1X3SA

Crystal structure of human rab18 in complex with gppnhp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
177
structure length
177
Chain Sequence
DEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human Rab18 in complex with Gppnhp
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords Ras-related protein Rab-18
total genus 61
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x3sA00
2XJ9A 3CF2A 4BRUA 1N5IA 2ZE6A 2CE2X 1ZM3A 3SBDA 3QXHA 4EDHA 5JBQA 1JR3A 1OFUX 1JXMA 1G8PA 1NKSA 1SXJA 2ZJOA 3B9QA 3FPAA 3PUZA 3L43A 1E2GA 1EWRA 2AXPA 1OYWA 2F1HA 2VL7A 3OFNA 4TTPA 3UXMA 1KI4A 4HZUA 3T1TA 2RGDA 3TAHA 3IQXA 1N6KA 2EW1A 4GP6A 1XB2A 2OCYC 2O5VA 1B23P 3T1OA 1P6XA 3ICEA 3LY5A 1SXJD 4IOLA 5L3SA 4Z54A 3AVVA 1OHHD 1F48A 2A3RA 3S1AB 3Q72A 1VMAA 1SVOA 2ZRNA 4DB2A 3QPWA 4MKIA 2Q3HA 4KYUA 4LC0A 4D4JA 4N0EA 5EP4A 5F2EA 5CB6A 2YC4C 3OFND 4EFLA 4FXPA 1T9HA 4OI2A 4BLRA 2ZI3A 3A4MA 4JLAA 3KXKA 2ZR0A 5FOVA 5J4YA 1E2QA 4GP7A 2QZ4A 4A36A 5DO9A 1KMHA 1FX0A 4L9SA 5KPJA 1JBKA 1E2IA 1MH1A 3CBQA 4LHWA 1GNPA 4XH9B 2G0TA 1XXHE 2O8DA 5EXXA 1NKTA 3CUEF 3K0FA 1GIAA 3W34A 1X6VA 1XTKA 2A30A 4WAUA 1NY5A 4AWXA 2FSIA 3DM5A 4BASA 5K8TA 2R6FA 4NYMQ 4I1SA 2R44A 2ZSFA 5H1YA 1B0UA 3BERA 2QRNA 5LPNA 5EJEA 1XZQA 3W8RA 2IEZA 5LBIA 4PQFA 2W0MA 2V7QD 3OAAD 5JZVA 1UKYA 2DWPA 1U81A 2VA8A 4EQ6B 2WHXA 3CX6A 1N25A 4G5OA 2HDNB 5CJPA 3MGCA 5TVKA 5AUOB 3R9IA 3KL4A 5CK5A 3BJIC 5EXPA 4PHGA 3THWA 3HPQA 5D3QA 1HV8A 4TSFD 2RH5A 1TEXA 1SVKA 3A8TA 3C14C 2VHCA 1TF7A 4FI3C 4MKFA 5JRJA 4PO1A 1R0ZA 4NL4H 4TL8A 1VYTA 5JJIA 4BGDA 3FKSD 4R7ZA 4RFSA 4R71A 3O47A 1RKBA 4II7A 4MITA 2AKYA 3AF1A 1FMLA 2ZI4A 4IXNA 1TMKA 1QF9A 2FPLA 1G8HA 2G6BA 3AVWA 1U0LA 4TLDA 3AVTA 3TVDA 2O8CA 1VECA 2XOKD 2ZI6A 1KIMA 3NDBB 1OJLA 1Z6TA 2PZFA 4US0R 4BZXA 1ZNZA 3QVUA 4QOSA 5GVSA 3HU2A 3MAAC 3TW4A 2R2AA 1FNMA 5CIQA 3CNLA 4W9MC 1LW7A 4ZCMA 3NDPA 2GCNA 1DG3A 1KAOA 1XMJA 1SXJE 2W83A 2EYUA 2FZ4A 2IXFA 2OFXA 3UPUA 4LHYA 1XTSA 4A82A 1Z3IX 1Q3TA 5EXTA 2JLUA 1ZNWA 5LD2C 1TTTA 3FDIA 2XJ4A 4PC2A 4PQYA 1D2EA 4MYHA 2WSSD 2XNDD 1Z6YA 3AGPA 2V4ZA 2QAJA 1J8YF 4G1UC 5FL3A 1XZPA 1YVDA 1RRPA 5GADl 1IN4A 3GLIB 2IL1A 4OJQA 1GTVA 2ZETA 4FW9A 2GJSA 4C3ZA 2GAOA 1E2KA 4LJ7A 4BFYA 3A4LA 1MKYA 3D6TB 2Y8EA 3PCRB 2PT7A 3NHAA 4NPHA 1FUUA 4YXWA 4CEIA 2H5EA 2G3YA 1G7CA 1W49A 1HY3A 2F3TA 5JJKA 4JT4A 3VAAA 3FHTA 2OLJA 4DLSA 3VU9A 1MO4A 3X1XA 4Q9HA 2IS1A 1KAGA 2ZREA 3DEFA 2YINC 3UATA 2Z4SA 2F1RA 1E1RA 4XD7A 5A0FA 3NH6A 2BMDA 2V3CC 3X1WA 2RKOA 1BMFD 4TMZA 3L0PA 1FMJA 3QNUA 2O8FA 2C03A 4PC3A 5SZKB 2O8DB 3A37A 1W36C 1AN0A 2NZ8A 2A5DA 4KFTA 1YZQA 2IEYA 4FCWA 3DOFA 4TMXA 2R6GA 4WOPA 1X1RA 3HYRA 3ZS9A 3TR5A 1D9ZA 1YE8A 3B2EA 4DT1A 3F5FA 1XD8A 1GZSA 3D31A 4K8OA 1KK1A 4JLVA 1E1QA 4CEJB 4Q66C 1KO1A 4UXHA 1P9RA 1Z28A 3U3RA 4M22A 2G77B 4JT2A 2VPPA 4UNPA 2UZ3A 5EQTA 3W8NA 2JLXA 2PL3A 2WMNB 4PO9A 5FBWB 1NNEA 4HDOB 1KO8A 1FUKA 5FPTA 1RRGA 1UBFA 1XD2A 3ASYA 3AP1A 1CIPA 4EAQA 3KB1A 2R9VA 4QM7A 1WDTA 5CIWA 3T12A 4TYNA 3IDQA 3K0EA 5EE0A 1MO6A 1JEDA 1R0XA 1ZD1A 4QC2A 4ITRC 3RAPR 1N6RA 5AUQA 4LDJA 1UAAA 2OHFA 1CKEA 2CCJA 4B35A 2BEJA 2IHYA 4W5JA 4B2LA 2GAAA 3WYFA 2C2HA 4QHTA 1KGDA 3U61B 2VLIA 2OFOA 3AVPA 1S3SA 4PC6A 2ZJ5A 2AFIE 3AUYA 1HTWA 1XMIA 2J9RA 2MMGA 3QPUA 2NPIA 2QEQA 4O0MA 2IT1A 1N6NA 2VP4A 4HZUB 1JI0A 3PIRA 3UIEA 2F9MA 3AKDA 2H92A 3HR7A 3L0IB 2ZUDA 2F1IA 3K09C 4QNMA 1TF5A 5EZ5A 4E5UA 4YMVA 3E2IA 2C78A 2XSZD 2FF7A 4BFXA 1EFCA 5F9FA 5AJXA 1T0HB 3RSOA 4A8JC 3SZRA 3ADKA 4FMDF 1ZMXA 2GEVA 3I1FA 2V54A 2PBRA 5FI0B 4A1FA 3D3QA 4GBMA 3K1JA 5E7IA 3QE0A 3U7FB 4XVUA 1Z0JA 2GXQA 2IUTA 5C18A 3I8XA 4HUQA 4JLMA 4RKFA 1SULA 3H84A 1SHZA 4YMSA 4O2RA 1WBDA 1WQ1R 2PX0A 4DLUA 3EIQA 2VHUA 3OZXA 3VNUA 1UDWA 1NP6A 1KDPA 2ZRAA 4I1OA 2WJJA 5JRZA 3K8YA 1H8HA 2J0UB 2RHDA 2BCJQ 4MYTA 1EFHA 3ND9A 1G3QA 3QSYA 2NO6A 3BWDD 2ZJYA 2VP0A 1LS1A 5FTMA 1XTQA 2GTPA 3W6OA 1IM2A 2GJ9A 1G16A 1BO6A 3F3YA 4CDGA 1L4YA 3RWMB 1DVRA 1I2MA 1OXUA 2F9LA 4AYWA 1KK3A 3A6PC 1NF3A 2GVZC 2REOA 1L8QA 4KO8A 4LJYA 1X8KA 3T06B 1OSNA 4M1TA 4BUJA 1J8MF 1E2EA 4HB3A 3ADCA 1KK2A 3PVSA 1NL3A 3CPEA 4Y0AA 3ZGXA 3D8BA 2XTNA 2B7CA 4MYCA 2XITA 3EIEA 2Q0HA 3U3MA 2PX3A 1C1YA 1YZLA 4Q4JA 1RC8A 1CRPA 4B71A 4OK6A 5HE8A 1S8FA 5DLQC 3GLIA 1NBMD 4JSYA 2WIAA 1AS3A 1T3SA 5ANRB 2RHMA 2FX3A 1ZM2A 1W46A 2XAUA 3G82C 3VX3A 1P62B 1U0HC 2WJVA 3EA0A 3QJYA 5EP2A 4WZBE 5FBLB 5HR5A 5J4HA 421PA 2ZQ5A 3MFYA 3PUYA 1G6HA 3FVQA 4BFWA 4E07A 2DWOA 1NN5A 3SJCA 1AIPA 3TNFA 2NO1A 2NPFA 4G01B 2VIIA 4QJ4A 2Z5FA 3AKCA 4FWTA 1HEIA 4FMCB 2HXSA 1ZUIA 1XEXB 3GJ8A 2FU5C 2FSFA 4JYBA 4M4SA 5BWMA 4YDSA 4LJAA 4PSAA 2ASEA 2GZDA 3CH5A 2CVFA 5BYKA 5AUPB 5FFMA 1A5TA 1KY2A 2HUPA 3W90A 2FSGA 1Q20A 1Z29A 4A8JA 2F55A 1DOAA 5B58C 2GXSA 4LV8B 3DZ8A 1N6LA 4TQAA 3U5ZB 1LFDB 4UJ5A 1ZRHA 2WJGA 3REFA 1G20E 2W58A 1R5BA 4B44A 3N2IA 4LJ8A 4IDQA 4LX0A 5J47A 2JATA 4D2IA 4B3GA 1AGRA 3FB4A 4HAVA 3WNBA 1PLKA 3VR4A 4EJSA 1J7KA 3EZ7A 2WJYA 4B32A 2VP9A 2FFQA 821PA 2Q3FA 1CXZA 4I1VA 4FD2A 4IFBA 1G8YA 3RC8A 1AQYA 3FMPB 4FMCF 1T3HA 5KNDA 4Z8XA 1SVMA 3LDAA 3CF0A 2JLYA 4OJKA 1XTIA 