1X3PA

3d solution structure of the chromo-3 domain of cpsrp43
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
54
structure length
54
Chain Sequence
AVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cpSRP43
publication title 3D Solution Structure of the Chromo-3 domain of cpSRP43
rcsb
source organism Arabidopsis thaliana
molecule tags Unknown function
total genus 2
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1x3pA00
1F9PA 2J7ZA 1WTWA 2X69A 2FJ2A 1GUWA 1BNZA 4RAUC 4MHEA 1NAPA 1BBXC 1AZPA 1NCVA 1S4ZA 4IUTA 1QNKA 1RTNA 2B2UC 2L4NA 4RA8A 5AFWA 1HHVA 3IFDA 1G2TA 2K01A 4IURA 1U4PA 2KEEA 3ONAB 4XT1B 2B2YA 1RHPA 1KNEA 3N52A 1J8IA 3I91A 1HRJA 3DEOA 2L9HA 1B4OA 3I90A 4X3SA 1O7ZA 5E4WC 5EJWA 3DEPA 2K03A 2FFKB 2HCCA 1ICWA 2RSOA 2X6LA 3GV3A 2N55A 3I8ZA 1BO0A 1JICA 1LV9A 1O80A 5CORA 4HEDA 2KECA 2RA4A 3QO2A 2FMMA 4R8IA 1WD1A 1VMCA 2M2LA 2KOLA 1RTOA 1B53A 2NWGA 1KNAA 3DM1A 2JYOA 1MGSA 2K05A 2K28A 4XDXA 5EPJA 2Q8TA 4OIJA 1QG7A 4O42A 4UAIA 5T1IA 1NR2A 2EE1A 1G91A 1EQTA 1EIGA 3I3CA 3P7JA 1WTOA 1SAPA 2XIWA 5COYA 1MSHA 2MP1A 4IUUA 3G7LA 1B50A 3TN2A 1MI2A 2CVRA 1EL0A 2MPMA 4IUVA 4ZAIA 1G2SA 2SDFA 1G6ZA 1CA5A 1CA6A 1X32A 2B2TC 1U4LA 3MTSA 4X3UA 1PLFA 2X6GA 3LWEA 4X3KA 1DZ1A 2L1BA 1XYIA 1F9RA 2B2VA 2HCIA 4U68A 5EPKA 3TZDA 1DOLA 4CJ0B 1JE4A 1O7YA 3IL8A 1BF4A 1WTPA 1ESRA 1C8CA 1SSOA 3HP3A 3KBXA 1XX8A 1SDFA 3R93A 1TVXA 1HA6A 3FDTA 1ML0D 1NR4A 2NZ1D 2B2UA 4IUPA 1F9SA 2D9UA 2DY7A 2IL8A 5CMDA 3GV6A 4XT3B 1E0BA 3MWYW 5D14A 1F9QA 1U4RA 1X3PA 2K04A 2KUMA 4IUQA 5E4XA 1WTRA 4ZLTF 2DY8A 2B2YC 2B2WC 2L11A 2L12A 4DN4M 1HUMA 3UI2A 1WTVA 1ILPA 2B2TA 1AP0A 1HUNA 4NW2A 4QUCA 4HAEA 2KEDA 5JJZA 4ZKCB 1J9OA 2KVMA 1RJTA 3H91A 1B3AA 2K1BA 4HCSA 2HDLA 2EOTA 4RWSC 2EPBA 2H1EA 1MSGA 1PFNA 5DNFA 2FINB 1X3QA 5EQ0A 1EIHA 5EKIA 1PFMA 5D65A 2MGSA 4QUFA 4LMQD 1DOMA 2JP1A 2RVLA 2NYZD 2HDMA 4CJ2C 5CBEE 2FHTA 4MN3A 2B2WA 1B2TA 1WTQA 1F2LA 1IKMA 1VMPA 1DOKA 3KUPA 3FPUB 5T1GA 1ILQA 1IL8A 3D6WA 1IKLA 1Q3LA 1AZQA 1QE6A 2RSNA 4ZK9B 1U4MA 1ZXTA 2Q8RE 3F2UA 1RODA 1M8AA 1HFGA 4R9WA 1PDQA 4OIKA 4X3TA 4ZKBB 1WD0A 4HSVA 2VXWA 1HFNA 2MJ8A 3Q6SA 3SVMA 1WVLA 2N88A 4CJ1B 2HUGA 2BDNA 1EOTA 1WTXA 2R3ZA 5EPLA 5CBAE 1A15A 1CM9A 1DONA 1PFBA 2B2VC
chains in the Genus database with same CATH superfamily
4QMGA 4KTAA 1HR0L 1ENCA 1GUWA 2J4XA 3FPPA 2RQXA 2HHHQ 4JI5Q 2PQAA 5LMNL 3K81C 3OWEB 1WFQA 3C1FA 3PIP3 1N34L 5IOCA 2YTVA 3L7ZC 2XRSD 4DR2L 1YEZA 3MAQA 2P5ZX 2LSSA 1C9OA 2A69C 3MXNB 2GVAA 3H6MA 2F0MA 1BDOA 2K14A 2I5HA 5IYBG 1WOCA 2FMMA 4RMFA 1VMCA 2DJGC 2M2LA 2KOLA 1RTOA 1D6EC 3G4SA 3K8AA 5NUCA 1EQRA 2K5NA 3DM1A 1CSQA 3TEHB 1EUJA 1TWHH 1JOQA 2F0LA 4R4QA 5J1ZA 1EQTA 2HIVA 4PNYA 2D0OA 1OTCA 4DA2A 1QB5D 2QF7A 2M9VA 1VQPA 3JAML 2HQLA 5CV9A 4HR7B 2K75A 3E5SA 4AYBB 1G6ZA 4IOAA 1X32A 2G9HD 5EKLA 1SXTA 1YI2A 4AQYL 4ZCKA 2Q8IB 5EPKA 4A3KH 2UXDL 4YHHL 4HCEA 3DMUA 5A35A 2UUAL 4DUYL 1TWFH 4JI7L 1CUKA 4LF8Q 1F2ZA 4HIMA 1NSNS 3GV6A 2MUYA 5FK9C 3TREA 3MZ5A 3NK9A 4BBSG 2VQFL 1W2BA 3UI2A 4GN3B 4XIGS 5JJZA 2O5JC 5IIFA 1R9TH 1HZ9A 4DAYB 2B63H 1B3AA 3J80c 4F88A 2QEJC 4XXEA 4NP5A 3WOFA 2TMPA 4IJLA 5AJ3Q 1N9WA 1V43A 1Y8NB 1GXDC 3X3MA 4MZ9A 1T5XD 5CBEE 4B3SL 1S5BD 3HKZG 2YU9H 1WTQA 3KUPA 4EQPA 2UXCQ 3TP7A 1TWAB 4LF7L 5C4HA 4DV2L 1N33Q 2AMCB 2ZXOA 4WJ3M 3S15B 1HFNA 3PO2H 2F0OA 3NPPA 3HOUG 2BDNA 4BWGB 2N88A 1BF4A 5M5YB 2JA5H 3I55A 4KK7A 1G291 3HKZE 1SNPA 1HZAA 3K0YA 4NB3A 4JVZA 1KQSA 1S4ZA 5M9OA 1QNKA 1RTNA 4RA8A 4C3IH 1VCIA 4K6LA 4OWWB 2B2YA 1SYEA 1GHJA 2JE6I 1FNUA 1KAWA 2HCCA 1I4RA 5FJ8H 1L1OA 3CPWA 3PV0A 1KXLA 3S1NB 1CI3M 4IJHA 1SEBD 2IWHA 1HR0W 4KI0A 2KJXA 2JYOA 4A3FB 1QWYA 5GAEC 1VQ4A 2HD3A 4IFDJ 3GTMB 4JI5L 1HNWQ 5C44G 4IUVA 3PUWA 5M3MG 4GNXC 3RZDB 3M85A 5IY0A 1LTSD 3LWUA 1HQRD 1PTOH 2QEXA 1SE3A 3F2BA 4DXGA 3NUCA 5KYLA 3J7YW 1GUTA 4ODGA 4PZ8A 4UPAA 1PTOF 1WTPA 1FGUA 1STNA 1S3OA 3HP3A 3GTGB 4HIOA 1X3FA 3LGJA 1N36L 3BZCA 2UUBQ 1HH2P 3TP6A 2JA8G 3T4AC 1PZID 4A3EG 5IP7H 3D8GA 1EYDA 4MIUA 1Y1VH 4TQUS 4M8AA 4G7HC 5JJLA 4R1JA 3K7UC 3RR5A 5EBCA 3V96A 3I72A 2IX3A 2K1BA 3DWQA 1I6HH 1DXMA 1VQCA 3P75A 3T51B 4HJ7A 2BE5C 1J5EL 4A3BG 4DKAC 2KENA 3RN2A 4OO1G 5IODA 5FLXc 1UE6A 2JP1A 1FYCA 1E2ZA 4LFCQ 1YHBA 3NWTA 1ASZA 4FP5D 5GQOA 2MO1A 1QUQB 3Q8DA 1IL8A 3X3NA 4DF7A 1QE6A 1RODA 1BKBA 2OF1A 3H0GB 1EOTA 3VR3A 3DWAA 4YCWA 1PFBA 5C4XG 2JA6H 2E2JB 3S1MH 1VQKA 3OTOQ 3A5UA 2EY1A 5KNCA 4Y7NH 5AJ3L 5JEAJ 4PMCA 1DD2A 1STYA 2K5WA 3GTPB 4A3LG 1F2YA 2IT1A 2QDBA 5I4DA 4WFN3 1HNZQ 2M00A 4HJ9A 3I4NH 4DXFA 2E2IB 1QCBD 2CQOA 5J39A 1ICWA 2X6LA 4QF4A 5CORA 3S1QH 2A74C 1KDAA 2RA4A 4XYOA 2R92B 4UP7A 4WRDA 4B08A 1KNAA 5IGGA 1EOVA 1JQYD 4A3CH 3J81i 4X62Q 4A3GB 5E1FA 4C3HB 2RCFA 1LTTD 2K5VA 5DM63 3TRZA 2XTIA 1B50A 1IBLQ 1TWCH 3S16B 1VS0A 1Q12A 4LFBQ 2PZWA 1XPUA 1I4PA 2E76C 2OXPA 1GUNA 5IYDH 3CP0A 2R93B 1XMQQ 3V2TA 1X65A 2AQ3B 2R61A 2L15A 3NTIA 1JOKA 1S72A 4BY7G 1SMXA 4CKBA 5C5LA 3U9SA 5D14A 1EYAA 5E4XA 2PMZB 4RH6A 1QNUA 2Z9HA 4GNXA 3L9AX 2GN5A 2H4OA 2NVYB 1PZJD 1IXRA 1RJTA 2XVSA 3A8IE 2B39A 2KA7A 1XJVA 3CCJA 1EZ6A 3F2CA 4PZ7A 3TMEA 2KHSA 4GN4B 3RLNA 1PFSA 1E1TA 3CQZH 3KF6A 5D65A 4NXML 1UE1A 1ONLA 4KMUC 2F0HA 1PRTC 1XMOQ 1E3PA 2XRQD 4MN3A 3URYA 1Q8KA 1TS3A 3K80C 1Y14B 4FNFA 4IZ8A 1YNJD 2LKVA 2RSNA 4X64L 1SNDA 4ME5A 4UP9A 1PH9A 2VB3X 1BCPC 1CM9A 2G5DA 3JAMi 4OL7A 3GTJH 5M5WB 1SYDA 1OXXK 3OSOA 4GS3A 3O13A 4DNRB 1FL0A 4GKKL 4DR1Q 1D8LA 5KEEA 1NCVA 2D0PA 3A56A 4R4CA 2RF4A 5DEHA 3ONAB 2CFMA 2KEEA 3DM3A 4F87A 1HRJA 1JB3A 3SDZA 3S1RB 3I90A 1AW7A 1TWAH 2KCNA 2L0CA 4JI4Q 1DONA 1EQVA 4IPHA 4DUZL 1S5CD 1VQNA 3HG9A 4IFDG 2R7ZB 4DV3Q 5E3FA 2KCMA 3BZKA 3EFXD 3S2DB 4RHSA 2Z6KC 4EQ5A 2AWNA 4EX5A 4K2KA 1HTLD 4BBRG 1HNZL 2R93G 3EQLC 5JVG3 3CC7A 2Q2TA 1G2SA 2F0GA 2JA7B 2D62A 4N8X1 3H3VH 1JJ2A 2PNHA 2VL6A 3LWEA 3J7ZC 5IYCH 2L1BA 1F9RA 4DR6L 1SYBA 3SK4A 2N3SA 4RGOS 4DU9A 4JI1Q 2J0TD 1HZCA 3STBD 2B2UA 1ZYRC 4X62L 4BXXG 2CW0C 1E0BA 1C7YA 1JOOA 1A63A 3PO3B 3T1YQ 2EQSA 1L0YB 1Z6HA 1SJED 3FRPB 2E2HH 4JBMA 2F0EA 4B3RQ 5GAHC 3U4ZA 3DWPA 3J81c 1OXSC 2EJGC 4N9TA 3AB9A 4P71A 4LF5Q 1SMYC 4U673 1HTPA 1GUOA 2QW7A 1HNXL 2A6HC 4KJOA 3BJUA 3GTGH 2VS1A 4V0BA 1TY2A 3CCEA 2NN6I 1A3TA 3DUZA 1F2LA 4P73A 4XQQA 1IKLA 2A19A 1LLRD 4DAYA 2EY2A 3CPFA 4BY1B 4MNOA 2F1MA 3FMCA 5F2DA 1KD1C 3Q6SA 1WVLA 1MHWC 5EPLA 1FNWA 2XWBB 4DV5L 3KJOA 1I4HA 2A6ED 3A5ZB 4QY7A 4B3MQ 2CHBD 4E6IA 4H0LC 4OELB 1JE5A 1EY8A 4IALA 1OO9B 5JJKA 1HHVA 1N32Q 4DV7L 2IPKD 4JYAQ 1XMOL 2K5DA 1KNEA 2PI2E 3ND9A 5FLMH 5IWAQ 3PUXA 1P8LA 5C3EG 4DV0Q 2EY5A 1EQQA 4ZYSA 3DEPA 4O0AA 3F1ZA 4RHRA 1FD7D 3H0GH 3M3YB 1Y1WH 1TWGB 5CC4A 5L37A 2KCTA 4DV1L 2WKDA 2CCZA 5JOBA 1EY6A 3GTLB 4EGVA 1SLJA 2NBFA 1B7YB 2QKIC 1CKMA 3UDIA 3GTOB 3HOYH 1TIID 3EA6A 3S2HH 3VA5A 2MP1A 4DR1L 3U9OA 1WYDA 1EZ8A 1MI2A 1V1OA 4OONA 1Z9FA 2NVQB 3Q24A 1BBUA 2UU9Q 2B29A 4CKEA 2NVXB 1HJPA 2K52A 3JAMc 1MIUA 4RFBA 4LF4Q 1WCMH 1RL2A 1II3A 1DOLA 3HOZH 3G6EA 1Y8OB 1Q1BA 3NBHB 1M90C 3PSIA 3RN5A 3QJYA 3BDLA 4YCUA 4G7OC 1I4GA 3L0OA 3NBIA 3CW2C 3R93A 1YJWA 1IYJB 1K9MC 3EJIA 2D9UA 2EYLA 3EBEA 1JT8A 3PUYA 3BG3A 3CCUA 4DN4M 2L12A 1UEAB 2XN9C 1A6XA 4NW2A 5EBDA 1EY7A 2XNAC 1SE4A 4HJ5A 4JW0A 5GADC 3PUVA 1STGA 1I94Q 1F77A 4GNXB 4GKJQ 4MTKA 1MSGA 1PH3A 1UEBA 4PV1C 1EYGA 1LYLA 3NP8A 4LMQD 5CV6A 1YJNA 4GN5A 4JI1L 5EGTA 3HOWH 1MJCA 3PGZA 2B63G 4FDBA 2DGYA 5GAGC 3NHHA 4LK1C 2F0IA 4JI6Q 5M3FH 1S5FD 1LTAD 3A54A 2EXZA 4NPSA 5LHY1 4BBSB 1K3RA 2K32A 2B2VC 1B9MA 4LF5L 3EROA 4HTHA 1D1KA 1QUQA 1STAA 3PO2G 1VQDA 2L4NA 3AFQA 4XT1B 4XTCS 1QILA 1U5KA 2WIIB 2JA5G 5IP9H 4LF6L 2SNMA 2D2CC 2A5HA 4RG1A 3HKZB 2N78A 5JJIA 5FO8B 3K57A 4AIMA 4NXNL 4DR7L 3E3XA 2UUCL 2PW5A 4A93H 4OIJA 3HOUB 2ZM6Q 3KOJA 5LMUQ 5FJ8G 3QOLA 3NENA 4ZUJA 2ALYB 4P75A 1ENFA 4ZAIA 4GZYC 3RLFA 3ITPA 1YHAA 4DV0L 1PH5A 5C0XH 4CJ0B 3FVQA 1X9NA 1BR9A 1O7YA 2EYOA 3IL8A 1YZ6A 5G3LD 2R7ZH 3I4OA 5BR8L 1OXUA 3V05A 1C8CA 2UXBL 5BN5A 1NR4A 1GD7A 1IW7C 3A0JA 3R3OA 2VUMH 3MWYW 4C2MH 4JK1C 1U4RA 3S14H 4C3JH 3IAYA 1Q8IA 4QJFA 2RCNA 1B1ZA 4KKSA 2VQEL 3R8BA 4OX9L 5ELCA 1FJGL 2JA7H 3W2DA 5C44B 1CKOA 1T9HA 2F0DA 5M3MB 4LAAA 5IP7G 1Y1VG 1AEXA 4DR4L 1EIHA 1SROA 2OQ0A 4S3SA 3RLOA 4PG3A 4IPCA 1K83H 2F0UA 1ET9A 2RHSB 2F3IA 3NXWA 2WB1G 3F8TA 4XQNA 4K6DA 3PIO3 1LTRD 2JA8B 3MEHA 1WD0A 2E8GA 3MC0B 2EJMA 4A3EB 4X3TA 1BXTA 1IYVA 1LT3D 4ABNA 1WTWA 2OQKA 1U0LA 2WB1E 1IYUA 4F8MA 5ELFA 1PMRA 4A3BB 5C3WA 1E24A 1PRTB 3CU7A 1J8IA 1H9JA 2YYZA 3CCQA 2JA6G 1E1OA 3NELA 2EIFA 3BU2A 2RSOA 4LFAQ 4RKBA 4JI6L 2Q2IA 2PI2A 1LTGD 2NWGA 