1X3ZA

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
320
structure length
320
Chain Sequence
b'NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptide: N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
total genus 113
structure length 320
sequence length 320
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.90 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1x3zA03
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x3zA04
1ZB8A 1TWAI 3S16I 3EERA 2PK7A 3RZDI 4NBAA 2NVXI 3PO3I 5C4JI 3HOUI 5C44I 2R92I 4MH4A 2NVTI 1L1OC 1WCMI 2R7ZI 3M3YI 4BBSI 4A3BI 2B63I 2E2HI 1LQLA 4NBCA 4A3FI 3GCFA 3VMHA 3S1RI 3D6WA 4NBHA 3GTJI 4X6AI 4BXXI 1Y1WI 4A3MI 3U50C 1I3QI 2E2II 3GTQI 3GTGI 1ML8A 2RBLA 3VMIA 3FKII 1K83I 1X3WA 3GTPI 3HOWI 3GTLI 1X3ZA 2E2JI 4BBRI 3S2HI 2JA7I 4A3JI 4A3LI 2JA8I 3K7AI 2VUMI 2F4MA 1TWCI 2JA6I 3H3VJ 1QYPA 3M4OI 4BY1I 3I4MI 1TWFI 3HOZI 5C4XI 3I4NI 1SFOI 5IP7I 3HOXI 2YU9I 3RZOI 2BJOA 2DE6A 3CQZI 1R9TI 1RO4A 3Q87A 4NBEA 1RLYA 3H0GI 2K5RA 4A3II 2R93I 5IP9I 3VB9A 2DE5A 3GTOI 1NUIA 1YUAA 2P3YA 2AKLA 2F4OA 1Y1VI 5FLMI 1Y1VS 2JNYA 3I07A 3S1QI 4A3EI 4NB9A 4A3CI 3ESWA 3S17I 3HOYI 4NBDA 3S14I 2NVQI 3LUSA 4Y7NI 4NBBA 1WW9A 3S2DI 3GTKI 1TWHI 4A93I 2J6AA 4A3DI 1I50I 4QTTA 4QTUA 1N2FA 3S1NI 3PO3S 3HOVI 5C3EI 4NBGA 1USPB 1ZB9A 1I6HI 4BY7I 1PFTA 4XX2A 1DL6A 4NOZA 2KPIA 3GTMI 3GTMS 2JA5I 4NBFA 1TFIA 1TWGI 4NB8A 2JR6A 2NVYI 4A3GI 2DE7A 3S1MI 3VMGA 4A3KI 3PO2I 4Y52I 3GKQA 5CM2M 2HF1A 2JS4A 3S15I 1VLAA 1USPA
chains in the Genus database with same CATH superfamily
