 A;  1GH8 A;  4QJV A;  4NXN F;  1JLA B;  3MTK A;  5LSO A;  5D77 A;  3O3L A;  3DLL Q;  2XLJ A;  4F0H A;  3QZ7 A;  2IRX A;  4K4W A;  5FDL B;  3SQO P;  4A3G C;  5J1N A;  5DDQ C;  1WC6 A;  4DV4 J;  2MQP A;  3CDA A;  4QU7 A;  1RT1 B;  1U1O A;  4BY7 K;  2GQC A;  4KIA A;  1DQA A;  4GTB A;  3ILL A;  2R3V A;  3SCK E;  2KRB A;  2VIC A;  3HDS A;  2X1B A;  3GG1 A;  1RTJ B;  3GYG A;  3GZ7 A;  3HKZ L;  2JA8 K;  4WTO B;  1SIW B;  1I6H C;  1GMV A;  2ZJQ Q;  4L72 B;  2HQ3 A;  2CG4 A;  3VAF A;  3CT9 A;  4ZS6 A;  3R6L B;  4F04 B;  2GX8 A;  2EK1 A;  3M2V A;  2BOP A;  4JI1 F;  1V3R A;  1TWA K;  5IYB K;  4RW6 B;  3HOW K;  5IT9 Y;  2UU9 F;  1CJV A;  1S57 A;  1H7X A;  1N8R T;  1IQZ A;  3OEP A;  2Y3Y A;  2CPD A;  4IFY A;  1VJW A;  3NS7 B;  5I3P A;  5KFU A;  1RXO B;  4P6Q A;  2FLL A;  2EFG A;  3J7Y U;  3ILJ A;  3G4C A;  2G2Z A;  3AB2 B;  2V4J A;  1FKP B;  4WFB Q;  4PXB A;  2KHC A;  2CPH A;  1N0U A;  2CJK A;  4PAA A;  2E44 A;  3C16 B;  3ICL A;  4AYB D;  1QSY A;  3T6J A;  2WBR A;  4N7T A;  2J7K A;  3ENV A;  2DGV A;  3KYL A;  3KUH A;  4H4M B;  2GVD A;  2I1R A;  5IXU A;  5FII A;  2W9C A;  1T03 B;  5ETM A;  1RT5 A;  2QTW A;  5C5J A;  2HPU A;  5GAH U;  4ZVG A;  4F3M A;  4ELT A;  5HQM A;  1P9Q C;  1N34 J;  4DZD A;  1S1X A;  5KFS A;  2HFO A;  4KHP F;  2XHW A;  1RTH A;  1LNQ A;  2YTC A;  4FYY B;  2Z2M A;  4Y2K A;  4WZQ A;  1GXU A;  3PX6 A;  1SFO C;  1EQ0 A;  1NPK A;  2HVE A;  3MEG A;  4B3O A;  1NKE A;  5E3R A;  3OR1 B;  3S7R A;  2B7B B;  4UOC A;  4JV5 F;  1WOR A;  2BE2 B;  3K57 A;  3D66 A;  2DIU A;  2DRD A;  2OEK A;  3K5N A;  4DV1 F;  2HND B;  1JLQ A;  1JIH A;  4BY7 C;  3RB4 A;  1U47 A;  3DU5 A;  2FJV A;  3M2R A;  5A0Y B;  3VV2 B;  3JSB A;  2BE5 A;  2HGM A;  2RS8 A;  3WC0 A;  2FYX A;  1JLF A;  2FY8 A;  2G2Y A;  3VGU A;  1ULR A;  1NK6 A;  5CAB A;  3CGI A;  3CTR A;  2AYE A;  1M5V C;  1FRX A;  3LPE A;  4G3I A;  4WIQ A;  1BLU A;  4QU6 A;  3L7P A;  3OD2 A;  3CC2 S;  2LDY A;  4TQS A;  3KUE A;  2ZHA A;  2ZH8 A;  1X5P A;  3FSI A;  1FFS B;  3H59 A;  4AL6 A;  3NAI A;  5CZX A;  3OPF A;  3J81 j;  4GTF A;  2GW8 A;  1WF0 A;  2EFO A;  2IJR A;  5HVF A;  2OUG A;  3MCN A;  2HZC A;  2QMX A;  3K7A C;  1RT6 B;  1CC7 A;  1RIS A;  2CQ4 A;  1NK5 A;  2R7T A;  5A2Q U;  1R0A B;  4B9S A;  3S16 K;  4E0D A;  5E5N A;  2RDJ A;  2LU2 A;  3M2R B;  1WG1 A;  4NLY A;  3QO9 B;  1S12 A;  2BUN A;  2AEM A;  4ZP7 A;  4DX8 H;  4PRF A;  2EKN A;  4CLZ A;  3CMQ A;  2B4V A;  1JXE A;  2M70 A;  2XGP A;  1NB2 A;  3KTQ A;  3P45 B;  5ETP A;  1C1B B;  3DLB A;  4DQI A;  4ANE A;  4N8N A;  1CS4 A;  3P96 A;  1UMJ A;  4K7Q A;  4P52 A;  3H2U B;  3N0V A;  3PNI A;  2X3G A;  3DGV A;  2H65 B;  5THW A;  3C15 B;  2MQM A;  2DR9 A;  1C4C A;  4C3I K;  4C0H A;  1RA7 A;  3PCO B;  2MEW A;  3ETM A;  3TZX A;  3K8W A;  1ARO P;  1N5Y B;  3RB3 A;  2CJX B;  3FJ2 A;  4IQX A;  5FLX Y;  3R2C J;  4OX9 J;  1O29 A;  9RUB A;  3ITH A;  2ZOF A;  2I9S A;  1RT3 B;  1FI4 A;  2VBZ A;  2KTQ A;  1NXI A;  1SC6 A;  3SZY A;  1QJH A;  1CUL B;  2J76 E;  3G82 A;  2AX0 A;  4G1P A;  2HWI A;  4B9M A;  2GHV C;  3OVS A;  3CB4 A;  5T7L B;  4DDF A;  1NJZ A;  4FZB A;  2JEI A;  4LBH A;  2NCK L;  4KO0 A;  1PYS B;  3NGT A;  1JNR B;  4AE5 A;  1H73 A;  2DPJ A;  4FXD A;  4X4N A;  1L3S A;  4DPO A;  4FYW B;  2BM0 A;  2DK2 A;  1ZPV A;  4NL5 A;  4P72 A;  3GFX A;  3DDI A;  5HMZ A;  3MPV A;  4K50 A;  4BWJ A;  3U7J A;  2DNZ A;  1FE0 A;  5M2P A;  1TWH A;  2G1H A;  5LMN J;  2Z8Q A;  3W2V A;  2Y3P A;  1K0V A;  3MM9 B;  2VG6 B;  3S14 C;  3ISN C;  4N77 A;  2OFG X;  5KG4 A;  3Q8P B;  2HLT A;  3GQC A;  3OSP A;  3T9Z A;  1OIA A;  3CQZ K;  3SZZ A;  2YNI B;  5EWE A;  2FHJ A;  4MYT A;  3FUY A;  4WBF A;  4OYM A;  2WB4 A;  3QSY B;  3Q3Q A;  2VA2 A;  1LW2 A;  3V6H A;  3BN4 A;  2XM3 A;  4IRC A;  3HHL A;  3CCT A;  1PJ5 A;  4ZP8 A;  1WEX A;  4WP3 A;  2FVR A;  1T95 A;  3ILI A;  2HS4 A;  1M1K T;  4LFA F;  5E3P A;  3HZG A;  4RNF A;  4ZPB A;  1JKH A;  5AJ3 J;  5IV4 A;  3RZD K;  2MXY A;  3L7O A;  3CUL A;  1U1N A;  1O5J A;  1B0P A;  4P74 A;  3M32 A;  4CLP A;  1ZS6 A;  2YWF A;  3FZB A;  3MOZ A;  3M8Z A;  4KB4 A;  3F56 A;  2IMW P;  4G0U A;  1F2H A;  2HYI B;  5K14 B;  4MJK A;  3QNW B;  3BGU A;  4X4P A;  2DTJ A;  4MYU A;  1WG5 A;  2A68 A;  5KG2 A;  2OTL S;  3S2H K;  3NCP A;  4B3M F;  3SV4 A;  5C25 B;  3JQM A;  1R9T K;  3JXO A;  4IH7 A;  3WZ0 A;  4U96 A;  4OFZ A;  2AYB A;  2YNI A;  2BOA A;  4IFV B;  2VUM C;  4NLP A;  2JJ4 D;  3R3T A;  2PFF B;  2J8A A;  2D74 B;  3C6T A;  4EYI B;  1VIO A;  3DDN A;  2V4Q A;  2P5M A;  4GTL A;  4C97 A;  4WTY A;  3UWT A;  1J5E J;  3S14 K;  4Y52 C;  2BRK A;  1RZM A;  3CQZ C;  2IVF B;  2YH0 A;  2YU9 K;  3THT A;  2XI3 A;  3PKM A;  3GTP K;  1KVK A;  4HAC A;  1NDP A;  1YHQ S;  4KAR A;  3VAI A;  2JVR A;  4PG8 A;  1WKK A;  1RU0 A;  1IBK F;  1VIX A;  5K14 A;  2EI5 A;  1FKO B;  2MLZ A;  4RW6 A;  5KFN A;  1ZM2 A;  5FD1 A;  4FNI A;  3WBZ A;  1KQG B;  5M5X K;  2NQP A;  2Y8W A;  4JUZ A;  4OHX A;  2Z58 B;  4NI2 A;  2JA6 K;  3CJ8 A;  3FKI A;  1K44 A;  5D78 A;  1OPI A;  2R7Q A;  2FHM A;  1MG7 A;  3SSS A;  1QVG R;  2E9Z A;  2AYM A;  1LEO A;  4ED1 A;  1FDD A;  1MWZ A;  3MUV P;  2ZC3 A;  1R3N A;  3DLH A;  1H72 C;  2IMO A;  4NE9 C;  1PCA A;  4XIU A;  1I94 J;  4GVB B;  1EX8 A;  5A8K A;  3PXG a;  9ATC B;  3R9L A;  3UVJ B;  1USO A;  2V6U A;  3ZTO A;  3LPX A;  1Q8L A;  4M5G A;  2ZH3 A;  3G96 A;  4AUK A;  3T5K A;  1SQF A;  3MM7 B;  2DNH A;  3C2P A;  3BQ1 A;  1UV7 A;  1D9A A;  1TAU A;  4F02 A;  4BS2 A;  2ROP A;  3PW7 A;  2P5V A;  2RQ4 A;  4F3Q A;  2MHN A;  2JLG A;  3BYP A;  3ZC4 A;  2UUC J;  5IV3 A;  3BPS P;  3GEI A;  4LRE A;  3DRR B;  2JEF A;  2XCR B;  2W2Q P;  4B3S F;  1HD0 A;  4MH8 A;  5F8M A;  4RU2 A;  1V6H A;  3TAQ A;  3HJF A;  3FKB A;  4M63 A;  1YJN S;  2H4W B;  1AB8 A;  1IQ0 A;  3TX8 A;  4FYD A;  4I56 A;  1HR0 J;  2PD1 A;  2QZ8 A;  1PYT A;  4WXW A;  5K20 B;  1SI9 A;  2VIH A;  