4C1NK 2HQEA 3CCMA 1BCPB 1VQ9A 1UWVA 3L3OC 4DR3Q 1G91A 3BS1A 2A68C 1WTOA 5C4XB 1SNCA 1E2VA 1D2BA 2SEBD 4A3CG 1XNRQ 3I4MH 1UNSA 5C5MA 4A3JH 1LUZA 4BS9A 2B2TC 3GTQB 3B6YA 4X3KA 2LS01 4A4IA 4QCLA 2AWOA 3NWSA 2D5DA 3NSWA 4KD3A 1SFOB 4P72A 3ERQA 1SSOA 3KBXA 1B44D 1HPCA 1TVXA 5LMNW 1ML0D 1NTGA 2IY5B 3Q22A 3GTOH 1EY0A 3HOXH 2HHHL 4DPGA 4DAPA 3MHBA 4F7XA 1PTOC 2B2WC 2LXJA 1IBMQ 1SYFA 4K0KQ 4PZ6A 4A76A 3VYRA 1PVOA 3GTKH 2XGTA 4A3DG 3C3LA 4GLVB 3CXCA 1KAAA 4KHZA 3ICEA 1XWEA 5DLQE 1H9KA 3S9WA 1NJIC 1Y69U 2IX1A 1VQ8A 4BY7B 5C6AA 2KQ3A 1CQVA 4ZKBB 1PDQA 5CYUA 3GP7A 3GQBA 1G6PA 4JOIC 5K5PA 2OWOA 1GJXA 4HN7A 3CAMA 1HA5A 3S24A 2FJ2A 3M4OH 4JC0A 1V1QA 2NTTA 4RAUC 5C4JB 2G9DA 2ICEC 4JI2Q 4LF8L 2F52A 1U4PA 2BCOA 1RCVD 3N52A 1QOHA 4JI3Q 5BN3A 2FMCA 3SHLA 1CHPD 3AQQA 3BYTB 5EJWA 2K03A 2FFKB 1GUSA 5KRUA 1JICA 3C1EA 4H02A 2BH2A 3J7AV 1OXVA 3CMAA 2LY7A 1FNVA 3VYTA 4KY6A 3N6RA 2Q8TA 1JJGA 3A74A 1YNND 2RBMA 4HJ8A 3CF5A 3HOVH 1TS2A 4CDEC 1XTDA 2LMCB 3P7JA 3K7AH 1HQMC 3G7LA 2Y0SG 4MTNA 2WKCA 5G3LF 1HXYD 2DJFC 3UE0A 5IT9E 3RZOB 3MA2B 4C1NI 3E0EA 1EY5A 2UXCL 3KLSX 2E74C 4EQOA 4DAVA 1N33L 2Z4HA 1GUGA 3SE0A 4JPBW 1SE8A 3FKIG 4B9WA 2Y0SE 1Q81C 1PH7A 1AFPA 2E75C 4HMIA 4QGUA 3K5MA 3AFPA 1TT2A 3HEJA 1X56A 3IRBA 2RDHA 4JI0Q 4A3MG 3SEBA 5IYCG 4DR3L 3HKSA 1I50B 1R4QB 2YTYA 4DNTB 4IUQA 1H95A 2B8GA 3ERSX 3MXPA 2F4IA 3P1HA 4ZLTF 5K36H 4KN7C 2WAQG 2B2TA 2KHJA 3ER0A 4HAEA 3NBHA 4OO1I 4ZKCB 2RDFA 5C0XJ 3H91A 1O78A 2HDLA 4BBRB 2F3VA 5C4ZA 2MNAA 2OCEA 5IGDA 1VQ7A 3VYSA 2IX0A 2WAQE 1MBYA 1KRSA 1NY4A 1PA6A 1FR3A 3KLRA 3QWNA 4QQBX 2B2WA 1B2TA 1AN8A 3KDFB 5I2XA 5T1GA 3OPOA 3D6WA 1V1PB 4JCVE 3KK7A 2JA9A 1ZXTA 4POGA 1HNWL 3TSSA 4N8FA 2EYPA 3SVMA 4CJ1B 2MO0A 2JXMB 2K5QA 4GOPC 3ULLA 2AQ1B 3W3AA 2NZHA 5LL6X 2ZJQA 1M1KC 1H9RA 4IUNA 4POFA 5AFWA 4G7ZC 2UUBL 4IURA 1GOZA 5HGTA 1KIXA 5A2QE 3IFTA 4DV4Q 2L9HA 3CCRA 1O7ZA 2H5XA 2JQOA 5J22A 1MJEA 4FF4A 4X3SA 1JWUD 1BO0A 2CQAA 4R8IA 3D4DA 3HGBA 4DK0A 3PIPA 4J6HA 3HS0C 2F4VQ 4ZQ3A 1B70B 5EKKA 1B53A 3E9HA 3H94A 2K5HA 3D6CA 1MGSA 5FLMG 1LTBD 4O42A 4IQZA 3PQIA 3BDCA 3BYYB 1EY9A 3NEMA 4LUZA 3I3CA 3VR2A 3H09A 1HZBA 5COYA 5I9OA 4DFAA 1Y1WG 4K8JA 4TVAB 4LFCL 5I6WA 1DM0B 4JI2L 3J7A5 4OO1H 3BZDB 4JI3L 1K0SA 5HURA 1A2UA 3S15H 1EWHA 1LO5D 1ET6A 2ZJRA 3HOYG 2VW9A 4LUVA 1CFMA 5C3EB 2A8VA 2EYJA 1JWMD 1QZHA 3PF4A 5M5YH 5CV7A 2NZ1D 2SOBA 3A7AB 1G8ZD 5ELDA 4OXPA 2NZOA 4DV6Q 2YV5A 3OTOL 1WTRA 3H3VC 3HOZG 3K5OA 1LTLA 1VQMA 1ILPA 1SNMA 4J15A 4JI8Q 4DR5Q 1EU4A 4FO2A 5KYIA 1JWSD 1VF7A 1N8RC 4DK6C 1A8VA 2ZXPA 1EYCA 4NKLA 2EOTA 3NQIA 2EPBA 3VR4A 3S1NH 1SFOH 5DM73 1CKNB 1E7ZA 1STHA 4A3FH 2V4DA 4TSSA 2I07B 3GTMH 4B3TQ 1IKMA 1H9MA 1VMPA 2IHFA 3K59A 3M4QA 1AZQA 3WOEA 1IBLL 2CWPA 1W6KA 3E9IA 5CV5A 1I3QB 4LFBL 2VNUD 3SK8A 3RZDH 3HOWG 2R3ZA 5CBAE 1Q86C 1TWFB 2F3WA 1KL9A 1XMQL 4A3IG 1H9SA 2I5LX 4MHEA 5M3FG 2F0FA 3SK5A 2K01A 2C9OA 2R7DA 5EAYA 5ELNA 4L5QA 4IFDI 3A8JE 1B4OA 1V8QA 5E4WC 2GA4B 2A69D 1R9TB 2B63B 5ISRA 1WD1A 2KECA 3QO2A 1YHQA 4ME3A 3CHBD 1WJJA 3C2PA 1PYSB 1RDPD 4XDXA 2K28A 3VA7A 5IP9G 1TY0A 4QL5A 4YWMA 1NR2A 2YU9B 1TS5A 1X55A 1AE2A 1B9NA 1JC7A 1GHKA 3MFGA 4R4OA 2L55A 1CT1D 3PO2B 5J3BA 2K33A 4A93G 2E5LQ 4DV4L 1CA6A 4X3UA 2KCCA 2X6GA 3CCLA 1DZ1A 4PMWA 1HR0Q 2JA5B 1O7IA 4ID6A 2PCFB 1JE4A 5LMNQ 3FHWA 4UHVA 3RMHA 1TU2B 2E2JH 5IT9L 3KLSA 4DR2Q 4IUPA 1Q46A 4QIWE 4ULLA 5CMDA 2PPBC 1NNXA 3T1HQ 3PF5A 1F9QA 5C0XG 4EVOA 2K04A 1ASYA 2KUMA 3GTPH 2SNSA 2DY8A 4G4KA 1WTVA 4HIKA 1I5FA 2QILA 4KHPQ 2E2IH 4Q0FA 4WJWA 1UE7A 4Z9CB 1XPOA 2QGQA 4HCSA 2VUMG 4CBVA 4JI4L 5FKAC 3CCSA 3QB3A 2R92H 3LNNA 2NTSA 5TSSA 5EQ0A 3TBIB 3UDFA 2BDOA 2DN8A 4RKLA 3TP5A 3WDNA 4KLKA 4C3JG 4DV3L 2NN6H 4YY3Q 2Z6KA 3QOJA 1QZGA 1VQEA 4A3GH 2FHTA 4C3HH 1OXTA 1YJ9A 2K6AA 3D31A 3TDQA 1RKNA 1YNJC 1DOKA 1UUPA 1ILQA 4A3KG 1TKWB 2I5MX 3D3RA 3S16H 4AQYQ 3RD4A 1M8AA 3K58A 4OIKA 2UXDQ 4YHHQ 4JI8L 4DR5L 2UUAQ 3W1BA 3QG1A 4KY7A 1JCKB 1A15A 2GVBA 3CMEA 1SRUA 1VQ6A 4BBRH 2R93H 1F9PA 5CV8A 2EYMA 3J80i 1E2WA 1AZPA 1Z47A 2VQFQ 1WTHA 1Y1VB 4CDFC 3IFDA 1GVPA 1PH4A 1PH2A 3KFUA 1ZKOA 1RHPA 2Z0SA 2C35B 3I91A 1DCZA 3ZYYX 5KNBA 1EIYB 1I6HB 1LV9A 3T1YL 1O80A 2WB1B 4TRDA 4HEDA 2NVYH 1I4QA 4B3RL 1A3VA 1EY4A 4OEMB 3PMFA 2MHVA 2PZUA 3KBGA 5A2QL 2HIXA 3AEVA 1M4VA 4R4TA 4LF7Q 3TN2A 3K5NA 1PH6A 2AQ2B 3NTHA 4KHVA 3T53B 1QVCA 4DK3C 1QVFA 2SDFA 4DGZA 1CA5A 3G6JB 1D5ZC 3KJPA 3M4PA 4OWTB 2JA6B 1L0XB 3A8KE 4U68A 1LT5D 3TZDA 4C3IG 3S1MB 3J80E 4Y7NB 1VQAA 3STBC 3ULJA 1Q1EA 2AUJD 3M9BA 1STBA 3I4MG 5M5WH 4A3JG 4YIJA 5GROA 1SNQA 5JEAH 4B3ML 3CRLC 4K5VA 1BQQT 3FEWX 1PYBA 2B2YC 3M7NA 1N32L 4JYAL 3S1RH 3S1QB 1DGSA 1XTCD 1AH9A 3I2ZA 1I6VC 5IWAL 4YWKA 1L1OC 2E5LL 3HOXG 5C3EH 2NVTB 2VZAA 1EIFA 5EKIA 3AU7A 2XWJB 2BE5D 2MGSA 4B9XA 1DOMA 4K2LA 3S2DH 2F0TA 1TWCB 4YCVA 4Y52H 4IOCA 3T1HL 4CKCA 4DNIA 1RD9D 1VDZA 2WFWA 4WORA 5ELBA 4ZK9B 3SK6A 2OT2A 5JPNC 4P74A 1NMGA 1JORA 2UU9L 3KF8A 1VQBA 4KHPL 2DNCA 4IPGA 3K6OA 4FF2A 3DXJC 1SN8A 1N36Q 2A6EC 2Z6BA 2CH4A 4X65Q 1G51A 4LF4L 2J7ZA 2VY3A 2WV6D 3D0FA 2X69A 5KGUA 1W6JA 3KDFA 1XNQQ 4XYQA 4YWLA 1ESFA 4JV5Q 3UDXA 1CZWA 3OW7A 1V1PA 4A3DB 3BVGA 1B3QA 2F0JA 4YY3L 3VR6A 2PO4A 1H9SB 5BN4A 4IN3A 2F0SA 4KV6A 3PO3H 2I46A 2N55A 1I3QH 1J5EQ 4L8JA 1P16A 3CQZB 4HIDA 1I94L 4GKJL 1LTID 3TS2A 4UAIA 4GOPB 5I6YA 1Q90A 1XPRA 4G57A 4HSPA 4GLXA 1AE3A 5IGFA 4FXKC 3WWVA 2BH8A 3LX0A 3ND8A 3HOVG 1IHZA 1X54A 1U4LA 3MTSA 4LNQA 1X3GA 4BY1H 3TZUA 4XQJA 1S5ED 2B2VA 3S17B 2IW3A 3GTJB 1X3EA 3I4NG 4Q5VA 3EN2A 1EEFD 1LT6D 2MFIA 4L6TB 5FLXE 4FXGC 1CZGA 3MXGA 3CC4A 2IHEA 2O4XA 3MFYA 2F0WA 1PH1A 1NBWA 2V1CC 5HY6A 1KHIA 4C56C 4QUCA 2Y0SB 4ILWA 3U50C 2KVMA 4H13C 1CSPA 2EYFA 1C48A 3UE1A 3M3YH 2RHQB 1TWGH 4R8NA 4M1UB 5K36G 1KDCA 3MXUA 3BVZA 2ID0A 3E6ZX 1VQFA 3HFZB 4OWXB 1R4PB 3GTLH 2RVLA 3FKIB 1PRTD 4I65A 5IYDG 2ZM6L 4L5TA 4RCOA 2LXKA 3AYHB 3I70A 5LMUL 2EZVA 1RIPA 2A1AA 1Q3LA 4APVA 2NVQH 4A3MB 1B8AA 2Z1CA 1UE5A 2NVXH 2HUGA 3EVQA 1CKNA 2WAQB 2F0NA 2AHOB 4FF3A 2QA4A 1BCPD 4J8QA 2ATWA 2ASBA 5IYBH 1KABA 4AYBG 3OMCA 1VQJA 1FGBD 1TXYA 1UAPA 3E0JA 1SR3A 1K8GA 5I2YA 3KYHC 2E2HB 4HMJA 1EU3A 4O1NA 3I56A 2PQEA 1FVIA 1K8OA 5IGBA 2R7FA 4NXMQ 4AYBE 1EFID 1EWCA 5EPJA 2K50A 4X65L 1SJHD 4CDCC 1TR5A 5T1IA 1VQIA 3R2IA 1GKHA 2CH4W 2CKZB 4LF9Q 4RGTA 3A7LA 3SXHA 1XNQL 4JV5L 4X64Q 2CVRA 1Z7TA 5KIXA 1PHJA 3K0XA 2R6GA 1L0WA 1SYGA 4PMBA 3BDOA 2EJFC 3I73A 4GKKQ 4BBSH 3AMUA 2WINB 2WACA 3TQYA 1DYQA 3GDEA 4ZRZA 1IBKQ 1IL2A 4NDXA 1ZYRD 1TQOA 2B8FA 4DK1A 5FO9B 2CW0D 3GD7A 2QDLA 4DUZQ 2EDGA 2L11A 1HUNA 4UP8A 3VR5A 1MKHA 1CTMA 1Y1WB 4P2CB 3J80L 3L2PA 5D3DA 4JG2A 3T56B 2O2LD 3PUZA 1JJCB 4RWSC 2HT1A 5I9PA 2H1EA 2LFNA 4LFAL 2N49A 5DNFA 1KDBA 1NMFA 1X3QA 4IO9A 1VQHA 1PFMA 2ES2A 4FXDA 1SMYD 5FOBB 1VQOA 3G48A 4AH6A 4QUFA 3HOYB 3S2HB 1K28A 2A6HD 2HDMA 3HOUH 1NUCA 3K5LA 2PQAB 1YVCA 1L2FA 1ENAA 1WCMB 1U4MA 3F2UA 3T13A 4DR6Q 4RCNA 4K8IA 4HSVA 4A3FG 3VDYA 3HOZB 3W1GA 1W3SA 2OTLA 1XNRL 3P20A 3TP8A 1PZKD 3KLWA 5FO7B 2NVTH 3CKIB 3KF8B 1BNZA 1BBXC 1XXGA 3OHXC 1V9PA 4IUTA 1JR0D 2B2UC 1Q82C 2ZTCA 4KKTA 1RF2D 3CRKC 1A62A 3I8ZA 1SNOA 3U58A 2WP8J 3U4VA 1IBML 1K3BC 4K0KL 3T16A 1HNXQ 5C44H 4O2DA 5CGKA 1JB7A 5M3MH 4K14A 3R2TA 5HGQA 2JJQA 2ZXRA 3HOWB 5JAVA 4L63B 1MSHA 4A3DH 3JC66 2F0KA 4A3IB 5M3FB 4LUOA 2KBNA 1GM5A 1TS4A 5IE8A 2JA8H 4CHTB 5JPMC 4DV5Q 4JOIA 2RKSA 1LT4D 4KD4A 4A3EH 1XYIA 3H3VI 3J7AF 3J81E 1A2TA 1VQGA 1A3UA 5KNDA 4K5WA 5M5XB 1SDFA 3D4RA 4DV7Q 1VF5C 4KKUA 3M4YA 2JK8A 2DY7A 2EY6A 5IT9c 5LL6S 4XT3B 4L5SA 3H0GG 4NMZA 4LF9L 4A3BH 1F2MA 5DAUA 3OW2A 4KJNA 2ZT9C 2ZTDA 2CWAA 2BA0A 2EYHA 2KEDA 3GO5A 4DV1Q 1PRTF 3MVVA 1KC8C 4QIWB 3S17H 4H7BA 4A93B 4FVMA 5FLXL 5H1SE 4JBKA 2TSSA 1WCMG 4CDDC 1CQFA 1BCPF 2EXDA 5C4XH 1K8AC 1IBKL 4CGYB 2R92G 2F0VA 3I4LA 2B3GA 1HFGA 1GO3E 2NN6G 2VXWA 2JEBI 4UDUC 2MQHA 1WTXA 1QVGA 4A3LH 4A3GG 4KY5A 4C3HG 3GTQH 4J1MA 1D5XC 1EL0A 4IPDA 2Q8RE 1L1OB 3PIOA 1TWHB 4RGNA 1NAPA 3NTKA 2VUMB 3MXNA 3OWFA 4C2MB 1IZ6A 4RGMA 5E7NA 3VYUA 3Q0AA 3S14B 2K7VA 1K73C 1G2TA 4A75A 3FKIH 4BA1I 1LM0A 2RDGA 4C3JB 4JI0L 2ZJPA 2ENBA 4WJ4A 3DEOA 3MEFA 1YNXA 2Z4IA 1VQLA 4A3MH 3JAME 4A3KB 4FF1A 1BVSA 3UDGA 1K0RA 1HCZA 1VQ5A 2Q2UA 1SBBB 4ALPA 1YNNC 3I7FA 4I7AA 2K05A 5JVH3 1K83B 3BVMA 1EIGA 1SAPA 2XIWA 4V190 4GLAC 4QB4A 1YITA 3H15A 2MPMA 5IGCA 1PH8A 1CHQD 1MD2D 2BOSA 4JBJA 2Z8LA 4BY7H 2IJ0A 3SGIA 1PLFA 2PMZE 4I7ZC 4H44C 5CR3A 2HCIA 3PCOB 3HRZC 2XSCA 1Y8PB 4GOPA 2C5CA 1BUVT 2AKWB 4LW1A 1EWIA 1XX8A 3OOCA 3OYYA 3FDTA 2K4KA 4BA2I 1BBWA 1F9SA 3CC2A 2IL8A 5ELOA 4K5XA 4LF6Q 1E22A 1IW7D 2NUCA 5C4JH 4X66Q 1WI5A 4L5RC 1C0AA 4NXNQ 3DHQA 4DR7Q 3NE5B 1D7QA 1STEA 5JEAG 2UUCQ 1D1IA 2BA1A 4FYDA 1PFNA 1Q7YC 2F4VL 1N34Q 4PQXA 5C3XA 1CK1A 3QIAA 2NYZD 3FP9A 1NE3A 4C3IB 1EFWA 2PW7A 3OIPA 1LABA 2L5TA 1SYCA 3OMGA 1QJOA 3I4MB 4A3JB 2R7ZG 1KRTA 3RZOH 4TKOB 2I0QA 4R9WA 2PZTA 1S5DD 1DJRD 4X6AH 2MJ8A 5BR8Q 3Q23A 1C4QA 2UXBQ 1KTKA 4EQNA 3F2DA 2DNEA 2OTJA 2A73B 1A0IA 4KN4C 3HOXB 2JA7G 4IFDH 1ICFB 2VQEQ 2E2DC 1FJGQ 4OX9Q 3D4WA 2JN4A 1I50H 1D5MC 4DV6L 4UY8C 2PYKA 2Q2HA 1LACA 3GV3A 3CCVA 1PTOB 1YIJA 3GTKB 1T5EA 1KLGD 2YTXA 4DR4Q 1BOSA 4DUYQ 4JI7Q 3NQTA 2F0PA 3DLLA 3PO3G 1QG7A 1X6OA 1PYWD 2EE1A 2PNRC 1PV4A 2O5IC 2AUKA 4IUUA 3QR8A 4HJAA 2A68D 2NB0A 1KLUD 4B3TL 2VB2X 3ZJYC 3A55A 1O7LA 4ZUIA 4BXXH 2JEAI 2FXQA 3M7GA 4LJZC 2ZTEA 3M4OB 5C0XI 3EIVA 3CD6A 1ESRA 4B3SQ 3HZXA 1YBYA 1HA6A 4DAMA 2N8NA 2OEOA 3J81j 4BY1G 3KF6B 4DV2Q 1X3PA 4OGQC 3RUZA 4N9PA 4JBWA 4A3IH 2KHIA 1HUMA 1AP0A 1PTOD 1I4XA 3J81L 5IGEA 5ELEA 4OHJA 2JSOA 1J9OA 2DUDA 2F0QA 3C46A 3ULPA 1K8MA 2ICIA 2FINB 3HOVB 5D3IB 3TS0A 1SE2A 3RNUA 4LWCA 5M5XH 3K7AB 4R4IA 5CV4A 1U9RA 1EEID 4CJ2C 1ZEQX 2F03A 3I4NB 3W5OA 3SR1A 3FPUB 2QCPX 3G71A 3IKJA 3OIQA 4X66L 1J6QA 1JMCA 2EVBA 1S40A 1PXUA