1Z2AA 3EIHA 4QBGB 3NVAA 1IN7A 1QHYA 3BS4A 5HE9A 3U7EB 4MUAA 1R2QA 3CZQA 1ZC4A 3SI7A 1UFQA 1G3RA 1G4AE 3H2YA 5AWFC 3Q9LA 4GOKA 2PH1A 1E6CA 1G9XA 5DE3A 3CR7A 1FPMA 5FI1B 2D74A 2OLKA 1Q1QA 3HP1A 3LBNA 4IFEA 1TNDA 5JEDA 4PC7A 2NQ2C 1XJCA 4Q1DA 3W5JA 3R20A 1OF1A 3I61A 4PO8A 2JLVA 3SQWA 2GILA 1D6JA 3C8UA 4A0FA 2XNDA 3OHMA 3I3SR 4NYJQ 2ZROA 4V03A 1GITA 2CXXA 1XCGB 4F38A 4AY2A 2J46A 3ZIAD 4UXJA 4X8HA 4IDOA 2HF8A 3AB3A 2QMUA 1KKLA 3P4YA 1SKQA 4B3DA 2WJHA 2WTUA 4UNQA 4YMUA 5FPKA 4URWR 5AJWA 1TL7C 2WPDA 5JHGB 1W1WA 3OIVA 4IOKA 3NH9A 3RRYA 2IYQA 2O8BA 3IILA 1EXMA 1GKIA 1Q22A 1YRAA 2ZE5A 3C41J 4MRSA 4B2PA 3HWSA 4NMMA 3B1WA 3IQWA 2A5JA 1QHSA 4IVRA 1ZIPA 1ZAKA 1KDTA 3AKEA 5CB8A 1YZKA 1W7AA 2XGJA 1OYYA 3LQQA 3Q5EA 5FTLA 2O8BB 4O3MA 3HDTA 3Q8XB 5FR2A 1R8SA 3EZ6A 2IW3A 2WV9A 1VHTA 4V0NA 1Z83A 3UWOA 4XSHA 1PZNA 4IRUB 5BN5A 5JLJA 5L3QB 1HE8B 2BV3A 5FBQB 1KI6B 4BZPA 3DVLA 1CBUA 2F3RA 1QZXA 1VCNA 3M0EA 2IYRA 4W7SA 4NCKA 1ZINA 4NBSA 2ONKA 1M74A 1V43A 5KHOC 4X8MA 1NMXA 3SJZA 2CCKA 1HT1E 4FMDB 1ODFA 5GJBA 1CJUC 1Q57A 2R6CA 2HV8A 3BFVA 1ZJ6A 3RVBA 2WBLC 1V5WA 3N5CA 6Q21A 3QIAA 1Q44A 4QXAA 4OHVA 5FR1A 1G18A 5JWOA 4IEEA 1AZSC 5CLLA 5JSZB 3LA6A 1KOFA 3C15C 3DO6A 2D4HA 3KJHA 4D0GA 4M1WA 2BBWA 3JVUA 4DEXA 1T91A 4JJZA 4V0KA 3ZQ6A 3DKVA 3B60A 4DLZA 1FTNA 3GJ5A 3TSOA 3G0HA 1ZD9A 3FKSA 5G41A 1P4SA 3NEJA 4XVQA 4D0NA 3R7WB 3QOFA 2UKDA 1N3BA 3K70D 1XP8A 1XCPA 2AXNA 4M1SA 4CRWB 2D3WA 2J0SA 3ZS8A 3H86A 3ZQJA 1JB1A 3EZFA 4KCGA 4A6XA 3DHWC 2V7QA 2FEOA 3C4JA 1E0KA 4DLYA 4KJZA 1PLLA 2J87A 1JALA 3RRNA 4M53A 3L0SA 1U90A 3B1XA 4PANA 4PPFA 3ZZTA 1NLYA 2LCFA 1AS2A 1CR4A 3W3ZB 5EE9A 3LVQE 4IOJA 2YC2C 2IXEA 4HB4A 4HUTA 2OXRA 1Q0UA 2QT0A 2YVUA 4M1YA 1IN6A 4OL0A 1LS6A 2EFHB 3GEEA 1RE0A 1XXHA 5E95A 1UBGA 2ZSAA 4LHXA 3IKJA 1VCIA 3TVTA 1H8EA 3RHFA 4XD7D 3U3OA 2VSOA 2QBYA 3KQLA 1MO3A 1U2RA 2RAPA 1OB5A 1KNXA 1T3LA 3RANA 1EESA 1TQ2A 4YONB 4TL7A 3NEYA 4LYHA 2QE7D 4F4JA 4MYUA 4A15A 4NTZA 4I99A 2OUKA 4HB2A 2IBMA 3OEED 3VHXA 3SC3A 1SXJC 2ZYWX 3IBGA 3KFXA 3ZLJA 3TKLA 5JCZA 5JFGA 4Q1FA 2PMDA 1M2OB 4DEYA 2OEPA 2Z6VA 4OHYA 2IA5A 3WHKA 4ABYA 3KXLA 1W36B 4OQXA 3SJBA 1N2CE 2OV2A 3IIJA 4MRPA 4D4MA 2ZRDA 1HQCA 4PFSA 1N0UA 1N6PA 4BECA 1DAEA 1WMSA 3AVYA 2N46A 2RGNA 4O2LA 2ODEA 1KZGB 1MR3F 4JBYA 1Z0FA 3ZJYA 2ZE8A 2BJVA 1OB2A 2OZEA 3FMOB 4URVR 4CYMA 3GLFA 3KXIA 1T5LA 1GKYA 1WB9A 4ZPXA 4CGZA 2R6DA 4KBFA 1TUIA 3BB3A 4DJTA 4B3CA 2EWWA 1IJEA 1DAFA 3GP8A 1XJQA 2ZVPX 1VG1A 4HLUC 4DSOA 2ZSBA 1GSIA 2QQEA 4DCTA 2IF0A 1MT0A 1FP7A 4YMWA 1VYUA 2ANCA 2JEOA 3MWJA 5KU1A 4AG5A 3Q85A 3GCGA 4LV5B 4AD8A 1E96A 2EFCB 2NO7A 4NDZA 1GFIA 3QF7A 4TZ0A 3WMGA 3K0AA 3TR0A 3OAAA 1W48A 2ZJ2A 4PAMA 3OEEA 1E9FA 4ERNA 4KAXA 4RCYA 2E1RA 5FOXA 2MMCA 4BFVA 1SVSA 2XXAB 4LJ9A 1VG9B 2RCNA 2QP4A 4PZLA 5TARA 1YRBA 4NYJR 3QY0A 2HYDA 3K9LA 2ZU6A 1H8ED 1CR2A 2H18A 4WXRA 2FJUA 1E4YA 1E94E 1IBRA 1KZ7B 2BBTA 4B3FX 4DSNA 5JWHA 2EVWX 1CJKC 1DPFA 1YZTA 1Q1EA 4XVRA 4EJSC 4DCSA 4KVGA 2GK7A 1I4DD 1XBTA 2EWVA 2KJQA 4G0NA 1NBME 5E3HA 2CL0X 1L4UA 1KHTA 4OI1A 2ZRBA 1NSTA 2CHQA 4B3XA 1OH5A 3U7GA 2XB2A 1VPLA 3TUIC 3UK6A 1NG9A 4LGMA 3EX7C 1PJRA 5P21A 4OHXA 1AS0A 2ZRCA 4LRWA 4GSYA 3T34A 4RFVA 3NC1C 4AI6A 3C16C 1S9HA 1E9BA 4TQUS 1OFTA 1LNZA 4A0RA 3RS5A 1US8B 3GQBA 2YOGA 1CS4C 1ZD8A 3K09A 4R2HA 2ZIAA 1E9AA 5J5CA 2HJVA 4N3NA 2Q9CA 2HLDA 4D6PA 2B7BA 1UEJA 2QAGC 2ZI5A 3K0SA 3T61A 2ZR9A 3FTQA 1JXOA 5BW8A 3L2OB 4HAWA 2GHIA 2H8KA 2W6JA 2NTYC 2O0KA 1E9DA 5FTKA 2OBNA 5AR1A 2J41A 1OIVA 3PJRA 4ACAA 3QQ5A 3GD7A 2C96A 3LVRE 4DT1B 5A4JA 5KO2A 4WXPA 2ZRMA 5TB5A 1AZTA 3JVVA 2A5YB 2BMEA 1SKYE 5DIFA 1NJFA 3C7KA 2CL7X 3A4NA 3BH0A 4HLUA 4Y0VA 3LAWA 2QA5A 3ZD6A 3N70A 1A1VA 3KZ1E 4X8LA 1RRFA 4D81A 1IHUA 1U8ZA 1IY2A 2PMKA 3X1ZA 1TF2A 4NONA 2WSMA 1MABB 1YQTA 1F3OA 5CK4A 5DSZA 4ZIRB 3VTKA 3UANA 2ZE7A 2GZAA 1YZUA 1IJFA 3KKOA 2HYIC 4URUR 2GXUA 4DB4A 2WPDD 4GMDA 5KDDA 1G17A 4CW7A 2W6ID 2ZRLA 3OE7A 3P32A 4LJ6A 1BH2A 2DY1A 4ZDIA 4Z8YA 1IQPA 4O25A 5AK0A 2YZ2A 1ZUHA 2FPMA 3QENA 2YYZA 3RDPA 1R8QA 3CRQA 3CRVA 1KI1A 1KI2A 4KFSA 4D4LA 3SU8A 1VIYA 3NBXX 3U6BA 4JSTA 3NKVA 3BGWA 1GILA 2IHBA 4M9ZA 4JBXA 4C30A 1E2NA 1KI8A 1W47A 5F3WB 3OIWA 3U4QA 4Q47A 2QM7A 3VR5A 3GLHB 2WOJA 2FGKA 1L7VC 1CTQA 3AEZA 1Z63A 2WVJA 3WNDA 3A36A 1QBKC 3RSLA 3VMFA 2X1VA 1Z0KA 2VHJA 3MLEA 1N0VC 2WMOB 3LW8A 5FOTA 4L4UA 3QKTA 1G8FA 2DPXA 1XU4A 4HZIA 5B2ZA 5A5GA 221PA 3WP1B 2XZLA 1OT3A 4MRNA 2GEDA 2KE5A 4UNRA 2B6HA 4TMVA 1XPRA 3GFOA 1Z6XA 2EFGA 3DOEA 4HLDA 3LFUA 1XNJA 4WZ6A 1BYIA 1ZUNB 2QMOA 4OHWA 3U3KA 3CONA 4W5HA 1QHHA 2F43B 1SQ5A 1H8HD 3C5CA 3FMIA 2L0XA 3HYTA 4IXMA 1NVVR 1FNNA 2RMKA 2WZQA 3OESA 5JI3E 2XXAA 3TUZC 4JKIA 1KDRA 2ATXA 3W6PA 3DMDA 2ZS9A 4BFZA 1Q1ZA 2CBZA 2ZI9A 4GT1A 4NCNA 4WIAA 1DS6A 4LSGA 1QHXA 1M34E 3EZ9A 2FFAA 1XWIA 2O52A 1E99A 1KSHA 2A5FA 121PA 3SEAA 2QM8A 2JDIA 3LX8A 1N5KA 4TMTA 5KUTA 1F60A 2QRZA 2KB0A 1R6BX 4NZYA 4BLPA 5B64A 4WVFA 3SHFA 3ETLA 3VQTA 4UKDA 3HU1A 2ZJZA 1E4VA 4QL3A 1G3UA 4KHZA 4A2PA 1DADA 2P5TB 1E32A 1UPTA 2D62A 3AP2A 1E79D 1ZP6A 2JJ2D 2P6NA 2BEKA 3JZAA 2E9SA 3AF2A 4F92B 3K70C 1COWD 2PT5A 