3S1R K;  5ETR A;  1XZP A;  2ZWO A;  2PMZ D;  3QZ8 A;  4JV2 A;  1BQM A;  3C19 A;  2B6A B;  4KAI A;  3CCW A;  2HW3 A;  1EKS A;  2ZVS A;  1J27 A;  1U48 A;  2RT3 A;  1WHW A;  3TAM A;  2ZH7 A;  4OIP A;  1IBK J;  2FVC A;  1H38 A;  2H9Z A;  3KWM A;  3NCR A;  5FLM K;  3FEZ A;  4JI1 J;  4DPX A;  2U2F A;  4XPC A;  1GT8 A;  5M5Y K;  3SQG A;  5B09 A;  3HHD A;  1U1M A;  4TU8 A;  2VFT A;  3GTY X;  4OL8 A;  4OI6 A;  4DL0 C;  5HMX A;  1ZVU A;  3CCU S;  2XSF A;  4A4J A;  2RH3 A;  1NK9 A;  2OO4 A;  3H42 A;  2JC1 A;  3IP0 A;  3G71 S;  2DR5 A;  4Q0B B;  3JAM U;  3R5C A;  3FBC A;  1UP1 A;  2ZH6 A;  5DRK A;  1LWE B;  1XXA A;  4RL1 A;  1DTT B;  3HZE A;  3GJT B;  2YPY A;  4P75 A;  4P2M A;  1VRU B;  3RGI A;  1REV B;  1SC1 B;  4O3N A;  3PM9 A;  1KLN A;  2F9J A;  1PC5 A;  5J2P A;  4A3K K;  4Q45 A;  3M6U A;  3HUL A;  1TVR B;  3D6F B;  3FEY B;  2JH3 A;  4JI2 F;  1DHM A;  2MLX A;  3IRX B;  5KFF A;  1WKJ A;  2FC8 A;  4LSZ B;  1DCP A;  1HAR A;  3GFY A;  5KG5 A;  2KG1 A;  1XNQ J;  3HM9 A;  3R7N B;  2OKQ A;  4DPT A;  4IQM A;  4ZLJ A;  1YIT S;  3IGN A;  4PEO A;  3RR8 A;  4ZVO B;  4I2P A;  2DBB A;  2DNM A;  2GAH C;  5IC4 B;  1UCN A;  3NWG A;  3PX4 A;  3DGP B;  4DV6 J;  1GMU A;  1CEZ A;  2IVY A;  4YP3 A;  4RUA A;  3HLU A;  3HVW A;  1DTT A;  3ZFV A;  3RU0 A;  2YWH A;  3W8P A;  3GEE A;  4HLB A;  1K9M T;  5D0R A;  1OSC A;  4JI3 J;  3CD0 A;  1GMW D;  3CCS S;  4NZ7 A;  4Y7N C;  3JSR A;  3DXS X;  2JOQ A;  3W3S A;  4DV6 F;  3OR2 B;  2RML A;  2FVS A;  4CCH A;  3S01 A;  1FFW B;  2KKH A;  1CG2 A;  5IT9 U;  5IP9 K;  5ETV A;  4ED7 A;  1K83 A;  2I2Y A;  2ZKT A;  4BBS C;  3OUY B;  5B0A A;  2MZT A;  4C45 A;  1NZ8 A;  5B0G A;  1HBO B;  2X51 A;  4XDC A;  2QLF B;  4C3M A;  4HH1 A;  4CP5 A;  4U8V A;  3KDO A;  1Y0H A;  1HNX J;  2IPO B;  4C11 A;  3WOD A;  1N5T A;  2CIM A;  4JI8 F;  2HNZ A;  3MM8 B;  1MU2 B;  3PRD A;  4LSL A;  2C3O A;  3HD2 A;  3BDP A;  4ALZ A;  5JMN A;  1U7L A;  1MMD A;  4OV1 A;  5I3U B;  4QPX A;  2YQ0 A;  4RBV A;  3KJQ B;  4ZK7 M;  3ZZ0 A;  1TKT B;  3H0P A;  2VB6 A;  5LOQ A;  1ROF A;  3GTL A;  1VOM A;  3CDU A;  4DEZ A;  4DN0 A;  5IYD C;  5F8L A;  4TY8 B;  3SSQ A;  3I6P A;  2F4V F;  1Q82 T;  4CWB A;  2HHH J;  1S79 A;  2YXL A;  2EBE A;  4ICL B;  3NY0 A;  4EU0 A;  3LP1 A;  4A8Y A;  1GTE A;  2VG5 A;  4V1A k;  2DJW A;  2FZK B;  2PA8 D;  2W2P P;  3OR1 A;  3EX7 B;  5F9L A;  4QJV B;  3UCU P;  1U2C A;  1RDR A;  1RGV A;  2W7O A;  2RRN A;  3AJ2 A;  3HFV A;  5J2M A;  1S1U A;  3PYD A;  2B4O A;  2NVY K;  3MPD A;  2YH1 A;  1HLW A;  2J9D E;  2MQN A;  4W92 B;  3HI9 A;  4ITS A;  3N3Y A;  1TP7 A;  3NGD A;  4MAK A;  2D3Z A;  5D4O A;  4DUZ F;  3S2D C;  3A12 A;  1IKW A;  1X9M A;  2QE5 A;  2VOP A;  5D6G A;  1N34 F;  3TJA A;  5BR8 J;  4DX6 A;  2HLU A;  1WHY A;  1Y1V C;  5F8N A;  4KAS A;  4J3N A;  2BE9 B;  1VQ8 S;  1RHR B;  4XSX A;  3KG1 A;  1RT7 A;  4DOZ A;  3DXJ A;  4F0M A;  1OYE A;  3A4T A;  1T11 A;  2RE1 A;  1HQM A;  1TWC A;  1M5K C;  2QA4 G;  3TAN A;  3RZA A;  1OSD A;  5B7W A;  3M2V B;  4WK1 A;  1SBR A;  1HQU B;  2F9D A;  2C2Z B;  2GGP B;  1ZXO A;  1HWK A;  3V81 B;  3FCV A;  1CJV B;  4KAT A;  3BGL A;  1TWA C;  2HS3 A;  3BH7 B;  3V4I A;  2PPB A;  5HP1 B;  2LA6 A;  1WEZ A;  2PMH A;  2ZZM A;  5ADZ A;  2E5J A;  2LEA A;  4PAB A;  1L0W A;  2D3O R;  1JXL A;  2XSJ A;  3M6W A;  2J6S A;  2LXI A;  1EQM A;  2R93 K;  2DR7 A;  4LRF A;  1SKW A;  4NI2 B;  4A3I C;  4RNO A;  3QX3 A;  5KFJ A;  1Y9O A;  3ADA C;  1QSL A;  4KKO A;  1Y4Z B;  3US5 A;  1ZTW A;  3FGV A;  2LQJ A;  1WD6 A;  4YUD A;  3UDC A;  2NVX K;  1DAR A;  2CPJ A;  2DGW A;  3D6M B;  4HDG A;  1NHV A;  2ZD1 B;  4A3B K;  3LO3 A;  5ETN A;  2DB1 A;  3GTL K;  4P2X A;  2DNQ A;  1GMW A;  3ZTP A;  2Z57 B;  5A76 A;  3VAK A;  2MPU A;  4UW2 A;  3PVX A;  2PDA A;  2LVW A;  2UV8 G;  4ZCI A;  5ETT A;  3FBE A;  3M1V A;  2VFS A;  2QA1 A;  1KC8 T;  2FD2 A;  1RBO B;  1QE1 A;  3B4D A;  3R5D A;  2RSQ A;  4FYV B;  3S6E A;  3KLG B;  1B0T A;  2Q66 A;  5C4J K;  2UVU A;  2FC9 A;  1VQN S;  2N4C A;  2RDD A;  2RRA A;  3GTG K;  4CH7 A;  3GFZ A;  2MST A;  5CCM A;  1LV5 A;  3AH5 A;  3L4B C;  5LJ5 Y;  2L48 A;  4DR3 F;  1RT4 B;  2BDP A;  2BJD A;  3OVA A;  1RAD B;  2F8E X;  3BQ0 A;  1JLF B;  3KNG A;  3L7U A;  3HX9 A;  4LFC F;  2AHO B;  2ZIT A;  4TYA A;  2WK4 A;  4IR9 A;  4OJH A;  3QFH A;  2NRE A;  4DCO B;  3EZO A;  1F5A A;  3S0X A;  4WFY A;  2DNL A;  1RWO B;  1S99 A;  3C16 A;  5E68 A;  4DG1 B;  2UXD F;  3Q2T C;  5ITH A;  2GV1 A;  1M5S A;  3MM5 B;  2YKM B;  2DHH A;  2GVD B;  2VFU A;  5DET A;  1R89 A;  3HT0 A;  3J80 Y;  2HIY A;  2IM3 A;  2UUB F;  4UZB A;  2AMC B;  4M5J A;  3T5L A;  1MRO A;  1NPP A;  5FDL A;  1S1X B;  1N54 B;  1N36 F;  3HFK A;  1WF1 A;  1I3O B;  3CJK A;  4A8M P;  3F44 A;  3LF0 A;  4ECV A;  5GMK a;  4AQY F;  1TL7 A;  1BGX T;  4AND A;  4RU9 A;  1IKY A;  2AJQ A;  2RU9 A;  3ZNU A;  4C8Y A;  3O2I A;  1S9E B;  4USM A;  3D68 A;  1Y1W K;  4N5S A;  2XZD B;  5AE3 A;  3PRB A;  1FXR A;  3VQS A;  3GEH A;  2MQ8 A;  2D9O A;  4KTQ A;  4CH1 A;  4W4M A;  1HWU A;  3D54 A;  5A8W B;  1GX5 A;  1DY3 A;  2AZ3 A;  2VU5 A;  4KBI A;  2HHU A;  1B64 A;  3H3V D;  4OZ1 A;  2M5Y A;  1U45 A;  1SC4 B;  1TK0 A;  2R8G A;  1FXD A;  4OJG A;  4DPU A;  4OZ3 A;  4CO5 A;  2E1C A;  4DX5 A;  1Q16 B;  3F41 A;  1HWL A;  3QRR A;  1U09 A;  4DL2 A;  2YU9 A;  3C8Y A;  1VRQ C;  4Z7C A;  3GTP A;  2M3D A;  1T9V A;  4NLG A;  4CI0 B;  1UZD A;  3K17 A;  1EAR A;  4YB7 A;  2QC3 A;  2VAS A;  1TAQ A;  4ATN A;  3KLE B;  1JLG A;  3AJD A;  4KAW X;  2DR6 A;  4USH A;  3BB5 A;  5KTQ A;  4HVZ A;  4Q44 A;  3NS5 A;  1Q5V A;  2GQ2 A;  1FKA F;  2BQ3 A;  5C44 C;  3O8W A;  3D0G E;  4WKY A;  2P8T A;  3VAG A;  2G0I A;  4QWB A;  3W2W B;  2A6M A;  3LH2 S;  4IFY B;  4NOH A;  1S7H A;  2I6W A;  3FMW A;  1YG0 A;  1JJ4 A;  5ETK A;  3VZH A;  1FRI A;  4KRW A;  4FS2 A;  1TFW A;  2CPZ A;  4OI4 A;  1T03 A;  2YKA A;  1U0S A;  2PHC