chains in the Genus database with same CATH topology
4QMGA 4KTAA 1ENCA 1GUWA 2J4XA 3FPPA 2RQXA 3OWEB 3C1FA 3PIP3 5IOCA 3L7ZC 2XRSD 3MAQA 2A69C 3H6MA 2F0MA 1BDOA 2FMMA 1VMCA 2M2LA 2KOLA 1RTOA 1D6EC 5NUCA 3DM1A 1JOQA 2F0LA 5J1ZA 1EQTA 4PNYA 4DA2A 1QB5D 2QF7A 2M9VA 3JAML 5CV9A 4HR7B 3E5SA 4AYBB 1G6ZA 1X32A 2G9HD 5EKLA 1SXTA 2Q8IB 5EPKA 4HCEA 3DMUA 5A35A 1F2ZA 1NSNS 3GV6A 2MUYA 5FK9C 3MZ5A 3NK9A 3UI2A 4XIGS 5JJZA 2O5JC 5IIFA 1B3AA 4F88A 2QEJC 4XXEA 4NP5A 3WOFA 2TMPA 1V43A 1Y8NB 1GXDC 3X3MA 1T5XD 5CBEE 1S5BD 1WTQA 3KUPA 4EQPA 3TP7A 1TWAB 5C4HA 2ZXOA 3S15B 1HFNA 2F0OA 3NPPA 2BDNA 4BWGB 2N88A 1BF4A 5M5YB 4KK7A 1G291 1SNPA 3K0YA 1S4ZA 5M9OA 1QNKA 1RTNA 4RA8A 1VCIA 4K6LA 2B2YA 1SYEA 1GHJA 2JE6I 1FNUA 2HCCA 1I4RA 3PV0A 3S1NB 1CI3M 1SEBD 2IWHA 4KI0A 2KJXA 2JYOA 4A3FB 1QWYA 4IFDJ 3GTMB 4IUVA 3PUWA 3RZDB 3M85A 1LTSD 3LWUA 1HQRD 1PTOH 1SE3A 4DXGA 3NUCA 5KYLA 3J7YW 1GUTA 4ODGA 1PTOF 1WTPA 1STNA 3HP3A 3GTGB 3TP6A 3T4AC 1PZID 3D8GA 1EYDA 4MIUA 4TQUS 4M8AA 4G7HC 5EBCA 3V96A 3I72A 2IX3A 2K1BA 3DWQA 1DXMA 3P75A 3T51B 2BE5C 4OO1G 5IODA 2JP1A 1FYCA 1E2ZA 3NWTA 4FP5D 3X3NA 4DF7A 1IL8A 1QE6A 1RODA 2OF1A 3H0GB 1EOTA 3VR3A 3DWAA 1PFBA 2E2JB 2EY1A 5KNCA 5JEAJ 4PMCA 1DD2A 1STYA 2K5WA 3GTPB 1F2YA 2IT1A 2QDBA 5I4DA 4WFN3 2M00A 4DXFA 2E2IB 1QCBD 5J39A 1ICWA 2X6LA 4QF4A 5CORA 2A74C 1KDAA 2RA4A 4XYOA 2R92B 4WRDA 4B08A 1KNAA 5IGGA 1JQYD 4A3GB 5E1FA 4C3HB 1LTTD 5DM63 1B50A 3S16B 1Q12A 2PZWA 1I4PA 2E76C 2OXPA 1GUNA 2R93B 3V2TA 2AQ3B 2R61A 3NTIA 1JOKA 4CKBA 5C5LA 3U9SA 5D14A 1EYAA 5E4XA 2PMZB 4RH6A 1QNUA 3L9AX 2H4OA 2NVYB 1PZJD 1RJTA 2XVSA 3A8IE 2B39A 2KA7A 1EZ6A 3TMEA 2KHSA 5D65A 4KMUC 1ONLA 2F0HA 1PRTC 2XRQD 4MN3A 3URYA 1TS3A 4FNFA 4IZ8A 1YNJD 2LKVA 2RSNA 1SNDA 4ME5A 2VB3X 1BCPC 1CM9A 4OL7A 5M5WB 1SYDA 1OXXK 3OSOA 4DNRB 3O13A 5KEEA 1NCVA 3A56A 5DEHA 3ONAB 2KEEA 4F87A 1HRJA 1JB3A 3SDZA 3S1RB 3I90A 1AW7A 2KCNA 2L0CA 1DONA 1EQVA 1S5CD 3HG9A 4IFDG 2R7ZB 5E3FA 3EFXD 3S2DB 4RHSA 2AWNA 4K2KA 1HTLD 3EQLC 5JVG3 1G2SA 2F0GA 2JA7B 2D62A 3LWEA 2L1BA 1F9RA 1SYBA 3SK4A 4RGOS 4DU9A 2J0TD 2B2UA 1ZYRC 2CW0C 1E0BA 1JOOA 3PO3B 1L0YB 1Z6HA 1SJED 3FRPB 2F0EA 3DWPA 1OXSC 2EJGC 4N9TA 3AB9A 1SMYC 4U673 1HTPA 1GUOA 2A6HC 4KJOA 4V0BA 1TY2A 2NN6I 1A3TA 3DUZA 1F2LA 4XQQA 1IKLA 1LLRD 4DAYA 2EY2A 4BY1B 2F1MA 3FMCA 5F2DA 3Q6SA 1WVLA 5EPLA 1FNWA 2XWBB 1I4HA 2A6ED 2CHBD 4E6IA 4H0LC 1EY8A 4IALA 1OO9B 1HHVA 2IPKD 2K5DA 1KNEA 3ND9A 3PUXA 2EY5A 4ZYSA 3DEPA 4RHRA 1FD7D 3M3YB 1TWGB 5CC4A 2WKDA 5JOBA 1EY6A 3GTLB 4EGVA 2NBFA 2QKIC 3GTOB 1TIID 3EA6A 3VA5A 2MP1A 3U9OA 1EZ8A 1MI2A 1V1OA 2NVQB 3Q24A 4CKEA 2NVXB 4RFBA 1II3A 1DOLA 1Y8OB 1Q1BA 3QJYA 3BDLA 4G7OC 1I4GA 3NBIA 3R93A 3EJIA 2D9UA 2EYLA 3PUYA 3BG3A 4DN4M 2L12A 1UEAB 2XN9C 1A6XA 4NW2A 5EBDA 1EY7A 2XNAC 1SE4A 3PUVA 1STGA 1F77A 1MSGA 4PV1C 3NP8A 4LMQD 5CV6A 5EGTA 3NHHA 4LK1C 2F0IA 1S5FD 1LTAD 3A54A 2EXZA 5LHY1 4BBSB 2K32A 2B2VC 1B9MA 3EROA 4HTHA 1D1KA 1STAA 2L4NA 4XT1B 4XTCS 1QILA 2WIIB 2SNMA 2D2CC 2A5HA 3HKZB 5FO8B 3K57A 2PW5A 4OIJA 3HOUB 3QOLA 4ZUJA 1ENFA 4ZAIA 4GZYC 3RLFA 3ITPA 5C0XH 4CJ0B 3FVQA 1BR9A 1O7YA 2EYOA 3IL8A 5G3LD 1OXUA 3V05A 1C8CA 5BN5A 1NR4A 1IW7C 3R3OA 3MWYW 4JK1C 1U4RA 3IAYA 1Q8IA 1B1ZA 4KKSA 3R8BA 5ELCA 3W2DA 5C44B 2F0DA 5M3MB 4LAAA 1AEXA 1EIHA 4S3SA 2F0UA 1ET9A 3NXWA 4XQNA 4K6DA 3PIO3 1LTRD 2JA8B 3MEHA 1WD0A 3MC0B 2EJMA 4A3EB 4X3TA 1BXTA 1IYVA 1LT3D 4ABNA 1WTWA 1IYUA 4F8MA 5ELFA 1PMRA 4A3BB 5C3WA 1PRTB 3CU7A 1J8IA 1H9JA 2YYZA 2RSOA 4RKBA 1LTGD 2NWGA 4C1NK 2HQEA 1BCPB 3L3OC 1G91A 3BS1A 2A68C 1WTOA 5C4XB 1SNCA 1E2VA 1D2BA 2SEBD 1UNSA 5C5MA 4BS9A 2B2TC 3GTQB 4X3KA 4QCLA 2LS01 2AWOA 3NWSA 2D5DA 3NSWA 4KD3A 1SFOB 3ERQA 1SSOA 3KBXA 1B44D 1HPCA 1TVXA 1ML0D 3Q22A 1EY0A 4DAPA 3MHBA 4F7XA 1PTOC 2B2WC 1SYFA 3VYRA 3C3LA 1KAAA 4KHZA 1XWEA 1H9KA 3S9WA 1Y69U 2IX1A 4BY7B 5C6AA 2KQ3A 1CQVA 4ZKBB 1PDQA 5CYUA 3GP7A 3GQBA 5K5PA 1GJXA 4HN7A 1HA5A 2FJ2A 2NTTA 4RAUC 5C4JB 2G9DA 2ICEC 1U4PA 2BCOA 1RCVD 1QOHA 3N52A 5BN3A 2FMCA 3SHLA 1CHPD 3BYTB 5EJWA 2K03A 2FFKB 1GUSA 5KRUA 1JICA 3C1EA 3J7AV 1OXVA 2LY7A 1FNVA 3VYTA 4KY6A 3N6RA 2Q8TA 1YNND 2RBMA 1TS2A 2LMCB 3P7JA 1HQMC 3G7LA 2WKCA 5G3LF 1HXYD 5IT9E 3RZOB 3MA2B 4C1NI 1EY5A 3KLSX 2E74C 4EQOA 4DAVA 2Z4HA 1GUGA 3SE0A 4B9WA 1AFPA 2E75C 4HMIA 3K5MA 1TT2A 3HEJA 2RDHA 3SEBA 1I50B 1R4QB 4DNTB 4IUQA 2B8GA 3MXPA 2F4IA 3P1HA 4ZLTF 5K36H 4KN7C 2B2TA 4HAEA 3NBHA 4OO1I 4ZKCB 2RDFA 5C0XJ 3H91A 1O78A 2HDLA 4BBRB 2F3VA 5C4ZA 5IGDA 3VYSA 2IX0A 1MBYA 1FR3A 3KLRA 3QWNA 2B2WA 1B2TA 1AN8A 5I2XA 5T1GA 3OPOA 3D6WA 1V1PB 3KK7A 1ZXTA 3TSSA 2EYPA 3SVMA 4CJ1B 2JXMB 2K5QA 2AQ1B 3W3AA 5LL6X 1H9RA 4IUNA 5AFWA 4G7ZC 4IURA 1GOZA 5HGTA 5A2QE 3IFTA 2L9HA 1O7ZA 5J22A 4FF4A 4X3SA 1JWUD 1BO0A 2CQAA 4R8IA 3D4DA 3HGBA 4DK0A 4J6HA 3HS0C 4ZQ3A 5EKKA 1B53A 3H94A 3D6CA 1MGSA 1LTBD 4O42A 4IQZA 3BDCA 3BYYB 1EY9A 3VR2A 3I3CA 3H09A 5COYA 5I9OA 4DFAA 4K8JA 5I6WA 1DM0B 4OO1H 3BZDB 5HURA 1A2UA 1EWHA 1LO5D 1ET6A 1CFMA 5C3EB 2EYJA 1JWMD 5CV7A 2NZ1D 2SOBA 3A7AB 1G8ZD 5ELDA 1WTRA 3H3VC 3K5OA 1ILPA 1SNMA 1EU4A 4FO2A 5KYIA 1JWSD 1VF7A 2ZXPA 1EYCA 4NKLA 2EOTA 3NQIA 2EPBA 3VR4A 5DM73 1STHA 2V4DA 4TSSA 2I07B 1IKMA 1H9MA 1VMPA 3K59A 1AZQA 3WOEA 1W6KA 5CV5A 1I3QB 2VNUD 3SK8A 2R3ZA 5CBAE 1TWFB 2F3WA 1H9SA 4MHEA 2F0FA 3SK5A 2K01A 2C9OA 4IFDI 3A8JE 1B4OA 1V8QA 5E4WC 2GA4B 2A69D 1R9TB 2B63B 5ISRA 1WD1A 2KECA 3QO2A 3CHBD 3C2PA 1RDPD 4XDXA 2K28A 3VA7A 1TY0A 1NR2A 2YU9B 1TS5A 1B9NA 1JC7A 1GHKA 3MFGA 2L55A 1CT1D 3PO2B 2K33A 1CA6A 4X3UA 2KCCA 2X6GA 1DZ1A 4PMWA 2JA5B 4ID6A 2PCFB 1JE4A 3RMHA 1TU2B 5IT9L 3KLSA 4IUPA 4ULLA 5CMDA 2PPBC 1F9QA 5C0XG 4EVOA 2K04A 2KUMA 2SNSA 2DY8A 4G4KA 1WTVA 2QILA 4Q0FA 4WJWA 4Z9CB 4HCSA 4CBVA 5FKAC 3QB3A 3LNNA 2NTSA 5TSSA 5EQ0A 3TBIB 2BDOA 2DN8A 4RKLA 3TP5A 3WDNA 4C3JG 2NN6H 3QOJA 2FHTA 1OXTA 2K6AA 3D31A 3TDQA 1RKNA 1YNJC 1DOKA 1UUPA 1ILQA 1TKWB 3D3RA 3RD4A 1M8AA 3K58A 4OIKA 3QG1A 4KY7A 1A15A 1JCKB 1F9PA 5CV8A 2EYMA 1E2WA 1AZPA 1Z47A 1Y1VB 3IFDA 1ZKOA 1RHPA 3I91A 1DCZA 3ZYYX 5KNBA 1I6HB 1LV9A 1O80A 2WB1B 4TRDA 4HEDA 1I4QA 1A3VA 1EY4A 3PMFA 2MHVA 2PZUA 3KBGA 5A2QL 1M4VA 3TN2A 3K5NA 2AQ2B 3NTHA 4KHVA 3T53B 2SDFA 4DGZA 1CA5A 3G6JB 1D5ZC 2JA6B 1L0XB 3A8KE 4U68A 1LT5D 3TZDA 4C3IG 3S1MB 3J80E 4Y7NB 1Q1EA 2AUJD 1STBA 4YIJA 1SNQA 5JEAH 3CRLC 4K5VA 1BQQT 3FEWX 2B2YC 3M7NA 3S1QB 1XTCD 1I6VC 2NVTB 5EKIA 3AU7A 2XWJB 2BE5D 2MGSA 4B9XA 1DOMA 4K2LA 2F0TA 1TWCB 4CKCA 1RD9D 1VDZA 5ELBA 4WORA 4ZK9B 3SK6A 2OT2A 5JPNC 1JORA 3KF8A 2DNCA 3K6OA 4FF2A 3DXJC 2A6EC 2J7ZA 2WV6D 2X69A 5KGUA 1W6JA 4XYQA 1ESFA 1CZWA 3OW7A 1V1PA 4A3DB 3BVGA 2F0JA 3VR6A 2PO4A 1H9SB 5BN4A 4IN3A 2F0SA 4KV6A 2I46A 2N55A 4L8JA 3CQZB 1LTID 4UAIA 5I6YA 1Q90A 4G57A 4HSPA 5IGFA 4FXKC 3LX0A 3ND8A 1IHZA 1U4LA 3MTSA 3TZUA 4XQJA 1S5ED 2B2VA 3S17B 2IW3A 3GTJB 4Q5VA 1EEFD 1LT6D 4L6TB 5FLXE 4FXGC 1CZGA 3MXGA 2O4XA 3MFYA 2F0WA 4C56C 4QUCA 2Y0SB 4ILWA 2KVMA 4H13C 2EYFA 1C48A 4R8NA 4M1UB 5K36G 1KDCA 3BVZA 3E6ZX 2ID0A 3MXUA 1R4PB 2RVLA 3FKIB 1PRTD 4I65A 4RCOA 2EZVA 3I70A 1Q3LA 4A3MB 2Z1CA 2HUGA 3EVQA 2WAQB 2F0NA 4FF3A 1BCPD 4J8QA 1KABA 3OMCA 1FGBD 1UAPA 3E0JA 5I2YA 2E2HB 4HMJA 1EU3A 4O1NA 2PQEA 1K8OA 5IGBA 1EFID 1EWCA 5EPJA 1SJHD 1TR5A 5T1IA 3R2IA 4RGTA 3A7LA 3SXHA 2CVRA 1Z7TA 5KIXA 2R6GA 1SYGA 4PMBA 3BDOA 2EJFC 3I73A 3AMUA 2WINB 2WACA 1DYQA 