1ZB8A 4FLRA 2GTHA 5FLXb 3FTVA 4EWCA 3CMA1 4ZX3A 4NBAA 3T8VA 3I55Z 4K5LA 3HOUI 1R0LA 4MH4A 1K8A1 3T4NB 4RSYA 2DQ6A 3FU0A 2Y1GA 1S7MA 2QRCB 3OW2Y 5AENA 3M3YI 4BBSI 1YJN1 3CHSA 3CC41 1VQ5Z 3NH5A 4A3BI 3CCQ1 1VQK1 3Q44A 1LQLA 3BG0B 4AR8A 4MRIA 4X6AI 4XN9A 2QREB 3NH4A 1QF8A 2OZKA 2V8JA 3IF8A 4BXXI 3D9XA 1YIJZ 1ZH1A 1VQLZ 1I3QI 2E2II 3G71Z 3FULA 2JD0A 1YHQZ 1GW6A 1N8R2 3FH7A 1K9M2 4RCVA 4XO4A 1VQOZ 1K83I 2Y1FA 2GTQA 3ZI0A 1MW2A 3CMAZ 4R7LA 3CCJ1 3CCU1 3B2XA 3AU9A 5T6BA 2VUMI 2V8KA 3M4OI 4XO5A 3JAMb 5AN9F 2C82A 3TE5B 3CCQZ 1VQKZ 5EV7A 1YJ91 3R0IA 4XN7A 3UEQA 3AUAA 4ZX5A 3JT1A 2VPXA 4QMEA 2K5RA 2V45A 1H19A 4A3II 2R93I 4RVBA 3CZKA 3B7UX 5IP9I 3B3BA 3CCV1 1JVSA 1YI2Z 3GTOI 2GTIA 4E33A 4GAAA 1YUAA 2P3YA 2OTL1 1MW1A 4ZQTA 1Y1VI 4E2ZA 5FLMI 4MD8A 3FUIA 3S1QI 3CCJZ 3CCUZ 3RC8A 2IZ3A 3ESWA 3P5JB 3HOYI 3NH8A 2NVQI 4R5VA 4Y7NI 3FH5A 4PU2A 4XMUA 3MONA 3GTKI 3WQRA 1I50I 2Y1DA 1YJ9Z 4XO3A 1VQ71 3KIFA 3KIHA 2Q4ZA 5C3EI 1SG7A 3QJXA 5JMPA 2P28A 4ZW5A 2YADA 1ZB9A 1I6HI 1MW3A 4ZX4A 1SIWA 1MVYA 4MONA 5A2Qb 1Q822 3CCVZ 4XMXA 4XMWA 2JA5I 4AICA 4E30A 1TWGI 2OTLZ 2NVYI 4X2UA 2JIRA 1R0KA 3CME1 2R6MA 3QWUA 1USPA 3B37A 2W03A 5T64A 3CZLA 2NVXI 3PO3I 5FLXf 2GU2A 2NVTI 1VQ51 1K731 1WCMI 1VQ7Z 3NFZA 3EEDA 2B63I 4BKXA 4HGYA 3B34A 1Q862 1WZNA 3VVLA 1M902 1RP3A 3S1RI 3CPWY 3D6WA 4NBHA 4KP7A 1SQMA 3CPWZ 3G6E1 1Z03A 1KC82 4QPEA 3ZHYA 1VQ91 3RASA 3CMEZ 3FKII 3GTPI 4Y67A 4K5OA 5JBIA 2Y1EA 3FUKA 2JA7I 5D1OA 4E31A 2JA8I 3MZLB 2JUBA 2JA6I 3H3VJ 1QYPA 4XN4A 1Q812 3I4MI 3FUEA 4FLOA 2JCVA 4R5TA 5JC1A 4Y6RA 3I4NI 1ONNA 5D1PA 1VQ41 1JGIA 1ZS2A 1KRLA 1VQ81 3JAMf 4FLSA 1T1SA 2VPWA 1Q0QA 5DULA 4ZW3A 2PMZA 2PUSA 1R9TI 3UERA 1VQP1 2NAPA 3A06A 3FUNA 4NBEA 2C5ZA 3VTNA 3G6EZ 3ZHZA 1YI21 3CC2Z 2RJIA 3FTXA 3CXBA 4RVHA 1VQ9Z 2MAPA 1RNIA 1NJI1 4RV9A 2A7OA 2JIOA 3EBGA 2WB1A 4J3BA 4QUOA 3CCL1 2JD1A 4ZN6A 3I07A 3B7SA 3FUHA 4NB9A 3FHEA 1JWHC 1QVGZ 1Z01A 4ZW7A 3PUUA 2E7ZA 2G2KA 4NQWA 1KD11 4PVBA 3J80b 4Q4IA 5JMWA 5BPPA 4CXFA 1Q7Y1 4NBBA 1VQ4Z 1MW0A 3T0YA 1VQ8Z 