B;  1WDD A;  5GAE I;  3Q0A A;  2HHP A;  5KFM A;  1IQT A;  1T8E A;  2E5H A;  5KFI A;  1VRT B;  2HIQ A;  3NGR A;  2XY6 A;  4XAK A;  1EP4 B;  4XDD A;  1PAU B;  3D28 A;  2FZC B;  4C98 A;  3MEC B;  2QYC A;  4GMK A;  4NML A;  2JC0 A;  2J9C A;  1XNR J;  4CRJ A;  5EGY A;  2BJ8 A;  2VQE F;  3VAM A;  4NXM J;  3KOA A;  3PIP Q;  2VF3 A;  1NZA A;  1G1X A;  2AJ0 A;  2GSO A;  3D6H B;  5B0C A;  2C22 A;  2XS2 A;  4J37 A;  4OX9 F;  3C6U B;  5I3U A;  1RWM B;  2HBZ B;  1DQ9 A;  2A0F B;  5A8K B;  1HBU A;  4YFU A;  5HVG A;  1FJG F;  2NXC A;  1AZS B;  2UU9 J;  2E2J K;  1UET A;  2NVX A;  3NRB A;  3B8H A;  2LEC A;  1X31 C;  3GR0 A;  2ZWP A;  4OV6 A;  4JI0 F;  1K83 C;  2R7Z A;  4IG0 A;  2LDI A;  3V6K A;  2YWG A;  2PO4 A;  4DWI A;  3DU6 A;  3GTQ K;  5MLC V;  2B63 C;  2GHP A;  2MY8 A;  2JRS A;  1N0V C;  2QL7 B;  2VH7 A;  3CCQ S;  4LK1 A;  1EET A;  2NVQ C;  1BC6 A;  1KOH A;  1TFY A;  4JK1 A;  3KK3 A;  3LAL A;  2XYP B;  4A93 C;  4EBD A;  1T9Y A;  5C4X C;  2HNY B;  4NRT A;  2K1R B;  5KFZ A;  2JWN A;  2VD3 A;  5IOQ A;  5A6P A;  1I6J A;  2JVO A;  2KI2 A;  1P6T A;  3LP2 B;  3FNN A;  2ZH9 A;  1VQP S;  2D3O 1;  5DM7 Q;  5RUB A;  1F5C A;  4CLF A;  3NUH A;  4HT7 A;  4C3J K;  4IFV A;  4PWU A;  3FSX A;  3G6Y A;  1AW0 A;  2D3U A;  1XZP B;  3SMZ A;  4PWD B;  1ACM B;  1Y3K A;  3I4P A;  2L9D A;  3M2U B;  3Q8Y A;  4LF7 J;  4XO0 A;  1B4B A;  1K8A T;  1PJ7 A;  2X1G A;  4OIR A;  3FBF A;  1JK9 B;  2DKO B;  4I7F A;  4BCA A;  4ETX A;  2XQC A;  4HAC B;  2N82 B;  1HHS A;  5DG8 A;  2ASD A;  1UWA A;  5TJ3 A;  2BV3 A;  3KK3 B;  3IS9 A;  2VBW A;  2QMW A;  2BKO A;  4JI7 F;  1J2V A;  4PPZ A;  2EFP A;  3WC2 A;  1CJU A;  2XMT A;  1AB4 A;  1URN A;  3BGR B;  1FER A;  4EI2 A;  4DV7 F;  3PO3 C;  2DHG A;  1OY6 A;  1FRL A;  4NLT A;  1VQ7 S;  3VR1 A;  4NLX A;  1FNO A;  3N4W A;  3ZTR A;  3I0S B;  2XMJ A;  1RTZ A;  5C24 A;  3T19 A;  3MFH A;  3ULH A;  1TWH K;  2V2K A;  1B4A A;  3QID A;  2ACM A;  1WHV A;  1SXL A;  3RBD A;  4RUH A;  4ZVH A;  4OYI A;  5HAO A;  3TUZ C;  4OHW A;  2YNF B;  3MFI A;  1B70 B;  5EUH A;  2GJI A;  4A3E K;  4L3K A;  2A18 A;  1UVN A;  3UO0 A;  4C3J C;  1NJY A;  4X84 A;  2GFF A;  4ZN1 A;  4IG3 B;  4NLS A;  3AA8 A;  4P7V A;  4YQW A;  2OIH A;  3KG4 A;  2KWA A;  3CJ3 A;  3SFU A;  4CO2 A;  3O5T B;  4MIA A;  1XQI A;  1E6V A;  4R5P A;  3N6M A;  1LWX A;  2UUW A;  2ZNY A;  1UJ4 A;  1ZAV A;  3HHE A;  2KM8 C;  2PSZ A;  4KMU A;  3MR6 A;  5IYC C;  5ETQ A;  4DL5 A;  3KJV A;  3D67 A;  4WZM A;  2XNR A;  4BHQ A;  2BEF A;  4KHM A;  2LP4 A;  1FKO A;  4HT5 A;  3MZI A;  2YKQ A;  1WOO A;  5L46 A;  1WF2 A;  4QIE A;  3I0R B;  4ELV A;  2M2B A;  1R43 A;  4ERD A;  3IBW A;  3T02 A;  4WFZ A;  3W9H A;  4ED8 A;  2H54 B;  1REG X;  3PEJ A;  1QVF R;  4GTE A;  3DI6 B;  4C8M A;  2C2K B;  4Y34 A;  4O3P A;  4DV1 J;  1PAE X;  1FEH A;  4EZ9 A;  4MFB A;  1GQE A;  4DR4 F;  1M1G A;  4P2F A;  1DBD A;  2EFV A;  1IS1 A;  1E6V B;  3S1M K;  1TU0 B;  4DSJ A;  2GNK A;  4LF5 J;  2IFX A;  4J9M A;  2I38 A;  3JS9 A;  3CC4 S;  1EJ7 L;  4OJ3 A;  3HO1 A;  2CZ4 A;  4DN9 A;  2V2Q A;  1H2T Z;  4FP9 A;  2OPS A;  3H4D A;  1NRK A;  3AOA A;  5J2N B;  2WSC C;  2DNG A;  1S6Q B;  2DEI A;  3CAG A;  2POK A;  3PR4 A;  4OI1 A;  1GX6 A;  4R0E A;  5KFA A;  2HFS A;  4FZV A;  4IR1 A;  4OHZ A;  1BWV A;  3CIZ A;  1ZOT A;  4GTC A;  3JTN A;  1RWX B;  1Q7Y T;  4UQG A;  1UL3 A;  2KB2 A;  5EHH A;  4W90 B;  4Z2X A;  4JI8 J;  4ED5 A;  2KU7 A;  1IKX A;  4F4K A;  2PEB A;  3LTO A;  5EN1 A;  3SBM A;  1N48 A;  1GFW B;  2WON A;  3R5B A;  4DSF A;  2KXF A;  4WE1 A;  2BA9 A;  5HK4 A;  3GCX P;  2J0S D;  3DMJ B;  3OXG A;  3THP A;  3T5H A;  3DOK A;  2LA4 A;  2W4D A;  3PHT A;  2VUM A;  1V5V A;  1VQ6 S;  2VFV A;  2W7V A;  2WSE C;  1J98 A;  3JQK A;  4GO5 X;  4ILR A;  2WBM A;  3UR0 A;  1ZYQ A;  2V94 A;  2WHO A;  3DRP A;  2YY3 A;  2UVW A;  1R0C B;  3MCO A;  4ZPV R;  5B0E A;  1HYS A;  4ILL A;  3QIP A;  3ENA A;  3HXM A;  3HSJ A;  2Y1R I;  3SV3 A;  3KFW X;  5HBM B;  3TNV A;  1J5O B;  1SC3 B;  4H4K C;  3GIR A;  1YJ9 S;  5D15 A;  2ZUE A;  4C3H C;  3SIP B;  2HQG A;  3DOM A;  4C7Q A;  4O4R A;  1KBR A;  4JI7 J;  4A3J K;  3W2W A;  1XMB A;  1U0H B;  1FXL A;  1EK8 A;  4B3O B;  5HAT A;  3S15 C;  3HF5 A;  4Y2I A;  3IMQ J;  4WU2 A;  5EWF A;  1LXN A;  4HHJ A;  1XJW B;  1XZQ A;  3K5M A;  5F8I A;  3AXK A;  1FRJ A;  1DD5 A;  2IBK A;  1JLQ B;  4KM9 A;  2K3I A;  3H5X A;  1VCT A;  2JA7 K;  2UVV A;  4A8S A;  1MU2 A;  5M3F K;  4O3Q A;  3FK4 A;  3A13 A;  3RUB L;  4NCG B;  2F4V J;  2FTR A;  4CH0 S;  3CVK A;  4ZN3 A;  1RK8 A;  1RI7 A;  3NNC A;  5A0Y A;  3GTG A;  2J7U A;  4DV2 J;  3NCQ A;  1OY9 A;  1NK4 A;  1WQF A;  2RUS A;  5HBM A;  1J5O A;  3KLH A;  4NZ6 A;  5F0U A;  3UR3 C;  1RE1 B;  2GCF A;  3PJX A;  2UXC F;  2JLF A;  1TL3 B;  3AH6 A;  1C2P A;  1N36 J;  1FX2 A;  1VMB A;  1JLC A;  3I5C A;  2VZ9 A;  1BQM B;  1RAO A;  4DFM A;  2JA5 A;  3ZZU A;  4DV0 F;  4WP8 A;  2KN4 A;  2Y1L B;  2R2U A;  1SV5 A;  4BBR C;  1C0U B;  1QE1 B;  1L3V A;  1RAA B;  2WZ1 A;  5HRO A;  2LQB A;  4K5R A;  3GE9 A;  2IVM A;  2JNJ A;  4DR6 J;  4A3J C;  2CQ0 A;  5E3Q A;  3TOQ A;  4AQY J;  2BJE A;  3KXD A;  5IFM A;  4LIR A;  2VUM K;  1HQE B;  3CDB A;  3TVY A;  5B0B A;  5HVH A;  1R6V A;  4C8K A;  2YNH A;  2MKS A;  4KGM A;  3MWB A;  4WPA A;  3E01 A;  4J9K A;  2OTJ S;  3OL9 A;  3POT A;  1CJT B;  4PXD A;  1TKD A;  2B9E A;  2BE7 D;  4X65 F;  4Y52 K;  2K1R A;  1C0T A;  4PXC A;  2H5E A;  2PEH A;  4J9L A;  4TYB A;  4NRU A;  2DD8 S;  4ZPT R;  3SZ2 A;  2E2I C;  3PJW A;  3IRW P;  1KWM A;  3RYL A;  4UQT A;  4DR2 F;  1TWG K;  4CIO A;  4ILD A;  2HQF A;  6FD1 A;  1ZYR A;  4KGZ B;  1B3T A;  2NXN A;  1HWI A;  1SJQ A;  5CD4 A;  1HD1 A;  3G6E S;  2ZBC A;  2WAQ L;  3DRS B;  4IDK B;  4WU3 A;  3S15 K;  3G87 A;  5HRO B;  3G2X A;  5U47 A;  1C1C A;  1S48 A;  3VQT A;  2KT2 A;  2XMM A;  1XBW A;  4KGK A;  1VQO S;  3TFJ A;  1HMV A;  2XB2 D;  2OLW