4ZRZA 4NDXA 1ZYRD 1TQOA 2B8FA 4DK1A 5FO9B 2CW0D 3GD7A 2EDGA 2L11A 1HUNA 3VR5A 1Y1WB 1CTMA 4P2CB 3J80L 5D3DA 3T56B 2O2LD 3PUZA 4RWSC 5I9PA 2H1EA 2LFNA 5DNFA 1KDBA 1X3QA 1PFMA 4FXDA 1SMYD 5FOBB 3HOYB 4QUFA 3S2HB 2A6HD 2HDMA 1NUCA 3K5LA 1ENAA 1WCMB 1U4MA 3F2UA 3T13A 4RCNA 4K8IA 4HSVA 3HOZB 3P20A 3TP8A 1PZKD 5FO7B 3CKIB 1BNZA 1BBXC 1XXGA 3OHXC 4IUTA 1JR0D 2B2UC 4KKTA 1RF2D 3CRKC 3I8ZA 1SNOA 2WP8J 3T16A 5CGKA 4K14A 3R2TA 2ZXRA 3HOWB 5JAVA 4L63B 1MSHA 2F0KA 4A3IB 5M3FB 1TS4A 5JPMC 4CHTB 2RKSA 1LT4D 4KD4A 1XYIA 3J7AF 3J81E 1A2TA 1A3UA 5KNDA 4K5WA 5M5XB 1SDFA 3D4RA 1VF5C 4KKUA 3M4YA 2DY7A 2EY6A 5LL6S 4XT3B 4NMZA 1F2MA 5DAUA 4KJNA 2ZT9C 2BA0A 2EYHA 2KEDA 3GO5A 1PRTF 3MVVA 4QIWB 4H7BA 4A93B 4FVMA 5FLXL 2TSSA 1CQFA 1BCPF 4CGYB 2F0VA 3I4LA 1HFGA 2NN6G 2VXWA 2JEBI 4UDUC 1WTXA 4KY5A 4C3HG 4J1MA 1D5XC 1EL0A 2Q8RE 1TWHB 4RGNA 1NAPA 3NTKA 2VUMB 3MXNA 3OWFA 4C2MB 4RGMA 3VYUA 3Q0AA 3S14B 2K7VA 1G2TA 4BA1I 2RDGA 4C3JB 2ENBA 3DEOA 2Z4IA 3JAME 4A3KB 4FF1A 1HCZA 1SBBB 1YNNC 2K05A 5JVH3 1K83B 3BVMA 1EIGA 1SAPA 2XIWA 4V190 4QB4A 2MPMA 5IGCA 1CHQD 1MD2D 2BOSA 2Z8LA 2IJ0A 1PLFA 4I7ZC 4H44C 5CR3A 2HCIA 3HRZC 2XSCA 1Y8PB 2C5CA 1BUVT 1XX8A 3OOCA 3FDTA 4BA2I 1F9SA 2IL8A 4K5XA 1IW7D 2NUCA 3DHQA 3NE5B 1STEA 5JEAG 1D1IA 2BA1A 4FYDA 1PFNA 4PQXA 5C3XA 1CK1A 3QIAA 2NYZD 4C3IB 2PW7A 3OIPA 1LABA 2L5TA 1SYCA 3OMGA 1QJOA 3I4MB 4A3JB 4TKOB 4R9WA 2PZTA 1S5DD 1DJRD 2MJ8A 3Q23A 1C4QA 1KTKA 4EQNA 2DNEA 2A73B 3HOXB 4KN4C 4IFDH 2E2DC 3D4WA 1D5MC 2PYKA 1LACA 3GV3A 1PTOB 3GTKB 1T5EA 1KLGD 1BOSA 3NQTA 2F0PA 1QG7A 1PYWD 2EE1A 2PNRC 2O5IC 2AUKA 4IUUA 2A68D 2NB0A 1KLUD 2VB2X 3A55A 1O7LA 4ZUIA 2JEAI 3M7GA 4LJZC 3M4OB 5C0XI 1ESRA 3HZXA 1HA6A 2OEOA 1X3PA 4OGQC 3RUZA 4N9PA 4JBWA 1HUMA 1AP0A 1PTOD 1I4XA 3J81L 5IGEA 5ELEA 4OHJA 2JSOA 1J9OA 2F0QA 3C46A 1K8MA 2ICIA 2FINB 3HOVB 5D3IB 1SE2A 3K7AB 5CV4A 1U9RA 1EEID 4CJ2C 1ZEQX 2F03A 3I4NB 3SR1A 3FPUB 2QCPX 3IKJA 3OIQA 2EVBA 1PXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9P A;  2J7Z A;  1WTW A;  2X69 A;  2FJ2 A;  1GUW A;  1BNZ A;  4RAU C;  4MHE A;  1NAP A;  1BBX C;  1AZP A;  1NCV A;  1S4Z A;  4IUT A;  1QNK A;  1RTN A;  2B2U C;  2L4N A;  4RA8 A;  5AFW A;  1HHV A;  3IFD A;  1G2T A;  2K01 A;  4IUR A;  1U4P A;  2KEE A;  3ONA B;  4XT1 B;  2B2Y A;  1RHP A;  1KNE A;  3N52 A;  1J8I A;  3I91 A;  1HRJ A;  3DEO A;  2L9H A;  1B4O A;  3I90 A;  4X3S A;  1O7Z A;  5E4W C;  5EJW A;  3DEP A;  2K03 A;  2FFK B;  2HCC A;  1ICW A;  2RSO A;  2X6L A;  3GV3 A;  2N55 A;  3I8Z A;  1BO0 A;  1JIC A;  1LV9 A;  1O80 A;  5COR A;  4HED A;  2KEC A;  2RA4 A;  3QO2 A;  2FMM A;  4R8I A;  1WD1 A;  1VMC A;  2M2L A;  2KOL A;  1RTO A;  1B53 A;  2NWG A;  1KNA A;  3DM1 A;  2JYO A;  1MGS A;  2K05 A;  2K28 A;  4XDX A;  5EPJ A;  2Q8T A;  4OIJ A;  1QG7 A;  4O42 A;  4UAI A;  5T1I A;  1NR2 A;  2EE1 A;  1G91 A;  1EQT A;  1EIG A;  3I3C A;  3P7J A;  1WTO A;  1SAP A;  2XIW A;  5COY A;  1MSH A;  2MP1 A;  4IUU A;  3G7L A;  1B50 A;  3TN2 A;  1MI2 A;  2CVR A;  1EL0 A;  2MPM A;  4IUV A;  4ZAI A;  1G2S A;  2SDF A;  1G6Z A;  1CA5 A;  1CA6 A;  1X32 A;  2B2T C;  1U4L A;  3MTS A;  4X3U A;  1PLF A;  2X6G A;  3LWE A;  4X3K A;  1DZ1 A;  2L1B A;  1XYI A;  1F9R A;  2B2V A;  2HCI A;  4U68 A;  5EPK A;  3TZD A;  1DOL A;  4CJ0 B;  1JE4 A;  1O7Y A;  3IL8 A;  1BF4 A;  1WTP A;  1ESR A;  1C8C A;  1SSO A;  3HP3 A;  3KBX A;  1XX8 A;  1SDF A;  3R93 A;  1TVX A;  1HA6 A;  3FDT A;  1ML0 D;  1NR4 A;  2NZ1 D;  2B2U A;  4IUP A;  1F9S A;  2D9U A;  2DY7 A;  2IL8 A;  5CMD A;  3GV6 A;  4XT3 B;  1E0B A;  3MWY W;  5D14 A;  1F9Q A;  1U4R A;  1X3P A;  2K04 A;  2KUM A;  4IUQ A;  5E4X A;  1WTR A;  4ZLT F;  2DY8 A;  2B2Y C;  2B2W C;  2L11 A;  2L12 A;  4DN4 M;  1HUM A;  3UI2 A;  1WTV A;  1ILP A;  2B2T A;  1AP0 A;  1HUN A;  4NW2 A;  4QUC A;  4HAE A;  2KED A;  5JJZ A;  4ZKC B;  1J9O A;  2KVM A;  1RJT A;  3H91 A;  1B3A A;  2K1B A;  4HCS A;  2HDL A;  2EOT A;  4RWS C;  2EPB A;  2H1E A;  1MSG A;  1PFN A;  5DNF A;  2FIN B;  1X3Q A;  5EQ0 A;  1EIH A;  5EKI A;  1PFM A;  5D65 A;  2MGS A;  4QUF A;  4LMQ D;  1DOM A;  2JP1 A;  2RVL A;  2NYZ D;  2HDM A;  4CJ2 C;  5CBE E;  2FHT A;  4MN3 A;  2B2W A;  1B2T A;  1WTQ A;  1F2L A;  1IKM A;  1VMP A;  1DOK A;  3KUP A;  3FPU B;  5T1G A;  1ILQ A;  1IL8 A;  3D6W A;  1IKL A;  1Q3L A;  1AZQ A;  1QE6 A;  2RSN A;  4ZK9 B;  1U4M A;  1ZXT A;  2Q8R E;  3F2U A;  1ROD A;  1M8A A;  1HFG A;  4R9W A;  1PDQ A;  4OIK A;  4X3T A;  4ZKB B;  1WD0 A;  4HSV A;  2VXW A;  1HFN A;  2MJ8 A;  3Q6S A;  3SVM A;  1WVL A;  2N88 A;  4CJ1 B;  2HUG A;  2BDN A;  1EOT A;  1WTX A;  2R3Z A;  5EPL A;  5CBA E;  1A15 A;  1CM9 A;  1DON A;  1PFB A;  2B2V C; 
#chains in the Genus database with same CATH topology
 4QMG A;  4KTA A;  1HR0 L;  1ENC A;  1GUW A;  2J4X A;  3FPP A;  2RQX A;  2HHH Q;  4JI5 Q;  2PQA A;  5LMN L;  3K81 C;  3OWE B;  1WFQ A;  3C1F A;  3PIP 3;  1N34 L;  5IOC A;  2YTV A;  3L7Z C;  2XRS D;  4DR2 L;  1YEZ A;  3MAQ A;  2P5Z X;  2LSS A;  1C9O A;  2A69 C;  3MXN B;  2GVA A;  3H6M A;  2F0M A;  1BDO A;  2K14 A;  2I5H A;  5IYB G;  1WOC A;  2FMM A;  4RMF A;  1VMC A;  2DJG C;  2M2L A;  2KOL A;  1RTO A;  1D6E C;  3G4S A;  3K8A A;  5NUC A;  1EQR A;  2K5N A;  3DM1 A;  1CSQ A;  3TEH B;  1EUJ A;  1TWH H;  1JOQ A;  2F0L A;  4R4Q A;  5J1Z A;  1EQT A;  2HIV A;  4PNY A;  2D0O A;  1OTC A;  4DA2 A;  1QB5 D;  2QF7 A;  2M9V A;  1VQP A;  3JAM L;  2HQL A;  5CV9 A;  4HR7 B;  2K75 A;  3E5S A;  4AYB B;  1G6Z A;  4IOA A;  1X32 A;  2G9H D;  5EKL A;  1SXT A;  1YI2 A;  4AQY L;  4ZCK A;  2Q8I B;  5EPK A;  4A3K H;  2UXD L;  4YHH L;  4HCE A;  3DMU A;  5A35 A;  2UUA L;  4DUY L;  1TWF H;  4JI7 L;  1CUK A;  4LF8 Q;  1F2Z A;  4HIM A;  1NSN S;  3GV6 A;  2MUY A;  5FK9 C;  3TRE A;  3MZ5 A;  3NK9 A;  4BBS G;  2VQF L;  1W2B A;  3UI2 A;  4GN3 B;  4XIG S;  5JJZ A;  2O5J C;  5IIF A;  1R9T H;  1HZ9 A;  4DAY B;  2B63 H;  1B3A A;  3J80 c;  4F88 A;  2QEJ C;  4XXE A;  4NP5 A;  3WOF A;  2TMP A;  4IJL A;  5AJ3 Q;  1N9W A;  1V43 A;  1Y8N B;  1GXD C;  3X3M A;  4MZ9 A;  1T5X D;  5CBE E;  4B3S L;  1S5B D;  3HKZ G;  2YU9 H;  1WTQ A;  3KUP A;  4EQP A;  2UXC Q;  3TP7 A;  1TWA B;  4LF7 L;  5C4H A;  4DV2 L;  1N33 Q;  2AMC B;  2ZXO A;  4WJ3 M;  3S15 B;  1HFN A;  3PO2 H;  2F0O A;  3NPP A;  3HOU G;  2BDN A;  4BWG B;  2N88 A;  1BF4 A;  5M5Y B;  2JA5 H;  3I55 A;  4KK7 A;  1G29 1;  3HKZ E;  1SNP A;  1HZA A;  3K0Y A;  4NB3 A;  4JVZ A;  1KQS A;  1S4Z A;  5M9O A;  1QNK A;  1RTN A;  4RA8 A;  4C3I H;  1VCI A;  4K6L A;  4OWW B;  2B2Y A;  1SYE A;  1GHJ A;  2JE6 I;  1FNU A;  1KAW A;  2HCC A;  1I4R A;  5FJ8 H;  1L1O A;  3CPW A;  3PV0 A;  1KXL A;  3S1N B;  1CI3 M;  4IJH A;  1SEB D;  2IWH A;  1HR0 W;  4KI0 A;  2KJX A;  2JYO A;  4A3F B;  1QWY A;  5GAE C;  1VQ4 A;  2HD3 A;  4IFD J;  3GTM B;  4JI5 L;  1HNW Q;  5C44 G;  4IUV A;  3PUW A;  5M3M G;  4GNX C;  3RZD B;  3M85 A;  5IY0 A;  1LTS D;  3LWU A;  1HQR D;  1PTO H;  2QEX A;  1SE3 A;  3F2B A;  4DXG A;  3NUC A;  5KYL A;  3J7Y W;  1GUT A;  4ODG A;  4PZ8 A;  4UPA A;  1PTO F;  1WTP A;  1FGU A;  1STN A;  1S3O A;  3HP3 A;  3GTG B;  4HIO A;  1X3F A;  3LGJ A;  1N36 L;  3BZC A;  2UUB Q;  1HH2 P;  3TP6 A;  2JA8 G;  3T4A C;  1PZI D;  4A3E G;  5IP7 H;  3D8G A;  1EYD A;  4MIU A;  1Y1V H;  4TQU S;  4M8A A;  4G7H C;  5JJL A;  4R1J A;  3K7U C;  3RR5 A;  5EBC A;  3V96 A;  3I72 A;  2IX3 A;  2K1B A;  3DWQ A;  1I6H H;  1DXM A;  1VQC A;  3P75 A;  3T51 B;  4HJ7 A;  2BE5 C;  1J5E L;  4A3B G;  4DKA C;  2KEN A;  3RN2 A;  4OO1 G;  5IOD A;  5FLX c;  1UE6 A;  2JP1 A;  1FYC A;  1E2Z A;  4LFC Q;  1YHB A;  3NWT A;  1ASZ A;  4FP5 D;  5GQO A;  2MO1 A;  1QUQ B;  3Q8D A;  1IL8 A;  3X3N A;  4DF7 A;  1QE6 A;  1ROD A;  1BKB A;  2OF1 A;  3H0G B;  1EOT A;  3VR3 A;  3DWA A;  4YCW A;  1PFB A;  5C4X G;  2JA6 H;  2E2J B;  3S1M H;  1VQK A;  3OTO Q;  3A5U A;  2EY1 A;  5KNC A;  4Y7N H;  5AJ3 L;  5JEA J;  4PMC A;  1DD2 A;  1STY A;  2K5W A;  3GTP B;  4A3L G;  1F2Y A;  2IT1 A;  2QDB A;  5I4D A;  4WFN 3;  1HNZ Q;  2M00 A;  4HJ9 A;  3I4N H;  4DXF A;  2E2I B;  1QCB D;  2CQO A;  5J39 A;  1ICW A;  2X6L A;  4QF4 A;  5COR A;  3S1Q H;  2A74 C;  1KDA A;  2RA4 A;  4XYO A;  2R92 B;  4UP7 A;  4WRD A;  4B08 A;  1KNA A;  5IGG A;  1EOV A;  1JQY D;  4A3C H;  3J81 i;  4X62 Q;  4A3G B;  5E1F A;  4C3H B;  2RCF A;  1LTT D;  2K5V A;  5DM6 3;  3TRZ A;  2XTI A;  1B50 A;  1IBL Q;  1TWC H;  3S16 B;  1VS0 A;  1Q12 A;  4LFB Q;  2PZW A;  1XPU A;  1I4P A;  2E76 C;  2OXP A;  