2ZRFA 1R0YA 2CLSA 2OCPA 3LD9A 2HEIA 3AQ4A 3SQXA 2YHSA 1BOFA 4A0GA 4MQBA 3NBYC 2MSDB 4MRVA 1SKYB 5G3ZA 3ZDQA 3QEOA 4N0DA 2OM2A 2GRJA 5LD2B 3PQCA 4IW3B 4NCHA 3TH5A 4I1UA 4PHFA 1LTQA 2Q6TA 1KY3A 4RZ3A 2J7PA 3QUSA 4XWAA 5SZHB 1JJVA 1RJ9B 5CYPA 1X8JA 4MUBA 5DN6A 2KI5A 3ZD7A 2VTKA 2G9NA 4Q02A 2EQBA 4PQRA 1XDBA 3K0FB 2XZOA 2RB4A 1W2HA 3VR1A 3THYA 3H0KA 1W0JA 5GJCA 5IRCD 2IS6A 4EUNA 2V55B 4TL6A 5L3VA 1D2MA 2CE7A 3FE2A 3KQKA 2ZITA 1NBMA 1YR9A 1ZM9A 3BOSA 1YZGA 2VQSA 2VF7A 3PXGA 4G5RA 2GEUA 2NGRA 2QL6A 3G5UA 3U2QA 5JS8A 1QHIA 2JLSA 4C0SA 4XTCS 2GF9A 4ARZB 3IO5A 1E69A 1CR1A 3UMRA 1M8PA 3ZH9B 1G64A 3B1VA 1TU3A 2DCUA 4HAUA 3V9PA 4B47A 2VH5R 4DUGA 1W0KD 2R6AA 1EK0A 4OQFA 3WY9A 1ZYUA 2BKEA 3AM1A 3LO5A 4JLNA 1W5SA 3BBPA 4OI0A 2XTZA 4LY6A 3NIBA 2FGJA 2RGAA 3DM9B 1VCOA 4RFSB 1DELA 4LZZA 1SGWA 2QI9C 2JLRA 1M6NA 1GWNA 2WJIA 2ZJ8A 4FINA 4ESVA 4Q7JB 2JJ8A 4QG7A 2J7PD 2RGXA 5C1BA 4EPVA 4NYMR 2FG5A 1FFHA 4UXIA 4HLQB 1OH6A 3AV0B 4LOAA 3KQNA 1LVGA 3THYB 4JIMA 4OYHA 1HE1C 4H1VA 3GJ4A 3ASZA 1PVOA 2W2VA 4QM6A 3WHLA 3GLGB 2B8TA 2JJ1A 5J40A 1XMSA 2GESA 2RGEA 1K5DA 1N5LA 1S1CA 1JR3E 5HCNA 1OFIA 2EFDB 3BE4A 3PEUA 3I4LA 2AFHE 1E2MA 2AX4A 5DISB 1U9IC 5F9HA 1FX0B 5DI3A 1E1QD 3K0CA 1IOZA 2V8OA 4XSGA 1SZPA 1VKJA 2N42A 3THOA 4Q19A 2BDTA 1IN5A 3IPXA 5CITA 4P4UA 1WBBA 3AVOA 4HDQB 3UWKA 3BB1A 1PLJA 4TLCA 4P31A 1TQDA 1F2TA 3IGFA 4Q4JB 2VHQA 1S96A 2FFHA 2JGNA 2BVNA 4A8JB 1P5ZB 1BMFA 2ZJAA 2HT6A 2GVDC 4LWZA 4FWIB 4RD3A 4EPXA 3B6EA 3GMTA 4QGHA 4J0QA 3SN6A 1E0JA 1N5JA 1FL9A 3VHLB 4C9BA 1IXZA 3K0CC 5FBVB 2YWEA 3AP3A 3QVVA 3GEIA 3B8HA 2CNWD 3DL0A 4KFUA 1U8AA 4GL2A 1UF9A 3O8DA 4EPWA 1Q1BA 2EFEB 1NI3A 1VG0B 5LB4A 2ZPTX 1AK2A 2CVHA 1R5NA 3QXSA 1G5RA 3SR0A 2VSFA 4R9UC 1W36D 3FOZA 1HYQA 3TMKA 2GETA 2JLWA 2VBCA 4E03A 3CPHA 2C04A 4YQFA 4IDPA 3PR1A 4LBYA 1TU4A 1AKEA 2G1KA 1N6HA 4GZMA 1E9RA 4N1AA 4L9WA 1Q12A 3SYLA 4LBZA 5JECA 2O8FB 1FOEB 2ZSEA 1Z8FA 2QN6A 4PPGA 2JLZA 5HKKD 4S2EA 1K6MA 2QG6A 1DAIA 3RS7A 4TYQA 3CLVA 1E0AA 1W0JD 2CDNA 4G3XA 1MOZA 5C4MA 2QUZA 4M21A 3DDCA 3AH8A 4JL6A 2IXGA 4ZV4A 1XJ0A 2GJKA 1G6OA 2OE2A 4LYAA 4B34A 2CHGA 3BXZA 1S2MA 4LV6A 3S1AA 1YR8A 3FYHA 1US8A 3CKLA 4M8NE 1MABA 4Q4LA 1W0KA 4OHZA 4PSVA 4TT3D 2UVQA 1Z07A 5IK2A 1S4QA 4DLWA 3C5HA 1NN1A 2XTMA 1XEWX 2ANBA 4QNRA 4TTRA 1YU9A 4DCVA 2ZRPA 1KYIA 1P3JA 3EXAA 4P3YA 1J99A 1G8GA 3E1SA 1M7GA 1E79A 2ORWA 2AK3A 4YXWD 2PJZA 3ND8A 2C99A 2ZAMA 4OQMA 2GKSA 2FZLA 4CEIB 1GRRA 2GCOB 4RCZA 2OCAA 4ASUA 4DIDA 3B13B 2WM9B 5TY0A 3AF3A 3QI2A 5FPSA 3A58B 4C0AC 5G3YA 5BN3A 4MRRA 1O3YA 3V4FA 4RD4A 4Q03A 2GCPA 2X19A 1FW6A 3WMFA 2KWIA 3BH6A 5KSYA 4LBWA 4QGAA 2D2FA 1W2GA 2CCGA 4PXAA 4U7DA 1DAMA 4EIWA 4EPYA 3LQRA 3LBHA 5UKDA 4ZDKA 5BN4A 1ZBDA 2ZU0C 3EARA 3F0TA 4KYIB 4LHZA 3J81k 5FL7A 5JCPA 3U7HB 2AWOA 3BH7A 2IYTA 3CWQA 4F7WA 5JEEA 4M2LA 3CB4A 1JJ7A 2VHTA 2J45A 4DDUA 1Y3AA 3ECCA 2BCGY 3IIMA 4KBGA 5IF9A 2OFWA 4F91B 3GJ7A 3T15A 2KBEA 4TLBA 3GJXC 4A0HA 3MJRA 4JVMA 5CLQA 3WBJA 4CEJA 4BRWA 4X8OA 2JA1A 1BYUA 4OK5A 1TQ4A 2NMVA 1KKMA 2OBLA 4TN1A 4Q1BA 4YMTA 1GRQA 1FZQA 1J70A 4POAA 3FMFA 3LV8A 2FFBA 4LJ4A 3TSWA 5G53C 5L8VA 3QKUA 1KI3A 4PTLA 4DDVA 4TYYA 2VO1A 4DWJA 2GJAA 2WWFA 3MJHA 4NYIR 2ONJA 4EPRA 2KSQA 3CNNA 4JMPA 3TIFA 1QHGA 2D2EA 3PENA 2IUSA 4LPSA 2WAYA 4V0OA 1PV4A 4Q1CA 4RD1A 4HAYA 4MGIR 1KO7A 3SYKA 1LB1B 4GOJA 4LJ5A 3M1IA 4DLRA 4NHOA 4D80A 3CX8A 2VEDA 1U0JA 2AR7A 2J3EA 1I2DA 3CM0A 2B92A 1UKVY 2QSZA 3IHLA 4M9XA 4DHEA 1NN3A 4JVLA 4GMXA 4ZCIA 1JPNA 5L3SB 1JQJC 2Q9BA 5EUMA 1F5NA 5H8WA 1KSGA 1T8TA 4DXAA 1NG1A 4QBIA 5BQ5A 2EU8A 2ZVQX 4FCTA 1A2KC 3SNHA 3T5GA 2PZEA 2PCJA 1J90A 2YOHA 3Q7QA 3RS2A 2ZYTX 4MH0R 2ZRKA 3ZZ0A 2DFLA 4EQ6A 1UADA 4BFSA 2QENA 4HYYA 5EP3A 3GEHA 2C9YA 4NCJA 2A9KA 5CDFA 4DSUA 4RD6A 1W44A 1ZCAA 1W5TA 4ZI3A 2QP9X 4KLNA 1NMZA 1MRSA 1KNQA 1NRJB 3NXSA 4RZXA 3RNLA 3KDSE 3VFDA 4Q9KA 1XEXA 1NSFA 2DB3A 1PUJA 2PLFA 4JYCA 2J1LA 1A7JA 2G0NA 2QU8A 4AYTA 1Z6AA 2J0VA 1GM5A 3MUFA 4TYWA 2QE7A 4GOXA 4ZDWA 1RPZA 2QTFA 3QG1A 2BBOA 4QFMA 2A7QA 1XF9A 2N1BA 2ZRIA 4PPNA 1KDOA 3THXB 4P4SA 3V4RA 2O8EA 3PEYA 1Z06A 1JAIA 3T5DA 2X2EA 2ODNA 3QG5A 4YDHB 2ZM5A 3OEHA 2XEXA 5LDDC 2WWIA 3BORA 2ZANA 3UMSA 3THXA 1EWQA 2QNRA 2D7CA 2Q9AA 3B82A 3QF4B 3K9GA 1OW3B 4TYPA 3BFKA 2J0QA 2R62A 3QKRA 5HPYB 1P72A 3HPRA 2OSBA 1GAJA 3AVQA 3IHWA 4QHSA 4P33A 1HURA 2CNWA 4WBSA 5DYIA 2GA8A 1ZC3A 3TJZA 4URZR 2C9CA 1E3MA 3HU3A 1N6IA 3QF4A 2GZHA 2WWXA 4LCBA 4KXFB 4Z1MA 4F4CA 1G21E 2QQ0A 3AUXA 4M9QA 2YWHA 5AJZA 2C8VA 5JMTA 3T35A 3WYGA 2V1XA 4MDEA 4G5QA 3KJGA 2W6JD 3KTAB 3NC0C 3QPVA 1UDXA 2P2LA 3PUVA 4V0MA 1X3SA 4A9AA 5KDLA 4NU0A 4TZ6A 4FN5A 3N2EA 1P9WA 2RGCA 3UG6A 1E2DA 3CNOA 2ZS8A 3KKNA 5LB2A 2I4IA 5HZKA 5FUYA 1EFUA 1G1MA 4OK3A 1BIFA 2IYVA 4L16A 1UBEA 4M1MA 3TGPA 2C95A 2FDCA 1AJEA 2ERYA 1WP9A 3D7MA 1OXSC 4ZCLA 2WKRA 4HDCA 1WE2A 3GLIE 3CRRA 1DEKA 2JDID 2CJWA 2ZYUX 4LPKA 4C0KA 2YKGA 1DARA 1GVNB 2GDJA 2DBYA 4DVGA 3I32A 3LNCA 5TV2A 4B75A 3R9WA 3SFVA 4RD0A 3ZVMA 4QRHA 2QROA 1Z0DA 3VR3A 4B43A 1RYHA 4XOIA 1ETUA 1OIWA 5E7JA 1P7CA 4B3BA 2W2TA 2AKAB 2VF8A 3M4YA 3AVUA 2Q3MA 1VDZA 3FGNA 4NE2A 