3NDIA 2OOXB 3U9WA 4ZQEA 3PO3S 1VQPZ 2OTJ1 1Q0HA 2XPZA 4Q4EA 1USPB 2LEXA 1W2BY 2WZGA 2RIQA 1W2BZ 2LFUA 2R70A 2KPIA 4K5NA 1JG9A 3GTMS 3FUFA 3EBHA 2B61A 1X0TA 1N8R1 4A3GI 5A2Qf 3ANNA 2O4HA 3CCLZ 1K9M1 3S1MI 2XQ0A 3MZKB 1T1RA 3S15I 2HF1A 2V8IA 3CHRA 3Q43A 2JD2A 4DGLA 2JIPA 2QRDB 3EBIA 4OOFA 1VQ6Z 2MAOA 3EERA 3AU8A 1YUKA 2ZXGA 2PGGA 5T67A 4E2XA 4DK1A 1VQN1 2KI7B 5C4JI 2DQMA 2QR1B 1RQFA 3JSZA 2RPRA 4RVGA 4TNUA 2R7ZI 2OTJZ 3CHOA 5LL6f 2RT9A 1M1K1 4A3FI 3FUMA 3GCFA 5JNLA 5DLLA 3GTJI 5D1OB 3D2LA 2QJ1A 4AR9A 4MD9A 3FUJA 1Y1WI 4A3MI 3CCE1 1S46A 4XN2A 3GTGI 2PM9A 2RBLA 2O7GA 1VQMZ 1X3WA 3HOWI 3CIAA 1QXFA 1X3ZA 2E2JI 2R72A 1P9NA 3CCM1 4XN8A 4BBRI 3S2HI 2HPTA 4A3JI 1VQNZ 2VPYA 3K7AI 2R59A 2F4MA 3F3FC 1TWCI 3CHQA 2JIMA 1ONPA 3FUDA 5C4XI 1ONOA 1K8A2 3CCR1 2WPGA 2HPOA 3ANLA 3WQSB 3CHPA 1OR7A 5IP7I 3HOXI 4PW4A 3RZOI 2BJOA 4NFRA 4XMVA 3B7RL 3CQZI 3CC21 3CD61 2PL5A 3Q87A 5JO0A 1RLYA 1AA6A 2XPYA 3H0GI 3I561 3CCEZ 4AR1A 3VB9A 2DE5A 2QVWA 1NUIA 2AKLA 3CCS1 2M6NA 2Y0SA 3CCMZ 4ZW8A 4Y6SA 4ARFA 1Y1VS 1NP6A 4K5MA 4A3EI 1NJI2 3ZHXA 2EGHA 4XN5A 3VVMA 1Z02A 2JIQA 2QA41 1YJW1 4LUPA 3J7A4 4A3CI 1KQSY 5IT9b 2JMOA 1KQSZ 3FQMA 3CCRZ 1JJ2Y 2O53A 3LUSA 5FWQA 3S2DI 1WW9A 4A93I 1JJ2Z 3J80f 2J6AA 1KD12 4A3DI 4GAEA 4QTTA 3CZGA 2V3VA 3A14A 3J81b 3S1NI 3CD6Z 1Q861 1RO2A 1M901 1Q7Y2 3FTYA 3I56Z 4BY7I 4E2WA 4XX2A 4RS4A 3FTUA 2AYDA 4E2YA 3OW2Z 1DL6A 4NOZA 4MXUA 1S721 2Q51A 1KC81 4NBFA 1QVGY 1TFIA 4NH1C 4ZQFA 3CCSZ 4AYBA 4Y52I 3PO2I 2M48A 5CM2M 3UCQA 3B7TA 3FQQA 3FTSA 3G4SZ 1VQ61 1VLAA 1K5HA 1YJWZ 2QA4Z 3FH8A 1TWAI 3S16I 2QKDA 3CC71 4ZQGA 2PK7A 4S1TA 3RZDI 1Q811 4A03A 1Q16A 2LIYA 4XNAA 4DPRA 5C44I 3FTZA 2R92I 2QLVB 4HGZA 1L1OC 1WJ2A 4FCAA 4ZX6A 4HH4A 2QEX1 4DQYB 1Y8CA 2FFLA 3ANMA 2E2HI 4NBCA 1G5AA 3VMHA 1YJNZ 3CC4Z 3IX0A 