1GUN A;  5IYD H;  3CP0 A;  2R93 B;  1XMQ Q;  3V2T A;  1X65 A;  2AQ3 B;  2R61 A;  2L15 A;  3NTI A;  1JOK A;  1S72 A;  4BY7 G;  1SMX A;  4CKB A;  5C5L A;  3U9S A;  5D14 A;  1EYA A;  5E4X A;  2PMZ B;  4RH6 A;  1QNU A;  2Z9H A;  4GNX A;  3L9A X;  2GN5 A;  2H4O A;  2NVY B;  1PZJ D;  1IXR A;  1RJT A;  2XVS A;  3A8I E;  2B39 A;  2KA7 A;  1XJV A;  3CCJ A;  1EZ6 A;  3F2C A;  4PZ7 A;  3TME A;  2KHS A;  4GN4 B;  3RLN A;  1PFS A;  1E1T A;  3CQZ H;  3KF6 A;  5D65 A;  4NXM L;  1UE1 A;  1ONL A;  4KMU C;  2F0H A;  1PRT C;  1XMO Q;  1E3P A;  2XRQ D;  4MN3 A;  3URY A;  1Q8K A;  1TS3 A;  3K80 C;  1Y14 B;  4FNF A;  4IZ8 A;  1YNJ D;  2LKV A;  2RSN A;  4X64 L;  1SND A;  4ME5 A;  4UP9 A;  1PH9 A;  2VB3 X;  1BCP C;  1CM9 A;  2G5D A;  3JAM i;  4OL7 A;  3GTJ H;  5M5W B;  1SYD A;  1OXX K;  3OSO A;  4GS3 A;  3O13 A;  4DNR B;  1FL0 A;  4GKK L;  4DR1 Q;  1D8L A;  5KEE A;  1NCV A;  2D0P A;  3A56 A;  4R4C A;  2RF4 A;  5DEH A;  3ONA B;  2CFM A;  2KEE A;  3DM3 A;  4F87 A;  1HRJ A;  1JB3 A;  3SDZ A;  3S1R B;  3I90 A;  1AW7 A;  1TWA H;  2KCN A;  2L0C A;  4JI4 Q;  1DON A;  1EQV A;  4IPH A;  4DUZ L;  1S5C D;  1VQN A;  3HG9 A;  4IFD G;  2R7Z B;  4DV3 Q;  5E3F A;  2KCM A;  3BZK A;  3EFX D;  3S2D B;  4RHS A;  2Z6K C;  4EQ5 A;  2AWN A;  4EX5 A;  4K2K A;  1HTL D;  4BBR G;  1HNZ L;  2R93 G;  3EQL C;  5JVG 3;  3CC7 A;  2Q2T A;  1G2S A;  2F0G A;  2JA7 B;  2D62 A;  4N8X 1;  3H3V H;  1JJ2 A;  2PNH A;  2VL6 A;  3LWE A;  3J7Z C;  5IYC H;  2L1B A;  1F9R A;  4DR6 L;  1SYB A;  3SK4 A;  2N3S A;  4RGO S;  4DU9 A;  4JI1 Q;  2J0T D;  1HZC A;  3STB D;  2B2U A;  1ZYR C;  4X62 L;  4BXX G;  2CW0 C;  1E0B A;  1C7Y A;  1JOO A;  1A63 A;  3PO3 B;  3T1Y Q;  2EQS A;  1L0Y B;  1Z6H A;  1SJE D;  3FRP B;  2E2H H;  4JBM A;  2F0E A;  4B3R Q;  5GAH C;  3U4Z A;  3DWP A;  3J81 c;  1OXS C;  2EJG C;  4N9T A;  3AB9 A;  4P71 A;  4LF5 Q;  1SMY C;  4U67 3;  1HTP A;  1GUO A;  2QW7 A;  1HNX L;  2A6H C;  4KJO A;  3BJU A;  3GTG H;  2VS1 A;  4V0B A;  1TY2 A;  3CCE A;  2NN6 I;  1A3T A;  3DUZ A;  1F2L A;  4P73 A;  4XQQ A;  1IKL A;  2A19 A;  1LLR D;  4DAY A;  2EY2 A;  3CPF A;  4BY1 B;  4MNO A;  2F1M A;  3FMC A;  5F2D A;  1KD1 C;  3Q6S A;  1WVL A;  1MHW C;  5EPL A;  1FNW A;  2XWB B;  4DV5 L;  3KJO A;  1I4H A;  2A6E D;  3A5Z B;  4QY7 A;  4B3M Q;  2CHB D;  4E6I A;  4H0L C;  4OEL B;  1JE5 A;  1EY8 A;  4IAL A;  1OO9 B;  5JJK A;  1HHV A;  1N32 Q;  4DV7 L;  2IPK D;  4JYA Q;  1XMO L;  2K5D A;  1KNE A;  2PI2 E;  3ND9 A;  5FLM H;  5IWA Q;  3PUX A;  1P8L A;  5C3E G;  4DV0 Q;  2EY5 A;  1EQQ A;  4ZYS A;  3DEP A;  4O0A A;  3F1Z A;  4RHR A;  1FD7 D;  3H0G H;  3M3Y B;  1Y1W H;  1TWG B;  5CC4 A;  5L37 A;  2KCT A;  4DV1 L;  2WKD A;  2CCZ A;  5JOB A;  1EY6 A;  3GTL B;  4EGV A;  1SLJ A;  2NBF A;  1B7Y B;  2QKI C;  1CKM A;  3UDI A;  3GTO B;  3HOY H;  1TII D;  3EA6 A;  3S2H H;  3VA5 A;  2MP1 A;  4DR1 L;  3U9O A;  1WYD A;  1EZ8 A;  1MI2 A;  1V1O A;  4OON A;  1Z9F A;  2NVQ B;  3Q24 A;  1BBU A;  2UU9 Q;  2B29 A;  4CKE A;  2NVX B;  1HJP A;  2K52 A;  3JAM c;  1MIU A;  4RFB A;  4LF4 Q;  1WCM H;  1RL2 A;  1II3 A;  1DOL A;  3HOZ H;  3G6E A;  1Y8O B;  1Q1B A;  3NBH B;  1M90 C;  3PSI A;  3RN5 A;  3QJY A;  3BDL A;  4YCU A;  4G7O C;  1I4G A;  3L0O A;  3NBI A;  3CW2 C;  3R93 A;  1YJW A;  1IYJ B;  1K9M C;  3EJI A;  2D9U A;  2EYL A;  3EBE A;  1JT8 A;  3PUY A;  3BG3 A;  3CCU A;  4DN4 M;  2L12 A;  1UEA B;  2XN9 C;  1A6X A;  4NW2 A;  5EBD A;  1EY7 A;  2XNA C;  1SE4 A;  4HJ5 A;  4JW0 A;  5GAD C;  3PUV A;  1STG A;  1I94 Q;  1F77 A;  4GNX B;  4GKJ Q;  4MTK A;  1MSG A;  1PH3 A;  1UEB A;  4PV1 C;  1EYG A;  1LYL A;  3NP8 A;  4LMQ D;  5CV6 A;  1YJN A;  4GN5 A;  4JI1 L;  5EGT A;  3HOW H;  1MJC A;  3PGZ A;  2B63 G;  4FDB A;  2DGY A;  5GAG C;  3NHH A;  4LK1 C;  2F0I A;  4JI6 Q;  5M3F H;  1S5F D;  1LTA D;  3A54 A;  2EXZ A;  4NPS A;  5LHY 1;  4BBS B;  1K3R A;  2K32 A;  2B2V C;  1B9M A;  4LF5 L;  3ERO A;  4HTH A;  1D1K A;  1QUQ A;  1STA A;  3PO2 G;  1VQD A;  2L4N A;  3AFQ A;  4XT1 B;  4XTC S;  1QIL A;  1U5K A;  2WII B;  2JA5 G;  5IP9 H;  4LF6 L;  2SNM A;  2D2C C;  2A5H A;  4RG1 A;  3HKZ B;  2N78 A;  5JJI A;  5FO8 B;  3K57 A;  4AIM A;  4NXN L;  4DR7 L;  3E3X A;  2UUC L;  2PW5 A;  4A93 H;  4OIJ A;  3HOU B;  2ZM6 Q;  3KOJ A;  5LMU Q;  5FJ8 G;  3QOL A;  3NEN A;  4ZUJ A;  2ALY B;  4P75 A;  1ENF A;  4ZAI A;  4GZY C;  3RLF A;  3ITP A;  1YHA A;  4DV0 L;  1PH5 A;  5C0X H;  4CJ0 B;  3FVQ A;  1X9N A;  1BR9 A;  1O7Y A;  2EYO A;  3IL8 A;  1YZ6 A;  5G3L D;  2R7Z H;  3I4O A;  5BR8 L;  1OXU A;  3V05 A;  1C8C A;  2UXB L;  5BN5 A;  1NR4 A;  1GD7 A;  1IW7 C;  3A0J A;  3R3O A;  2VUM H;  3MWY W;  4C2M H;  4JK1 C;  1U4R A;  3S14 H;  4C3J H;  3IAY A;  1Q8I A;  4QJF A;  2RCN A;  1B1Z A;  4KKS A;  2VQE L;  3R8B A;  4OX9 L;  5ELC A;  1FJG L;  2JA7 H;  3W2D A;  5C44 B;  1CKO A;  1T9H A;  2F0D A;  5M3M B;  4LAA A;  5IP7 G;  1Y1V G;  1AEX A;  4DR4 L;  1EIH A;  1SRO A;  2OQ0 A;  4S3S A;  3RLO A;  4PG3 A;  4IPC A;  1K83 H;  2F0U A;  1ET9 A;  2RHS B;  2F3I A;  3NXW A;  2WB1 G;  3F8T A;  4XQN A;  4K6D A;  3PIO 3;  1LTR D;  2JA8 B;  3MEH A;  1WD0 A;  2E8G A;  3MC0 B;  2EJM A;  4A3E B;  4X3T A;  1BXT A;  1IYV A;  1LT3 D;  4ABN A;  1WTW A;  2OQK A;  1U0L A;  2WB1 E;  1IYU A;  4F8M A;  5ELF A;  1PMR A;  4A3B B;  5C3W A;  1E24 A;  1PRT B;  3CU7 A;  1J8I A;  1H9J A;  2YYZ A;  3CCQ A;  2JA6 G;  1E1O A;  3NEL A;  2EIF A;  3BU2 A;  2RSO A;  4LFA Q;  4RKB A;  4JI6 L;  2Q2I A;  2PI2 A;  1LTG D;  2NWG A;  4C1N K;  2HQE A;  3CCM A;  1BCP B;  1VQ9 A;  1UWV A;  3L3O C;  4DR3 Q;  1G91 A;  3BS1 A;  2A68 C;  1WTO A;  5C4X B;  1SNC A;  1E2V A;  1D2B A;  2SEB D;  4A3C G;  1XNR Q;  3I4M H;  1UNS A;  5C5M A;  4A3J H;  1LUZ A;  4BS9 A;  2B2T C;  3GTQ B;  3B6Y A;  4X3K A;  2LS0 1;  4A4I A;  4QCL A;  2AWO A;  3NWS A;  2D5D A;  3NSW A;  4KD3 A;  1SFO B;  4P72 A;  3ERQ A;  1SSO A;  3KBX A;  1B44 D;  1HPC A;  1TVX A;  5LMN W;  1ML0 D;  1NTG A;  2IY5 B;  3Q22 A;  3GTO H;  1EY0 A;  3HOX H;  2HHH L;  4DPG A;  4DAP A;  3MHB A;  4F7X A;  1PTO C;  2B2W C;  2LXJ A;  1IBM Q;  1SYF A;  4K0K Q;  4PZ6 A;  4A76 A;  3VYR A;  1PVO A;  3GTK H;  2XGT A;  4A3D G;  3C3L A;  4GLV B;  3CXC A;  1KAA A;  4KHZ A;  3ICE A;  1XWE A;  5DLQ E;  1H9K A;  3S9W A;  1NJI C;  1Y69 U;  2IX1 A;  1VQ8 A;  4BY7 B;  5C6A A;  2KQ3 A;  1CQV A;  4ZKB B;  1PDQ A;  5CYU A;  3GP7 A;  3GQB A;  1G6P A;  4JOI C;  5K5P A;  2OWO A;  1GJX A;  4HN7 A;  3CAM A;  1HA5 A;  3S24 A;  2FJ2 A;  3M4O H;  4JC0 A;  1V1Q A;  2NTT A;  4RAU C;  5C4J B;  2G9D A;  2ICE C;  4JI2 Q;  4LF8 L;  2F52 A;  1U4P A;  2BCO A;  1RCV D;  3N52 A;  1QOH A;  4JI3 Q;  5BN3 A;  2FMC A;  3SHL A;  1CHP D;  3AQQ A;  3BYT B;  5EJW A;  2K03 A;  2FFK B;  1GUS A;  5KRU A;  1JIC A;  3C1E A;  4H02 A;  2BH2 A;  3J7A V;  1OXV A;  3CMA A;  2LY7 A;  1FNV A;  3VYT A;  4KY6 A;  3N6R A;  2Q8T A;  1JJG A;  3A74 A;  1YNN D;  2RBM A;  4HJ8 A;  3CF5 A;  3HOV H;  1TS2 A;  4CDE C;  1XTD A;  2LMC B;  3P7J A;  3K7A H;  1HQM C;  3G7L A;  2Y0S G;  4MTN A;  2WKC A;  5G3L F;  1HXY D;  2DJF C;  3UE0 A;  5IT9 E;  3RZO B;  3MA2 B;  4C1N I;  3E0E A;  1EY5 A;  2UXC L;  3KLS X;  2E74 C;  4EQO A;  4DAV A;  1N33 L;  2Z4H A;  1GUG A;  3SE0 A;  4JPB W;  1SE8 A;  3FKI G;  4B9W A;  2Y0S E;  1Q81 C;  1PH7 A;  1AFP A;  2E75 C;  4HMI A;  4QGU A;  3K5M A;  3AFP A;  1TT2 A;  3HEJ A;  1X56 A;  3IRB A;  2RDH A;  4JI0 Q;  4A3M G;  3SEB A;  5IYC G;  4DR3 L;  3HKS A;  1I50 B;  1R4Q B;  2YTY A;  4DNT B;  4IUQ A;  1H95 A;  2B8G A;  3ERS X;  3MXP A;  2F4I A;  3P1H A;  4ZLT F;  5K36 H;  4KN7 C;  2WAQ G;  2B2T A;  2KHJ A;  3ER0 A;  4HAE A;  3NBH A;  4OO1 I;  4ZKC B;  2RDF A;  5C0X J;  3H91 A;  1O78 A;  2HDL A;  4BBR B;  2F3V A;  5C4Z A;  2MNA A;  2OCE A;  5IGD A;  1VQ7 A;  3VYS A;  2IX0 A;  2WAQ E;  1MBY A;  1KRS A;  1NY4 A;  1PA6 A;  1FR3 A;  3KLR A;  3QWN A;  4QQB X;  2B2W A;  1B2T A;  1AN8 A;  3KDF B;  5I2X A;  5T1G A;  3OPO A;  3D6W A;  1V1P B;  4JCV E;  3KK7 A;  2JA9 A;  1ZXT A;  4POG A;  1HNW L;  3TSS A;  4N8F A;  2EYP A;  3SVM A;  4CJ1 B;  2MO0 A;  2JXM B;  2K5Q A;  4GOP C;  3ULL A;  2AQ1 B;  3W3A A;  2NZH A;  5LL6 X;  2ZJQ A;  1M1K C;  1H9R A;  4IUN A;  4POF A;  5AFW A;  4G7Z C;  2UUB L;  4IUR A;  1GOZ A;  5HGT A;  1KIX A;  5A2Q E;  3IFT A;  4DV4 Q;  2L9H A;  3CCR A;  1O7Z A;  2H5X A;  2JQO A;  5J22 A;  1MJE A;  4FF4 A;  4X3S A;  1JWU D;  1BO0 A;  2CQA A;  4R8I A;  3D4D A;  3HGB A;  4DK0 A;  3PIP