3MCAA 2H17A 3CF6R 2IYSA 1KMQA 1XTJA 1DTSA 2QMEA 2WKPA 3F8TA 1P75A 2OO7A 3TK1A 1PUIA 1RZ3A 2FH5B 1C9KA 1SHKA 3PFIA 4G5GA 5J4KA 3NBFA 4PHTA 4EJSB 3MWYW 3ZVLA 1R4AA 1KJWA 2FWRA 4LI0A 4G5SA 3ICQB 4C0BA 3LLUA 3RS0A 5AJYA 5IDVA 4B48A 2QPAA 3VKHA 1P60A 4JL5A 3GLFE 3AF4A 1QVAA 5IHPA 1T0JB 2XX3A 5KSZA 4DBLC 3MMPA 3H1TA 3AVXA 2FN4A 1JAHA 5CJ2A 1CR0A 1KI6A 1DAGA 4EFMA 3WYAA 5KNCA 1ZU4A 721PA 2P0EA 3GJ3A 2LWIA 2H57A 2VP5A 3GJ0A 4BFUA 3LX5A 1XPUA 5CM8B 1I4TD 2ORVA 2E87A 2O0HA 4JLOA 2A5GA 2IYLD 4Q9IA 1CU1A 1E0SA 2W0SA 4TWZA 1ONBA 1EGAA 1IY0A 4P4SB 2QORA 5GVRA 2AWNA 1IXRC 1DE0A 2FNAA 4TMKA 4HI0E 4OKSA 2CHVA 2Z83A 1ANKA 3P20A 4HEJA 4C2TA 3ZYCA 4KFRA 2VSXA 3BAFA 1QRAA 3DMNA 3OEHD 5FUVA 4YLGA 1GKUB 1Z0IA 1WF3A 2OILA 4B6EA 4XWOA 4NP6A 1E2FA 1T5IA 1D8TA 3EC1A 4EKDA 3PUXA 4IKEA 4AURA 2Z43A 1F2UA 4GDFA 1UKZA 3O8BA 3SYNA 3U44A 5AJVB 5E4FA 4XWKA 3WXMA 4DDTA 1VYVA 4Q01A 5FOWA 1KI9A 2A78A 1OPXA 2CK3A 1RYFA 4JJKA 1MO5A 1T8UA 3QXXA 3REGA 4AKEA 5K8LA 5KPDA 1GL9B 4DIEA 1YHNA 1UJ2A 2NIPA 2EYQA 1E9SA 1CJVC 1D2NA 1VHLA 4TLAA 4U5XA 2F1JA 4IHQA 2ZXUA 1OE0A 3QXCA 3A1UA 2REXB 5SZJA 4GNKA 4DZZA 2JIZD 3RWOA 5CDFE 2HCBA 4DLVA 2YWFA 1K5GA 3TAUA 3KKMA 4D0LB 1NVWQ 5C2JB 5DGXA 4JLPA 5EZ6B 1QVRA 4BE7B 1GNRA 2OESA 1OH8A 4ZKDA 2Z4RA 3GPLA 3I5YA 4D26A 4BLOA 5D3MB 1DAKA 4QJ3A 4KODA 4OBEA 4R2IA 4Q48A 1XTRA 1GNQA 1P61B 2YNMA 2IWRA 4AKGA 3LBIA 2HJGA 3SHWA 5AUNB 3AKYA 4FMBB 3U4QB 2ZRGA 1N0WA 2Q21A 1C4OA 3I92A 4OQNA 2JCSA 2NOAA 2ORIA 4B73A 4CZ2A 3U44B 5DHFA 1Z47A 1XCMA 3VNVA 5BYJA 1A2BA 3UKDA 1XD2B 3U3JA 3I73A 4QGFA 1U9IA 3KJIA 5DH9A 2QMHA 5JWRA 4Q1AA 2DHRA 2H16A 2AD5A 5FL7D 3LXXA 3B78A 4B6FA 1G3IA 4AK9A 3T1VA 4B74A 4HLCA 2IS2A 4E22A 4JLJA 5FOSA 1KJYA 1IY1A 5BXQC 2F43A 3VR6A 4KU4A 2YWGA 3LH5A 3FWYA 2QSYA 5G40A 5IT5A 1CJTC 1SVIA 2ZRJA 5DI9A 1WRBA 4RVCA 5JHHB 2HT1A 3RABA 2IC5A 1ESMA 1AA9A 3IEUA 4PHHA 1NIJA 4RZUA 2IYYA 2VYFA 2GWHA 1GDDA 1G291 1U98A 4RJLA 3IBYA 2WOOA 2FPKA 4Q4AA 4RY2A 4TT3A 4ARZA 5IK2D 4M1OA 2D7DA 1W4AA 4A92A 1W4CA 3GLFB 4Q7MB 1CP2A 2W6IA 1E2LA 3OE7D 2BHRA 4TTQA 4Q9JA 5EE1A 3FKQA 3WRXC 4IDHA 4JVNA 2V1UA 2FOLA 3MWLA 4A2QA 1KO5A 3CW2A 3Q5DA 2OG2A 5KNBA 4HAXA 1LF0A 3GFTA 2JLQA 5TXGA 1JECA 1W4RA 2C98A 2DR3A 3IPYA 1E2PA 1OHHA 4M1KA 4UJ3A 4Q9LA 5E7MA 2WWHA 3GLGE 2ZYVX 4BEJA 5CYOA 2QY9A 2OAQ1 1NLFA 2ZR7A 4US1R 1AKYA 4HUQB 3GJ6A 2FSHA 3KTAA 3W3AA 4B2IA 1HQYE 3CX7A 2W2XA 4QJ5A 4D4KA 3IUYA 4Q7KA 2SHKA 3TSZA 3MRSA 2PZGA 3OF5A 3L0OA 2QAGA 3BIFA 5DHAA 2AD1A 3CH4B 3KQUA 2IYUA 1ELOA 4UQOA 4B33A 3UMFA 4XTRA 4DKXA 2ZRHA 1SVLA 2HXYA 5FTJA 3K70B 4H1UA 2A2ZA 5TDHA 4K81B 3I5XA 1G19A 1R0WA 2X77A 4AC9A 2DFTA 3RC3A 4ZDJA 4C2UA 3LLMA 3L82B 2BM1A 4LYFA 1COWA 2AK2A 3QXJA 4RD2A 5FOUA 4Z1MD 3A1VA 3R9XA 1M7BA 2GBLA 5HCIA 4PR0A 1UM8A 4KSBA 4GFDA 3KUDA 3DKPA 3WMEA 1MV5A 2GCOA 4AIIA 1G5PA 4WZAE 2O8CB 2WWGA 4P0TA 3RRZA 4U02A 2RGBA 3GLHE 1ESNA 1ZW6A 3Q7PA 1DO0A 3QBVA 3IIKA 4Q00A 3RYTC 3GLHA 3EASA 4DSTA 1NY6A 1JR6A 2LKDA 3K9NA 2FV8A 2XSZA 3BRWD 1KSFX 1BS1A 2CEAA 5H68A 3BB4A 4IVQA 1LF5A 1P2TA 4C0HA 3FFAA 1OLOA 2XB4A 4KITB 2UZIR 2P6UA 1YR6A 2OT3B 4TL9A 1Z0AA 3B7GA 4Q5IA 3VX4A 2QTVB 4URYR 2WICA 2ATVA 2DFKB 1ZNXA 4LBVA 4BZQA 1AGPA 1P2VA 5KOYA 2ZAOA 2QTHA 1UEIA 2DWQA 2H1LA 2FMXA 2GF0A 2OXCA 3TBKA 3PG5A 3EPHA 2WWYA 4B76A 3TQFA 3KFVA 2QBYB 2JAQA 1NJGA 1HA3A 2CLDX 4K46A 4A2WA 2YV5A 3LXRA 4FCVA 1VTKA 2NG1A 2C77A 2QGNA 1TEVA 1UKEA 4UNNA 4BFTA 2GXAA 1CF4A 1D5CA 4C4PA 5CM9C 3SS8A 3QKRB 3GLGA 2J7KA 5F98A 4Q7LA 4IDNA 5FTNA 1II9A 4C7OB 4JS0A 4GZLA 4W5WA 3M6AA 4KSCA 2YJTD 2QP3A 2ZS7A 2I3BA 1LV7A 4Q1EA 2JJ2A 3TLXA 4ACBA 4DUGD 1GG2A 5KTYA 1N6OA 5FPHA 1R7RA 4DDWA 3EPLA 2QPTA 4EFNA 1UBCA 4FIDA 4L8GA 4Q4HA 3NG1A 3CZPA 4F4IA 621PA 3SFZA 4QGGA 2B8WA 4TQ9A 2IS4A 4M9SA 4ZKEA 1E2JA 4U00A 1Z22A 3O8CA 1F6BA 4JLKA 2JASA 4DCNA 1AQUA 2WKQA 2KBFA 4IOMA 1A4RA 4AKIA 3IEVA 3EG5A 2XZPA 2J0UA 3WRYC 1FQKA 1WCV1 4F93B 3PEWA 5ELXA 3SE0A 2ODBA 2CMKA 2CLCX 3IO3A 1VIAA 3CRMA 1YZNA 1IXSB 2ECKA 1IONA 4JZKA 3W6NA 2NZJA 2PEZA 2CJWB 4S35A 4CT5A 2P3SA 4PSKA 3T1QA 1WA5A 2WAXA 3EAQA 4AYXA 4JBWA 2IUUA 3K53A 3NHBA 3EA5A 3ADDA 3BFXA 2OCBA 1OFHA 5D3MA 1CEEA 2F7SA 1T6NA 4WA7A 1NVVQ 3TE6A 2H7VA 3R8CA 4OQLA 3ZZUA 1HT2E 3KKPA 5L3RA 2OAP1 2ZI7A 4PX9A 3CWZA 2V6JA 1G5TA 5HTKA 5EXSA 4DRZA 4NKRA 1E98A 4PAQA 2O8EB 5JJLA 1R10A 4IJMA 1G3MA 1KO4A 4LHVA 1OKKA 3WNCA 1EFTA 2W00A 4V0ME 2J59A 2BWJA 1M7HA 2TMKA 2BBSA 1L2TA 3I72A 4JVSB 3NWJA 1GUAA 2BMFA 1NIPA 1G7TA 1YKSA 2JIZA 2X2FA 2K5UA 4ZO4A 5FUXA 4ZIRA 5K8UA 3VKGA 2D06A 4BQSA 2FA9A 1KK0A 1W4BA 4MKHA 1P2SA 3V00A 1JEEA 1F2UB 4BLTA 5JS7A 1XXHB 4QKQA 2VP2A 4MGYR 1GL6A 3KQHA 1IAQA 1X86B 3BK7A 4IVPA 3P27A 3X1DA 1TAGA 4A4DA 4BPBA 2GJ8A 5KSOA 1OKKD 1Q21A 3DPUA 5L3QA 3ZIAA 3P26A 2YOFA 5J4VA 2VRWA 3CIOA 1KSJA 2WSSA 3L8YA 4I81A 1DG1G 5C4GB 2WWWA 2IYZA 4PAOA 3CRW1 1EFRA 5FBRB 521PA 3AF0A 2CL6X 4PPQA 4TLEA 4BLSA 1ZNYA 2P6RA 1O87A 2RGGA 4WW0A 3EW9A 1YR7A 2AN9A 2RGNC 1S3GA 3KUCA 4KVAA 3U6KA 2B21A 1TPZA 2QT1A 1OXTA 4EPTA 2G1JA 4HATA 4US2R 3VR2A 1RVDA 1CLUA 4QHYA 1S0UA 3THWB 1F2TB 2HF9A 3KKQA 1FTSA 3ADBA 4XIGS 2ZTSA 3Q3JB 1S9DA 