1X3ZA

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
320
structure length
320
Chain Sequence
NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptide: N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
total genus 113
structure length 320
sequence length 320
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.90 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1x3zA03
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x3zA04
3S16I 1RLYA 4A3GI 3S14I 3GCFA 3GTQI 3S1RI 2E2HI 2P3YA 1VLAA 4QTTA 1I50I 2NVTI 2E2II 4A3LI 4NBGA 2NVYI 1TWCI 4BXXI 3HOVI 3M3YI 3H0GI 4A3II 1ZB9A 4A3BI 3VMHA 1NUIA 3HOUI 1WW9A 3RZOI 5C44I 3EERA 3I07A 4BBRI 1X3ZA 3K7AI 4NB9A 3HOXI 4Y7NI 5C3EI 1Y1VI 2BJOA 3D6WA 5FLMI 2HF1A 4QTUA 4BY7I 3M4OI 2B63I 2DE7A 2DE6A 2NVQI 4A3CI 4A3EI 3I4NI 5C4XI 1USPB 2JA7I 3Q87A 1LQLA 1DL6A 3VB9A 5C4JI 2R92I 4NBBA 2F4OA 5IP9I 1X3WA 1TWAI 5CM2M 2DE5A 4A3DI 1Y1VS 1YUAA 3VMGA 3HOZI 1Y1WI 3H3VJ 1TWFI 2YU9I 2F4MA 2VUMI 4NBAA 4NBEA 2E2JI 3S15I 3GTGI 3GTPI 2JS4A 3RZDI 3S1MI 1N2FA 4NBHA 1QYPA 1TWHI 4NBCA 4BBSI 4A3KI 3S17I 1TWGI 3VMIA 4X6AI 3GTOI 5IP7I 1USPA 4A3FI 4NBDA 3S1QI 3HOWI 3CQZI 4Y52I 3GTLI 1ML8A 2AKLA 4NB8A 3GTMS 3U50C 2RBLA 2PK7A 4A3MI 2JNYA 1SFOI 1I6HI 1ZB8A 1K83I 3GTMI 3PO3S 2JR6A 3S2DI 4A3JI 1L1OC 2JA8I 2NVXI 3ESWA 2JA5I 1WCMI 4A93I 1R9TI 4NBFA 3PO2I 4XX2A 3PO3I 3S1NI 4BY1I 1PFTA 4MH4A 3LUSA 3S2HI 2J6AA 4NOZA 3GTKI 2KPIA 3HOYI 3GTJI 3I4MI 2K5RA 2R93I 3GKQA 2R7ZI 2JA6I 1TFIA 1I3QI 3FKII 1RO4A
chains in the Genus database with same CATH superfamily
2NAPA 5DLLA 1YJNZ 2OOYB 5D1PA 2JIQA 2B61A 3WQSB 3VVMA 2NVTI 1R0LA 4NBGA 2GTHA 2RHBA 3CMAZ 4K5MA 2Q4ZA 1TWCI 2QA4Z 4E2WA 4RVBA 3G4S1 3G71Z 1SC5A 3FH5A 3CHQA 3VMHA 4AYBA 2E9HA 1VQOZ 1Q811 2PUSA 3CCQZ 3RZOI 3EERA 2R59A 3CC21 3EBGA 1X3ZA 1VQM1 2AYDA 2PGGA 5JO0A 1S7MA 4ZW8A 3CZLA 2WAQA 2BJOA 3R0IA 3UEQA 2MAPA 4XN7A 2VJ8A 3CHRA 3ZHZA 3FUJA 1H3LA 2WZFA 2NVQI 4Y6PA 4FLSA 4XMVA 2ZAEB 3FQQA 5C4XI 2JA7I 2EGHA 1YI2Z 1Q7Y1 1VQ8Z 1N8R2 2Y1FA 5LL6f 4XO3A 3ZHYA 2F4OA 4AR8A 4AICA 1Y1VS 3B34A 3CZEA 3Q43A 2HPTA 3CCU1 1KD11 3FTVA 2FFLA 4R5TA 2JD0A 2F4MA 3CHPA 2DQ6A 3J81f 1ZS2A 2Y1CA 1T1SA 4DPRA 3CCVZ 2OTLZ 3GTPI 2QRDB 4ZQEA 3RZDI 3FUEA 4QPEA 1QYPA 4RVGA 3BG0B 1K9M2 4X6AI 2HPOA 2Y1GA 1QVFY 2JD2A 4FLQA 4NBDA 2V3VA 5DULA 1QF8A 3GTLI 1ML8A 2PM9A 1JJ2Y 4NB8A 3U50C 2RBLA 2PK7A 2VPXA 3UCQA 3ANNA 5JMWA 3G4SZ 3RASA 2WZGA 1ZB8A 3NH5A 4GAAA 5HNHA 3CC2Z 3B7TA 1VQMZ 3A06A 1VQK1 4OOFA 3ESWA 1WCMI 4E31A 4XMTA 4XX2A 3J81b 4XO5A 4E2XA 3J7A4 4MH4A 1SG7A 3S2HI 4RSYA 3AU9A 1Q812 3NH8A 3T8VA 1QXFA 4DGLA 3EEDA 4HH4A 3CCL1 4ARFA 4MRIA 3GTKI 3HOYI 3GTJI 3I4MI 1ONOA 5IT9f 3FTZA 2R7ZI 5FWQA 2JUBA 3D2LA 3CCUZ 2JA6I 4K5NA 4CXFA 3B37A 1Q16A 2QR1B 3NH4A 1W2BZ 3IR7A 2JCXA 3IF8A 4MD7A 2OOXB 4MKTA 4RV9A 3S1RI 2E2HI 1MW0A 2QREB 2P3YA 1VLAA 4RS4A 1VQL1 4QTTA 1I50I 4A3LI 2E2II 2NVYI 1Q862 4HGZA 1KC82 1M1K2 3HOVI 3M3YI 3G6E1 4NFRA 4K5LA 1VQ71 3FTWA 4J3BA 4RVDA 3CC41 4NB9A 3T0YA 4R5VA 4Y7NI 2GTIA 2RIQA 1WJ2A 2JIPA 2QEXZ 4Y6SA 4ZQHA 4QTUA 3ZI0A 3CHSA 5IT9b 1VQKZ 4A3CI 4ZX5A 2JD1A 3IIEA 4XNAA 2WB1A 4HGYA 3FU5A 2VLAA 1VQ51 1NP6A 3Q87A 1VQP1 1YJW1 1LQLA 1Z01A 3AUAA 1FDIA 3ANLA 2K3RA 3VB9A 1YHQ1 4MD9A 2R92I 2QJ1A 4NBBA 5IP9I 1TWAI 3OW2Y 2VPWA 3RC3A 2VUGA 