2W04A 5DYFA 3IR7A 1S72Z 4JNDA 1M1K2 3U50C 1VQM1 2OOYB 3GTQI 1ML8A 5HNFA 3VMIA 1HS6A 4XNBA 2VJ8A 3FU6A 3FTWA 3GTLI 4E32A 4QHPA 4R5XA 3WQQA 3CC7Z 3TDHB 3KEDA 4L2LA 2VPZA 4A3LI 4RVDA 2JV7A 4AYSA 4BY1I 1TWFI 2IZ4A 2QEXZ 3HOZI 2WAQA 1K732 3FU3A 3NDJA 1SFOI 3B2PA 4ZW6A 2YU9I 2DE6A 3IIEA 5JAZA 1RO4A 1FDIA 4OOEA 1WIIA 2I3CA 3HKZA 4MD7A 2WZFA 5HLTA 3CZEA 2H85A 1FDOA 2F4OA 4XMTA 2JNYA 3BG1B 2HU9A 2JCYA 3CXCY 2ZAEB 1YIT1 3CXCZ 3HW2A 3S17I 1QVFY 1SC5A 4NBDA 3S14I 1QVFZ 3IFUA 4FLQA 3I551 1TWHI 4MS6A 5IT9f 3F3PC 4RVFA 2IV2X 2EGTA 4QTUA 1Q821 2VF1A 1N2FA 3HOVI 1H3LA 4XN1A 4MKTA 3FU5A 4NBGA 3J81f 2JCXA 3RC3A 1PFTA 1Q0LA 2K3RA 3GTMI 4QIRA 5HNHA 4CL1A 1YIJ1 4NB8A 2JR6A 2RHBA 2DE7A 4XMZA 2VLAA 3G4S1 1VQL1 2Y1CA 3VMGA 4Y6PA 4A3KI 3G711 1YHQ1 3GKQA 4XNDA 2JS4A 2VUGA 4K5PA 4ZQHA 1VQO1 1RO0A 1YITZ 2E9HA
chains in the Genus database with same CATH topology
1ZB8A 4FLRA 2GTHA 5FLXb 3FTVA 4EWCA 3CMA1 4ZX3A 4NBAA 3T8VA 3I55Z 4K5LA 3HOUI 1R0LA 4MH4A 1K8A1 3T4NB 4RSYA 2DQ6A 3FU0A 2Y1GA 1S7MA 2QRCB 3OW2Y 5AENA 3M3YI 4BBSI 1YJN1 3CHSA 3CC41 1VQ5Z 3NH5A 4A3BI 3CCQ1 1VQK1 3Q44A 1LQLA 3BG0B 4AR8A 4MRIA 4X6AI 4XN9A 2QREB 3NH4A 1QF8A 2OZKA 2V8JA 3IF8A 4BXXI 3D9XA 1YIJZ 1ZH1A 1VQLZ 1I3QI 2E2II 3G71Z 3FULA 2JD0A 1YHQZ 1GW6A 1N8R2 3FH7A 1K9M2 4RCVA 4XO4A 1VQOZ 1K83I 2Y1FA 2GTQA 3ZI0A 1MW2A 3CMAZ 4R7LA 3CCJ1 3CCU1 3B2XA 3AU9A 5T6BA 2VUMI 2V8KA 3M4OI 4XO5A 3JAMb 5AN9F 2C82A 3TE5B 3CCQZ 1VQKZ 5EV7A 1YJ91 3R0IA 4XN7A 3UEQA 3AUAA 4ZX5A 3JT1A 4QMEA 2K5RA 1H19A 4A3II 2R93I 4RVBA 3CZKA 3B7UX 5IP9I 3B3BA 3CCV1 1JVSA 1YI2Z 3GTOI 2GTIA 4E33A 4GAAA 1YUAA 2P3YA 2OTL1 1MW1A 4ZQTA 1Y1VI 4E2ZA 5FLMI 4MD8A 3FUIA 3S1QI 3CCJZ 3CCUZ 3RC8A 2IZ3A 3ESWA 3P5JB 3HOYI 3NH8A 2NVQI 4R5VA 4Y7NI 3FH5A 4PU2A 4XMUA 3MONA 3GTKI 3WQRA 1I50I 2Y1DA 1YJ9Z 