1RFLA 1E9CA 2BC9A 2IYWA 4JLDA 2V9PA 1VCMA 2QAGB 4MGZR 4P4TA 3CO5A 3SDZA 1G41A 3NTUA 1TQ6A 1ZIOA 2C5LA 1OIXA 2DYKA 3EWAA 3R7WA 5K8IA 2QGZA 3OIYA 1XPOA 2PJRA 1G4UR 2BMJA 2HLDD 3HR8A 4YC7A 3DZDA 3ONWA 1Y63A 2DFNA 3L8ZA 1BKDR 1J2JA 1E2HA 1XMVA 1YJ5A 1ZM7A 3H4MA 3NBZC 4JL8A 4C0LA 2XNSA 3MSXA 3K0AB 4L5BA 3P1JA 3PV0A 2R8RA 5GJWC 3EWSA 2REBA 4Q18A 4MKGA 1KTVA 3LW7A 1GP2A 1KMHB 4LC1A 1Z2CA 4GRAA 1K8RA 1KJZA 2BM0A 1KI7A 4I4LA 4R98A 3I62A 4BWYA 4C0JA 1II8B 3SOPA 4AG6A 1MRNA 3B85A 1RRCA 4PZZA 4KV9A 2VP6A 2ZEJA 4IEIA 2PEYA 3GFPA 3EZ2A 1S1MA 1WXQA 4OI4A 1E9EA 5DN6D 1QHHB 3KX2A 5KDOA 1NMYA 3QKSA 5H70A 2GNOA 3MWKA 3QEJA 2OBMA 2ZUBA 3TRFA 1QHNA 4QBFA 3RRMA 4DLTA 4C0QC 4V02A 1JR3D 2AL7A 4JLBA 2BKUA 1Q3HA 1ZVQA 1OH7A 4GPTA 1JNYA 4ON9A 1GL7A 3VKWA 4Z51A 1D9XA 3KJEA 4UNSA 5GJVC 2IK8A 4PZYA 2I1VB 3PUWA 1A82A 1JPJA 2FEMA 2BJWA 2ZJBA 1T4GA 4MGKR 1DAHA 2IWHA 4CIDA 2NO9A 1R5OA 1U94A 3MD0A 4JKYA 5EUQB 3B5JA 4DLXA 3VU9B 1QG4A 1VG8A 3LWNA 4LK2A 4Q4AB 4ESHA 1II0A 1HH4A 1X1SA 3FHCB 1EG7A 3HJNA 1RIFA 3B1YA 1E1RD 1RJ9A 1JQLB 2GBLC 5C46F 1Z5ZA 2CK3D 4HSEA 1TADA 5KSPA 2P5SA 3TQCA 1II8A 1Z6GA 4CVNA 3W5IA 2MSEB 3EPKA 1Z08A 2HCJB 5DYGA 5HKKA 1XEWY 2IX3A 1XD9A 3TW8B 1EX7A 2XOKA 1TX4B 3E5HA 1H65A 1RW4A 4KLZA 5HZHA 4NCIA 3ZVRA 4PC1A 4Q4HB 4HB0A 1M1YE 3UG7A 4DC9A 2AHOA 2MSCB 3KB2A 5FUWA 3SJAA 3PITA 4H9GA 3LRPA 2R65A 4BLQA 1G7RA 5KYKA 1GRNA 2GK6A 2G83A 4RSGA 3B9PA 2V6IA 3BC1A 3RS4A 2ZSDA 4M0LA 2BOVA 1EX6A 1ZM4A 4V0LA 4D25A 3U60B 3I8SA 3A1SA 4TSFA 4MDFA 1DO2A 3R8FA 5EP1A 1P9NA 2PLRA 1XFAA 1U8YA 2PCLA 2F6RA 4KI0A 3SBEA 4CT4B 1ZU5A 3JZMA 3ZVNA 3K9HA 5B57C 4Q21A 1CRQA 1QDEA 4LUCA 2BIFA 1OXVA 3OIUA 4RZ2A 3TUJC 3W9YA 3O8RA 2C9OA 2NO0A 4ZI2A 2FE4A 3EC2A 5B30A 5DNYB 4MA4A 4TMWA 5TMPA 5FPYA 2ZUCA 1AM4D 1NVXQ 4CEHB 2Z0MA 3P4XA 1DBSA 1TUEA 3CR8A 4P32A 3EPJA 1U99A 1GOTA 3CPJB 4NYIQ 5EE5B 4URXR 4XJXA 1NLZA 2IYXA 1FP6A 1XRJA 4L15A 2IF2A 3QBTA 5SZIA 1FQJA 3AGQA 2X8AA 3B1ZA 3FHOA 5DI3B 4CEHA 3E70C 1NVUQ 2I1QA 4CF7A 1CULC 5JI2E 1HUQA 5M04A 4C7OA 2ODWA 1G7SA 3X2SA 4QBHA 3RS3A 3PEVA 1CJMA 2O0JA 1EFRD 2P65A 4A6PA 3MG9A 2ERXA 4ILEA 3WP0A 4RKEA 4E09A 1XEFA 2G88A 3QKSB 5J4LA 8OHMA 4HAZA 4D82A 2JJ1D 1I4LD 4NH0A 1QG2A 1ZCBA 2P67A 1OV4A 2WIBA 3BD9A 1P73A 1LY1A 3A1TA 4AKHA 3X1YA 4ASUD 4LYJA 2J5XA 4BEBA 1NN0A 5JSZA 1SVWA 1IN8A 3WBKA 1OXXK 1X8LA 4GI7A 3A1WA 1XX6A 3RLFA 4DCUA 5EE3A 2LKCA 5FH9A 3FFBA 1SXJB 2QPOA 1P2UA
chains in the Genus database with same CATH superfamily
4JEMA 3CF2A 3NU1A 5JQGF 5C7YA 2NUAB 4EGQA 1RABA 1LBQA 1RHRA 5BURA 1HL3A 5JISA 2R47A 2HRRA 2R60A 2D1TA 1RP1A 2JBAB 3FWNA 2ILTA 3NI2A 2ZE6A 4E5KA 3EY9A 3N28A 1IIRA 1SY7A 4Q82A 1G8PA 1SXJA 3E5NA 3FTPA 3PUZA 3AR2A 4MNTA 1A76A 3C3WA 3ZLUA 1AF4A 4F71A 1A9PA 2CKMA 2VL7A 2ZJFA 3T38A 5F4BA 1YC5A 2WJPA 4JCOA 1ILEA 5JYEA 3DYVA 3T1TA 1W93A 2RGDA 2YBEA 4PGHA 3IQXA 4D0SA 5JQWA 2YWRA 3L84A 1UUFA 4KE6A 3WGTA 2EKPA 4BNUA 2EZTA 2OCYC 5K0NA 1FDIA 3FTDA 3ICEA 1MAHA 4LKRA 1WXIA 1OWOA 4QUIA 1ZHOA 3I04M 5TJHA 4ISCA 3ZZNA 2ATCA 4I5IA 2I29A 2D0IA 4NE9A 4YAWA 2QRUA 1ISIA 4OLFA 2ZRNA 3NHFA 5JVDB 1OMOA 4XRGA 3AHDA 4DB2A 3W9UA 4LRSB 5THKA 1RXYA 4ZALA 5CB6A 3GDWA 3DEKA 4CNQA 4EFLA 3EQ2A 2PS0A 2R7AA 4D92A 3KXKA 1DIAA 1E2QA 2VDWA 3EXG1 4L9SA 3QV1A 1P6QA 4UBJA 4G4JA 2BUBA 2MR5A 4AQYB 1P5JA 3TZ6A 1CQWA 2Y1LA 4DYVA 4QG3A 3LYHA 3ZLTA 2X1HA 4Y2PA 1NJSA 3SYTA 1WZEA 4OOFA 1GIAA 1X6VA 1GA6A 4FZVA 2ET6A 4EZEA 3OCUA 3EGIA 2HIAA 3M5WA 4AWXA 5K8TA 2R6FA 3T9CA 3K1ZA 3PPYA 4I1SA 1JDJA 5A0VA 5IF3A 5IC6A 1RLTA 1YAHA 4ZYVA 2HO5A 1C4XA 1CNEA 1XZQA 2CBXA 2RAFA 2JI8A 3CHYA 3D7KA 1U2DC 3HACA 1A9XA 2A1IA 2I4NA 5LBIA 2W0MA 1R4NB 1KXJA 3GFGA 1W87A 2DWPA 3MXTA 4FYKA 4EQ6B 5FO0A 3RTGA 3AFHA 4NK5A 1CS0A 4R1PA 5AUOB 1CY4A 2AX3A 3MILA 1J21A 1NPDA 2YIDA 3SMVA 5JLAA 5FRDA 4KXYA 3HPQA 3F3SA 5COQA 2PZ8A 4JC0A 4TSFD 5JFTA 1ZN2A 4QQFA 2PSFA 1K6EA 2B8JA 1BE8A 2PR7A 1T35A 3IQGX 3LNTA 2XUZA 4HS4A 1A7UA 4L2IB 1M2NA 2YH2A 2OGSA 2X15A 3ES9A 4I9NA 3A05A 5K6RA 2HHHB 2X2OA 2OZPA 4Q3LA 4MITA 1OVMA 4OJTA 3AF1A 3RV3A 3THRA 2ZI4A 4R8MA 3OM8A 4IXNA 3LUGA 4WDRA 3L05A 1BWPA 1QF9A 4I1YA 3K8ZA 5T8KC 1OGIA 2GAJA 4DW8A 4OEHA 4TLDA 3D4OA 1C7IA 1MX5A 1QB7A 1VECA 2H5IA 1KIMA 2I34A 3R44A 1UWCA 4HDKA 5H16A 1RPAA 4R2WA 3B3QA 1OJLA 2MYNA 4ADSG 2PZFA 4ZD6A 3RROA 4ZJZA 1FYXA 4BZXA 3RUDA 1P8JA 1UXOA 1YU6A 2C2KA 3RKRA 2XY4A 2F00A 5BSGA 3HU2A 5IVIA 1GZVA 1JYSA 3RVKA 2D1RA 2O0MA 1RT9A 3M6WA 5EHNA 3RI3A 3T94A 2ZJ6A 3ZEAA 5DNUA 1H1TA 2PTHA 4BATA 4ZCMA 1QS0B 5ARBA 2FX5A 2GCNA 4XYMA 3KWLA 1DG3A 3MB8A 2YRWA 1XMJA 4MPDA 4NPAA 4TKMA 1R8YA 2IXFA 3D2LA 5EJIA 5A4IS 2PZAA 2QRQA 4LHYA 2XCRB 4YRAA 3RRFA 4GL4A 5KYYA 2JLUA 2J5QA 1ZNWA 2C2MA 2UUCB 3B7WA 3QEMA 3WWEA 4WN9A 1YZYA 1N9KA 1W5BA 3I6MA 1IXYA 1HYBA 4C88A 2WSSD 4D5GA 2XNDD 1A27A 1BWRA 1GGHA 2XPCA 1SH7A 3OJWA 4EATA 1XZPA 1ENYA 1YVDA 3NM4A 1TYBE 3UC5A 4RVNA 4XRRA 1DC7A 2NZUG 3GLIB 1FFWA 2ZTUA 3VR5H 5ENVA 1UZMA 4OGWA 5KB3A 4B5LA 4YJDA 3ZJUA 4C3ZA 2GAOA 2OR3A 1FRVA 2D5CA 3EXHB 1QHEA 4ZEVA 3D6TB 3UBTA 4AZSA 4DUZB 3NHAA 3G0GA 3MGAA 1IYZA 3TRDA 5ED0A 1H2ZA 3U7EB 1J06A 3LGAA 1HY3A 