3CCLZ 3FTXA 1YUAA 3HOZI 1HS6A 3EBIA 2GTQA 1Y1WI 2GU2A 2VF1A 1QVGZ 2E7ZA 4XN1A 3P5JB 2VUMI 4NBEA 3F3PC 1RNIA 3QWUA 3GTGI 4R5XA 2OZKA 3S1MI 4NBHA 3WQRA 1RO0A 4A3KI 4ZX6A 2W04A 1Y8CA 4XN9A 1VQLZ 1OR7A 1TWGI 3MZLB 4QMEA 4Y6RA 2JIOA 3ANMA 1Q861 3GTMS 3B7RL 1ONPA 2JIMA 1S721 3G6EZ 1KC81 2R72A 2JNYA 1M1K1 1KQSZ 5T64A 2Y0SA 5EV7A 4E2YA 1VQ7Z 3GTMI 4PW4A 3KIHA 2JA8I 2C82A 1R9TI 3I551 4Q4EA 4XMXA 2C5ZA 4ZX3A 3S1NI 1SIWA 3FU6A 1VQ61 3B2XA 3EBHA 4BY1I 2LFUA 3LUSA 1VQ5Z 1KRLA 2XPZA 1VQPZ 1YJWZ 5JNLA 3VTNA 3Q44A 4NOZA 4DK1A 1Q822 4XN2A 3CIAA 4X2UA 3GKQA 4FLOA 4K5OA 5JMPA 3F3FC 1M902 2OTJ1 2A7OA 3FULA 3FKII 1RO4A 3S16I 3FTSA 3GCFA 3WQQA 3CXBA 3CXCZ 1RP3A 1X0TA 1K732 3CCE1 1YIT1 3FH7A 4L2LA 3JT1A 3AU8A 2M6NA 2XQ0A 3H0GI 4PU2A 1YIJ1 3B7UX 4A3II 1ZH1A 2VPYA 2YADA 1ZB9A 1NUIA 3HOUI 4E2ZA 1WW9A 4MS6A 5C44I 1S72Z 2V8KA 3K7AI 3PUUA 3HKZA 3NDIA 5C3EI 4ZW3A 4XN4A 3D6WA 1SQMA 5FLMI 3JAMf 2JV7A 3M4OI 4LUPA 4E33A 2DE6A 3CC71 4E30A 3I55Z 4A3EI 1VQN1 3T4NB 2G2KA 3FH8A 1K8A2 3CCS1 1VQ6Z 4DQYB 1X3WA 2V45A 4EWCA 2V8IA 2MAOA 2Q51A 5FLXf 2PL5A 1AA6A 3H3VJ 3JSZA 1TWFI 2YU9I 2V8JA 1Q821 2O4HA 2R6MA 4NBAA 1H19A 4ZQFA 2OTJZ 1W2BY 1N2FA 4MXUA 2ZXGA 1TWHI 4OOEA 5HLTA 1M901 1WIIA 5T6BA 3TE5B 3S17I 4FLRA 4ZN6A 3CCEZ 1YITZ 2P28A 5IP7I 4A3FI 1K731 3S1QI 3CQZI 1T1RA 3FHEA 3CCM1 1YUKA 3CPWY 4A3MI 1ONNA 4JNDA 4ZQTA 3TDHB 3FUKA 1SFOI 1K83I 5D1OB 3UERA 1VQ91 1NJI2 3S2DI 1L1OC 4ZQGA 1JVSA 2JA5I 5FLXb 3J80f 4NBFA 3PO2I 3FUHA 4XMUA 2JIRA 3CC7Z 4RVFA 2WPGA 1VQNZ 1PFTA 4RCVA 4TNUA 2W03A 3CCSZ 2DQMA 2J6AA 1MW1A 4AR1A 2QKDA 3CME1 1K8A1 3IX0A 3CCR1 5JBIA 5HNFA 2K5RA 5BPPA 1K5HA 4R7LA 1Z03A 2R93I 5DYFA 3CCJ1 2H85A 4Y67A 3VVLA 1Z02A 1TFIA 1GW6A 2O53A 3CC4Z 1QVGY 2LEXA 3RC8A 5D1OA 1RLYA 2QRCB 3I561 3S14I 4A3GI 3GTQI 3KIFA 1VQ41 3B3BA 4XNDA 2RT9A 1QVFZ 1YJ91 2O7GA 4AR9A 4E32A 4ZW6A 1JJ2Z 1R0KA 1JWHC 1JG9A 3FU3A 1Q0QA 4BXXI 3J80b 1FDOA 2JCYA 2HU9A 2PMZA 4XNBA 2I3CA 1YHQZ 2R70A 4ZW7A 4A3BI 5AN9F 3CCMZ 3D9XA 3CD61 5AENA 3I07A 4BBRI 3BG1B 4A03A 3HOXI 1KQSY 2JCVA 4XMZA 3QJXA 1JGIA 4XMWA 1Y1VI 3IFUA 1VQ9Z 2HF1A 4BY7I 3NDJA 4GAEA 2RPRA 1NJI1 2B63I 2DE7A 3FUNA 3I4NI 1USPB 4S1TA 2LIYA 4BKXA 1DL6A 2IZ4A 5C4JI 3MZKB 1S46A 5CM2M 2DE5A 4A3DI 3VMGA 3CMEZ 3CCRZ 1P9NA 4MD8A 3CHOA 2QEX1 3CCJZ 3S15I 2E2JI 4MONA 2JS4A 1YJN1 1MW3A 3A14A 3ZHXA 3FTUA 4NBCA 2QVWA 3I56Z 4BBSI 4KP7A 4ZX4A 1VQ4Z 3FU0A 3CMA1 4CL1A 2Y1EA 3FUMA 4XN8A 4Q4IA 3CZGA 3VMIA 3CXCY 2QA41 2M48A 1YJ9Z 3GTOI 1RQFA 1MW2A 1USPA 4Y52I 3HOWI 5A2Qf 2IV2X 2AKLA 2VPZA 3G711 4RVHA 3KEDA 1VQO1 1N8R1 3CCQ1 4QUOA 2KI7B 1I6HI 1Q0HA 2Y1DA 4FCAA 2JMOA 3CD6Z 3PO3S 2EGTA 2JR6A 3FTYA 3NFZA 4A3JI 2RJIA 2NVXI 3B7SA 3MONA 4PVBA 1G5AA 4A93I 3FUFA 3FUDA 1MVYA 5T67A 1Q7Y2 3HW2A 4NQWA 1Q0LA 3PO3I 1YI21 5JAZA 4AYSA 1VQ81 4XO4A 3CPWZ 4ZW5A 3OW2Z 1K9M1 1KD12 3JAMb 3U9WA 2XPYA 5JC1A 3FQMA 1YIJZ 2KPIA 1WZNA 4XN5A 4QIRA 4K5PA 2IZ3A 3CZKA 2OTL1 3CCV1 2QLVB 5A2Qb 4QHPA 1I3QI 4NH1C 3B2PA 3FUIA 1RO2A
chains in the Genus database with same CATH topology