A;  4J6H A;  3HS0 C;  2F4V Q;  4ZQ3 A;  1B70 B;  5EKK A;  1B53 A;  3E9H A;  3H94 A;  2K5H A;  3D6C A;  1MGS A;  5FLM G;  1LTB D;  4O42 A;  4IQZ A;  3PQI A;  3BDC A;  3BYY B;  1EY9 A;  3NEM A;  4LUZ A;  3I3C A;  3VR2 A;  3H09 A;  1HZB A;  5COY A;  5I9O A;  4DFA A;  1Y1W G;  4K8J A;  4TVA B;  4LFC L;  5I6W A;  1DM0 B;  4JI2 L;  3J7A 5;  4OO1 H;  3BZD B;  4JI3 L;  1K0S A;  5HUR A;  1A2U A;  3S15 H;  1EWH A;  1LO5 D;  1ET6 A;  2ZJR A;  3HOY G;  2VW9 A;  4LUV A;  1CFM A;  5C3E B;  2A8V A;  2EYJ A;  1JWM D;  1QZH A;  3PF4 A;  5M5Y H;  5CV7 A;  2NZ1 D;  2SOB A;  3A7A B;  1G8Z D;  5ELD A;  4OXP A;  2NZO A;  4DV6 Q;  2YV5 A;  3OTO L;  1WTR A;  3H3V C;  3HOZ G;  3K5O A;  1LTL A;  1VQM A;  1ILP A;  1SNM A;  4J15 A;  4JI8 Q;  4DR5 Q;  1EU4 A;  4FO2 A;  5KYI A;  1JWS D;  1VF7 A;  1N8R C;  4DK6 C;  1A8V A;  2ZXP A;  1EYC A;  4NKL A;  2EOT A;  3NQI A;  2EPB A;  3VR4 A;  3S1N H;  1SFO H;  5DM7 3;  1CKN B;  1E7Z A;  1STH A;  4A3F H;  2V4D A;  4TSS A;  2I07 B;  3GTM H;  4B3T Q;  1IKM A;  1H9M A;  1VMP A;  2IHF A;  3K59 A;  3M4Q A;  1AZQ A;  3WOE A;  1IBL L;  2CWP A;  1W6K A;  3E9I A;  5CV5 A;  1I3Q B;  4LFB L;  2VNU D;  3SK8 A;  3RZD H;  3HOW G;  2R3Z A;  5CBA E;  1Q86 C;  1TWF B;  2F3W A;  1KL9 A;  1XMQ L;  4A3I G;  1H9S A;  2I5L X;  4MHE A;  5M3F G;  2F0F A;  3SK5 A;  2K01 A;  2C9O A;  2R7D A;  5EAY A;  5ELN A;  4L5Q A;  4IFD I;  3A8J E;  1B4O A;  1V8Q A;  5E4W C;  2GA4 B;  2A69 D;  1R9T B;  2B63 B;  5ISR A;  1WD1 A;  2KEC A;  3QO2 A;  1YHQ A;  4ME3 A;  3CHB D;  1WJJ A;  3C2P A;  1PYS B;  1RDP D;  4XDX A;  2K28 A;  3VA7 A;  5IP9 G;  1TY0 A;  4QL5 A;  4YWM A;  1NR2 A;  2YU9 B;  1TS5 A;  1X55 A;  1AE2 A;  1B9N A;  1JC7 A;  1GHK A;  3MFG A;  4R4O A;  2L55 A;  1CT1 D;  3PO2 B;  5J3B A;  2K33 A;  4A93 G;  2E5L Q;  4DV4 L;  1CA6 A;  4X3U A;  2KCC A;  2X6G A;  3CCL A;  1DZ1 A;  4PMW A;  1HR0 Q;  2JA5 B;  1O7I A;  4ID6 A;  2PCF B;  1JE4 A;  5LMN Q;  3FHW A;  4UHV A;  3RMH A;  1TU2 B;  2E2J H;  5IT9 L;  3KLS A;  4DR2 Q;  4IUP A;  1Q46 A;  4QIW E;  4ULL A;  5CMD A;  2PPB C;  1NNX A;  3T1H Q;  3PF5 A;  1F9Q A;  5C0X G;  4EVO A;  2K04 A;  1ASY A;  2KUM A;  3GTP H;  2SNS A;  2DY8 A;  4G4K A;  1WTV A;  4HIK A;  1I5F A;  2QIL A;  4KHP Q;  2E2I H;  4Q0F A;  4WJW A;  1UE7 A;  4Z9C B;  1XPO A;  2QGQ A;  4HCS A;  2VUM G;  4CBV A;  4JI4 L;  5FKA C;  3CCS A;  3QB3 A;  2R92 H;  3LNN A;  2NTS A;  5TSS A;  5EQ0 A;  3TBI B;  3UDF A;  2BDO A;  2DN8 A;  4RKL A;  3TP5 A;  3WDN A;  4KLK A;  4C3J G;  4DV3 L;  2NN6 H;  4YY3 Q;  2Z6K A;  3QOJ A;  1QZG A;  1VQE A;  4A3G H;  2FHT A;  4C3H H;  1OXT A;  1YJ9 A;  2K6A A;  3D31 A;  3TDQ A;  1RKN A;  1YNJ C;  1DOK A;  1UUP A;  1ILQ A;  4A3K G;  1TKW B;  2I5M X;  3D3R A;  3S16 H;  4AQY Q;  3RD4 A;  1M8A A;  3K58 A;  4OIK A;  2UXD Q;  4YHH Q;  4JI8 L;  4DR5 L;  2UUA Q;  3W1B A;  3QG1 A;  4KY7 A;  1JCK B;  1A15 A;  2GVB A;  3CME A;  1SRU A;  1VQ6 A;  4BBR H;  2R93 H;  1F9P A;  5CV8 A;  2EYM A;  3J80 i;  1E2W A;  1AZP A;  1Z47 A;  2VQF Q;  1WTH A;  1Y1V B;  4CDF C;  3IFD A;  1GVP A;  1PH4 A;  1PH2 A;  3KFU A;  1ZKO A;  1RHP A;  2Z0S A;  2C35 B;  3I91 A;  1DCZ A;  3ZYY X;  5KNB A;  1EIY B;  1I6H B;  1LV9 A;  3T1Y L;  1O80 A;  2WB1 B;  4TRD A;  4HED A;  2NVY H;  1I4Q A;  4B3R L;  1A3V A;  1EY4 A;  4OEM B;  3PMF A;  2MHV A;  2PZU A;  3KBG A;  5A2Q L;  2HIX A;  3AEV A;  1M4V A;  4R4T A;  4LF7 Q;  3TN2 A;  3K5N A;  1PH6 A;  2AQ2 B;  3NTH A;  4KHV A;  3T53 B;  1QVC A;  4DK3 C;  1QVF A;  2SDF A;  4DGZ A;  1CA5 A;  3G6J B;  1D5Z C;  3KJP A;  3M4P A;  4OWT B;  2JA6 B;  1L0X B;  3A8K E;  4U68 A;  1LT5 D;  3TZD A;  4C3I G;  3S1M B;  3J80 E;  4Y7N B;  1VQA A;  3STB C;  3ULJ A;  1Q1E A;  2AUJ D;  3M9B A;  1STB A;  3I4M G;  5M5W H;  4A3J G;  4YIJ A;  5GRO A;  1SNQ A;  5JEA H;  4B3M L;  3CRL C;  4K5V A;  1BQQ T;  3FEW X;  1PYB A;  2B2Y C;  3M7N A;  1N32 L;  4JYA L;  3S1R H;  3S1Q B;  1DGS A;  1XTC D;  1AH9 A;  3I2Z A;  1I6V C;  5IWA L;  4YWK A;  1L1O C;  2E5L L;  3HOX G;  5C3E H;  2NVT B;  2VZA A;  1EIF A;  5EKI A;  3AU7 A;  2XWJ B;  2BE5 D;  2MGS A;  4B9X A;  1DOM A;  4K2L A;  3S2D H;  2F0T A;  1TWC B;  4YCV A;  4Y52 H;  4IOC A;  3T1H L;  4CKC A;  4DNI A;  1RD9 D;  1VDZ A;  2WFW A;  4WOR A;  5ELB A;  4ZK9 B;  3SK6 A;  2OT2 A;  5JPN C;  4P74 A;  1NMG A;  1JOR A;  2UU9 L;  3KF8 A;  1VQB A;  4KHP L;  2DNC A;  4IPG A;  3K6O A;  4FF2 A;  3DXJ C;  1SN8 A;  1N36 Q;  2A6E C;  2Z6B A;  2CH4 A;  4X65 Q;  1G51 A;  4LF4 L;  2J7Z A;  2VY3 A;  2WV6 D;  3D0F A;  2X69 A;  5KGU A;  1W6J A;  3KDF A;  1XNQ Q;  4XYQ A;  4YWL A;  1ESF A;  4JV5 Q;  3UDX A;  1CZW A;  3OW7 A;  1V1P A;  4A3D B;  3BVG A;  1B3Q A;  2F0J A;  4YY3 L;  3VR6 A;  2PO4 A;  1H9S B;  5BN4 A;  4IN3 A;  2F0S A;  4KV6 A;  3PO3 H;  2I46 A;  2N55 A;  1I3Q H;  1J5E Q;  4L8J A;  1P16 A;  3CQZ B;  4HID A;  1I94 L;  4GKJ L;  1LTI D;  3TS2 A;  4UAI A;  4GOP B;  5I6Y A;  1Q90 A;  1XPR A;  4G57 A;  4HSP A;  4GLX A;  1AE3 A;  5IGF A;  4FXK C;  3WWV A;  2BH8 A;  3LX0 A;  3ND8 A;  3HOV G;  1IHZ A;  1X54 A;  1U4L A;  3MTS A;  4LNQ A;  1X3G A;  4BY1 H;  3TZU A;  4XQJ A;  1S5E D;  2B2V A;  3S17 B;  2IW3 A;  3GTJ B;  1X3E A;  3I4N G;  4Q5V A;  3EN2 A;  1EEF D;  1LT6 D;  2MFI A;  4L6T B;  5FLX E;  4FXG C;  1CZG A;  3MXG A;  3CC4 A;  2IHE A;  2O4X A;  3MFY A;  2F0W A;  1PH1 A;  1NBW A;  2V1C C;  5HY6 A;  1KHI A;  4C56 C;  4QUC A;  2Y0S B;  4ILW A;  3U50 C;  2KVM A;  4H13 C;  1CSP A;  2EYF A;  1C48 A;  3UE1 A;  3M3Y H;  2RHQ B;  1TWG H;  4R8N A;  4M1U B;  5K36 G;  1KDC A;  3MXU A;  3BVZ A;  2ID0 A;  3E6Z X;  1VQF A;  3HFZ B;  4OWX B;  1R4P B;  3GTL H;  2RVL A;  3FKI B;  1PRT D;  4I65 A;  5IYD G;  2ZM6 L;  4L5T A;  4RCO A;  2LXK A;  3AYH B;  3I70 A;  5LMU L;  2EZV A;  1RIP A;  2A1A A;  1Q3L A;  4APV A;  2NVQ H;  4A3M B;  1B8A A;  2Z1C A;  1UE5 A;  2NVX H;  2HUG A;  3EVQ A;  1CKN A;  2WAQ B;  2F0N A;  2AHO B;  4FF3 A;  2QA4 A;  1BCP D;  4J8Q A;  2ATW A;  2ASB A;  5IYB H;  1KAB A;  4AYB G;  3OMC A;  1VQJ A;  1FGB D;  1TXY A;  1UAP A;  3E0J A;  1SR3 A;  1K8G A;  5I2Y A;  3KYH C;  2E2H B;  4HMJ A;  1EU3 A;  4O1N A;  3I56 A;  2PQE A;  1FVI A;  1K8O A;  5IGB A;  2R7F A;  4NXM Q;  4AYB E;  1EFI D;  1EWC A;  5EPJ A;  2K50 A;  4X65 L;  1SJH D;  4CDC C;  1TR5 A;  5T1I A;  1VQI A;  3R2I A;  1GKH A;  2CH4 W;  2CKZ B;  4LF9 Q;  4RGT A;  3A7L A;  3SXH A;  1XNQ L;  4JV5 L;  4X64 Q;  2CVR A;  1Z7T A;  5KIX A;  1PHJ A;  3K0X A;  2R6G A;  1L0W A;  1SYG A;  4PMB A;  3BDO A;  2EJF C;  3I73 A;  4GKK Q;  4BBS H;  3AMU A;  2WIN B;  2WAC A;  3TQY A;  1DYQ A;  3GDE A;  4ZRZ A;  1IBK Q;  1IL2 A;  4NDX A;  1ZYR D;  1TQO A;  2B8F A;  4DK1 A;  5FO9 B;  2CW0 D;  3GD7 A;  2QDL A;  4DUZ Q;  2EDG A;  2L11 A;  1HUN A;  4UP8 A;  3VR5 A;  1MKH A;  1CTM A;  1Y1W B;  4P2C B;  3J80 L;  3L2P A;  5D3D A;  4JG2 A;  3T56 B;  2O2L D;  3PUZ A;  1JJC B;  4RWS C;  2HT1 A;  5I9P A;  2H1E A;  2LFN A;  4LFA L;  2N49 A;  5DNF A;  1KDB A;  1NMF A;  1X3Q A;  4IO9 A;  1VQH A;  1PFM A;  2ES2 A;  4FXD A;  1SMY D;  5FOB B;  1VQO A;  3G48 A;  4AH6 A;  4QUF A;  3HOY B;  3S2H B;  1K28 A;  2A6H D;  2HDM A;  3HOU H;  1NUC A;  3K5L A;  2PQA B;  1YVC A;  1L2F A;  1ENA A;  1WCM B;  1U4M A;  3F2U A;  3T13 A;  4DR6 Q;  4RCN A;  4K8I A;  4HSV A;  4A3F G;  3VDY A;  3HOZ B;  3W1G A;  1W3S A;  2OTL A;  1XNR L;  3P20 A;  3TP8 A;  1PZK D;  3KLW A;  5FO7 B;  2NVT H;  3CKI B;  3KF8 B;  1BNZ A;  1BBX C;  1XXG A;  3OHX C;  1V9P A;  4IUT A;  1JR0 D;  2B2U C;  1Q82 C;  2ZTC A;  4KKT A;  1RF2 D;  3CRK C;  1A62 A;  3I8Z A;  1SNO A;  3U58 A;  2WP8 J;  3U4V A;  1IBM L;  1K3B C;  4K0K L;  3T16 A;  1HNX Q;  5C44 H;  4O2D A;  5CGK A;  1JB7 A;  5M3M H;  4K14 A;  3R2T A;  5HGQ A;  2JJQ A;  2ZXR A;  3HOW B;  5JAV A;  4L63 B;  1MSH A;  4A3D H;  3JC6 6;  2F0K A;  4A3I B;  5M3F B;  4LUO A;  2KBN A;  1GM5 A;  1TS4 A;  5IE8 A;  2JA8 H;  4CHT B;  5JPM C;  4DV5 Q;  4JOI A;  2RKS A;  1LT4 D;  4KD4 A;  4A3E H;  1XYI A;  3H3V I;  3J7A F;  3J81 E;  1A2T A;  1VQG A;  1A3U A;  5KND A;  4K5W A;  5M5X B;  1SDF A;  3D4R A;  4DV7 Q;  1VF5 C;  4KKU A;  3M4Y A;  2JK8 A;  2DY7 A;  2EY6 A;  5IT9 c;  5LL6 S;  4XT3 B;  4L5S A;  3H0G G;  4NMZ A;  4LF9 L;  4A3B H;  1F2M A;  5DAU A;  3OW2 A;  4KJN A;  2ZT9 C;  2ZTD A;  2CWA A;  2BA0 A;  2EYH A;  2KED A;  3GO5 A;  4DV1 Q;  1PRT F;  3MVV A;  1KC8 C;  4QIW B;  3S17 H;  4H7B A;  4A93 B;  4FVM A;  5FLX L;  5H1S E;  4JBK A;  2TSS A;  