3G5MA 5JH7A 2FPUA 2R96A 4YJFB 3X1XA 1KOGA 4NS1A 3WQRA 3G2LA 2ZREA 3D8TA 1E7SA 3DEFA 2YINC 3FNQA 2H4JA 5JRDS 3G8BA 1E1RA 5A0FA 3F97A 3M6MD 5AXAA 3X1WA 4OGGA 5JANA 1I13A 1FMJA 3C6BA 4AJHA 4A8TA 1G9TA 2C03A 2O8DB 4G24A 2VC2B 2E5WA 2I78A 5JSFA 3WK7A 1YZQA 4TMXA 5ALRA 1R4MA 4HV4A 1MHPA 2R6GA 4YRKA 1UQUA 3ND5A 4LZJA 5DM2A 4OLBA 2OBFA 2I80A 3PTLA 3B2EA 4GS5A 4X90A 1TM3E 1DRKA 1B2LA 3D31A 3IPLA 2JI7A 3WA6A 5A03A 5LUAA 2LPMA 4D8XA 4CEJB 4HWSA 2HH9A 2CYAA 3O1IC 2GWRA 1FMTA 4KO2S 2LCQA 4DIKA 4EVQA 1RAEA 2V58A 1LK5A 2Z1NA 3L9WA 3NASA 3KEOA 4JT2A 4M22A 3ZK9A 1CEQA 1TLTA 2PL3A 2D0OB 4G0VA 2CJFA 2HRDA 2J5BA 2AV6A 2HBYA 2Y0DA 5AHOA 2Q0QA 5HMLA 4FGKA 3C3CA 1SG9A 4AMGA 1N4DA 1UBFA 3QEBZ 2IUYA 4GC9A 1F0NA 1MIOA 1NUAA 4EAQA 1E8DA 3KB1A 2Z58A 4DEVA 4QM7A 5CIWA 5LU9A 10MHA 5FWXB 2YJ3A 3IDQA 3K0EA 5DU2A 5EE0A 1JEDA 3SXUA 4QC2A 3PTAA 4GBJA 2BP7B 3LQ2A 2R4QA 4EFKA 5AUQA 1UAAA 1CKEA 3VO9A 4FR5A 5CT4A 1CRZA 3N7AA 3LZCA 4HBGA 2NXEA 4GW3A 4LF4B 1T34A 3WYFA 1E1DA 2C2HA 1WG8A 4ER6A 3LHDA 2VLIA 1NMQA 2EL9A 5JAUA 4OP1A 3AUYA 1HTWA 1MORA 4O1IA 2ZOSA 2H7YA 3UYKA 1RQRA 2NPIA 2B8NA 3I39X 5J9FA 4D44A 2COEA 5IMSA 1N6NA 4DN6A 5KKCA 3IPAA 4HZUB 5AHRA 1RYYA 1RJEA 3BWYA 1M6VA 1MEJA 3HR7A 4LF9B 3L0IB 5GIOE 2ZUDA 2F1IA 2Y27A 1Z38A 4KHPB 5EZ5A 1QYRA 1APBA 3VI3B 3NP9A 4I4TB 4ZOLA 1A88A 3A9WA 3GT3A 1HR0B 2I55A 4NULA 3CN9A 1ODKA 5JSKA 3RSHA 1VE9A 2AQKA 4HGNA 3UV3A 4BU1A 1T0HB 4UTVA 5KYXA 1IK4A 2DETA 4MUJA 2QIPA 1WY7A 4A8JC 4AJ2A 4E70A 4K0KB 1YE5A 4LJKA 4FMDF 3MJVA 3SC6A 3FTFA 4LZPA 5ALGA 1OLSA 2GEVA 5BR7A 3D6FA 3HE3A 2PBRA 3UJHA 1GTJ1 4GBMA 3K1JA 2AE1A 2WNIA 5KQGA 4IIHA 3U7FB 2IUTA 1F20A 4TTSA 5G0WA 3I8XA 4XVHA 3OETA 1X1QA 1WBDA 1MJGA 4DLUA 5F23A 4CMEA 2ZWIA 3LPAA 1ZK0A 5HBGA 1JFRA 2H1IA 1DOHA 4ZRMA 3ZHOA 3C7AA 1VSUA 1H8HA 1G8SA 2QQ5A 3CNBA 4V24A 1G3QA 2FVXA 3CXRA 2NO6A 3EXIA 4R9VA 5FTMA 1KP3A 2NU8B 1RTTA 4BCBA 1BX0A 3HDGA 2CNOA 2W7TA 3GPCA 1GGMA 1BO6A 3F3YA 4WTOA 4CDGA 1L4YA 5T3UA 4IIUA 3RWMB 3NATA 1I2MA 2F9LA 1MC1A 4NABA 2REOA 4FDMA 1I2AA 4BUJA 3L7JA 1WDLA 2WU4A 4GKKB 1KK2A 4E12A 3PVSA 1LSSA 1FRFS 3Q3VA 2VNSA 3BFPA 4Y0AA 2QN1A 3C5VA 4MYCA 2OAGA 2DH6A 1IPFA 4R69A 3EIEA 3U3MA 5G1NA 4FFVA 1DZIA 1KEZA 2DXIA 1W94A 3F6PA 2WIAA 3I2YX 4KNVA 1GQOA 5FQNA 3ZI4A 1T3TA 2D1SA 1ZM2A 2FX3A 5C3UA 1M1NA 1V4NA 2XAUA 3V1TC 3FF4A 1MT3A 2WJVA 3QJYA 5EP2A 1Y7IA 3T3GA 5A06A 4EEKA 4FUQA 5K0SA 3T0IA 3OH8A 1CY7A 4YHBA 2PD4A 5J4HA 4WNIA 4RLFA 2AR9A 1LPAB 1A77A 4DZRA 4E07A 1EXDA 1NN5A 2JIRA 3FYUA 4L9AA 3TNFA 5IAJA 4G01B 3HN6A 2YXEA 4WH0A 4CI9A 2QMQA 4UM8B 1U2SA 3LC2O 1HEIA 2IUEA 1LXCA 4F97A 2WIJA 1V2HE 2BUAA 1B1AA 3L0DA 4FMCB 1HX7A 4B79A 1SD2A 2AFHB 2BFDB 1XEXB 1COZA 1OI7A 1SCUB 4EG7A 2FU5C 4P3KA 2F62A 4XWWA 1RRKA 3MQ2A 4YDSA 4LJAA 4MKRA 2Z1DA 1TZ2A 2ASEA 1W85B 3A31A 1PYGA 1ABBA 2CVFA 4ZU6X 3MTAA 2HUPA 1KY2A 3ACDA 5FFMA 5AUPB 1RJWA 1UBKS 1DOAA 4RZIA 1VIMA 2XMRA 4NJOA 4Y7DA 5ALDA 3PPVA 4KR3A 1LEHA 2HR1A 4TQAA 1LFDB 4UJ5A 3JQQA 3I52A 5ADUS 2JGDA 4HDNB 1XI2A 4FR2A 1G20E 3MT7A 4B44A 4DNQA 1KAHA 1EGVB 1YONA 4RK4A 3HUFA 1X1CA 3I30X 3CUYA 5IBRA 1RWBA 4K05A 1C2YA 4DCMA 5CVUA 4HAVA 1PLKA 2I03A 3QX8A 1J7KA 1TLFA 3G9XA 4E88A 4B32A 2VP9A 2FFQA 2Q1SA 2WAAA 4HDNA 2W71A 4IFBA 3VZRA 1C8BA 2EQ5A 1X1DA 4I4CA 2AT1A 3H9QA 1G2OA 3K2QA 3C39A 1LQUA 3VDNB 4RDIA 2GPTA 3LDAA 2C2WA 1UP7A 4IDBA 1BJTA 4LHSA 5LXTF 1OX4B 2E4VA 1OU0A 5HKAA 3P4UA 1K3UB 2E7ZA 3AJRA 1ESEA 2N47A 2QB5A 1QHYA 1R0RE 3DNFA 3NVAA 3HL4A 1AMOA 1J23A 4MICA 4CF6A 1UBOS 2HM7A 1B8UA 1ZC4A 3AHCA 3CZQA 1NVEA 1UFQA 3H2YA 4EHAA 4MJ7A 3GT4A 1T0BA 1T2VA 3D2BA 5CGZA 3Q9LA 4GOKA 4HNQA 2IHVA 2BGIA 4AJEA 3OPQA 2GF2A 4KXMA 1E6CA 4EG5A 1J8FA 2OZVA 4Y6QA 2MSWA 2F55A 1UOEA 2EJTA 3UJNA 2OLKA 3LBNA 3HKEB 1ZDMA 4OFWA 5AKLA 4QVGA 2Z3WA 2PSEA 3I28A 4JLWA 5JS6A 1QK5A 4YCDA 4TYWA 4Q1DA 1GZ7A 2DOKA 2JLVA 4DJEC 1L9XA 3C8UA 3BA6A 3GO4A 3DW1X 3OSUA 3N3AC 5JXWA 2X8LA 4NYJQ 1QNFA 4V03A 1GITA 1JFLA 2CXXA 1XCGB 3F47A 3DZHA 4XCVA 4KOEC 3ZUPA 4C4TA 4F38A 2HSWA 2BN4A 2IOHA 2WIKA 2QMUA 1VMDA 4FJ1A 1C0EA 5GY7A 3VU3A 1RLOA 3ZJTA 2QLBA 3PBKA 3DV0B 1K66A 2WJHA 3PRYA 4UE6A 3X43A 2WTUA 1JA9A 3EN0A 5FXMA 4AP5A 2AUMA 5FPKA 2JKYA 4URWR 5AJWA 3VH3A 3QPCA 1W1WA 1WHTA 4MPPA 1PZMA 2C5HA 4AMUA 3RRYA 4LQ4A 3I05A 2IYQA 5K0LA 4X91A 2VJYA 4ZQBA 2O8BA 1ZXBA 3RU9A 1EXMA 4WX2B 2V9ZA 2C82A 3C41J 5DTMA 3WLLA 4PLTA 4UM5A 4UM9D 2ZK7A 3DDNA 3IQWA 1EYZA 1Z75A 1XTBA 4IVRA 1ZIPA 2VJDA 4BN4A 2I9PA 4N8DA 5CB8A 3UOAB 4CMIB 3KYCB 3IOBA 3H8WA 3Q5EA 4IIJF 2IKQA 3WIUA 9GPBA 2O8BB 3WC4A 3HDTA 2P9GA 2FCAA 4QATA 3GDHA 1I7QB 2IW3A 5AI8A 3KAPA 1KRHA 1U0RA 3LWDA 5CNJA 1UM9B 1Z83A 2H7CA 4XSHA 4DQLA 4E2WA 5BN1A 1PZNA 4IRUB 5FWNA 5LQCA 5IWAB 2ZDHA 1DAPA 2XW6A 3PICA 4W5NA 1U8FO 2BV3A 2UDPA 2V0NA 1VRWA 5FBQB 4BZPA 3CIFA 1CBUA 3I0NA 3TM5A 3GZTB 3ZTTA 3ZHVA 3NIWA 2B30A 2O2YA 2P4HX 3ND6A 4NCKA 1RCFA 1ZINA 1YK0A 2LD4A 1XMQB 1V43A 2HMSA 2ZLBA 3GJQA 4ZCRA 2BCEA 3CEHA 4HH4A 4X8MA 1NMXA 5BYBA 3U7RA 4YJ2A 1N5RA 2LDBA 2HY7A 2CCKA 4FMDB 1IHDA 3I9NA 4DSAA 1Q57A 4RJTA 2R6CA 3VR6D 2HV8A 1ZJ6A 3RVBA 1IBSA 5BRJA 4YWJA 1FMFA 2JFHA 4M9UA 4GX1A 2CNNA 