5DLLA 1YJNZ 2OOYB 5D1PA 2B61A 3WQSB 3VVMA 2NVTI 1R0LA 4NBGA 2GTHA 2RHBA 3CMAZ 4K5MA 2Q4ZA 1TWCI 2QA4Z 4E2WA 4RVBA 3G4S1 3G71Z 1SC5A 3FH5A 3CHQA 3VMHA 4AYBA 2E9HA 1VQOZ 1Q811 2PUSA 3CCQZ 3RZOI 3EERA 2R59A 3CC21 3EBGA 1X3ZA 1VQM1 2PGGA 5JO0A 1S7MA 4ZW8A 3CZLA 2WAQA 2BJOA 3R0IA 3UEQA 2MAPA 4XN7A 2VJ8A 3CHRA 3ZHZA 3FUJA 1H3LA 2WZFA 2NVQI 4Y6PA 4FLSA 4XMVA 2ZAEB 3FQQA 5C4XI 2JA7I 2EGHA 1YI2Z 1Q7Y1 1VQ8Z 1N8R2 2Y1FA 5LL6f 4XO3A 3ZHYA 2F4OA 4AR8A 4AICA 1Y1VS 3B34A 3CZEA 3Q43A 2HPTA 3CCU1 1KD11 3FTVA 2FFLA 4R5TA 2JD0A 2F4MA 3CHPA 2DQ6A 3J81f 1ZS2A 2Y1CA 1T1SA 4DPRA 3CCVZ 2OTLZ 3GTPI 2QRDB 4ZQEA 3RZDI 3FUEA 4QPEA 1QYPA 4RVGA 3BG0B 1K9M2 4X6AI 2HPOA 2Y1GA 1QVFY 2JD2A 4FLQA 4NBDA 5DULA 1QF8A 3GTLI 1ML8A 2PM9A 1JJ2Y 4NB8A 3U50C 2RBLA 2PK7A 3UCQA 3ANNA 5JMWA 3G4SZ 3RASA 2WZGA 1ZB8A 3NH5A 4GAAA 5HNHA 3CC2Z 3B7TA 1VQMZ 3A06A 1VQK1 4OOFA 3ESWA 1WCMI 4E31A 4XMTA 4XX2A 3J81b 4XO5A 4E2XA 3J7A4 4MH4A 1SG7A 3S2HI 4RSYA 3AU9A 1Q812 3NH8A 3T8VA 4DGLA 3EEDA 4HH4A 3CCL1 4ARFA 4MRIA 3GTKI 3HOYI 3GTJI 3I4MI 1ONOA 5IT9f 3FTZA 2R7ZI 5FWQA 2JUBA 3CCUZ 2JA6I 4K5NA 4CXFA 3B37A 2QR1B 3NH4A 1W2BZ 2JCXA 3IF8A 4MD7A 2OOXB 4MKTA 4RV9A 3S1RI 2E2HI 1MW0A 2QREB 2P3YA 1VLAA 4RS4A 1VQL1 4QTTA 1I50I 4A3LI 2E2II 2NVYI 1Q862 4HGZA 1KC82 1M1K2 3HOVI 3M3YI 3G6E1 4NFRA 4K5LA 1VQ71 3FTWA 4J3BA 4RVDA 3CC41 4NB9A 3T0YA 4R5VA 4Y7NI 2GTIA 2RIQA 2QEXZ 4Y6SA 4ZQHA 4QTUA 3ZI0A 3CHSA 5IT9b 1VQKZ 4A3CI 4ZX5A 2JD1A 3IIEA 4XNAA 2WB1A 4HGYA 3FU5A 2VLAA 1VQ51 1NP6A 3Q87A 1VQP1 1YJW1 1LQLA 1Z01A 3AUAA 3ANLA 2K3RA 3VB9A 1YHQ1 4MD9A 2R92I 2QJ1A 4NBBA 5IP9I 1TWAI 3OW2Y 3RC3A 2VUGA 3CCLZ 3FTXA 1YUAA 3HOZI 1HS6A 3EBIA 2GTQA 1Y1WI 2GU2A 2VF1A 1QVGZ 4XN1A 3P5JB 2VUMI 4NBEA 3F3PC 1RNIA 3QWUA 3GTGI 4R5XA 2OZKA 3S1MI 4NBHA 3WQRA 1RO0A 4A3KI 4ZX6A 2W04A 4XN9A 1VQLZ 1OR7A 1TWGI 3MZLB 4QMEA 4Y6RA 3ANMA 1Q861 3GTMS 3B7RL 1ONPA 1S721 3G6EZ 1KC81 2R72A 2JNYA 1M1K1 1KQSZ 5T64A 2Y0SA 5EV7A 4E2YA 1VQ7Z 3GTMI 4PW4A 3KIHA 2JA8I 2C82A 1R9TI 3I551 4Q4EA 4XMXA 2C5ZA 4ZX3A 3S1NI 3FU6A 1VQ61 3B2XA 3EBHA 4BY1I 2LFUA 3LUSA 1VQ5Z 1KRLA 2XPZA 1VQPZ 1YJWZ 5JNLA 3VTNA 3Q44A 4NOZA 4DK1A 1Q822 4XN2A 3CIAA 4X2UA 3GKQA 4FLOA 4K5OA 5JMPA 3F3FC 1M902 2OTJ1 2A7OA 3FULA 3FKII 1RO4A 3S16I 3FTSA 3GCFA 3WQQA 3CXCZ 1RP3A 1X0TA 1K732 3CCE1 1YIT1 3FH7A 4L2LA 3JT1A 3AU8A 2M6NA 2XQ0A 3H0GI 4PU2A 1YIJ1 3B7UX 4A3II 1ZH1A 2YADA 1ZB9A 1NUIA 3HOUI 4E2ZA 1WW9A 4MS6A 5C44I 1S72Z 2V8KA 3K7AI 3PUUA 3HKZA 3NDIA 5C3EI 4ZW3A 4XN4A 3D6WA 1SQMA 5FLMI 3JAMf 2JV7A 3M4OI 4LUPA 4E33A 2DE6A 3CC71 4E30A 3I55Z 4A3EI 1VQN1 3T4NB 2G2KA 3FH8A 1K8A2 3CCS1 1VQ6Z 4DQYB 1X3WA 4EWCA 2V8IA 2MAOA 2Q51A 5FLXf 2PL5A 3H3VJ 3JSZA 1TWFI 2YU9I 2V8JA 1Q821 2O4HA 2R6MA 4NBAA 1H19A 4ZQFA 2OTJZ 1W2BY 1N2FA 4MXUA 2ZXGA 1TWHI 4OOEA 5HLTA 1M901 1WIIA 5T6BA 3TE5B 3S17I 4FLRA 4ZN6A 3CCEZ 1YITZ 2P28A 5IP7I 4A3FI 1K731 3S1QI 3CQZI 1T1RA 3FHEA 3CCM1 1YUKA 3CPWY 4A3MI 1ONNA 4JNDA 4ZQTA 3TDHB 3FUKA 1SFOI 1K83I 5D1OB 3UERA 1VQ91 1NJI2 3S2DI 1L1OC 4ZQGA 1JVSA 2JA5I 5FLXb 3J80f 4NBFA 3PO2I 3FUHA 4XMUA 3CC7Z 4RVFA 2WPGA 1VQNZ 1PFTA 4RCVA 4TNUA 2W03A 3CCSZ 2DQMA 2J6AA 1MW1A 4AR1A 2QKDA 3CME1 1K8A1 3IX0A 3CCR1 5JBIA 5HNFA 2K5RA 1Z03A 1K5HA 4R7LA 5BPPA 2R93I 5DYFA 3CCJ1 2H85A 4Y67A 1Z02A 3VVLA 1TFIA 1GW6A 2O53A 3CC4Z 1QVGY 3RC8A 5D1OA 1RLYA 2QRCB 3I561 3S14I 4A3GI 3GTQI 3KIFA 1VQ41 3B3BA 4XNDA 2RT9A 1QVFZ 1YJ91 2O7GA 4AR9A 4E32A 4ZW6A 1JJ2Z 1R0KA 1JWHC 1JG9A 3FU3A 1Q0QA 4BXXI 3J80b 2JCYA 2HU9A 2PMZA 4XNBA 2I3CA 1YHQZ 2R70A 4ZW7A 4A3BI 5AN9F 3CCMZ 3D9XA 3CD61 5AENA 3I07A 4BBRI 