A;  2BYC A;  1S7I A;  2Z2Y B;  4LBP A;  2O3D A;  2Y1I A;  3ENQ A;  2QLX A;  3NKY A;  3RRK A;  4N56 A;  3PZP A;  5HP1 A;  3HD1 A;  5HJY A;  4G7H A;  2EKY A;  3OJS A;  1PIL A;  2HHS A;  3FCH A;  1M5O C;  2BAN A;  4F0K A;  2Q43 A;  3FQK A;  2PMZ L;  2R8J A;  1IN0 A;  2XMK A;  4LR9 A;  4ZVQ B;  4CNY A;  3T1Y J;  4OYA A;  1XTZ A;  1J6V A;  2BW2 A;  3UE2 A;  4M5N A;  4J7C A;  2XO6 A;  2W7P A;  1PO6 A;  1D9F A;  2DEJ A;  5L1I A;  3CQZ A;  2KFY A;  2Y9H A;  3T01 A;  4N41 A;  2KYX A;  3BBF A;  4NA3 A;  2Q79 A;  4KB2 A;  5IOS A;  2FQO A;  3ZZR A;  3EVO A;  4ECY A;  3HSG A;  4ILM A;  3OUY A;  5I42 B;  3RRG A;  4A3D C;  1U8S A;  3T1H J;  1YQH A;  3GR1 A;  4KT0 C;  4ZPW R;  3CCM S;  2XMW A;  4JI5 J;  3HPO A;  1RA6 A;  1R8A A;  1TWC C;  2HEK A;  3MAH A;  4C11 B;  4DL7 A;  5B0D A;  2XO7 A;  5BR8 F;  2Z2Z A;  3NLC A;  1X4D A;  1BGW A;  3TR5 A;  3AQO A;  2W7A A;  3OPK A;  3V81 A;  2AGO A;  1ZAX A;  5A8R A;  4OLP A;  2HKE A;  2MTL A;  3HHL D;  3TTG A;  1LWC A;  2DHA A;  3S17 K;  2JEJ A;  2K7J A;  1T3O A;  2Y0B B;  4FPI A;  4DSK A;  4A8Q A;  1J6X A;  1OMS A;  2UUB J;  1N88 A;  4XLN A;  3CJ0 A;  2C3M A;  1UVK A;  3EGZ A;  5KAK A;  3U1L A;  3ZZT A;  2HZA A;  3AY0 A;  4KB7 A;  3MMJ A;  4TVA B;  1Y3J A;  1Y00 A;  4AXJ A;  3H5U A;  1HNV A;  3MMA A;  3IR7 B;  4OZ0 A;  1SJR A;  1TVR A;  1KQK A;  3PO2 C;  3LA0 A;  2DRB A;  5LMU F;  2DH8 A;  1VBZ A;  3KHL A;  2UUC F;  4MFB B;  4AT1 B;  3PW5 A;  2V69 A;  2RU3 A;  1RAH B;  1IKV A;  4Q8E A;  4MMO A;  4TQR A;  3CJR A;  1Q79 A;  1F5B A;  4DU7 A;  2QG9 B;  2LCW A;  4ZKA A;  4A8X A;  3BH6 B;  2FJW A;  1VJE A;  2RB7 A;  4CT8 A;  4ES2 A;  4I2P B;  1LFP A;  2FHO B;  5KT2 A;  2QA2 A;  4CO3 A;  3PTW A;  1QAI A;  4NYO A;  4F4A A;  4WYL A;  2OSQ A;  4F7V A;  3A8J A;  2EG2 A;  4ZVT B;  4KH0 B;  5J2M B;  4A8K A;  5E7O B;  2DNY A;  3DLJ A;  1U2R A;  1WEL A;  1KHV A;  1O8B A;  4U7C A;  2L41 A;  1RAI B;  5DG9 A;  1TWF K;  5D0E A;  5KFE A;  2CFA A;  1HNV B;  4ECQ A;  2CJY B;  2YX4 A;  1ELO A;  4X64 J;  2I5J B;  2GJ2 A;  2IM0 A;  2L9W A;  1RWV B;  2P9C A;  1YCL A;  3W5Z A;  3RAQ A;  1F2G A;  3FZ2 A;  3GCW P;  5CAA A;  3CCL S;  5I4M A;  3G8T A;  2XUL A;  5L1K A;  1NCL A;  2WVC A;  3H8Y A;  5GME A;  3W62 A;  1H74 A;  4EFA C;  1NDL A;  4LF1 A;  2B56 A;  4FM9 A;  1JVI A;  3PJ9 A;  1B0V A;  5DLG A;  3L3C A;  3H25 A;  4H4M A;  3TFH A;  1FTR A;  3HKZ D;  1WHX A;  4J9R A;  2VDI A;  3WIV A;  4PR6 A;  2RKI A;  5IP9 C;  2JA6 C;  4OYW A;  4U7U K;  2QN6 B;  5HMY A;  2V50 A;  4FF4 A;  2B43 A;  3UDL A;  1PIE A;  2K8G A;  1XWL A;  2CQB A;  2R7O A;  4FYX B;  1NKC A;  1LQ9 A;  4D3G A;  4M1X A;  2MKK A;  1LWF B;  1N5S A;  2DGU A;  4DQS A;  5AJ3 F;  1VC6 A;  4RW4 B;  1MLA A;  2OPP B;  2AJF E;  3EDQ B;  4WXO A;  1TL5 A;  4L76 A;  4ECS A;  1Y7P A;  1R0B G;  4ZJO A;  1BE4 A;  3I5A A;  4J91 A;  4MQ9 A;  3OVB A;  3RJM B;  1X4B A;  3IS9 B;  1UPP A;  3DFE A;  1QSS A;  3ZO7 A;  1WC3 A;  3D9B A;  4KH1 B;  2W01 A;  5TMF A;  1RHM B;  3IBC B;  3FEX B;  4P2S A;  2NR0 A;  4A8O A;  4X2B A;  1X0F A;  4CLL A;  4F4Z A;  4KFB A;  4LK0 A;  3MUM P;  2BJ3 A;  4JI2 J;  3DKD A;  4ER8 A;  2ZE2 A;  2F8H A;  2DR8 A;  3VWS A;  5B0F A;  3PKY A;  4OHV A;  4A3M K;  4XCH A;  4Y28 C;  2DO0 A;  1HBM A;  1X7V A;  4J5O A;  1S10 A;  3DM2 A;  4DV5 J;  2E29 A;  3HOZ C;  3M3Y C;  1NK7 A;  4UUW A;  1ZAW A;  2R2T A;  1S76 D;  1RP5 A;  4MEY A;  1KSP A;  1IWA A;  3GJQ B;  4JOU A;  3MD3 A;  2C1E B;  3TI0 A;  4G0V A;  2AGQ A;  5HL8 A;  2HS0 A;  1EH1 A;  3Q86 A;  5GAE U;  3HSZ A;  2B9X A;  1YJR A;  4MIW A;  2NUH A;  3TEH B;  3Q2S C;  4UOF A;  2EBB A;  3GWC A;  4X4R A;  3C15 A;  4YEA A;  4Q7A A;  2QMU B;  4NLR A;  3IG1 A;  2MZ1 A;  5IOR A;  4E8U A;  3MR3 A;  4LF4 F;  2QYG A;  2CRL A;  2ZH2 A;  3BGF A;  4JV5 J;  2W1B A;  5JJB A;  2E5L F;  5DZ7 A;  2HBQ B;  2EWH A;  2YPZ A;  4RW8 B;  4TY9 A;  2FVQ A;  5JUM A;  3H2V E;  2ERR A;  2LXF A;  5G0R A;  3K7R A;  3CNQ P;  2GSN A;  3WIU A;  2V5H G;  5FJ8 K;  2DGX A;  1PSD A;  3S17 C;  4KSE B;  1VQ5 S;  5C25 A;  3I9V 9;  5GAD I;  4GKK J;  3I96 A;  2Q6B A;  4RX6 A;  2ZZN A;  3N5B A;  1F9N A;  1CJK B;  1XR5 A;  1QUP A;  2I0X A;  3HVR A;  2CPF A;  5HO4 A;  1QLN A;  1S9E A;  1UEV A;  3VCD A;  1UFK A;  1Q8I A;  3AOB A;  3EPI A;  1N5Q A;  3R2D J;  4YHH F;  1VQK S;  4JI6 F;  3KHH A;  5KFD A;  5J1E A;  5KOW A;  1IJE B;  2WAQ D;  3L95 X;  5EWG A;  3I56 S;  3AQP A;  5DDO C;  2VG6 A;  3KLG A;  1HQU A;  1RT2 B;  1L3T A;  1X60 A;  4A3B C;  2H5J B;  3P5B P;  3ET6 B;  2ZDO A;  3I55 S;  2GML A;  4M5I A;  2W24 A;  2FJX A;  3R7S B;  3TAR A;  2CQC A;  1MWQ A;  5EX3 A;  3VA7 A;  3D1Q A;  4K5S A;  3RG6 A;  3PIO Q;  1ICE B;  2VC1 A;  4QBU A;  1SFO A;  4U7U D;  2DNO A;  4LQ3 A;  3JSM B;  4H4O B;  3H40 A;  3ENW A;  4F25 A;  4A3I K;  4Y2A A;  3WHI A;  4Q4Z A;  3HK2 A;  5C3E C;  4ZVE A;  4K0K F;  4DDQ A;  2V0N A;  4HI1 A;  4OMF G;  1N33 J;  1HW8 A;  2IM2 A;  5KFW A;  3CC7 S;  1BXN A;  2XLI A;  2E2I K;  3Q83 A;  3NBP B;  1O28 A;  4ENO A;  1G51 A;  4D3H A;  1AFJ A;  2RIL A;  1TR0 A;  5D0G A;  2KFN A;  2VOO A;  2V67 A;  4QWA A;  2JL9 A;  3FBB A;  1AUS L;  1YSJ A;  3EXY A;  5AXN A;  2MQO A;  4BXX C;  2HBR B;  4FNH A;  1RTJ A;  2HHX A;  3D3C J;  4Y0F A;  1J5E F;  1ZET A;  3QRP A;  4RR5 A;  4X65 J;  2W9B A;  4DCJ B;  2XYG B;  4XTT A;  1VQM S;  6FDR A;  4RUB A;  2HUR A;  2FB0 A;  2O5J A;  2FDN A;  4H4K A;  3ZNJ 1;  4EO8 A;  2G13 A;  2JSX A;  4TY8 A;  3TZZ A;  3TJ9 A;  1J6W A;  4OZ2 A;  1IBC B;  3TVK A;  4YME A;  3THV A;  2EC2 A;  3BUE A;  3LP0 A;  2F8M A;  3R5J B;  1URR A;  1WC5 A;  3GSD A;  4MKV A;  2Q6C A;  1HI8 A;  2QA4 S;  4DV7 J;  2GA7 A;  2DGT A;  3NAH A;  4J9Q A;  5AXM A;  1S1U B;  2H5I B;  3DCA A;  1SJ1 A;  1I5O B;  4ANC A;  3Q8Q B;  2AD9 A;  4U95 A;  2E9R X;  2PT0 A;  4DR7 F;  3M8Y A;  2HNY A;  4FXV A;  1QDU B;  5H9F J;  4E2F B;  1U25 A;  4EK2 A;  3JYT B;  