1R37A 3HFGA 3ZBPA 1AZSC 2XWPA 1PBNA 5D1NA 1OWPA 3DMFA 4QPNA 3I4FA 3OJFA 4YLYA 4BVEA 4BJHB 2D4HA 2PY6A 2QM3A 4M1WA 4UM7A 1VE6A 1ZWLA 1Z4MA 4YCAA 1T91A 4I9UA 3ZWMA 4BBJA 4IVNA 2HQSA 5IDXA 1OBFO 4ENQA 2VTBA 1T6XA 2OGUA 3CZ5A 3NORA 1AKVA 1JHXA 3G0HA 4O6VA 4OHPA 4V2IA 4D96A 3NEJA 1HE2A 4JI4B 5CPFA 2HUNA 2EFYA 4G9BA 4R6XA 1BTOA 4QAQA 3H83A 4D3FA 2ZTHA 4H3VA 1TZJA 2FN8A 2X40A 5LZ4A 4EG1A 1D2HA 3LT1A 4DQVA 2DJIA 3KV3O 4P58A 2GN8A 2G67A 3T7EA 3BPSA 3WKDA 3RFFA 4RVUA 5LNK1 1JYFA 1Z33A 4OHFA 1PJ2A 5K0TA 3T99A 3EZFA 3FCXA 4FX2A 3KLNA 4PLCA 4AZ3B 4RF4A 1PR9A 2GEFA 3IT2A 3VTZA 1ZGZA 4CMGA 1VJRA 2PGOA 3L8CA 3H0CA 3FPJA 4WGFA 3AHHA 2YICA 2ZJ7A 4KJZA 4AF7A 3AIOA 3KT3A 3HB0A 3HRIA 2QYSA 4L02A 3RRNA 4DVJA 4M53A 3WJ7A 5A05A 3L0SA 1RAHA 2A94A 3K73O 3B1XA 4KEAA 1Y80A 2PFKA 2O20A 3IAS1 2LCFA 2OKCA 4PANA 4Z7OB 2Q8PA 5KJ1A 4UOQA 4X6LA 4Y30A 4M6WB 2IXEA 4HB4A 1IB0A 3HHPA 3LGSA 1XELA 4DXDA 1LS6A 1ZK1A 5E6UB 5K9ZA 1IOVA 1T2EA 3OQVA 5DP1A 1YIDA 4FFDA 1H1DA 4MIKA 1WNTA 5BO5A 2J6IA 4JI5B 2B1QA 1WTAA 3W7AA 1U2RA 1OB5A 1KNXA 1NRIA 1T3LA 4DJAA 4J9UE 5C35A 4OHRA 3HTXA 1TQ2A 4V1CB 3EGXB 3X1MA 4FGUA 4F4JA 4MYUA 4TZTA 4B7AA 1WDWB 2X4LA 1T36A 3PYLA 2OUKA 4LRTB 1ZH4A 3WGQA 4BJ1A 1SCKA 4RHXA 5CDGA 3SC3A 2ZYWX 1YRWA 2P9TA 3TLYA 3FYCA 1ZOIA 3TKLA 3MOIA 2PMDA 1KKUA 2OEPA 1UBUS 4MVJM 2IA5A 2V7GA 3HJHA 1ULBA 4KO3S 4ABYA 2OVBA 4M36A 5BT8A 4F9FA 1Z17A 1HQCA 3DTYA 3H5LA 3R4VA 4PFSA 5E1OA 5FUMA 1N0UA 3R4CA 1N6PA 5HF9A 1DAEA 1F2DA 4DR2B 3GIDA 2YN0A 4KPFC 3K5PA 1TC1A 1EEXB 1ONSA 1U3GA 2N46A 4BNTA 1XTZA 2DPHA 1KZGB 1WS6A 2O2GA 2WNHA 1D0SA 1L5YA 1Z0FA 3DT8A 3H65A 3NAZA 4H59A 3D8HA 4D97A 2BJVA 4RIIA 1KL7A 3ICOA 2VXOA 4CYMA 3KXIA 4X7RA 5HFJA 5KYWB 3GLFA 1JVBA 3U48A 1WB9A 3HLTA 4P7KA 5KTKA 3OOJA 2C2BA 3AIKA 1A4XA 3MLAA 3QBJA 1L4HA 1SHJA 4KBFA 1TUIA 2RH9B 3QVWA 4L5JA 3I2JA 4B3CA 3KV1A 2EWWA 3ER8A 3WL7A 1G42A 1D04A 3L40A 2ZVPX 3P19A 4HLUC 2O5EA 2Z2YA 2QQEA 2EKQA 3AY6A 4L4ZA 2VK4A 1FP7A 1SUCA 1KYXA 1VYUA 1SD1A 2ANCA 3LUJA 4YMWA 2CVOA 1DTWA 3GCDA 3NGLA 3NHWA 4EG8A 1QV9A 3IX7A 4J1TA 1PF7E 2NQ8A 3O8LA 4Y6OA 5EPUA 4AD8A 4NDZA 1GFIA 3FIUA 1VJTA 2EP7A 2OC4A 4TSKA 3K0AA 3N05A 3OAAA 2ZJ2A 3TR0A 3WMGA 5DX0A 2YN4A 3OEEA 1H5UA 3GWZA 3RYIA 2IGTA 3AUFA 1B41A 1V3QE 1OI2A 5FOXA 5GM2A 1HM5A 4YALA 2C0PA 1TJ4A 3CG0A 2XXAB 4LJ9A 2JZCA 3JX9A 1GN9A 4PZLA 1GLGA 2J3JA 3AUJB 2XD9A 3L01A 3PKJA 4NVRA 1RJDA 3Q6MA 4W99A 4NYJR 4JUCA 5B58T 2HYDA 4EITA 5CDUA 5EGSA 5AVXA 1H8ED 3UXYA 4WXRA 3UPDA 3DVRX 3P2YA 4ZVNA 4B3FX 5JY1A 2YJNA 5JWHA 2Q41A 1UBLS 3SEQA 4KQ9A 2X0KA 3H4IA 1DPFA 1OD6A 1YZTA 4BQNA 2ZW9A 3E2MA 4DY6A 5ILOA 1NHGA 2IQIA 2GK7A 1KH3A 3R5FA 1VFNA 4K9MA 3LS2A 4DFDA 4G0NA 2AG1A 5F9MA 4BNYA 2QW8A 1VL8A 5JH7F 1T1GA 4LXYA 5H81A 2CL0X 3TSCA 1G59A 3GC6A 3IH5A 1NSTA 3KHKA 2CHQA 2ZIEA 5B1YA 5HNKA 1PX0A 4HMQA 1LK0A 2IE0A 3PC8A 1EHYA 2C9ZA 1UJ5A 5AVZA 1LPOA 4LGMA 1ZR4A 3IBFA 4M0FA 3ROFA 1AS0A 2ZRCA 1I7NA 1EE9A 3AIMA 2BI7A 3M3HA 4LRWA 1TVKB 3DBOB 4U2EA 5ESXA 3T34A 4C7VA 4I50F 2D3TA 4AI6A 5DLDA 1D2GA 1TKCA 1OFTA 1XJWA 1LNZA 1YL5A 1OTHA 1WMDA 1WX1A 3GQBA 3WQBA 2V59A 4MI9A 4TWAA 3SHQA 5BSTA 3K09A 1GTSA 4QLAA 1UMBB 4N3NA 1TA0A 5T8KA 3FA2A 5E4TA 2QAGC 4JP2A 4MQEA 3T61A 1PWHA 3FTQA 3PKIA 8LDHA 4GF5A 7YASA 1ZN8A 4MVWA 2XIQA 2WJ3A 1L5HA 2CN1A 2H8KA 3CMMA 3OE4A 3H1GA 1A04A 1N2XA 4OJYA 4HNHA 3FUXA 5ADHA 1A8QA 1TZCA 4KB5A 2HK8A 3TTXA 1FFGA 1TE2A 3SZGA 1V6CA 4DA0A 5A4JA 2RKWA 2Z5VA 3D3NA 1PN3A 4X41A 1Z6QA 4N0QA 4GKBA 4CQLA 3H5RA 4FKZA 1ICEA 2ENWA 3C7KA 5CXSA 4EG0A 3A4NA 3C4VA 3G9TA 4GKAA 1P1CA 1V37A 2XODA 3LAWA 4WEOA 4FYJA 1QBGA 4ECAA 5LKRA 2ZBDA 2I8AA 1ADFA 4X8LA 1RRFA 1I2BA 1S7GA 4L5IA 5CVEA 3C6ZA 1KDVA 3X1ZA 4HBZA 4RCVA 1J2TA 4WY8A 3JU3A 5DYNA 3UYLA 1F3OA 4ZIRB 4NFYA 3HBLA 3VUEA 1WPXA 4EL0A 2FWNA 3OQNA 2XKAA 3HZOA 4ZI7A 4R0MA 3EQZA 3NYIA 3KKOA 3UHPA 4CIYA 1LPNA 1TM2A 4FSDA 3HRHA 4NBUA 2GN0A 2WYHA 3BBLA 1EDZA 4OMUA 4GMDA 1A0OA 3WSVA 5EJ6A 3IESA 2HA2A 1NV9A 3IQFA 3LC1O 4EEZA 4D56A 3KVOA 1G17A 4Q6BA 4RSMA 4RPLA 1NWHA 3OE7A 3QQPA 4MWBA 4UCFA 1VFPA 5ABPA 1TT7A 1IQPA 3K2EA 1M2KA 5AK0A 5KI6A 2AQIA 3RDPA 2BEVB 1C8VB 1V16A 1THZA 5IXJA 4QA9A 1R8QA 4BNZA 4RAQA 1P1FA 4WJKB 1JSCA 3WWOA 2VJKA 4YP1A 4CN8A 3U6BA 2IBSA 1SA0A 4LYDA 3NKVA 3BGWA 1OX5A 2IOFA 1GILA 2XA9A 2VBGA 1ML3A 4FT2A 5KYUA 3LHSA 4JROA 3INGA 5AJHA 1KI8A 5J5AA 3RADC 3P71T 3DD1A 1TJNA 3GAMA 3K0BA 4Q47A 1JLLB 1NFQA 1LC0A 1Y89A 5K4HA 1YVPA 1T6YA 2FGKA 1L7VC 1CTQA 5FV4A 1U11A 3WNDA 1J07A 4BX3A 1JAXA 1G1AA 4Q3CA 1HEYA 4X1YA 4EZIA 3VMFA 1ZA2A 1REQB 3MLEA 2FXIA 1N0VC 3E2PA 3NDRA 5ILQA 3LW8A 1NC3A 1EI9A 1XU4A 2D8MA 3EAGA 3NRCA 5DBFA 3SK0A 2XLCA 4X3PA 221PA 3WP1B 2FW9A 1OT3A 3HP7A 4MRNA 3OX2A 2KE5A 1IPEA 1XPRA 3H5TA 2NXWA 1HOXA 4BGVA 2O50A 4U7HA 2FZCA 3DCNA 3V48A 5EZQA 3IOMA 3CONA 5CH3A 2HK6A 2F43B 2DHEA 2ZIFA 2L0XA 3HYTA 5AVWA 2PH3A 3Q0EA 3J80A 2AQHA 2O7SA 1ISMA 2RMKA 2WZQA 2FETA 3D3KA 3HYNA 4OPMA 1PVDA 3KYBA 4Q05A 1IBKB 2B1RA 4JKIA 2ATXA 3UTCA 2AN4A 2C42A 4C7MA 1ZJ5A 3DMDA 3GRFA 4R83A 1Q1ZA 2CBZA 3MWEB 4JJGA 3EEOA 4B8ZA 1EWKA 3O8NA 6AT1A 4LXGA 2H0AA 1ZL2A 1SQSA 4RXUA 4PO3X 3TNYA 