4XO3A 1VQ71 3KIFA 3KIHA 2Q4ZA 5C3EI 1SG7A 3QJXA 5JMPA 2P28A 4ZW5A 2YADA 1ZB9A 1I6HI 1MW3A 4ZX4A 1MVYA 4MONA 5A2Qb 1Q822 3CCVZ 4XMXA 4XMWA 2JA5I 4AICA 4E30A 1TWGI 2OTLZ 2NVYI 4X2UA 1R0KA 3CME1 2R6MA 3QWUA 1USPA 3B37A 2W03A 5T64A 3CZLA 2NVXI 3PO3I 5FLXf 2GU2A 2NVTI 1VQ51 1K731 1WCMI 1VQ7Z 3NFZA 3EEDA 2B63I 4BKXA 4HGYA 3B34A 1Q862 3VVLA 1M902 1RP3A 3S1RI 3CPWY 3D6WA 4NBHA 4KP7A 1SQMA 3CPWZ 3G6E1 1Z03A 1KC82 4QPEA 3ZHYA 1VQ91 3RASA 3CMEZ 3FKII 3GTPI 4Y67A 4K5OA 5JBIA 2Y1EA 3FUKA 2JA7I 5D1OA 4E31A 2JA8I 3MZLB 2JUBA 2JA6I 3H3VJ 1QYPA 4XN4A 1Q812 3I4MI 3FUEA 4FLOA 2JCVA 4R5TA 5JC1A 4Y6RA 3I4NI 1ONNA 5D1PA 1VQ41 1JGIA 1ZS2A 1KRLA 1VQ81 3JAMf 4FLSA 1T1SA 1Q0QA 5DULA 4ZW3A 2PMZA 2PUSA 1R9TI 3UERA 1VQP1 3A06A 3FUNA 4NBEA 2C5ZA 3VTNA 3G6EZ 3ZHZA 1YI21 3CC2Z 2RJIA 3FTXA 4RVHA 1VQ9Z 2MAPA 1RNIA 1NJI1 4RV9A 2A7OA 3EBGA 2WB1A 4J3BA 4QUOA 3CCL1 2JD1A 4ZN6A 3I07A 3B7SA 3FUHA 4NB9A 3FHEA 1JWHC 1QVGZ 1Z01A 4ZW7A 3PUUA 2G2KA 4NQWA 1KD11 4PVBA 3J80b 4Q4IA 5JMWA 5BPPA 4CXFA 1Q7Y1 4NBBA 1VQ4Z 1MW0A 3T0YA 1VQ8Z 3NDIA 2OOXB 3U9WA 4ZQEA 3PO3S 1VQPZ 2OTJ1 1Q0HA 2XPZA 4Q4EA 1USPB 1W2BY 2WZGA 2RIQA 1W2BZ 2LFUA 2R70A 2KPIA 4K5NA 1JG9A 3GTMS 3FUFA 3EBHA 2B61A 1X0TA 1N8R1 4A3GI 5A2Qf 3ANNA 2O4HA 3CCLZ 1K9M1 3S1MI 2XQ0A 3MZKB 1T1RA 3S15I 2HF1A 2V8IA 3CHRA 3Q43A 2JD2A 4DGLA 2QRDB 3EBIA 4OOFA 1VQ6Z 2MAOA 3EERA 3AU8A 1YUKA 2ZXGA 2PGGA 5T67A 4E2XA 4DK1A 1VQN1 2KI7B 5C4JI 2DQMA 2QR1B 1RQFA 3JSZA 2RPRA 4RVGA 4TNUA 2R7ZI 2OTJZ 3CHOA 5LL6f 2RT9A 1M1K1 4A3FI 3FUMA 3GCFA 5JNLA 5DLLA 3GTJI 5D1OB 2QJ1A 4AR9A 4MD9A 3FUJA 1Y1WI 4A3MI 3CCE1 1S46A 4XN2A 3GTGI 2PM9A 2RBLA 2O7GA 1VQMZ 1X3WA 3HOWI 3CIAA 1X3ZA 2E2JI 2R72A 1P9NA 3CCM1 4XN8A 4BBRI 3S2HI 2HPTA 4A3JI 1VQNZ 3K7AI 2R59A 2F4MA 3F3FC 1TWCI 3CHQA 1ONPA 3FUDA 5C4XI 1ONOA 1K8A2 