1C1B A;  1P8G A;  2HVI A;  5D3G A;  1IKW B;  2C3P A;  2FJA B;  3FRY A;  2OPS B;  3KK2 B;  2HK2 A;  5J2N A;  2WCX A;  2DGQ A;  3BSC A;  1KD1 T;  2QT7 A;  2HWH A;  5JVH Q;  2H51 B;  4KE5 A;  3U1M A;  1C0A A;  3TEG A;  2OJ3 A;  1EAY C;  3IAS 9;  1JLC B;  4BXX K;  3I9Z A;  1HNZ F;  2HQI A;  1HW9 A;  2MJN A;  2ZUG A;  1BQN B;  2X7I A;  3GIL A;  1A7G E;  3J81 Y;  2AJ2 A;  1RTH B;  4OJ1 A;  4X62 F;  2MB0 B;  4I67 A;  4I0W A;  4BKW A;  3HOU C;  4KGV B;  1WQH A;  2ZFH A;  2XI2 A;  1VC0 A;  4PCQ A;  2HRT A;  2E7W A;  1IM6 A;  3HHL C;  2F4F A;  4QOT A;  2XZT B;  1WTB A;  1RWU A;  4B3T F;  4NA1 A;  2FJD B;  2YWW A;  3NOG A;  1WSR A;  3MEE B;  3BSO A;  1TUV A;  2UV8 A;  4KV8 A;  3L4K A;  3K58 A;  1GXT A;  1AUD A;  4USI A;  4L74 A;  2HAF A;  1FRM A;  3DRP B;  4P73 A;  1XPP A;  2A6H A;  2Z56 B;  3DRY A;  1YX2 A;  2NSC A;  4ZJQ A;  3K89 A;  2N3L A;  3RZD C;  4J90 A;  4YN3 B;  5F8J A;  4DU8 A;  3EUN A;  4Q5S A;  8ATC B;  1F7V A;  2A2D A;  2OPR A;  4HR2 A;  4X66 J;  4ZIV A;  2WOM A;  5HLF A;  1S1T B;  4X4T A;  4OX6 A;  2VV5 A;  4A3E C;  3DRS A;  2WSF C;  1UWB B;  2FHJ D;  4Y2C A;  1WSV A;  2L3M A;  2P6T A;  3CJS A;  5IC6 B;  1I51 B;  1CC8 A;  4DPY A;  2ZDP A;  5C24 B;  1M5P C;  4URG A;  3OR2 A;  3JTO A;  3G4S S;  1UA1 A;  4P9S A;  1RKJ A;  4R5P B;  2QJ3 A;  3B78 A;  3H3V L;  1FT8 A;  3OFH A;  1UJ6 A;  2R92 K;  4S0M A;  3BO2 A;  4OYO A;  2EPI A;  1FNM A;  1SCJ B;  1G2E A;  1F9F A;  5FLX U;  4DQP A;  2H3E B;  1QY7 A;  3HOY K;  4KM8 A;  1SPB P;  1SL2 A;  4I6A A;  3IBF B;  3CCJ S;  3IXQ A;  2RD5 C;  3FFI A;  1NPR A;  1E6Y A;  1K83 K;  1CS4 B;  1CVJ A;  3LP2 A;  4TKT A;  3DM2 B;  3LUY A;  1HI0 P;  3QGG A;  3MM5 A;  2EXU A;  1XMQ F;  1BD6 A;  5KFH A;  1NUE A;  3M30 B;  1NDC A;  2NVQ K;  2WW4 A;  2E5L J;  4DG1 A;  1WUU A;  1DZ5 A;  2JA7 A;  5DS7 A;  4YB1 P;  1ZM4 A;  1IJF B;  5DQI A;  1EIY B;  1VHI A;  4O4G A;  4ZJL A;  3QGI A;  2MKI A;  5H9E K;  3IAM 9;  4C0B A;  3M4O K;  3W64 A;  3TZW A;  2ATC B;  3ITH B;  4DS5 A;  2CJQ A;  1OPZ A;  2BRL A;  3GTO A;  1OQ3 A;  2HAI A;  2KT3 A;  4F36 A;  1WCM K;  4KJI A;  4OYB A;  1T9T A;  3IWL A;  1HNI B;  3EVW A;  1HBU B;  1B4S A;  1RAJ A;  3J81 U;  2BQR A;  2BKN A;  4F8R A;  4FDF A;  1I1G A;  2HWT A;  4FF3 A;  2PC6 A;  4Q8F A;  5IT0 A;  5A2Q Y;  4NAS A;  4L3N A;  2XGQ A;  2ILZ A;  2NXJ A;  1XEZ A;  2WVB A;  2ZJR Q;  1DUR A;  1HBN B;  1LWC B;  4PG5 A;  4DV4 F;  1FTC A;  3H4B A;  5L39 A;  3C3L A;  1YBA A;  2E1P A;  2ZH5 A;  1EZZ B;  1FJC A;  4LF4 J;  2C2N A;  1TTH B;  4OZN A;  4LF6 J;  3QFW A;  4PYD A;  4USW A;  3S1M C;  1UTA A;  1UW9 A;  4L75 A;  1S77 D;  1IM4 A;  1U26 A;  4UT4 A;  2M0G B;  4LR2 A;  4OIO A;  2CVE A;  2P6S A;  3I4M K;  4O4G B;  1YRX A;  4O44 B;  1FD8 A;  1WI6 A;  4MIB A;  4YS2 A;  3W60 A;  3C14 A;  1JX4 A;  3VTI A;  5HMW A;  5KT6 A;  1FD2 A;  1TWA A;  3D1O A;  1S1W B;  1IKV B;  2FJE B;  4NLW A;  1JJH A;  1S49 A;  3DMJ A;  2QV6 A;  3BPD A;  4J9U E;  3SCL E;  1HL6 A;  2DCL A;  4QR0 A;  4M5H A;  4K4V A;  1UA0 A;  1FHT A;  3S16 C;  4QWD A;  2AJ1 A;  1U1L A;  5J1E B;  4I68 A;  2CW0 A;  5AT1 B;  4EUV A;  2BJ1 A;  1M5H A;  1EB0 A;  5KFX A;  3DOK B;  4ZHR A;  3JSY A;  1HPZ A;  1DTQ B;  2CFA B;  1Y11 A;  1TKT A;  3N6N A;  1Q53 A;  2XSJ B;  2JA6 A;  2VA3 A;  1PGZ A;  3LOU A;  4DR1 F;  1DFD A;  2YKN B;  2E7V A;  3BBB A;  4EWT A;  2AGP A;  2DY9 A;  1IR0 A;  1V3Z A;  1RHQ B;  1AFI A;  3M4X A;  1BWE A;  3FKI C;  2HG4 A;  5KT5 A;  2NPI A;  4C3I C;  1RKI A;  5HN0 A;  2V8P A;  4J9N A;  4F4X A;  1ZH5 A;  1WCM C;  1VFJ A;  1JWW A;  3BV8 A;  2KZM A;  3LGH A;  2ZD1 A;  3A8K A;  3QT6 A;  3KNA A;  3GJR B;  3S1N K;  4MK8 A;  1RWW B;  3GTG C;  2DXD A;  5CYM A;  2UP1 A;  4JB8 B;  4F2R A;  3HVT B;  1JNZ B;  5IQ6 A;  2FUG 9;  1VGY A;  4ZIW A;  5C42 A;  4IKA A;  4G0W A;  4L6V 3;  3GTM C;  1D09 B;  1S1V A;  2ACY A;  2DHS A;  4ZMM A;  2DH9 A;  4UTG A;  2APO A;  1SQG A;  3P49 B;  1VHF A;  3PO4 A;  1CLF A;  3EGN A;  1TZ0 A;  4YR3 A;  5C2G A;  4HEA 9;  3GYX B;  5D4N A;  1GK8 A;  2D6F C;  1S6O A;  4DJB A;  4NCG A;  2E1M C;  2UXB F;  3MMC A;  2CNL B;  2NZ4 A;  3ZZO A;  1FK9 A;  3G9C A;  4LFB F;  5M5W K;  2VG7 B;  2PA8 L;  4KFB B;  2YX1 A;  2GIR A;  2RRB A;  1VQY A;  1SH3 A;  2A69 A;  3FCW A;  2LU1 A;  1KP6 A;  3CJ2 A;  3OL6 A;  5KT3 A;  4YOE A;  1MML A;  1TUG B;  4UOG A;  4NLD A;  1JXV A;  3Q8V A;  3KLI A;  3NNA A;  2V9K A;  2F63 A;  1WC0 A;  8AT1 B;  4LF6 F;  2YKM A;  2HVH A;  2XWX A;  3N0C A;  2IC3 B;  2C2O B;  1F9E B;  2XLK A;  4LF9 F;  1BUX A;  4URS A;  2HQC A;  3D6T B;  2GVZ B;  3GTJ K;  4NXM F;  4G6V B;  1EKR A;  3MMC B;  3CJK B;  3UNG C;  3UN2 A;  1MNE A;  4CT9 A;  2DNR A;  3ILO A;  1S0O A;  4WII A;  5IOL A;  5LSR A;  1BS2 A;  1UJ5 A;  2D41 A;  5A6W A;  3PYF A;  1KTQ A;  1CJU B;  4OHY A;  3GIM A;  1QAX A;  3V6D A;  2ZM6 F;  2A10 A;  4ES3 A;  5CZV A;  1O6X A;  4KPC A;  2VPZ B;  1KON A;  1WTF A;  4XLP A;  4A3F C;  1CSJ A;  5DO2 A;  3SSR A;  5T41 A;  2R7X A;  2XHC A;  4I2Q B;  2FVP A;  3MUT P;  4DXL A;  1QTM A;  1T9U A;  3MMB B;  4OIX A;  1K0T A;  1D3W A;  2ZOM A;  4TN2 A;  3MM6 A;  5B08 A;  4DR5 J;  4NLV A;  2E2H C;  1HBO A;  3PHE A;  4EGL A;  3NNH A;  4G65 A;  4FS1 A;  1PYO B;  4N8O A;  1IR2 A;  3BKT A;  2V8H A;  4O2D A;  2NVY C;  2AF6 A;  3GB0 A;  5M2R A;  1N56 A;  3UI3 A;  5HLF B;  2KJW A;  1P27 B;  1I50 K;  3UD4 P;  1IE0 A;  2QEX S;  2EW9 A;  4LF7 F;  2CUY A;  2B0G A;  4R8U A;  4ZLP A;  1BY9 A;  4LMZ A;  4C2M C;  4CDI A;  1I6H K;  1R7I A;  2ABY A;  3A3P B;  4PG7 A;  2QSW A;  2P8I A;  1JMT A;  1O51 A;  3PR5 B;  5JXS A;  3MTJ A;  4AYB L;  1UFL A;  4DLG A;  3TVZ A;  5F8H A;  3BS9 A;  3DLG A;  4LF5 F;  4EBC A;  1N52 B;  2QGF B;  3MMB A;  3GTJ A;  2V2Z A;  1AYE A;  1YJT A;  3TQE A;  5KFO A;  2OI2 A;  4NYP A;  2O01 C;  1S0N A;  5I42 A;  2N4D A;  2C3Y A;  2YNG A;  3H98 A;  4NYZ A;  1WIH A;  3G6V A;  1FDA A;  2O66 