3BG1B 4A03A 3HOXI 1KQSY 2JCVA 4XMZA 3QJXA 1JGIA 4XMWA 1Y1VI 3IFUA 1VQ9Z 2HF1A 4BY7I 3NDJA 4GAEA 2RPRA 1NJI1 2B63I 2DE7A 3FUNA 3I4NI 1USPB 4S1TA 2LIYA 4BKXA 1DL6A 2IZ4A 5C4JI 3MZKB 1S46A 5CM2M 2DE5A 4A3DI 3VMGA 3CMEZ 3CCRZ 1P9NA 4MD8A 3CHOA 2QEX1 3CCJZ 3S15I 2E2JI 4MONA 2JS4A 1YJN1 1MW3A 3A14A 3ZHXA 3FTUA 4NBCA 2QVWA 3I56Z 4BBSI 4KP7A 4ZX4A 1VQ4Z 3FU0A 3CMA1 4CL1A 2Y1EA 3FUMA 4XN8A 4Q4IA 3CZGA 3VMIA 3CXCY 2QA41 2M48A 1YJ9Z 3GTOI 1RQFA 1MW2A 1USPA 4Y52I 3HOWI 5A2Qf 2AKLA 3G711 4RVHA 3KEDA 1VQO1 1N8R1 3CCQ1 4QUOA 2KI7B 1I6HI 1Q0HA 2Y1DA 4FCAA 2JMOA 3CD6Z 3PO3S 2EGTA 2JR6A 3FTYA 3NFZA 4A3JI 2RJIA 2NVXI 3B7SA 3MONA 4PVBA 1G5AA 4A93I 3FUFA 3FUDA 1MVYA 5T67A 1Q7Y2 4NQWA 1Q0LA 3PO3I 1YI21 5JAZA 4AYSA 1VQ81 4XO4A 3CPWZ 4ZW5A 3OW2Z 1K9M1 1KD12 3JAMb 3U9WA 2XPYA 5JC1A 3FQMA 1YIJZ 2KPIA 4XN5A 4QIRA 4K5PA 2IZ3A 3CZKA 2OTL1 3CCV1 2QLVB 5A2Qb 4QHPA 1I3QI 4NH1C 3B2PA 3FUIA 1RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 I;  1RLY A;  4A3G I;  3S14 I;  3GCF A;  3GTQ I;  3S1R I;  2E2H I;  2P3Y A;  1VLA A;  4QTT A;  1I50 I;  2NVT I;  2E2I I;  4A3L I;  4NBG A;  2NVY I;  1TWC I;  4BXX I;  3HOV I;  3M3Y I;  3H0G I;  4A3I I;  1ZB9 A;  4A3B I;  3VMH A;  1NUI A;  3HOU I;  1WW9 A;  3RZO I;  5C44 I;  3EER A;  3I07 A;  4BBR I;  1X3Z A;  3K7A I;  4NB9 A;  3HOX I;  4Y7N I;  5C3E I;  1Y1V I;  2BJO A;  3D6W A;  5FLM I;  2HF1 A;  4QTU A;  4BY7 I;  3M4O I;  2B63 I;  2DE7 A;  2DE6 A;  2NVQ I;  4A3C I;  4A3E I;  3I4N I;  5C4X I;  1USP B;  2JA7 I;  3Q87 A;  1LQL A;  1DL6 A;  3VB9 A;  5C4J I;  2R92 I;  4NBB A;  2F4O A;  5IP9 I;  1X3W A;  1TWA I;  5CM2 M;  2DE5 A;  4A3D I;  1Y1V S;  1YUA A;  3VMG A;  3HOZ I;  1Y1W I;  3H3V J;  1TWF I;  2YU9 I;  2F4M A;  2VUM I;  4NBA A;  4NBE A;  2E2J I;  3S15 I;  3GTG I;  3GTP I;  2JS4 A;  3RZD I;  3S1M I;  1N2F A;  4NBH A;  1QYP A;  1TWH I;  4NBC A;  4BBS I;  4A3K I;  3S17 I;  1TWG I;  3VMI A;  4X6A I;  3GTO I;  5IP7 I;  1USP A;  4A3F I;  4NBD A;  3S1Q I;  3HOW I;  3CQZ I;  4Y52 I;  3GTL I;  1ML8 A;  2AKL A;  4NB8 A;  3GTM S;  3U50 C;  2RBL A;  2PK7 A;  4A3M I;  2JNY A;  1SFO I;  1I6H I;  1ZB8 A;  1K83 I;  3GTM I;  3PO3 S;  2JR6 A;  3S2D I;  4A3J I;  1L1O C;  2JA8 I;  2NVX I;  3ESW A;  2JA5 I;  1WCM I;  4A93 I;  1R9T I;  4NBF A;  3PO2 I;  4XX2 A;  3PO3 I;  3S1N I;  4BY1 I;  1PFT A;  4MH4 A;  3LUS A;  3S2H I;  2J6A A;  4NOZ A;  3GTK I;  2KPI A;  3HOY I;  3GTJ I;  3I4M I;  2K5R A;  2R93 I;  3GKQ A;  2R7Z I;  2JA6 I;  1TFI A;  1I3Q I;  3FKI I;  1RO4 A; 
#chains in the Genus database with same CATH topology
 2NAP A;  5DLL A;  1YJN Z;  2OOY B;  5D1P A;  2JIQ A;  2B61 A;  3WQS B;  3VVM A;  2NVT I;  1R0L A;  4NBG A;  2GTH A;  2RHB A;  3CMA Z;  4K5M A;  2Q4Z A;  1TWC I;  2QA4 Z;  4E2W A;  4RVB A;  3G4S 1;  3G71 Z;  1SC5 A;  3FH5 A;  3CHQ A;  3VMH A;  4AYB A;  2E9H A;  1VQO Z;  1Q81 1;  2PUS A;  3CCQ Z;  3RZO I;  3EER A;  2R59 A;  3CC2 1;  3EBG A;  1X3Z A;  1VQM 1;  2AYD A;  2PGG A;  5JO0 A;  1S7M A;  4ZW8 A;  3CZL A;  2WAQ A;  2BJO A;  3R0I A;  3UEQ A;  2MAP A;  4XN7 A;  2VJ8 A;  3CHR A;  3ZHZ A;  3FUJ A;  1H3L A;  2WZF A;  2NVQ I;  4Y6P A;  4FLS A;  4XMV A;  2ZAE B;  3FQQ A;  5C4X I;  2JA7 I;  2EGH A;  1YI2 Z;  1Q7Y 1;  1VQ8 Z;  1N8R 2;  2Y1F A;  5LL6 f;  