3CCR1 2WPGA 2HPOA 3ANLA 3WQSB 3CHPA 1OR7A 5IP7I 3HOXI 4PW4A 3RZOI 2BJOA 4NFRA 4XMVA 3B7RL 3CQZI 3CC21 3CD61 2PL5A 3Q87A 5JO0A 1RLYA 2XPYA 3H0GI 3I561 3CCEZ 4AR1A 3VB9A 2DE5A 2QVWA 1NUIA 2AKLA 3CCS1 2M6NA 2Y0SA 3CCMZ 4ZW8A 4Y6SA 4ARFA 1Y1VS 1NP6A 4K5MA 4A3EI 1NJI2 3ZHXA 2EGHA 4XN5A 3VVMA 1Z02A 1YJW1 2QA41 3J7A4 4LUPA 4A3CI 1KQSY 5IT9b 2JMOA 1KQSZ 3FQMA 3CCRZ 1JJ2Y 2O53A 3LUSA 5FWQA 3S2DI 1WW9A 4A93I 1JJ2Z 3J80f 2J6AA 1KD12 4A3DI 4GAEA 4QTTA 3CZGA 3A14A 3J81b 3S1NI 3CD6Z 1Q861 1RO2A 1M901 1Q7Y2 3FTYA 3I56Z 4BY7I 4E2WA 4XX2A 4RS4A 3FTUA 4E2YA 3OW2Z 1DL6A 4NOZA 4MXUA 1S721 2Q51A 1KC81 4NBFA 1QVGY 1TFIA 4NH1C 4ZQFA 3CCSZ 4AYBA 4Y52I 3PO2I 2M48A 5CM2M 3UCQA 3B7TA 3FQQA 3FTSA 3G4SZ 1VQ61 1VLAA 1K5HA 1YJWZ 2QA4Z 3FH8A 1TWAI 3S16I 2QKDA 3CC71 4ZQGA 2PK7A 4S1TA 3RZDI 1Q811 4A03A 2LIYA 4XNAA 4DPRA 5C44I 3FTZA 2R92I 2QLVB 4HGZA 1L1OC 4HH4A 4FCAA 4ZX6A 2QEX1 4DQYB 2FFLA 3ANMA 2E2HI 4NBCA 1G5AA 3VMHA 1YJNZ 3CC4Z 3IX0A 2W04A 5DYFA 1S72Z 4JNDA 1M1K2 3U50C 1VQM1 2OOYB 3GTQI 1ML8A 5HNFA 3VMIA 1HS6A 4XNBA 2VJ8A 3FU6A 3FTWA 3GTLI 4E32A 4QHPA 4R5XA 3WQQA 3CC7Z 3TDHB 3KEDA 4L2LA 4A3LI 4RVDA 2JV7A 4AYSA 4BY1I 1TWFI 2IZ4A 2QEXZ 3HOZI 2WAQA 1K732 3FU3A 3NDJA 1SFOI 3B2PA 4ZW6A 2YU9I 2DE6A 3IIEA 5JAZA 1RO4A 4OOEA 1WIIA 2I3CA 3HKZA 4MD7A 2WZFA 5HLTA 3CZEA 2H85A 2F4OA 4XMTA 2JNYA 3BG1B 2HU9A 2JCYA 3CXCY 2ZAEB 1YIT1 3CXCZ 3S17I 1QVFY 1SC5A 4NBDA 3S14I 1QVFZ 3IFUA 4FLQA 3I551 1TWHI 4MS6A 5IT9f 3F3PC 4RVFA 2EGTA 4QTUA 1Q821 2VF1A 1N2FA 3HOVI 1H3LA 4XN1A 4MKTA 3FU5A 4NBGA 3J81f 2JCXA 3RC3A 1PFTA 1Q0LA 2K3RA 3GTMI 4QIRA 5HNHA 4CL1A 1YIJ1 4NB8A 2JR6A 2RHBA 2DE7A 4XMZA 2VLAA 3G4S1 1VQL1 2Y1CA 3VMGA 4Y6PA 4A3KI 3G711 1YHQ1 3GKQA 4XNDA 2JS4A 2VUGA 4K5PA 4ZQHA 1VQO1 1RO0A 1YITZ 2E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB8 