A;  2JA7 C;  1L5U A;  1YKW A;  4DHV A;  4KGX B;  3PW0 A;  4ID5 B;  2B9W A;  2G4B A;  5E33 A;  4X6A K;  1FJE B;  3N0B A;  1E6Y B;  2C2E A;  3M3Y K;  3EYZ A;  3VGT A;  2PE8 A;  4DR6 F;  1HHQ A;  1T7P A;  4LQY A;  2BW7 A;  4DV3 F;  4BY1 C;  3X3U A;  2AT1 B;  1U49 A;  4NPO A;  4BLA A;  4DR2 J;  1LWF A;  1HQ2 A;  4C8O A;  2MKY A;  5AXL A;  1YBU A;  4DQQ A;  1AZS A;  4P10 A;  4P5A A;  2RHS B;  2ZH4 A;  2B8Q A;  1WDT A;  3MED B;  3P8B B;  4C3K A;  1U1R A;  4ZPA A;  2ZVI A;  3DLG B;  1R31 A;  4E98 A;  4GO7 X;  2XS5 A;  3D2W A;  2EK6 A;  3ZZY A;  1X0P A;  4PQA A;  4CM2 A;  1G7C B;  1RHK B;  1TV6 B;  3J7A N;  1IKX B;  4O0I A;  4ID5 A;  2JFD A;  4UZC A;  1RTI A;  3Q89 A;  3GTO C;  2OEL A;  3M05 A;  2GGP A;  1INN A;  4U9R A;  1UEU A;  2ZE2 B;  2IYI A;  4DV2 F;  4I1T A;  1HQE A;  4X66 F;  4DL6 A;  3ONQ A;  2F65 A;  2OMO A;  2HND A;  3ZZP A;  1IW7 A;  3KJF B;  4RBU A;  3OQ2 A;  1C0T B;  2BJ7 A;  4WFA Q;  2CXE A;  2MZS A;  4WP9 A;  4QZV B;  2YX7 A;  1Y5L B;  2AEJ A;  2CJB A;  5DM6 Q;  1LK7 A;  1Q5Y A;  4WK3 A;  1HYS B;  1F1B B;  1RTD A;  4RJV A;  3EIC A;  2B5J B;  5AE1 A;  3NGS A;  4CLK A;  2BZ2 A;  4N76 A;  3OTE A;  5K8O A;  4XPE A;  4ZLN A;  4NWB A;  2YKO A;  1TK8 A;  1P1T A;  3IM8 A;  4JYA F;  4M1K A;  1TV6 A;  1FWP A;  2KL8 A;  1OY8 A;  4WJB A;  1A6L A;  4MK9 A;  3PFE A;  1YTY A;  4WCE Q;  3RZO C;  2CPE A;  4M5D B;  1VS3 A;  2Y0S D;  3CJ4 A;  1ZBT A;  4Y65 A;  3BGR A;  1RWN B;  2IAJ B;  3TO8 A;  3IR5 B;  5CH7 B;  4A3D K;  2ROE A;  4WF9 Q;  4U67 Q;  4NX9 A;  4ZPC A;  4LBI A;  5FLM C;  2QRR A;  4HTI A;  1HI9 A;  1K1S A;  4RW8 A;  5AE2 A;  1FDB A;  5DQH A;  4LRB A;  2PFD A;  2GIQ A;  5KFB A;  1FKP A;  4ECU A;  1NM2 A;  3M8S A;  2R9L A;  2LEP A;  3QJL A;  3M8Q A;  2E66 A;  1VGX A;  4K0K J;  3FQL A;  1Z2L A;  2D9P A;  1H98 A;  5C2C A;  4RNM A;  1I6V A;  3S1Q K;  3DOL A;  1RYR A;  5H9E J;  2GMH A;  3MD1 A;  3WX4 A;  4P5B A;  2OSR A;  3ZTS A;  4BLB A;  2QL9 B;  3M8R A;  3GTP C;  5J2Q A;  4DS4 A;  2HGN A;  2CAJ A;  2RHQ B;  4IG0 B;  1FE4 A;  2L08 A;  1B99 A;  5IM0 A;  3CO9 A;  1RBA A;  3HOV C;  4QIG A;  4QIF A;  3DLK B;  2X3D A;  2CQD A;  2BBE A;  1N5Y A;  4AH6 A;  5KG1 A;  3RW6 A;  3MOJ B;  2NVT C;  3BYR A;  2VOD A;  3T00 A;  2CDQ A;  4DV3 J;  2ADC A;  2ZBP A;  4RW9 A;  1V9O A;  5E2Q A;  7FDR A;  3T9N A;  1CUL A;  2RS2 A;  1NH7 A;  4FF2 A;  3MR2 A;  1SKU B;  1R8H A;  3CME S;  3UNY A;  1KLM B;  1KVJ A;  3HMJ G;  1XXC A;  4BBR K;  1X4A A;  3EPG A;  2RIJ A;  3IWX A;  2YBV A;  2JDJ A;  3RW7 A;  5KT7 A;  1U1Q A;  2DHX A;  3W66 A;  5H1S V;  2B3T B;  3EWG A;  5LM7 E;  3M2U A;  2G0C A;  1CJT A;  2OP5 A;  5K8N A;  2CWK A;  2EFQ A;  5T14 A;  2GZO A;  3RRH A;  2DNP A;  1XXB A;  4DF8 A;  4ZH4 A;  1O0P A;  1K47 A;  2XYH B;  3ZXW A;  4EEY A;  3PRV A;  4O3R A;  5L1L A;  3Q22 A;  4A3L C;  4K59 A;  1RQ0 A;  5IP7 K;  2A6O A;  2NXE A;  2V4R A;  2M9K A;  4ED0 A;  4RZR A;  3N28 A;  2BQU A;  2B4P A;  1S0M A;  2CPX A;  4USK A;  3PW4 A;  1LW0 A;  2UZA A;  4P7T A;  1NSQ A;  3OTD A;  4F26 A;  1UPM B;  3NEK A;  4YFX A;  4G7Z A;  4JI4 F;  1N32 F;  1TWG C;  5HJX A;  2OD6 A;  2B4U A;  1QAY A;  4X62 J;  3PY8 A;  2KXH A;  2R2R A;  5EDW A;  3IC1 A;  4B3M J;  1Y1W A;  3I0S A;  2M7S A;  3LAJ A;  4ZLL A;  3O44 A;  2VON A;  1FWK A;  3NL0 A;  2CNK B;  5LMU J;  3S1Q C;  2R7R A;  3BO3 A;  4C3L A;  1TWF C;  3BJY A;  3TW0 A;  3S8S A;  4GTD A;  2HFV A;  4A46 A;  5DDR C;  2AU0 A;  4NMX A;  3H7H B;  4CNZ A;  3CXC R;  3K8V A;  4OIN A;  1NO8 A;  2DT9 A;  4C2M A;  2KM8 B;  1T0T V;  2LYV A;  4OZJ A;  2RVJ A;  4IG3 A;  1AXQ A;  1RJJ A;  2K3K A;  4A3C K;  4LIW A;  4RW7 B;  4CZC A;  2M88 A;  3TAP A;  4NOI A;  2M52 A;  3T5J A;  3BF4 A;  3GII A;  4RBT A;  4XK8 C;  1ZM9 A;  4USV A;  1YI2 S;  1EP4 A;  3R5A A;  1S1T A;  2XCA A;  3MF5 A;  4DZ6 A;  3NGU A;  3VHQ A;  2LQ9 A;  3OT9 A;  3F73 A;  4GKJ F;  3JSM A;  3L4J A;  4ZP6 A;  1T94 A;  4HL9 A;  3QYY A;  2C2D A;  3DYA A;  3C6T B;  3V5R A;  3JTP A;  2RKI B;  3W7B A;  4HDH A;  3TUJ C;  1MRO B;  3SI8 A;  2RQC A;  5IWA F;  2J8S A;  5F9N A;  1KNZ A;  1PKU A;  1U0H A;  2NVY A;  3V2U C;  4F3O A;  2V6S A;  4O0N A;  4HHH A;  3HOX C;  2E5G A;  3TQ1 A;  3QGP A;  1FDN A;  5D4D A;  1NSA A;  1S5Z A;  1NEE A;  2JFK A;  2ZEJ A;  2VQF F;  1VJQ A;  2DCU B;  4X4S A;  2F5G A;  1SJ4 P;  2ZC4 A;  3VAL A;  3OLB A;  4DPW A;  4CYU B;  1WNE A;  2NLW A;  4LFB J;  4JI4 J;  3EVM A;  4Q2L A;  4NCA A;  2OHD A;  1EQR A;  2H1Y A;  2P9G A;  3SYZ A;  1XN9 A;  3P4U B;  3B6B A;  3GLJ A;  2BM1 A;  3QT8 A;  4U8Y A;  3AOD A;  1Q7L B;  2HSE B;  4M5M A;  3U27 A;  2A1B A;  3GSI A;  3EE3 A;  3GYN A;  1WWH A;  4DV5 F;  2O67 A;  3TA0 A;  3W1Y C;  5KFQ A;  2DNK A;  2E5I A;  1IBM J;  2QLJ B;  3RAX A;  2UVR A;  4YHH J;  4B3T J;  3EGV A;  1S6P A;  2CA9 A;  3GG0 A;  1IBM F;  4Q43 A;  1U6F A;  2F3J A;  3HHL B;  1U6B A;  3OFG A;  2EVZ A;  4CLW A;  4C0O C;  1KDN A;  2VL1 A;  1TMJ A;  1SMY A;  3M9M B;  4A47 A;  1C0U A;  4IOB A;  2GS8 A;  4NZ0 A;  4YR2 A;  3KK2 A;  1LOU A;  5G4D A;  4I7F B;  2ZBR A;  2CQ1 A;  1JLB B;  2WON B;  5FJ4 A;  4USU A;  3IO1 A;  2MKJ A;  1IWG A;  3W9I A;  3TUP A;  1U1P A;  3ZTQ A;  1F3F A;  1JQG A;  4Y7N K;  5DJB A;  2HHV A;  3QSI A;  2W8L A;  1NND A;  2KT5 A;  4F67 A;  1RAF B;  1FA0 A;  3QAT A;  1RWP B;  1FK9 B;  1XMO J;  4LF8 F;  2FLN A;  1KHW A;  5SZT A;  2HHT A;  2R7V A;  2MJU A;  2KVQ E;  4LFC J;  3WDO A;  3S1R C;  1L3U A;  3WQP A;  4R25 A;  3MEC A;  4GFQ A;  1NSP A;  2HBY B;  5KT4 A;  2DVI A;  2JA5 C;  3I4M C;  3SDE B;  1S6P B;  2GIF A;  1S97 A;  2HRY A;  3QO9 A;  2HFU A;  5GAD U;  2HMI B;  3NG8 A;  3HXA A;  3ETO A;  2CPY A;  3BBC A;  5KFR A;  2IYG A;  2WVE A;  3PYG A;  4DBQ A;  3D5M A;  3DOM B;  2ILY A;  3KLF B;  3DHX A;  3MPU B;  4LRD A;  3OL7 A;  3LQV A;  3OTB A;  2PN6 A;  5KG3 A;  3CW2 C;  3CJT A;  4ZOS A;  2IY5 B;  1O24 A;  1TKZ A;  4K4X A;  1OS5 A;  4DUY