4XO3 A;  3ZHY A;  2F4O A;  4AR8 A;  4AIC A;  1Y1V S;  3B34 A;  3CZE A;  3Q43 A;  2HPT A;  3CCU 1;  1KD1 1;  3FTV A;  2FFL A;  4R5T A;  2JD0 A;  2F4M A;  3CHP A;  2DQ6 A;  3J81 f;  1ZS2 A;  2Y1C A;  1T1S A;  4DPR A;  3CCV Z;  2OTL Z;  3GTP I;  2QRD B;  4ZQE A;  3RZD I;  3FUE A;  4QPE A;  1QYP A;  4RVG A;  3BG0 B;  1K9M 2;  4X6A I;  2HPO A;  2Y1G A;  1QVF Y;  2JD2 A;  4FLQ A;  4NBD A;  2V3V A;  5DUL A;  1QF8 A;  3GTL I;  1ML8 A;  2PM9 A;  1JJ2 Y;  4NB8 A;  3U50 C;  2RBL A;  2PK7 A;  2VPX A;  3UCQ A;  3ANN A;  5JMW A;  3G4S Z;  3RAS A;  2WZG A;  1ZB8 A;  3NH5 A;  4GAA A;  5HNH A;  3CC2 Z;  3B7T A;  1VQM Z;  3A06 A;  1VQK 1;  4OOF A;  3ESW A;  1WCM I;  4E31 A;  4XMT A;  4XX2 A;  3J81 b;  4XO5 A;  4E2X A;  3J7A 4;  4MH4 A;  1SG7 A;  3S2H I;  4RSY A;  3AU9 A;  1Q81 2;  3NH8 A;  3T8V A;  1QXF A;  4DGL A;  3EED A;  4HH4 A;  3CCL 1;  4ARF A;  4MRI A;  3GTK I;  3HOY I;  3GTJ I;  3I4M I;  1ONO A;  5IT9 f;  3FTZ A;  2R7Z I;  5FWQ A;  2JUB A;  3D2L A;  3CCU Z;  2JA6 I;  4K5N A;  4CXF A;  3B37 A;  1Q16 A;  2QR1 B;  3NH4 A;  1W2B Z;  3IR7 A;  2JCX A;  3IF8 A;  4MD7 A;  2OOX B;  4MKT A;  4RV9 A;  3S1R I;  2E2H I;  1MW0 A;  2QRE B;  2P3Y A;  1VLA A;  4RS4 A;  1VQL 1;  4QTT A;  1I50 I;  4A3L I;  2E2I I;  2NVY I;  1Q86 2;  4HGZ A;  1KC8 2;  1M1K 2;  3HOV I;  3M3Y I;  3G6E 1;  4NFR A;  4K5L A;  1VQ7 1;  3FTW A;  4J3B A;  4RVD A;  3CC4 1;  4NB9 A;  3T0Y A;  4R5V A;  4Y7N I;  2GTI A;  2RIQ A;  1WJ2 A;  2JIP A;  2QEX Z;  4Y6S A;  4ZQH A;  4QTU A;  3ZI0 A;  3CHS A;  5IT9 b;  1VQK Z;  4A3C I;  4ZX5 A;  2JD1 A;  3IIE A;  4XNA A;  2WB1 A;  4HGY A;  3FU5 A;  2VLA A;  1VQ5 1;  1NP6 A;  3Q87 A;  1VQP 1;  1YJW 1;  1LQL A;  1Z01 A;  3AUA A;  1FDI A;  3ANL A;  2K3R A;  3VB9 A;  1YHQ 1;  4MD9 A;  2R92 I;  2QJ1 A;  4NBB A;  5IP9 I;  1TWA I;  3OW2 Y;  2VPW A;  3RC3 A;  2VUG A;  3CCL Z;  3FTX A;  1YUA A;  3HOZ I;  1HS6 A;  3EBI A;  2GTQ A;  1Y1W I;  2GU2 A;  2VF1 A;  1QVG Z;  2E7Z A;  4XN1 A;  3P5J B;  2VUM I;  4NBE A;  3F3P C;  1RNI A;  3QWU A;  3GTG I;  4R5X A;  2OZK A;  3S1M I;  4NBH A;  3WQR A;  1RO0 A;  4A3K I;  4ZX6 A;  2W04 A;  1Y8C A;  4XN9 A;  1VQL Z;  1OR7 A;  1TWG I;  3MZL B;  4QME A;  4Y6R A;  2JIO A;  3ANM A;  1Q86 1;  3GTM S;  3B7R L;  1ONP A;  2JIM A;  1S72 1;  3G6E Z;  1KC8 1;  2R72 A;  2JNY A;  1M1K 1;  1KQS Z;  5T64 A;  2Y0S A;  5EV7 A;  4E2Y A;  1VQ7 Z;  3GTM I;  4PW4 A;  3KIH A;  2JA8 I;  2C82 A;  1R9T I;  3I55 1;  4Q4E A;  4XMX A;  2C5Z A;  4ZX3 A;  3S1N I;  1SIW A;  3FU6 A;  1VQ6 1;  3B2X A;  3EBH A;  4BY1 I;  2LFU A;  3LUS A;  1VQ5 Z;  1KRL A;  2XPZ A;  1VQP Z;  1YJW Z;  5JNL A;  3VTN A;  3Q44 A;  4NOZ A;  4DK1 A;  1Q82 2;  4XN2 A;  3CIA A;  4X2U A;  3GKQ A;  4FLO A;  4K5O A;  5JMP A;  3F3F C;  1M90 2;  2OTJ 1;  2A7O A;  3FUL A;  3FKI I;  1RO4 A;  3S16 I;  3FTS A;  3GCF A;  3WQQ A;  3CXB A;  3CXC Z;  1RP3 A;  1X0T A;  1K73 2;  3CCE 1;  1YIT 1;  3FH7 A;  4L2L A;  3JT1 A;  3AU8 A;  2M6N A;  2XQ0 A;  3H0G I;  4PU2 A;  1YIJ 1;  3B7U X;  4A3I I;  1ZH1 A;  2VPY A;  2YAD A;  1ZB9 A;  1NUI A;  3HOU I;  4E2Z A;  1WW9 A;  4MS6 A;  5C44 I;  1S72 Z;  2V8K A;  3K7A I;  3PUU A;  3HKZ A;  3NDI A;  5C3E I;  4ZW3 A;  4XN4 A;  3D6W A;  1SQM A;  5FLM I;  3JAM f;  2JV7 A;  3M4O I;  4LUP A;  