4H15A 1DC5A 4A91A 2JIQA 3AM5A 2H4WA 2OO5A 2WT9A 4M89A 4CMAA 3EZ9A 4XX0B 5EZYB 3SYRA 1RADA 2O0LA 1C2TA 3GW8A 2P1RA 3DV9A 3PQ4A 2YIVX 3EPRA 2YY6A 5IYZB 2PGXA 4M3NA 1GCAA 2O1SA 2QRZA 1HRDA 1MC4A 1RJFA 2R751 4C7KA 5AI0A 1DDGA 1N2IA 3V8BA 3A70A 2IOYA 3E5MA 3ZCQA 3BHMA 4CL0A 4BLPA 4D1YA 3L0YA 3FLBA 5TPWA 4XIIA 5LXTB 3ETLA 2QL5A 3VQTA 3C1OA 3JQ6A 4TXJA 3ENNA 4XDGA 5KNBH 1ZVJA 3HV2A 3LPLA 5KTTA 2OQRA 3NM6B 4CDMA 2RD2A 1HYEA 2G80A 1JHUA 1GGJA 1Z5PA 2DMRA 2P5TB 3UQZA 2BFAA 1E79D 1ZP6A 1J5XA 3BCHA 3CUWA 1A5AB 2JJ2D 3GGGA 2BEKA 3JZAA 2E9SA 5IT0A 2CLSA 2OCPA 4YI3A 2A9JA 4RTMA 4C4RA 4F21A 3P0HA 2YHSA 1BOFA 4I5EA 2I2BA 4LTDA 1NWCA 1NVFA 3VRHA 2FSVC 1SKYB 2BMWA 3SF8A 2GRJA 1EQUA 1YCDA 4IW3B 1NE2A 3C3BA 4J43A 3ZTYA 5LD2B 5HFAA 2I22A 5IPFA 4MX8A 2X6QA 2B37A 4DNFA 4J7UA 2J7PA 2R1UA 3L77A 2O1XA 3WDSA 1WVIA 5B12A 4GPIB 5CCXA 3ELDA 1IBMB 4HX2A 2KI5A 2PYIA 1U7XA 3ZD7A 5KNCH 1P4RA 4K1XA 2G9NA 2PRZA 4GUAA 1X70A 3QUQA 1XDBA 5TQJA 2FG7C 3K0FB 3OURA 1CDEA 3VR1A 1HL7A 1QYXA 5GP1A 3TSYA 4BCDA 1O89A 1JQAA 2ZIUB 4YYEA 2GKOA 3HMKA 2JGDB 4GLJA 5IRCD 7ABPA 2YZKA 2VJQA 1H2YA 1TIKA 5TQVA 1R9MA 4N0MA 3ZWOA 1QJ4A 3D0RA 5P21A 1K6XA 1T1IA 4WZAB 1D2MA 2CE7A 3L92A 3ZU5A 1RLUA 2ZITA 3MCUA 3NYRA 3PQ2A 1NBMA 1B4DA 1Q11A 3CF4A 5T4HA 5BOSB 5LQDA 1WUYA 2B4RO 2WABA 2VQSA 3PR3A 4Y0NA 3DE1X 5E38A 1JEYB 2G04A 4E5PA 3QVOA 2WD7A 5IXSA 4C0SA 5I7FA 3PQEA 1BROA 4XTCS 2GF9A 3K71B 1E69A 1CR1A 4TUYB 3D6VA 3UMRA 1G64A 2HGZA 1TU3A 2DCUA 4JUBA 2BGGA 4H08A 1PR2A 1YTUA 1PGOA 2GCIA 2M98A 1E8MA 4JLNA 3U4IA 2HCRA 3BBPA 4OI0A 1NATA 2XTZA 4EYQA 1BDHA 3NIBA 5JD3A 2ON6A 4CV3A 2Z9BA 3UK7A 2FGJA 5GV7A 3DM9B 5C31A 1WB5A 1VCOA 4GU5A 2UXBB 1NW8A 2OM6A 4ESVA 4XIJA 2ZJ8A 4PX3A 4RAOA 5BSFA 1UXKA 3L7KA 1NR5A 3STTA 5C1BA 1EFVB 1AZLA 1P44A 3PQ5A 1ABFA 1CF2O 4L72A 4REOA 1JXAA 1OH6A 3AV0B 4LOAA 4OYHA 5AJUA 4PZPA 4JXJA 1JL3A 2I3GA 2NXNA 2AYZA 2WWVD 4QM6A 1XMSA 1BVRA 2OBBA 2XQGA 3PPWA 2R0QC 2VUUA 2YIJA 3PEUA 4IIJA 4JBIA 3G2NA 5ITVA 1O0CA 4LDAA 4JI0B 1PJSA 1SCDA 1VL0A 1A7KA 5F9HA 1JIIA 1FX0B 2YY7A 5DI3A 3ESCA 3KELA 3GVHA 4XSGA 5BUSA 3BWEA 3OG9A 1SZPA 1VKJA 3SR3A 4B9EA 1TAHA 4Q19A 1IN5A 3BQMB 5J2UB 1OZAA 3AVOA 4KNWA 4HDQB 1WBBA 1J20A 3BB1A 4BL5A 5KYGA 3UMBA 4P31A 1OU4A 1TQDA 1F2TA 3IGFA 4D7AA 2GBPA 1LPSA 3ANTA 3HY6A 2JGNA 3K9BA 4ND1A 4RGQA 2CXNA 3LU1A 4A8JB 1BMFA 5IJ9A 4G4SO 2JGAA 1SUAA 2RC5A 3AONB 3TQIA 2GVDC 5CBKA 3GLUA 3N2NA 4ZVTA 1M2GA 1CB7A 4EPXA 3EIWA 3FDXA 4ZQIA 3SN6A 3DD5A 4G8JA 4RZSA 2HLPA 2P3LA 1LDYA 2GI4A 5FBVB 2WJ6A 3GEIA 3LQKA 4RJJA 5CTAA 3E53A 1N5MA 2CNWD 3SZ3A 5ICGA 4FE3A 4BGUA 3ET5A 3IDSA 3LUKA 2TMGA 4KXQA 4ZK6A 5ICEA 1U0BB 2EFEB 3IERA 5LB4A 3EW7A 3BL8A 3JS5A 3C3DA 1CQZA 2O48X 2CVHA 3GGDA 1R5NA 2C5EA 3JQFA 1XC7A 3NDJA 4FHFA 2H9YA 4QOFA 4UBKA 1W36D 4FKMA 3H87A 4UCWA 5AOCA 3FPCA 4QYSA 1R0CA 2Q5QA 3FNBA 5H02A 3TMKA 4E11A 4MR7A 1PL7A 3IP8A 1RM5A 2VBCA 1GXSA 4OM7A 3EXHC 4FT4A 4E03A 4LOHA 3QM1A 4WCFC 4YQFA 5HOEA 3FBGA 2Q45A 4I8IA 3NB0A 4L5YA 3J7AC 1BHSA 2G1KA 4GZMA 3FAKA 5JECA 4AS3A 2GZ3A 2O8FB 1FOEB 1Z8FA 4HMPA 4QPZA 2EZ8A 4Y2VA 3IA7A 4TYQA 2H2AA 1BC5A 3QPAA 3W3AH 4J0HA 4F5ZA 1V9SA 4JDUA 1AGXA 1YH3A 2I4RA 1FC0A 3F3MA 1MOZA 2V8BA 3CRNA 1U9ZA 2FQQA 1CQIB 2V98A 5T67A 3DDCA 3AH8A 4RSHA 1V8BA 2IXGA 2XAAA 4Y9SA 3SM9A 4IGKA 4ZV4A 4E5NA 3RBZA 2OE2A 1U8TA 4F5EA 4O2AA 3T0GA 5LCXA 2CHGA 3BXZA 1I7PA 4QPJC 5TEWA 1HDZA 3KJXA 1G20B 3FI0A 3MBIA 4OQDA 3S1AA 1QK3A 1YR8A 4OQPA 1XKTA 4MB6A 4DGSA 3NS7A 5GINE 3HCEA 3WK6A 1JFSA 1Y8RA 5CHEA 4U7FA 1XR3A 3F5MA 2AH5A 3RYHB 4CFZA 3S29A 4UTOA 1MABA 2BKXA 3UENA 4A10A 3DUFB 4MWGA 1V7ZA 4WZZA 4INAA 5IK2A 1YS2X 4ETIA 2DKNA 1S4QA 4YYZA 4ZGWA 5CB0A 1OC4A 1QPBA 1I3KA 2G9UA 1P3JA 1FVFA 2VHXA 2ZRPA 3PD1A 2ZUVA 3FPLA 3S68A 4EI8A 3R6LA 3VXKA 1HNXB 5DNAA 1E79A 2RSLA 2BZGA 2FUEA 2W6NA 3GL9A 4RA6A 4Y6GB 4D3XA 3V1NA 4YXWD 4KNYA 3ND8A 4OQMA 2VAMA 1FS5A 4JEHA 1GRRA 3JD4A 4RCZA 4GWLA 4BIMA 1U3FA 2WM9B 5T4EA 4E4TA 2QAIA 4UNIA 4XW2A 5KVCA 4C0AC 2GFQA 3WO0A 4OHKA 1W25A 3V4FA 4Q03A 5HZGA 1Z5OA 4BKUA 3WMFA 2IY8A 5ECGC 2D2FA 1ULHA 4IKOA 3PRJA 1T4CB 1DAMA 3HVUA 4LI3X 3HC7A 4F2DA 4ZDKA 4PQGA 5JNSA 3IEKA 2ZU0C 2XRMA 2YFKA 4LHZA 1Z15A 4M98A 5B2FA 3J81k 2OCXA 3PS9A 3UGTA 1DLJA 3BH7A 5IJ0B 2Y1DA 4YR9A 1TI7A 1J00A 3RYHA 3N2ZB 4TXMA 1VDMA 4KKVA 1NBWB 5TVGA 4EYKA 3NMUF 3CB4A 4W7IA 3ZN2A 3ECCA 4KR9A 1GNTA 1SJ9A 4E14A 4BB0A 4MINA 3T15A 2O14A 5AI6A 4FOTA 4TLBA 1NONA 2VPIA 1L3IA 5DCWA 2FUG1 2H0QA 3DZFA 2I1LA 2JA1A 4E2FA 5C32A 2W42A 4OK5A 2NMVA 3QJ5A 4Q1BA 4RYDA 1Y3CE 5IZCA 3CZMA 3V46A 2UYQA 5ESDA 2I91A 1FFAA 2EP8A 3ACBA 5ALPA 5L7TA 4RS4A 3N2KB 1XLTA 3ZQUA 3QKUA 4IMJB 1NAHA 4F3CA 1YDHA 3IVAA 3TLAA 3GAAA 4DWJA 5C8YA 1DRVA 1UANA 1BA2A 5TMBA 4R6WA 1O0SA 4RABA 1RHQA 1XKQA 2W4MA 1EXWA 1SBHA 5ENZA 2ZSKA 3JYLA 2KSQA 2H07A 2HAEA 2BTOA 3GLQA 4MR9A 1QHGA 5CNKA 1L1QA 4MUFA 3NHLA 4LPSA 2AI3A 4F6LA 5AQ1A 3K1AB 4HAYA 2RG7A 2J3KA 4MGIR 3AR9A 3INNA 4IV5A 1LB1B 3Q9SA 5EXDA 1U5BA 4F5YA 5I7UA 3CX8A 2VEDA 5K0GA 2Q5FA 5KNDH 1XAGA 1UKVY 1JDBC 4RSRA 1U4NA 4GMFA 4JVLA 4R7TA 4J4HA 3ZQ4A 3H6GA 3ZPXA 1DEAA 4FB4A 2Q9BA 4JUIA 2AVNA 3NLLA