F;  3UN3 A;  3GV8 B;  4WWS A;  4G7O A;  4K4S A;  4X4Q A;  4C8N A;  3KMQ A;  2CQ3 A;  3DRX A;  1FWL A;  2VHG A;  2GHW A;  5BXI A;  1YRT A;  2WOM B;  1FO1 A;  2HVD A;  1JLE B;  4EMD A;  5K8P A;  4J9P A;  1NBE B;  2BAN B;  4RO0 A;  3FOF A;  1TL3 A;  4NLQ A;  2DPI A;  1HFE L;  2RGR A;  4NXN J;  2EEY A;  3RAM A;  1NK0 A;  3AA9 A;  2IRY A;  3HOZ K;  5DQG A;  1X9W A;  3MAQ A;  1ZPW X;  4K2X A;  3K59 A;  4YFN A;  1VQS A;  1REV A;  4F2S A;  2MHE A;  3I5B A;  3BGO P;  3I4N C;  3LWM A;  4ED6 A;  1RSC A;  2ZFZ A;  3UPF A;  1HBM B;  1T9W A;  1VC5 A;  3E51 A;  5KFK A;  3LAN A;  5HQ8 A;  5JVG Q;  1VK8 A;  3CD7 A;  4YB5 A;  3C66 A;  2JA5 K;  1SFO K;  3AAW B;  4MKB A;  4OX8 A;  3MPY A;  5LXR A;  1PBU A;  3DLE B;  4OI0 A;  2GO8 A;  1FCA A;  3S2D K;  3CJ5 A;  4X4U A;  3NOC A;  4CM0 A;  4IOA Q;  1DLO A;  3CUN A;  3TA2 A;  1AT1 B;  4I6W A;  2XNQ A;  1H2V Z;  1HNZ J;  3QLH A;  1RAG B;  1B7F A;  1TKX A;  1KS2 A;  5HI7 A;  4QR1 A;  3D7S B;  1LFW A;  1KOO A;  1SB6 A;  1SUQ A;  1F0X A;  2CDR B;  4AXI A;  3M4O C;  3IFE A;  2J6T A;  4PQU B;  1UKU A;  2VG7 A;  1KFD A;  3M9O B;  2QX0 A;  1MMN A;  3M6X A;  1U6Z A;  1VLO A;  2VBY A;  2X1F A;  1T05 A;  2BKP A;  2R93 A;  5LSL A;  1SJ3 P;  1W2I A;  5C44 K;  5DDP C;  5F0W A;  3MM9 A;  1S4F A;  3OJU A;  2B6A A;  2H4Y B;  3KLI B;  4BLG A;  1IBL F;  4LF9 J;  4GRS A;  1TWH C;  5DZ6 A;  2R42 A;  5L1J A;  4DV0 J;  1QM9 A;  1ZBS A;  4IH6 A;  3GTK A;  1AA1 B;  3JAM Y;  3N9U C;  4DR1 J;  2WVF A;  2IJF A;  4EZ6 A;  1IBL J;  1QAJ A;  1HMV B;  1OQ6 A;  3FVY A;  5CYM B;  2CVI A;  5L8R C;  4XSZ A;  2VKR A;  4O23 A;  2QL5 B;  2COL A;  1FVQ A;  1YJ7 A;  3GV7 B;  2C3U A;  3PV8 A;  1TMM A;  4ECT A;  2MZJ A;  2B63 K;  1YBT A;  3K0J A;  2E1R A;  2B51 A;  4PZV A;  3UD5 A;  3G86 A;  2UXB J;  2PI4 A;  2C28 A;  4YDD B;  4DL3 A;  3DXB A;  2XMU A;  1IBA A;  3P6Y C;  3H20 A;  1BQN A;  3OHA A;  4G1Q A;  3G8S A;  4F4W A;  3V6J A;  4DFK A;  4CLY A;  3VVU A;  2OFH X;  1RT2 A;  3Q8U A;  3C14 B;  3GIK A;  2Q3P A;  4WIL A;  1S1W A;  4C6A A;  3B82 A;  5KG7 A;  4GC6 A;  1SKR A;  3TWZ A;  4YFK A;  1NAQ A;  1DTQ A;  1A0O B;  4K4Z A;  2VQF J;  4UY8 5;  4H4O A;  4CLS A;  5D8H B;  2CPI A;  4L73 A;  1WQG A;  2AX1 A;  3H90 A;  4WFN Q;  2R92 C;  4X4O A;  3TJ8 A;  3QGH A;  1FRK A;  1X4H A;  2HHW A;  1BMQ B;  4M94 A;  4DI6 A;  2KZZ A;  1I50 C;  1K1Q A;  2B5J A;  1KRP A;  3MMA B;  3H0G C;  3LAP A;  4RW4 A;  1YNJ A;  4GKJ J;  2XCO A;  2V68 A;  4A48 A;  3KLH B;  5K8M A;  2F1F A;  1PC4 A;  3KHR A;  2LMI A;  1FES A;  3LAK A;  4KMA A;  3S1N C;  3M7V A;  2D1C A;  3J7Y I;  1U02 A;  4QWC A;  1UWB A;  2QLW A;  4ID8 A;  4C48 A;  3HP6 A;  3UVJ A;  2W9B B;  1NJX A;  2V9W A;  4FVC A;  5CQG A;  4F4Y A;  1ZQ1 C;  2VQE J;  2WB1 D;  2FPH X;  4PKD B;  1NU4 A;  1S72 S;  2Z30 B;  1YDL A;  2MDA A;  2O5I A;  1U2F A;  2DIV A;  1SQE A;  2MQL A;  4PG6 A;  1GE9 A;  4CO1 A;  1YGY A;  5CXT A;  3R7B B;  1NJI T;  4GVB A;  3AT1 B;  5CYQ B;  5KFL A;  4LSN A;  1SL0 A;  4PYA A;  1WJ9 A;  1UW4 A;  4DUT A;  2J9E A;  4QWE A;  4DUZ J;  3POT B;  3K5P A;  4A8F A;  4EYH B;  1W25 A;  3PO3 K;  3RB0 A;  2KVI A;  2AIR B;  3FFI B;  2AZ1 A;  4QW9 A;  1P9Y A;  2DY1 A;  5D4P A;  3RBE A;  3FRZ A;  3GTL C;  2OEJ A;  3K5L A;  2XBP A;  3A3O B;  5SUH A;  5D3G B;  4TU7 A;  2M4M A;  3K7A K;  2WB1 L;  2R2S A;  4YR0 A;  4DR5 F;  3HOU K;  2I5J A;  4ED4 A;  3LP1 B;  4BBS K;  3DC2 A;  3IG1 B;  3CDE A;  4OIQ A;  4DSE A;  4RWX A;  2V63 A;  3LGN A;  4BWM A;  1TWC K;  3RB6 A;  2J0X A;  3J7Z 5;  3CDW A;  4HH0 A;  4X4V A;  3GTO K;  3CCZ A;  1KEK A;  3EJM A;  3OFF A;  1KLM A;  1Q8K A;  1YK9 A;  2WVD A;  3RTV A;  2YQ1 A;  2X1A A;  4ZP9 A;  4KYZ A;  1HWJ A;  5IYC K;  4QCL A;  5CJ9 A;  3GTQ A;  2ZJP Q;  3H0G K;  3I4H X;  2VKZ G;  3SQG B;  5F41 A;  1KQF B;  4EBE A;  3RBZ A;  2HMI A;  4FVM A;  3EM1 A;  4A3F K;  3TRG A;  4DL4 A;  1G6B A;  4JI6 J;  5TMC A;  1KQ4 A;  1CJK A;  3G8Q A;  3SCI E;  2VBX A;  1RU2 A;  4ECR A;  2ZUF A;  3KLF A;  1BHN A;  2R7U A;  4OLO A;  2E2H K;  2G0J A;  2CKW A;  4QW8 A;  1Q78 A;  2KDO A;  5KOX A;  2ZKU A;  1QTN B;  2BX6 A;  2IBO A;  2FZG B;  4DQR A;  4UUX A;  3OBI A;  4DR3 J;  4KN7 A;  3TUI C;  1RT3 A;  3O6Q A;  3HOY C;  3EQL A;  2XY5 A;  3ET6 A;  3GTQ C;  1SH2 A;  4IUF A;  2DXE A;  4YG2 A;  3E01 B;  2UUA J;  1XIQ A;  3FC9 A;  2AWZ A;  4LFA J;  1BDF A;  2XMA A;  2W4P A;  1F93 A;  4C8L A;  4CQ1 A;  1ZA1 B;  2IJN A;  1TK5 A;  1WI8 A;  2GMJ A;  1OWX A;  4NEZ A;  3MAA A;  4TLQ A;  4KY3 A;  1Q0N A;  5C4X K;  4HTJ A;  3NS6 A;  1XK8 A;  2QIF A;  3DGP A;  1N32 J;  2YKN A;  1QD1 A;  4I6Y A;  3M30 A;  2O1P A;  5EX0 A;  4DMZ A;  4C2M K;  2RUG A;  5BYQ A;  1PJ6 A;  3NP5 A;  2MGZ B;  2DIS A;  3E8O A;  1XER A;  5EGH A;  4HYK A;  4QYZ K;  1TL1 B;  3GON A;  2HVZ A;  1N6Q B;  2J9D A;  4JI5 F;  3GU0 A;  2KHD A;  2W9C B;  3OFE A;  1S6U A;  4C3H K;  2JZ5 A;  7FD1 A;  1VQ4 S;  3UDV A;  4IO9 Q;  1VDH A;  5HL7 Q;  1RAB B;  3Q24 A;  2YNG B;  3MEK A;  1FF2 A;  3HFZ B;  3AD9 C;  1GNK A;  4DFJ A;  5IS2 A;  2KJV A;  1SUQ B;  4C9D A;  5G0R B;  2EFN A;  1GXL A;  3QPI A;  5DGB A;  3NMR A;  4B08 A;  2EBG A;  4AD6 A;  4FF1 A;  2V34 A;  2CJ9 A;  1R8P A;  2JA8 C;  1Y5I B;  4ZPD A;  1HBN A;  1WCM A;  4JYA J;  1KQS R;  3DHW C;  2JHE A;  5E41 A;  2G2O A;  1O26 A;  4IH5 A;  5IOT A;  3HKW A;  1HA1 A;  3HCX A;  1PBA A;  3FOE A;  4Y3C A;  1S9G B;  4JI0 J;  5KFT A;  4Y2M A;  3FSY A;  4U6P A;  5IYB C;  3HOW C;  2VPY B;  3I4N K;  5IP7 C;  3CMA S;  3I82 A;  3LGM A;  2AKW B;  4ZVR B;  4QQB A;  3CO0 P;  2CQI A;  1JJ2 R;  1APS A;  2GQQ A;  1WEY A;  1O2F B;  4ZDN A;  4KMD A;  3C6U A;  4DUY J;  4RWW A;  1W2B R;  3KHG A;  2ZH1 A;  3RR7 A;  1V5I B;  4B3S J;  1IKY B;  1XMQ J;  4QIW D;  3GTJ C;  1F6T A;  1UEK A;  1JJC B;  2MZR A;  3OXF A;  1RT6 A;  4PUO B;  2N7Y A;  4ED2 A;  2OAU A;  2PGC A;  5T7L A;  2KFZ A;  3NBP A;  2OH2 A;  4CTA B;  