1WCM G;  4CDD C;  1CQF A;  1BCP F;  2EXD A;  5C4X H;  1K8A C;  1IBK L;  4CGY B;  2R92 G;  2F0V A;  3I4L A;  2B3G A;  1HFG A;  1GO3 E;  2NN6 G;  2VXW A;  2JEB I;  4UDU C;  2MQH A;  1WTX A;  1QVG A;  4A3L H;  4A3G G;  4KY5 A;  4C3H G;  3GTQ H;  4J1M A;  1D5X C;  1EL0 A;  4IPD A;  2Q8R E;  1L1O B;  3PIO A;  1TWH B;  4RGN A;  1NAP A;  3NTK A;  2VUM B;  3MXN A;  3OWF A;  4C2M B;  1IZ6 A;  4RGM A;  5E7N A;  3VYU A;  3Q0A A;  3S14 B;  2K7V A;  1K73 C;  1G2T A;  4A75 A;  3FKI H;  4BA1 I;  1LM0 A;  2RDG A;  4C3J B;  4JI0 L;  2ZJP A;  2ENB A;  4WJ4 A;  3DEO A;  3MEF A;  1YNX A;  2Z4I A;  1VQL A;  4A3M H;  3JAM E;  4A3K B;  4FF1 A;  1BVS A;  3UDG A;  1K0R A;  1HCZ A;  1VQ5 A;  2Q2U A;  1SBB B;  4ALP A;  1YNN C;  3I7F A;  4I7A A;  2K05 A;  5JVH 3;  1K83 B;  3BVM A;  1EIG A;  1SAP A;  2XIW A;  4V19 0;  4GLA C;  4QB4 A;  1YIT A;  3H15 A;  2MPM A;  5IGC A;  1PH8 A;  1CHQ D;  1MD2 D;  2BOS A;  4JBJ A;  2Z8L A;  4BY7 H;  2IJ0 A;  3SGI A;  1PLF A;  2PMZ E;  4I7Z C;  4H44 C;  5CR3 A;  2HCI A;  3PCO B;  3HRZ C;  2XSC A;  1Y8P B;  4GOP A;  2C5C A;  1BUV T;  2AKW B;  4LW1 A;  1EWI A;  1XX8 A;  3OOC A;  3OYY A;  3FDT A;  2K4K A;  4BA2 I;  1BBW A;  1F9S A;  3CC2 A;  2IL8 A;  5ELO A;  4K5X A;  4LF6 Q;  1E22 A;  1IW7 D;  2NUC A;  5C4J H;  4X66 Q;  1WI5 A;  4L5R C;  1C0A A;  4NXN Q;  3DHQ A;  4DR7 Q;  3NE5 B;  1D7Q A;  1STE A;  5JEA G;  2UUC Q;  1D1I A;  2BA1 A;  4FYD A;  1PFN A;  1Q7Y C;  2F4V L;  1N34 Q;  4PQX A;  5C3X A;  1CK1 A;  3QIA A;  2NYZ D;  3FP9 A;  1NE3 A;  4C3I B;  1EFW A;  2PW7 A;  3OIP A;  1LAB A;  2L5T A;  1SYC A;  3OMG A;  1QJO A;  3I4M B;  4A3J B;  2R7Z G;  1KRT A;  3RZO H;  4TKO B;  2I0Q A;  4R9W A;  2PZT A;  1S5D D;  1DJR D;  4X6A H;  2MJ8 A;  5BR8 Q;  3Q23 A;  1C4Q A;  2UXB Q;  1KTK A;  4EQN A;  3F2D A;  2DNE A;  2OTJ A;  2A73 B;  1A0I A;  4KN4 C;  3HOX B;  2JA7 G;  4IFD H;  1ICF B;  2VQE Q;  2E2D C;  1FJG Q;  4OX9 Q;  3D4W A;  2JN4 A;  1I50 H;  1D5M C;  4DV6 L;  4UY8 C;  2PYK A;  2Q2H A;  1LAC A;  3GV3 A;  3CCV A;  1PTO B;  1YIJ A;  3GTK B;  1T5E A;  1KLG D;  2YTX A;  4DR4 Q;  1BOS A;  4DUY Q;  4JI7 Q;  3NQT A;  2F0P A;  3DLL A;  3PO3 G;  1QG7 A;  1X6O A;  1PYW D;  2EE1 A;  2PNR C;  1PV4 A;  2O5I C;  2AUK A;  4IUU A;  3QR8 A;  4HJA A;  2A68 D;  2NB0 A;  1KLU D;  4B3T L;  2VB2 X;  3ZJY C;  3A55 A;  1O7L A;  4ZUI A;  4BXX H;  2JEA I;  2FXQ A;  3M7G A;  4LJZ C;  2ZTE A;  3M4O B;  5C0X I;  3EIV A;  3CD6 A;  1ESR A;  4B3S Q;  3HZX A;  1YBY A;  1HA6 A;  4DAM A;  2N8N A;  2OEO A;  3J81 j;  4BY1 G;  3KF6 B;  4DV2 Q;  1X3P A;  4OGQ C;  3RUZ A;  4N9P A;  4JBW A;  4A3I H;  2KHI A;  1HUM A;  1AP0 A;  1PTO D;  1I4X A;  3J81 L;  5IGE A;  5ELE A;  4OHJ A;  2JSO A;  1J9O A;  2DUD A;  2F0Q A;  3C46 A;  3ULP A;  1K8M A;  2ICI A;  2FIN B;  3HOV B;  5D3I B;  3TS0 A;  1SE2 A;  3RNU A;  4LWC A;  5M5X H;  3K7A B;  4R4I A;  5CV4 A;  1U9R A;  1EEI D;  4CJ2 C;  1ZEQ X;  2F03 A;  3I4N B;  3W5O A;  3SR1 A;  3FPU B;  2QCP X;  3G71 A;  3IKJ A;  3OIQ A;  4X66 L;  1J6Q A;  1JMC A;  2EVB A;  1S40 A;  1PXU A; 
#chains in the Genus database with same CATH homology
 4QMG A;  4KTA A;  1ENC A;  1GUW A;  2J4X A;  3FPP A;  2RQX A;  3OWE B;  3C1F A;  3PIP 3;  5IOC A;  3L7Z C;  2XRS D;  3MAQ A;  2A69 C;  3H6M A;  2F0M A;  1BDO A;  2FMM A;  1VMC A;  2M2L A;  2KOL A;  1RTO A;  1D6E C;  5NUC A;  3DM1 A;  1JOQ A;  2F0L A;  5J1Z A;  1EQT A;  4PNY A;  4DA2 A;  1QB5 D;  2QF7 A;  2M9V A;  3JAM L;  5CV9 A;  4HR7 B;  3E5S A;  4AYB B;  1G6Z A;  1X32 A;  2G9H D;  5EKL A;  1SXT A;  2Q8I B;  5EPK A;  4HCE A;  3DMU A;  5A35 A;  1F2Z A;  1NSN S;  3GV6 A;  2MUY A;  5FK9 C;  3MZ5 A;  3NK9 A;  3UI2 A;  4XIG S;  5JJZ A;  2O5J C;  5IIF A;  1B3A A;  4F88 A;  2QEJ C;  4XXE A;  4NP5 A;  3WOF A;  2TMP A;  1V43 A;  1Y8N B;  1GXD C;  3X3M A;  1T5X D;  5CBE E;  1S5B D;  1WTQ A;  3KUP A;  4EQP A;  3TP7 A;  1TWA B;  5C4H A;  2ZXO A;  3S15 B;  1HFN A;  2F0O A;  3NPP A;  2BDN A;  4BWG B;  2N88 A;  1BF4 A;  5M5Y B;  4KK7 A;  1G29 1;  1SNP A;  3K0Y A;  1S4Z A;  5M9O A;  1QNK A;  1RTN A;  4RA8 A;  1VCI A;  4K6L A;  2B2Y A;  1SYE A;  1GHJ A;  2JE6 I;  1FNU A;  2HCC A;  1I4R A;  3PV0 A;  3S1N B;  1CI3 M;  1SEB D;  2IWH A;  4KI0 A;  2KJX A;  2JYO A;  4A3F B;  1QWY A;  4IFD J;  3GTM B;  4IUV A;  3PUW A;  3RZD B;  3M85 A;  1LTS D;  3LWU A;  1HQR D;  1PTO H;  1SE3 A;  4DXG A;  3NUC A;  5KYL A;  3J7Y W;  1GUT A;  4ODG A;  1PTO F;  1WTP A;  1STN A;  3HP3 A;  3GTG B;  3TP6 A;  3T4A C;  1PZI D;  3D8G A;  1EYD A;  4MIU A;  4TQU S;  4M8A A;  4G7H C;  5EBC A;  3V96 A;  3I72 A;  2IX3 A;  2K1B A;  3DWQ A;  1DXM A;  3P75 A;  3T51 B;  2BE5 C;  4OO1 G;  5IOD A;  2JP1 A;  1FYC A;  1E2Z A;  3NWT A;  4FP5 D;  3X3N A;  4DF7 A;  1IL8 A;  1QE6 A;  1ROD A;  2OF1 A;  3H0G B;  1EOT A;  3VR3 A;  3DWA A;  1PFB A;  2E2J B;  2EY1 A;  5KNC A;  5JEA J;  4PMC A;  1DD2 A;  1STY A;  2K5W A;  3GTP B;  1F2Y A;  2IT1 A;  2QDB A;  5I4D A;  4WFN 3;  2M00 A;  4DXF A;  2E2I B;  1QCB D;  5J39 A;  1ICW A;  2X6L A;  4QF4 A;  5COR A;  2A74 C;  1KDA A;  2RA4 A;  4XYO A;  2R92 B;  4WRD A;  4B08 A;  1KNA A;  5IGG A;  1JQY D;  4A3G B;  5E1F A;  4C3H B;  1LTT D;  5DM6 3;  1B50 A;  3S16 B;  1Q12 A;  2PZW A;  1I4P A;  2E76 C;  2OXP A;  1GUN A;  2R93 B;  3V2T A;  2AQ3 B;  2R61 A;  3NTI A;  1JOK A;  4CKB A;  5C5L A;  3U9S A;  5D14 A;  1EYA A;  5E4X A;  2PMZ B;  4RH6 A;  1QNU A;  3L9A X;  2H4O A;  2NVY B;  1PZJ D;  1RJT A;  2XVS A;  3A8I E;  2B39 A;  2KA7 A;  1EZ6 A;  3TME A;  2KHS A;  5D65 A;  4KMU C;  1ONL A;  2F0H A;  1PRT C;  2XRQ D;  4MN3 A;  3URY A;  1TS3 A;  4FNF A;  4IZ8 A;  1YNJ D;  2LKV A;  2RSN A;  1SND A;  4ME5 A;  2VB3 X;  1BCP C;  1CM9 A;  4OL7 A;  5M5W B;  1SYD A;  1OXX K;  3OSO A;  4DNR B;  3O13 A;  5KEE A;  1NCV A;  3A56 A;  5DEH A;  3ONA B;  2KEE A;  4F87 A;  1HRJ A;  1JB3 A;  3SDZ A;  3S1R B;  3I90 A;  1AW7 A;  2KCN A;  2L0C A;  1DON A;  1EQV A;  1S5C D;  3HG9 A;  4IFD G;  2R7Z B;  5E3F A;  3EFX D;  3S2D B;  4RHS A;  2AWN A;  4K2K A;  1HTL D;  3EQL C;  5JVG 3;  1G2S A;  2F0G A;  2JA7 B;  2D62 A;  3LWE A;  2L1B A;  1F9R A;  1SYB A;  3SK4 A;  4RGO S;  4DU9 A;  2J0T D;  2B2U A;  1ZYR C;  2CW0 C;  1E0B A;  1JOO A;  3PO3 B;  1L0Y B;  1Z6H A;  1SJE D;  3FRP B;  2F0E A;  3DWP A;  1OXS C;  2EJG C;  4N9T A;  3AB9 A;  1SMY C;  4U67 3;  1HTP A;  1GUO A;  2A6H C;  4KJO A;  4V0B A;  1TY2 A;  2NN6 I;  1A3T A;  3DUZ A;  1F2L A;  4XQQ A;  1IKL A;  1LLR D;  4DAY A;  2EY2 A;  4BY1 B;  2F1M A;  3FMC A;  5F2D A;  3Q6S A;  1WVL A;  5EPL A;  1FNW A;  2XWB B;  1I4H A;  2A6E D;  2CHB D;  4E6I A;  4H0L C;  1EY8 A;  4IAL A;  1OO9 B;  1HHV A;  2IPK D;  2K5D A;  1KNE A;  3ND9 A;  3PUX A;  2EY5 A;  4ZYS A;  3DEP A;  4RHR A;  1FD7 D;  3M3Y B;  1TWG B;  5CC4 A;  2WKD A;  5JOB A;  1EY6 A;  3GTL B;  4EGV A;  2NBF A;  2QKI C;  3GTO B;  1TII D;  3EA6 A;  3VA5 A;  2MP1 A;  3U9O A;  1EZ8 A;  1MI2 A;  1V1O A;  2NVQ B;  3Q24 A;  4CKE A;  2NVX B;  4RFB A;  1II3 A;  1DOL A;  1Y8O B;  1Q1B A;  3QJY A;  3BDL A;  4G7O C;  1I4G A;  3NBI A;  3R93 A;  3EJI A;  2D9U A;  2EYL A;  3PUY A;  3BG3 A;  4DN4 M;  2L12 A;  1UEA B;  2XN9 C;  1A6X A;  4NW2 A;  5EBD A;  1EY7 A;  2XNA C;  1SE4 A;  3PUV A;  1STG A;  1F77 A;  1MSG A;  4PV1 C;  3NP8 A;  4LMQ D;  5CV6 A;  5EGT A;  3NHH A;  4LK1 C;  2F0I A;  1S5F D;  1LTA D;  3A54 A;  2EXZ A;  5LHY 1;  4BBS B;  2K32 A;  2B2V C;  1B9M A;  3ERO A;  4HTH A;  1D1K A;  1STA A;  2L4N A;  4XT1 B;  4XTC S;  1QIL A;  2WII B;  2SNM A;  2D2C C;  2A5H A;  3HKZ B;  5FO8 B;  3K57 A;  2PW5 A;  4OIJ A;  3HOU B;  3QOL A;  4ZUJ A;  1ENF A;  4ZAI A;  4GZY C;  3RLF A;  3ITP A;  5C0X H;  4CJ0 B;  3FVQ A;  1BR9 A;  1O7Y A;  2EYO A;  3IL8 A;  5G3L D;  1OXU A;  3V05 A;  1C8C A;  5BN5 A;  1NR4 A;  1IW7 C;  3R3O A;  3MWY W;  4JK1 C;  1U4R A;  3IAY A;  1Q8I A;  1B1Z A;  4KKS A;  3R8B A;  5ELC A;  3W2D A;  5C44 B;  2F0D A;  5M3M B;  4LAA A;  1AEX A;  1EIH A;  4S3S A;  2F0U A;  1ET9 A;  3NXW A;  4XQN A;  4K6D A;  3PIO 3;  1LTR D;  2JA8 B;  3MEH A;  1WD0 A;  3MC0 B;  2EJM A;  4A3E B;  4X3T A;  1BXT A;  1IYV A;  1LT3 D;  4ABN A;  1WTW A;  1IYU A;  4F8M A;  5ELF A;  1PMR A;  4A3B B;  5C3W A;  1PRT B;  3CU7 A;  1J8I A;  1H9J A;  2YYZ A;  2RSO A;  4RKB A;  1LTG D;  2NWG A;  4C1N K;  2HQE A;  1BCP B;  3L3O C;  1G91 A;  3BS1 A;  2A68 C;  1WTO A;  5C4X B;  1SNC A;  1E2V A;  1D2B A;  2SEB D;  1UNS A;  5C5M A;  4BS9 A;  2B2T C;  3GTQ B;  