4E33 A;  2DE6 A;  3CC7 1;  4E30 A;  3I55 Z;  4A3E I;  1VQN 1;  3T4N B;  2G2K A;  3FH8 A;  1K8A 2;  3CCS 1;  1VQ6 Z;  4DQY B;  1X3W A;  2V45 A;  4EWC A;  2V8I A;  2MAO A;  2Q51 A;  5FLX f;  2PL5 A;  1AA6 A;  3H3V J;  3JSZ A;  1TWF I;  2YU9 I;  2V8J A;  1Q82 1;  2O4H A;  2R6M A;  4NBA A;  1H19 A;  4ZQF A;  2OTJ Z;  1W2B Y;  1N2F A;  4MXU A;  2ZXG A;  1TWH I;  4OOE A;  5HLT A;  1M90 1;  1WII A;  5T6B A;  3TE5 B;  3S17 I;  4FLR A;  4ZN6 A;  3CCE Z;  1YIT Z;  2P28 A;  5IP7 I;  4A3F I;  1K73 1;  3S1Q I;  3CQZ I;  1T1R A;  3FHE A;  3CCM 1;  1YUK A;  3CPW Y;  4A3M I;  1ONN A;  4JND A;  4ZQT A;  3TDH B;  3FUK A;  1SFO I;  1K83 I;  5D1O B;  3UER A;  1VQ9 1;  1NJI 2;  3S2D I;  1L1O C;  4ZQG A;  1JVS A;  2JA5 I;  5FLX b;  3J80 f;  4NBF A;  3PO2 I;  3FUH A;  4XMU A;  2JIR A;  3CC7 Z;  4RVF A;  2WPG A;  1VQN Z;  1PFT A;  4RCV A;  4TNU A;  2W03 A;  3CCS Z;  2DQM A;  2J6A A;  1MW1 A;  4AR1 A;  2QKD A;  3CME 1;  1K8A 1;  3IX0 A;  3CCR 1;  5JBI A;  5HNF A;  2K5R A;  5BPP A;  1K5H A;  4R7L A;  1Z03 A;  2R93 I;  5DYF A;  3CCJ 1;  2H85 A;  4Y67 A;  3VVL A;  1Z02 A;  1TFI A;  1GW6 A;  2O53 A;  3CC4 Z;  1QVG Y;  2LEX A;  3RC8 A;  5D1O A;  1RLY A;  2QRC B;  3I56 1;  3S14 I;  4A3G I;  3GTQ I;  3KIF A;  1VQ4 1;  3B3B A;  4XND A;  2RT9 A;  1QVF Z;  1YJ9 1;  2O7G A;  4AR9 A;  4E32 A;  4ZW6 A;  1JJ2 Z;  1R0K A;  1JWH C;  1JG9 A;  3FU3 A;  1Q0Q A;  4BXX I;  3J80 b;  1FDO A;  2JCY A;  2HU9 A;  2PMZ A;  4XNB A;  2I3C A;  1YHQ Z;  2R70 A;  4ZW7 A;  4A3B I;  5AN9 F;  3CCM Z;  3D9X A;  3CD6 1;  5AEN A;  3I07 A;  4BBR I;  3BG1 B;  4A03 A;  3HOX I;  1KQS Y;  2JCV A;  4XMZ A;  3QJX A;  1JGI A;  4XMW A;  1Y1V I;  3IFU A;  1VQ9 Z;  2HF1 A;  4BY7 I;  3NDJ A;  4GAE A;  2RPR A;  1NJI 1;  2B63 I;  2DE7 A;  3FUN A;  3I4N I;  1USP B;  4S1T A;  2LIY A;  4BKX A;  1DL6 A;  2IZ4 A;  5C4J I;  3MZK B;  1S46 A;  5CM2 M;  2DE5 A;  4A3D I;  3VMG A;  3CME Z;  3CCR Z;  1P9N A;  4MD8 A;  3CHO A;  2QEX 1;  3CCJ Z;  3S15 I;  2E2J I;  4MON A;  2JS4 A;  1YJN 1;  1MW3 A;  3A14 A;  3ZHX A;  3FTU A;  4NBC A;  2QVW A;  3I56 Z;  4BBS I;  4KP7 A;  4ZX4 A;  1VQ4 Z;  3FU0 A;  3CMA 1;  4CL1 A;  2Y1E A;  3FUM A;  4XN8 A;  4Q4I A;  3CZG A;  3VMI A;  3CXC Y;  2QA4 1;  2M48 A;  1YJ9 Z;  3GTO I;  1RQF A;  1MW2 A;  1USP A;  4Y52 I;  3HOW I;  5A2Q f;  2IV2 X;  2AKL A;  2VPZ A;  3G71 1;  4RVH A;  3KED A;  1VQO 1;  1N8R 1;  3CCQ 1;  4QUO A;  2KI7 B;  1I6H I;  1Q0H A;  2Y1D A;  4FCA A;  2JMO A;  3CD6 Z;  3PO3 S;  2EGT A;  2JR6 A;  3FTY A;  3NFZ A;  4A3J I;  2RJI A;  2NVX I;  3B7S A;  3MON A;  4PVB A;  1G5A A;  4A93 I;  3FUF A;  3FUD A;  1MVY A;  5T67 A;  1Q7Y 2;  3HW2 A;  4NQW A;  1Q0L A;  3PO3 I;  1YI2 1;  5JAZ A;  4AYS A;  1VQ8 1;  4XO4 A;  3CPW Z;  4ZW5 A;  3OW2 Z;  1K9M 1;  1KD1 2;  3JAM b;  3U9W A;  2XPY A;  5JC1 A;  3FQM A;  1YIJ Z;  2KPI A;  1WZN A;  4XN5 A;  4QIR A;  4K5P A;  2IZ3 A;  3CZK A;  2OTL 1;  3CCV 1;  2QLV B;  5A2Q b;  4QHP A;  1I3Q I;  4NH1 C;  3B2P A;  3FUI A;  1RO2 A; 
#chains in the Genus database with same CATH homology