3MR5 A;  5KG0 A;  3PW2 A;  5E0O A;  1TUW A;  1RT7 B;  5A8W A;  1JB0 C;  2XG8 A;  2V4J B;  3T1H F;  5JVO A;  3AFG A;  5KFG A;  4B3R F;  1S9G A;  3E2E A;  3UFC X;  1BJT A;  1I3Q A;  1TWF A;  3MEE A;  3BZQ A;  2CQH A;  4KDD A;  4Q2M A;  4Z37 A;  2PA3 A;  2IA0 A;  3M9N B;  2OPQ A;  1YZ7 A;  1GTH A;  1HI1 A;  1NH8 A;  4UF4 A;  1YJU A;  2BJ9 A;  3R1H A;  1NKB A;  2I8E A;  2RF2 B;  1X4E A;  3GTK K;  4M8L A;  3MEG B;  4I64 A;  5M3M K;  1VK3 A;  2UUT A;  2F40 A;  3SDE A;  2BE2 A;  1FRH A;  2FLO A;  4CO0 A;  3GTM K;  4JV0 A;  3M8Q B;  2OPR B;  3K2Y A;  1IL2 A;  3IA0 A;  3HSD A;  4GTA A;  2A2C A;  1G4C A;  4C4W A;  1L3K A;  4FBT A;  4CTA A;  1FJG J;  3AD7 C;  1Y1W C;  5ETO A;  3HVT A;  1YWX A;  2ROG A;  5GMD A;  3SEO A;  2WTF A;  1Z2Z A;  5CHP A;  1Q1K A;  1H7W A;  4B9U A;  3UCG A;  4BC7 A;  4F50 A;  4I69 A;  3M8P B;  4H54 A;  4AL5 A;  3KK1 A;  3DRR A;  3MCS A;  1TQL A;  1RYS A;  4OYX A;  3M6V A;  2CJA A;  2KYZ A;  5DLF A;  1X5O A;  3PX0 A;  2CQP A;  5GAH I;  2UUA F;  3MXH P;  1Y1V A;  2XY7 A;  4ZCM A;  3KDN A;  2Y8Y A;  2YKP A;  4CLU A;  2SXL A;  4WKR A;  2J6U A;  3JYT A;  1XR6 A;  1YIJ S;  1D8Y A;  3ERE D;  3BR8 A;  4IRD A;  3ISN D;  1R0A A;  5CYQ A;  3QAU A;  4HKQ A;  2PII A;  1WOP A;  5F3T A;  4ZVP B;  3NXZ A;  4IYQ A;  4BBY A;  5GAG U;  4Q5V A;  1HKA A;  1Q4R A;  1IVZ A;  4M95 A;  5KFY A;  4URQ U;  3B54 A;  4JI3 F;  1U4B A;  3N5F A;  1RAC B;  1FVS A;  5LXY A;  1B7Y B;  1NLK L;  4B17 A;  2MQQ A;  2ASY A;  3KK1 B;  3AOC A;  3J7Z T;  1R9T A;  3J7A 1;  1Q95 G;  2VDH A;  4OZL A;  1IUJ A;  2HHQ A;  1G3O A;  3EGW B;  3PEH A;  3TFI A;  2VC0 A;  2GVZ A;  1YJV A;  3T6B A;  4ED3 A;  5I3Q A;  1YVF A;  3N79 A;  3GV5 B;  2ZBQ A;  1EHW A;  2RH6 A;  3GTK C;  4B9N A;  4Y6I A;  1EFW A;  3OSN A;  4RUC A;  2C2R A;  2OD4 A;  4DFP A;  3IPJ A;  5L38 A;  2GAG C;  1D9D A;  3B4M A;  5J1P A;  2IRU A;  1VRU A;  3T41 A;  4KPY A;  2D7S A;  5GAG I;  2ZUA A;  4B9T A;  4ES1 A;  4UOH A;  5J2P B;  4GT9 A;  3D0H E;  5L9N A;  2YU9 C;  3Q23 A;  4I2Q A;  2ATL A;  4A3M C;  4LRC A;  3PO5 A;  4CLT A;  2MMY A;  3QWU A;  2YWE A;  1NHU A;  4DX7 A;  2CYY A;  1RCO B;  3I87 A;  1NB7 A;  3CD6 S;  3BM7 A;  4MEX A;  1SIZ A;  3TP2 A;  2BAB A;  2XTJ P;  1O2A A;  2AEF A;  3SXL A;  1RUS A;  4RKU C;  2G1D A;  1MW7 A;  1U1K A;  2K7K A;  2NUU G;  3ISZ A;  3G82 B;  2HQD A;  2JLE A;  3T1Y F;  3U1N A;  1RTD B;  1LXJ A;  3IM9 A;  3CSK A;  4OI2 A;  4NEY A;  1KVI A;  2XEX A;  1JLE A;  4ECW A;  4KO0 B;  2J7W A;  2LQ5 A;  1S6Q A;  4PWW A;  3PDN A;  2M8D B;  5E3C A;  3EDR B;  5F8G A;  1FX4 A;  3RZO K;  1X4F A;  1KKH A;  4GC7 A;  2JEG A;  2ASL A;  2A3J A;  2KH9 A;  2ZHB A;  4YDX A;  3KG0 A;  2MLY A;  5CYJ A;  2GSU A;  2W8K A;  2NXU A;  4IRK A;  5CHC B;  1T9X A;  3H0G A;  1H2U X;  3T3F A;  2W2M P;  1R8B A;  3HOX K;  3CCV S;  1RB0 A;  4M5L A;  2FIU A;  1LW2 B;  1HNI A;  1TEL A;  2BVZ A;  4JV1 A;  1O27 A;  1WKL A;  2R8K A;  3KLE A;  1HNW F;  1OYD A;  1VLY A;  4BY1 K;  3DYA B;  3LP0 B;  2A6E A;  2BAC A;  1ITP A;  1F60 B;  2UXD J;  3QMQ A;  3NGK A;  1FJ7 A;  2W9A A;  4K2J A;  1Y5N B;  5BJR A;  5F3Z A;  1VRT A;  2LQ8 A;  2HNZ B;  3BP8 C;  3PFO A;  4YY3 J;  3CD5 A;  1NHK L;  1LKZ A;  4AFF A;  1M90 T;  4ZIT A;  4RNN A;  1RWK B;  4X6A C;  2K2P A;  1CQM A;  3VGS A;  2LFV A;  1WG4 A;  2E2I A;  3UW1 A;  4ECZ A;  5J2Q B;  2AW0 A;  3HOV K;  4BDP A;  2ZZT A;  3TZY A;  3BSA A;  4Q0B A;  5K5M A;  1XMO F;  4LF8 J;  2R8I A;  1DCH A;  5IM0 B;  3BP3 A;  2W4C A;  5D4L A;  2NVT K;  2W2N P;  4FKX A;  4MKY A;  3MED A;  4LT6 A;  4OYP A;  1I3Q C;  3BO4 A;  5L9X A;  3H5S A;  3KUG A;  2E1A A;  1NSK L;  2XMV A;  5BYR A;  4A3L K;  3CE8 A;  2ZBI A;  1W26 A;  2KRR A;  2IDL A;  3EZ5 A;  1RTI B;  1SJF A;  4HI2 A;  2R7Z K;  1S4E A;  4IOC Q;  3K5O A;  2MY7 A;  1X9S A;  2MKC A;  4WJ4 A;  2GO9 A;  1UZH A;  5CA5 A;  5IYD K;  1X5T A;  3W5Y A;  1XZQ B;  4FBU A;  3CED A;  5D0H A;  2B9Y A;  3EMT A;  3S2H C;  2CNO B;  1MN9 A;  3F0N A;  5LMN F;  2CAD A;  5IT4 A;  2V2V A;  3MML B;  3IR6 B;  4A3K C;  2B8P A;  5DGA A;  4RPF A;  1Y10 A;  3KJN B;  3SFG A;  1JQW A;  1NJW A;  1RBL A;  1YLX A;  2DRA A;  3BDE A;  2VFR A;  2YQ3 A;  1MSW D;  4RNH A;  5CD4 H;  2R7S A;  3VF0 B;  4K8R A;  4KV8 B;  3J80 U;  3ORE A;  1ZZF A;  4PXE A;  1C4A A;  3GMG A;  5C7P A;  1VI7 A;  2U1A A;  1RU1 A;  2IA6 A;  3KMS A;  4OX7 A;  3CPW R;  1CBK A;  3PYE A;  4WYW A;  3UCZ P;  2LEB A;  1F3V A;  5CCL A;  1U24 A;  3OXL A;  4I4B A;  1N4L A;  4K4U A;  2WRM A;  1EI6 A;  2Z4P A;  2Q1L A;  2ZM6 J;  2KG0 A;  2ASJ A;  2Y0S L;  3OTC A;  2R92 A;  4Y00 A;  2XS7 A;  5IZH A;  3H2L A;  5EGE A;  4PUO A;  2DGO A;  3VAH A;  2J0Q D;  5LL6 d;  1F9H A;  5AXK A;  2D69 A;  1ZA2 B;  4O3S A;  3BQ2 A;  2BMB A;  1ZZN A;  4TNO A;  1XNQ F;  2OEM A;  3R1L A;  3V4I B;  3TYT A;  4MTP A;  2XC9 A;  4FPR A;  3GPA A;  2N3O A;  4LR7 A;  1F7U A;  1PG5 B;  2H48 B;  2PI5 A;  3IN5 A;  3C46 A;  3MGJ A;  3UD3 P;  3M32 B;  1RLC L;  2Z0G A;  2QO3 A;  4IO1 A;  1K73 T;  4A8W A;  2FY1 A;  2ALY B;  3QJJ A;  5HAN A;  2N7C A;  5C42 B;  4UY8 T;  5HSP A;  2R93 C;  1S1V B;  4RW7 A;  3PO2 K;  2IIH A;  3MM7 A;  2QFI A;  3GP9 A;  2XZW A;  3R8Y A;  3DLK A;  2UXC J;  1VYA A;  1VH2 A;  1H6K X;  2HGL A;  2R7Z C;  4ZVS B;  1W7W A;  2P9E A;  1RLD A;  2WW8 A;  3LPY A;  4ZVU B;  3QBC A;  1C1C B;  4LUB A;  2NVX C;  1WC1 A;  3W2V B;  3P5T L;  3S1T A;  1X4G A;  1X4C A; 
#chains in the Genus database with same CATH homology
 3AD9 C;  3GEE A;  3TFH A;  4PAB A;  3ADA C;  4PAA A;  2GAG C;  3GIR A;  2GAH C;  1VLO A;  3GEI A;  1PJ7 A;  1XZQ A;  1WSV A;  1PJ6 A;  4P9S A;  3GEH A;  1XZP B;  3A8K A;  1XZP A;  1V5V A;  1WOO A;  1XZQ B;  5L46 A;  3TFJ A;  3AD8 C;  1WOS A;  1WOR A;  3A8J A;  1PJ5 A;  1WOP A;  1WSR A;  3TTG A;  3AD7 C;  3A8I A;  1YX2 A;  3GSI A;  3TFI A;  1X31 C;  1VRQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...