4X3K A;  4QCL A;  2LS0 1;  2AWO A;  3NWS A;  2D5D A;  3NSW A;  4KD3 A;  1SFO B;  3ERQ A;  1SSO A;  3KBX A;  1B44 D;  1HPC A;  1TVX A;  1ML0 D;  3Q22 A;  1EY0 A;  4DAP A;  3MHB A;  4F7X A;  1PTO C;  2B2W C;  1SYF A;  3VYR A;  3C3L A;  1KAA A;  4KHZ A;  1XWE A;  1H9K A;  3S9W A;  1Y69 U;  2IX1 A;  4BY7 B;  5C6A A;  2KQ3 A;  1CQV A;  4ZKB B;  1PDQ A;  5CYU A;  3GP7 A;  3GQB A;  5K5P A;  1GJX A;  4HN7 A;  1HA5 A;  2FJ2 A;  2NTT A;  4RAU C;  5C4J B;  2G9D A;  2ICE C;  1U4P A;  2BCO A;  1RCV D;  1QOH A;  3N52 A;  5BN3 A;  2FMC A;  3SHL A;  1CHP D;  3BYT B;  5EJW A;  2K03 A;  2FFK B;  1GUS A;  5KRU A;  1JIC A;  3C1E A;  3J7A V;  1OXV A;  2LY7 A;  1FNV A;  3VYT A;  4KY6 A;  3N6R A;  2Q8T A;  1YNN D;  2RBM A;  1TS2 A;  2LMC B;  3P7J A;  1HQM C;  3G7L A;  2WKC A;  5G3L F;  1HXY D;  5IT9 E;  3RZO B;  3MA2 B;  4C1N I;  1EY5 A;  3KLS X;  2E74 C;  4EQO A;  4DAV A;  2Z4H A;  1GUG A;  3SE0 A;  4B9W A;  1AFP A;  2E75 C;  4HMI A;  3K5M A;  1TT2 A;  3HEJ A;  2RDH A;  3SEB A;  1I50 B;  1R4Q B;  4DNT B;  4IUQ A;  2B8G A;  3MXP A;  2F4I A;  3P1H A;  4ZLT F;  5K36 H;  4KN7 C;  2B2T A;  4HAE A;  3NBH A;  4OO1 I;  4ZKC B;  2RDF A;  5C0X J;  3H91 A;  1O78 A;  2HDL A;  4BBR B;  2F3V A;  5C4Z A;  5IGD A;  3VYS A;  2IX0 A;  1MBY A;  1FR3 A;  3KLR A;  3QWN A;  2B2W A;  1B2T A;  1AN8 A;  5I2X A;  5T1G A;  3OPO A;  3D6W A;  1V1P B;  3KK7 A;  1ZXT A;  3TSS A;  2EYP A;  3SVM A;  4CJ1 B;  2JXM B;  2K5Q A;  2AQ1 B;  3W3A A;  5LL6 X;  1H9R A;  4IUN A;  5AFW A;  4G7Z C;  4IUR A;  1GOZ A;  5HGT A;  5A2Q E;  3IFT A;  2L9H A;  1O7Z A;  5J22 A;  4FF4 A;  4X3S A;  1JWU D;  1BO0 A;  2CQA A;  4R8I A;  3D4D A;  3HGB A;  4DK0 A;  4J6H A;  3HS0 C;  4ZQ3 A;  5EKK A;  1B53 A;  3H94 A;  3D6C A;  1MGS A;  1LTB D;  4O42 A;  4IQZ A;  3BDC A;  3BYY B;  1EY9 A;  3VR2 A;  3I3C A;  3H09 A;  5COY A;  5I9O A;  4DFA A;  4K8J A;  5I6W A;  1DM0 B;  4OO1 H;  3BZD B;  5HUR A;  1A2U A;  1EWH A;  1LO5 D;  1ET6 A;  1CFM A;  5C3E B;  2EYJ A;  1JWM D;  5CV7 A;  2NZ1 D;  2SOB A;  3A7A B;  1G8Z D;  5ELD A;  1WTR A;  3H3V C;  3K5O A;  1ILP A;  1SNM A;  1EU4 A;  4FO2 A;  5KYI A;  1JWS D;  1VF7 A;  2ZXP A;  1EYC A;  4NKL A;  2EOT A;  3NQI A;  2EPB A;  3VR4 A;  5DM7 3;  1STH A;  2V4D A;  4TSS A;  2I07 B;  1IKM A;  1H9M A;  1VMP A;  3K59 A;  1AZQ A;  3WOE A;  1W6K A;  5CV5 A;  1I3Q B;  2VNU D;  3SK8 A;  2R3Z A;  5CBA E;  1TWF B;  2F3W A;  1H9S A;  4MHE A;  2F0F A;  3SK5 A;  2K01 A;  2C9O A;  4IFD I;  3A8J E;  1B4O A;  1V8Q A;  5E4W C;  2GA4 B;  2A69 D;  1R9T B;  2B63 B;  5ISR A;  1WD1 A;  2KEC A;  3QO2 A;  3CHB D;  3C2P A;  1RDP D;  4XDX A;  2K28 A;  3VA7 A;  1TY0 A;  1NR2 A;  2YU9 B;  1TS5 A;  1B9N A;  1JC7 A;  1GHK A;  3MFG A;  2L55 A;  1CT1 D;  3PO2 B;  2K33 A;  1CA6 A;  4X3U A;  2KCC A;  2X6G A;  1DZ1 A;  4PMW A;  2JA5 B;  4ID6 A;  2PCF B;  1JE4 A;  3RMH A;  1TU2 B;  5IT9 L;  3KLS A;  4IUP A;  4ULL A;  5CMD A;  2PPB C;  1F9Q A;  5C0X G;  4EVO A;  2K04 A;  2KUM A;  2SNS A;  2DY8 A;  4G4K A;  1WTV A;  2QIL A;  4Q0F A;  4WJW A;  4Z9C B;  4HCS A;  4CBV A;  5FKA C;  3QB3 A;  3LNN A;  2NTS A;  5TSS A;  5EQ0 A;  3TBI B;  2BDO A;  2DN8 A;  4RKL A;  3TP5 A;  3WDN A;  4C3J G;  2NN6 H;  3QOJ A;  2FHT A;  1OXT A;  2K6A A;  3D31 A;  3TDQ A;  1RKN A;  1YNJ C;  1DOK A;  1UUP A;  1ILQ A;  1TKW B;  3D3R A;  3RD4 A;  1M8A A;  3K58 A;  4OIK A;  3QG1 A;  4KY7 A;  1A15 A;  1JCK B;  1F9P A;  5CV8 A;  2EYM A;  1E2W A;  1AZP A;  1Z47 A;  1Y1V B;  3IFD A;  1ZKO A;  1RHP A;  3I91 A;  1DCZ A;  3ZYY X;  5KNB A;  1I6H B;  1LV9 A;  1O80 A;  2WB1 B;  4TRD A;  4HED A;  1I4Q A;  1A3V A;  1EY4 A;  3PMF A;  2MHV A;  2PZU A;  3KBG A;  5A2Q L;  1M4V A;  3TN2 A;  3K5N A;  2AQ2 B;  3NTH A;  4KHV A;  3T53 B;  2SDF A;  4DGZ A;  1CA5 A;  3G6J B;  1D5Z C;  2JA6 B;  1L0X B;  3A8K E;  4U68 A;  1LT5 D;  3TZD A;  4C3I G;  3S1M B;  3J80 E;  4Y7N B;  1Q1E A;  2AUJ D;  1STB A;  4YIJ A;  1SNQ A;  5JEA H;  3CRL C;  4K5V A;  1BQQ T;  3FEW X;  2B2Y C;  3M7N A;  3S1Q B;  1XTC D;  1I6V C;  2NVT B;  5EKI A;  3AU7 A;  2XWJ B;  2BE5 D;  2MGS A;  4B9X A;  1DOM A;  4K2L A;  2F0T A;  1TWC B;  4CKC A;  1RD9 D;  1VDZ A;  5ELB A;  4WOR A;  4ZK9 B;  3SK6 A;  2OT2 A;  5JPN C;  1JOR A;  3KF8 A;  2DNC A;  3K6O A;  4FF2 A;  3DXJ C;  2A6E C;  2J7Z A;  2WV6 D;  2X69 A;  5KGU A;  1W6J A;  4XYQ A;  1ESF A;  1CZW A;  3OW7 A;  1V1P A;  4A3D B;  3BVG A;  2F0J A;  3VR6 A;  2PO4 A;  1H9S B;  5BN4 A;  4IN3 A;  2F0S A;  4KV6 A;  2I46 A;  2N55 A;  4L8J A;  3CQZ B;  1LTI D;  4UAI A;  5I6Y A;  1Q90 A;  4G57 A;  4HSP A;  5IGF A;  4FXK C;  3LX0 A;  3ND8 A;  1IHZ A;  1U4L A;  3MTS A;  3TZU A;  4XQJ A;  1S5E D;  2B2V A;  3S17 B;  2IW3 A;  3GTJ B;  4Q5V A;  1EEF D;  1LT6 D;  4L6T B;  5FLX E;  4FXG C;  1CZG A;  3MXG A;  2O4X A;  3MFY A;  2F0W A;  4C56 C;  4QUC A;  2Y0S B;  4ILW A;  2KVM A;  4H13 C;  2EYF A;  1C48 A;  4R8N A;  4M1U B;  5K36 G;  1KDC A;  3BVZ A;  3E6Z X;  2ID0 A;  3MXU A;  1R4P B;  2RVL A;  3FKI B;  1PRT D;  4I65 A;  4RCO A;  2EZV A;  3I70 A;  1Q3L A;  4A3M B;  2Z1C A;  2HUG A;  3EVQ A;  2WAQ B;  2F0N A;  4FF3 A;  1BCP D;  4J8Q A;  1KAB A;  3OMC A;  1FGB D;  1UAP A;  3E0J A;  5I2Y A;  2E2H B;  4HMJ A;  1EU3 A;  4O1N A;  2PQE A;  1K8O A;  5IGB A;  1EFI D;  1EWC A;  5EPJ A;  1SJH D;  1TR5 A;  5T1I A;  3R2I A;  4RGT A;  3A7L A;  3SXH A;  2CVR A;  1Z7T A;  5KIX A;  2R6G A;  1SYG A;  4PMB A;  3BDO A;  2EJF C;  3I73 A;  3AMU A;  2WIN B;  2WAC A;  1DYQ A;  4ZRZ A;  4NDX A;  1ZYR D;  1TQO A;  2B8F A;  4DK1 A;  5FO9 B;  2CW0 D;  3GD7 A;  2EDG A;  2L11 A;  1HUN A;  3VR5 A;  1Y1W B;  1CTM A;  4P2C B;  3J80 L;  5D3D A;  3T56 B;  2O2L D;  3PUZ A;  4RWS C;  5I9P A;  2H1E A;  2LFN A;  5DNF A;  1KDB A;  1X3Q A;  1PFM A;  4FXD A;  1SMY D;  5FOB B;  3HOY B;  4QUF A;  3S2H B;  2A6H D;  2HDM A;  1NUC A;  3K5L A;  1ENA A;  1WCM B;  1U4M A;  3F2U A;  3T13 A;  4RCN A;  4K8I A;  4HSV A;  3HOZ B;  3P20 A;  3TP8 A;  1PZK D;  5FO7 B;  3CKI B;  1BNZ A;  1BBX C;  1XXG A;  3OHX C;  4IUT A;  1JR0 D;  2B2U C;  4KKT A;  1RF2 D;  3CRK C;  3I8Z A;  1SNO A;  2WP8 J;  3T16 A;  5CGK A;  4K14 A;  3R2T A;  2ZXR A;  3HOW B;  5JAV A;  4L63 B;  1MSH A;  2F0K A;  4A3I B;  5M3F B;  1TS4 A;  5JPM C;  4CHT B;  2RKS A;  1LT4 D;  4KD4 A;  1XYI A;  3J7A F;  3J81 E;  1A2T A;  1A3U A;  5KND A;  4K5W A;  5M5X B;  1SDF A;  3D4R A;  1VF5 C;  4KKU A;  3M4Y A;  2DY7 A;  2EY6 A;  5LL6 S;  4XT3 B;  4NMZ A;  1F2M A;  5DAU A;  4KJN A;  2ZT9 C;  2BA0 A;  2EYH A;  2KED A;  3GO5 A;  1PRT F;  3MVV A;  4QIW B;  4H7B A;  4A93 B;  4FVM A;  5FLX L;  2TSS A;  1CQF A;  1BCP F;  4CGY B;  2F0V A;  3I4L A;  1HFG A;  2NN6 G;  2VXW A;  2JEB I;  4UDU C;  1WTX A;  4KY5 A;  4C3H G;  4J1M A;  1D5X C;  1EL0 A;  2Q8R E;  1TWH B;  4RGN A;  1NAP A;  3NTK A;  2VUM B;  3MXN A;  3OWF A;  4C2M B;  4RGM A;  3VYU A;  3Q0A A;  3S14 B;  2K7V A;  1G2T A;  4BA1 I;  2RDG A;  4C3J B;  2ENB A;  3DEO A;  2Z4I A;  3JAM E;  4A3K B;  4FF1 A;  1HCZ A;  1SBB B;  1YNN C;  2K05 A;  5JVH 3;  1K83 B;  3BVM A;  1EIG A;  1SAP A;  2XIW A;  4V19 0;  4QB4 A;  2MPM A;  5IGC A;  1CHQ D;  1MD2 D;  2BOS A;  2Z8L A;  2IJ0 A;  1PLF A;  4I7Z C;  4H44 C;  5CR3 A;  2HCI A;  3HRZ C;  2XSC A;  1Y8P B;  2C5C A;  1BUV T;  1XX8 A;  3OOC A;  3FDT A;  4BA2 I;  1F9S A;  2IL8 A;  4K5X A;  1IW7 D;  2NUC A;  3DHQ A;  3NE5 B;  1STE A;  5JEA G;  1D1I A;  2BA1 A;  4FYD A;  1PFN A;  4PQX A;  5C3X A;  1CK1 A;  3QIA A;  2NYZ D;  4C3I B;  2PW7 A;  3OIP A;  1LAB A;  2L5T A;  1SYC A;  3OMG A;  1QJO A;  3I4M B;  4A3J B;  4TKO B;  4R9W A;  2PZT A;  1S5D D;  1DJR D;  2MJ8 A;  3Q23 A;  1C4Q A;  1KTK A;  4EQN A;  2DNE A;  2A73 B;  3HOX B;  4KN4 C;  4IFD H;  2E2D C;  3D4W A;  1D5M C;  2PYK A;  1LAC A;  3GV3 A;  1PTO B;  3GTK B;  1T5E A;  1KLG D;  1BOS A;  3NQT A;  2F0P A;  1QG7 A;  1PYW D;  2EE1 A;  2PNR C;  2O5I C;  2AUK A;  4IUU A;  2A68 D;  2NB0 A;  1KLU D;  2VB2 X;  3A55 A;  1O7L A;  4ZUI A;  2JEA I;  3M7G A;  4LJZ C;  3M4O B;  5C0X I;  1ESR A;  3HZX A;  1HA6 A;  2OEO A;  1X3P A;  4OGQ C;  3RUZ A;  4N9P A;  4JBW A;  1HUM A;  1AP0 A;  1PTO D;  1I4X A;  3J81 L;  5IGE A;  5ELE A;  4OHJ A;  2JSO A;  1J9O A;  2F0Q A;  3C46 A;  1K8M A;  2ICI A;  2FIN B;  3HOV B;  5D3I B;  1SE2 A;  3K7A B;  5CV4 A;  1U9R A;  1EEI D;  4CJ2 C;  1ZEQ X;  2F03 A;  3I4N B;  3SR1 A;  3FPU B;  2QCP X;  3IKJ A;  3OIQ A;  2EVB A;  1PXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...