 5DLL A;  1YJN Z;  2OOY B;  5D1P A;  2B61 A;  3WQS B;  3VVM A;  2NVT I;  1R0L A;  4NBG A;  2GTH A;  2RHB A;  3CMA Z;  4K5M A;  2Q4Z A;  1TWC I;  2QA4 Z;  4E2W A;  4RVB A;  3G4S 1;  3G71 Z;  1SC5 A;  3FH5 A;  3CHQ A;  3VMH A;  4AYB A;  2E9H A;  1VQO Z;  1Q81 1;  2PUS A;  3CCQ Z;  3RZO I;  3EER A;  2R59 A;  3CC2 1;  3EBG A;  1X3Z A;  1VQM 1;  2PGG A;  5JO0 A;  1S7M A;  4ZW8 A;  3CZL A;  2WAQ A;  2BJO A;  3R0I A;  3UEQ A;  2MAP A;  4XN7 A;  2VJ8 A;  3CHR A;  3ZHZ A;  3FUJ A;  1H3L A;  2WZF A;  2NVQ I;  4Y6P A;  4FLS A;  4XMV A;  2ZAE B;  3FQQ A;  5C4X I;  2JA7 I;  2EGH A;  1YI2 Z;  1Q7Y 1;  1VQ8 Z;  1N8R 2;  2Y1F A;  5LL6 f;  4XO3 A;  3ZHY A;  2F4O A;  4AR8 A;  4AIC A;  1Y1V S;  3B34 A;  3CZE A;  3Q43 A;  2HPT A;  3CCU 1;  1KD1 1;  3FTV A;  2FFL A;  4R5T A;  2JD0 A;  2F4M A;  3CHP A;  2DQ6 A;  3J81 f;  1ZS2 A;  2Y1C A;  1T1S A;  4DPR A;  3CCV Z;  2OTL Z;  3GTP I;  2QRD B;  4ZQE A;  3RZD I;  3FUE A;  4QPE A;  1QYP A;  4RVG A;  3BG0 B;  1K9M 2;  4X6A I;  2HPO A;  2Y1G A;  1QVF Y;  2JD2 A;  4FLQ A;  4NBD A;  5DUL A;  1QF8 A;  3GTL I;  1ML8 A;  2PM9 A;  1JJ2 Y;  4NB8 A;  3U50 C;  2RBL A;  2PK7 A;  3UCQ A;  3ANN A;  5JMW A;  3G4S Z;  3RAS A;  2WZG A;  1ZB8 A;  3NH5 A;  4GAA A;  5HNH A;  3CC2 Z;  3B7T A;  1VQM Z;  3A06 A;  1VQK 1;  4OOF A;  3ESW A;  1WCM I;  4E31 A;  4XMT A;  4XX2 A;  3J81 b;  4XO5 A;  4E2X A;  3J7A 4;  4MH4 A;  1SG7 A;  3S2H I;  4RSY A;  3AU9 A;  1Q81 2;  3NH8 A;  3T8V A;  4DGL A;  3EED A;  4HH4 A;  3CCL 1;  4ARF A;  4MRI A;  3GTK I;  3HOY I;  3GTJ I;  3I4M I;  1ONO A;  5IT9 f;  3FTZ A;  2R7Z I;  5FWQ A;  2JUB A;  3CCU Z;  2JA6 I;  4K5N A;  4CXF A;  3B37 A;  2QR1 B;  3NH4 A;  1W2B Z;  2JCX A;  3IF8 A;  4MD7 A;  2OOX B;  4MKT A;  4RV9 A;  3S1R I;  2E2H I;  1MW0 A;  2QRE B;  2P3Y A;  1VLA A;  4RS4 A;  1VQL 1;  4QTT A;  1I50 I;  4A3L I;  2E2I I;  2NVY I;  1Q86 2;  4HGZ A;  1KC8 2;  1M1K 2;  3HOV I;  3M3Y I;  3G6E 1;  4NFR A;  4K5L A;  1VQ7 1;  3FTW A;  4J3B A;  4RVD A;  3CC4 1;  4NB9 A;  3T0Y A;  4R5V A;  4Y7N I;  2GTI A;  2RIQ A;  2QEX Z;  4Y6S A;  4ZQH A;  4QTU A;  3ZI0 A;  3CHS A;  5IT9 b;  1VQK Z;  4A3C I;  4ZX5 A;  2JD1 A;  3IIE A;  4XNA A;  2WB1 A;  4HGY A;  3FU5 A;  2VLA A;  1VQ5 1;  1NP6 A;  3Q87 A;  1VQP 1;  1YJW 1;  1LQL A;  1Z01 A;  3AUA A;  3ANL A;  2K3R A;  3VB9 A;  1YHQ 1;  4MD9 A;  2R92 I;  2QJ1 A;  4NBB A;  5IP9 I;  1TWA I;  3OW2 Y;  3RC3 A;  2VUG A;  3CCL Z;  3FTX A;  1YUA A;  3HOZ I;  1HS6 A;  3EBI A;  2GTQ A;  1Y1W I;  2GU2 A;  2VF1 A;  1QVG Z;  4XN1 A;  3P5J B;  2VUM I;  4NBE A;  3F3P C;  1RNI A;  3QWU A;  3GTG I;  4R5X A;  2OZK A;  3S1M I;  4NBH A;  3WQR A;  1RO0 A;  4A3K I;  4ZX6 A;  2W04 A;  4XN9 A;  1VQL Z;  1OR7 A;  1TWG I;  3MZL B;  4QME A;  4Y6R A;  3ANM A;  1Q86 1;  3GTM S;  3B7R L;  1ONP A;  1S72 1;  3G6E Z;  1KC8 1;  2R72 A;  2JNY A;  1M1K 1;  1KQS Z;  5T64 A;  2Y0S A;  5EV7 A;  4E2Y A;  1VQ7 Z;  3GTM I;  4PW4 A;  3KIH A;  2JA8 I;  2C82 A;  1R9T I;  3I55 1;  4Q4E A;  4XMX A;  2C5Z A;  4ZX3 A;  3S1N I;  3FU6 A;  1VQ6 1;  3B2X A;  3EBH A;  4BY1 I;  2LFU A;  3LUS A;  1VQ5 Z;  1KRL A;  2XPZ A;  1VQP Z;  1YJW Z;  5JNL A;  3VTN A;  3Q44 A;  4NOZ A;  4DK1 A;  1Q82 2;  4XN2 A;  3CIA A;  4X2U A;  3GKQ A;  4FLO A;  4K5O A;  5JMP A;  3F3F C;  1M90 2;  2OTJ 1;  2A7O A;  3FUL A;  3FKI I;  1RO4 A;  3S16 I;  3FTS A;  3GCF A;  3WQQ A;  3CXC Z;  1RP3 A;  1X0T A;  1K73 2;  3CCE 1;  1YIT 1;  3FH7 A;  4L2L A;  3JT1 A;  3AU8 A;  2M6N A;  2XQ0 A;  3H0G I;  4PU2 A;  1YIJ 1;  3B7U X;  4A3I I;  1ZH1 A;  2YAD A;  1ZB9 A;  1NUI A;  3HOU I;  4E2Z A;  1WW9 A;  4MS6 A;  5C44 I;  1S72 Z;  2V8K A;  3K7A I;  3PUU A;  3HKZ A;  3NDI A;  5C3E I;  4ZW3 A;  4XN4 A;  3D6W A;  1SQM A;  5FLM I;  3JAM f;  2JV7 A;  3M4O I;  4LUP A;  4E33 A;  2DE6 A;  3CC7 1;  4E30 A;  3I55 Z;  4A3E I;  1VQN 1;  3T4N B;  2G2K A;  3FH8 A;  1K8A 2;  3CCS 1;  1VQ6 Z;  4DQY B;  1X3W A;  4EWC A;  2V8I A;  2MAO A;  2Q51 A;  5FLX f;  2PL5 A;  3H3V J;  3JSZ A;  1TWF I;  2YU9 I;  2V8J A;  1Q82 1;  2O4H A;  2R6M A;  4NBA A;  1H19 A;  4ZQF A;  2OTJ Z;  1W2B Y;  1N2F A;  4MXU A;  2ZXG A;  1TWH I;  4OOE A;  5HLT A;  1M90 1;  1WII A;  5T6B A;  3TE5 B;  3S17 I;  4FLR A;  4ZN6 A;  3CCE Z;  1YIT Z;  2P28 A;  5IP7 I;  4A3F I;  1K73 1;  3S1Q I;  3CQZ I;  1T1R A;  3FHE A;  3CCM 1;  1YUK A;  3CPW Y;  4A3M I;  1ONN A;  4JND A;  4ZQT A;  3TDH B;  3FUK A;  1SFO I;  1K83 I;  5D1O B;  3UER A;  1VQ9 1;  1NJI 2;  3S2D I;  1L1O C;  4ZQG A;  1JVS A;  2JA5 I;  5FLX b;  3J80 f;  4NBF A;  3PO2 I;  3FUH A;  4XMU A;  3CC7 Z;  4RVF A;  2WPG A;  1VQN Z;  1PFT A;  4RCV A;  4TNU A;  2W03 A;  3CCS Z;  2DQM A;  2J6A A;  1MW1 A;  4AR1 A;  2QKD A;  3CME 1;  1K8A 1;  3IX0 A;  3CCR 1;  5JBI A;  5HNF A;  2K5R A;  1Z03 A;  1K5H A;  4R7L A;  5BPP A;  2R93 I;  5DYF A;  3CCJ 1;  2H85 A;  4Y67 A;  1Z02 A;  3VVL A;  1TFI A;  1GW6 A;  2O53 A;  3CC4 Z;  1QVG Y;  3RC8 A;  5D1O A;  1RLY A;  2QRC B;  3I56 1;  3S14 I;  4A3G I;  3GTQ I;  3KIF A;  1VQ4 1;  3B3B A;  4XND A;  2RT9 A;  1QVF Z;  1YJ9 1;  2O7G A;  4AR9 A;  4E32 A;  4ZW6 A;  1JJ2 Z;  1R0K A;  1JWH C;  1JG9 A;  3FU3 A;  1Q0Q A;  4BXX I;  3J80 b;  2JCY A;  2HU9 A;  2PMZ A;  4XNB A;  2I3C A;  1YHQ Z;  2R70 A;  4ZW7 A;  4A3B I;  5AN9 F;  3CCM Z;  3D9X A;  3CD6 1;  5AEN A;  3I07 A;  4BBR I;  3BG1 B;  4A03 A;  3HOX I;  1KQS Y;  2JCV A;  4XMZ A;  3QJX A;  1JGI A;  4XMW A;  1Y1V I;  3IFU A;  1VQ9 Z;  2HF1 A;  4BY7 I;  3NDJ A;  4GAE A;  2RPR A;  1NJI 1;  2B63 I;  2DE7 A;  3FUN A;  3I4N I;  1USP B;  4S1T A;  2LIY A;  4BKX A;  1DL6 A;  2IZ4 A;  5C4J I;  3MZK B;  1S46 A;  5CM2 M;  2DE5 A;  4A3D I;  3VMG A;  3CME Z;  3CCR Z;  1P9N A;  4MD8 A;  3CHO A;  2QEX 1;  3CCJ Z;  3S15 I;  2E2J I;  4MON A;  2JS4 A;  1YJN 1;  1MW3 A;  3A14 A;  3ZHX A;  3FTU A;  4NBC A;  2QVW A;  3I56 Z;  4BBS I;  4KP7 A;  4ZX4 A;  1VQ4 Z;  3FU0 A;  3CMA 1;  4CL1 A;  2Y1E A;  3FUM A;  4XN8 A;  4Q4I A;  3CZG A;  3VMI A;  3CXC Y;  2QA4 1;  2M48 A;  1YJ9 Z;  3GTO I;  1RQF A;  1MW2 A;  1USP A;  4Y52 I;  3HOW I;  5A2Q f;  2AKL A;  3G71 1;  4RVH A;  3KED A;  1VQO 1;  1N8R 1;  3CCQ 1;  4QUO A;  2KI7 B;  1I6H I;  1Q0H A;  2Y1D A;  4FCA A;  2JMO A;  3CD6 Z;  3PO3 S;  2EGT A;  2JR6 A;  3FTY A;  3NFZ A;  4A3J I;  2RJI A;  2NVX I;  3B7S A;  3MON A;  4PVB A;  1G5A A;  4A93 I;  3FUF A;  3FUD A;  1MVY A;  5T67 A;  1Q7Y 2;  4NQW A;  1Q0L A;  3PO3 I;  1YI2 1;  5JAZ A;  4AYS A;  1VQ8 1;  4XO4 A;  3CPW Z;  4ZW5 A;  3OW2 Z;  1K9M 1;  1KD1 2;  3JAM b;  3U9W A;  2XPY A;  5JC1 A;  3FQM A;  1YIJ Z;  2KPI A;  4XN5 A;  4QIR A;  4K5P A;  2IZ3 A;  3CZK A;  2OTL 1;  3CCV 1;  2QLV B;  5A2Q b;  4QHP A;  1I3Q I;  4NH1 C;  3B2P A;  3FUI A;  1RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...