A;  1TWA I;  3S16 I;  3EER A;  2PK7 A;  3RZD I;  4NBA A;  2NVX I;  3PO3 I;  5C4J I;  3HOU I;  5C44 I;  2R92 I;  4MH4 A;  2NVT I;  1L1O C;  1WCM I;  2R7Z I;  3M3Y I;  4BBS I;  4A3B I;  2B63 I;  2E2H I;  1LQL A;  4NBC A;  4A3F I;  3GCF A;  3VMH A;  3S1R I;  3D6W A;  4NBH A;  3GTJ I;  4X6A I;  4BXX I;  1Y1W I;  4A3M I;  3U50 C;  1I3Q I;  2E2I I;  3GTQ I;  3GTG I;  1ML8 A;  2RBL A;  3VMI A;  3FKI I;  1K83 I;  1X3W A;  3GTP I;  3HOW I;  3GTL I;  1X3Z A;  2E2J I;  4BBR I;  3S2H I;  2JA7 I;  4A3J I;  4A3L I;  2JA8 I;  3K7A I;  2VUM I;  2F4M A;  1TWC I;  2JA6 I;  3H3V J;  1QYP A;  3M4O I;  4BY1 I;  3I4M I;  1TWF I;  3HOZ I;  5C4X I;  3I4N I;  1SFO I;  5IP7 I;  3HOX I;  2YU9 I;  3RZO I;  2BJO A;  2DE6 A;  3CQZ I;  1R9T I;  1RO4 A;  3Q87 A;  4NBE A;  1RLY A;  3H0G I;  2K5R A;  4A3I I;  2R93 I;  5IP9 I;  3VB9 A;  2DE5 A;  3GTO I;  1NUI A;  1YUA A;  2P3Y A;  2AKL A;  2F4O A;  1Y1V I;  5FLM I;  1Y1V S;  2JNY A;  3I07 A;  3S1Q I;  4A3E I;  4NB9 A;  4A3C I;  3ESW A;  3S17 I;  3HOY I;  4NBD A;  3S14 I;  2NVQ I;  3LUS A;  4Y7N I;  4NBB A;  1WW9 A;  3S2D I;  3GTK I;  1TWH I;  4A93 I;  2J6A A;  4A3D I;  1I50 I;  4QTT A;  4QTU A;  1N2F A;  3S1N I;  3PO3 S;  3HOV I;  5C3E I;  4NBG A;  1USP B;  1ZB9 A;  1I6H I;  4BY7 I;  1PFT A;  4XX2 A;  1DL6 A;  4NOZ A;  2KPI A;  3GTM I;  3GTM S;  2JA5 I;  4NBF A;  1TFI A;  1TWG I;  4NB8 A;  2JR6 A;  2NVY I;  4A3G I;  2DE7 A;  3S1M I;  3VMG A;  4A3K I;  3PO2 I;  4Y52 I;  3GKQ A;  5CM2 M;  2HF1 A;  2JS4 A;  3S15 I;  1VLA A;  1USP A; 
#chains in the Genus database with same CATH topology
 1ZB8 A;  4FLR A;  2GTH A;  5FLX b;  3FTV A;  4EWC A;  3CMA 1;  4ZX3 A;  4NBA A;  3T8V A;  3I55 Z;  4K5L A;  3HOU I;  1R0L A;  4MH4 A;  1K8A 1;  3T4N B;  4RSY A;  2DQ6 A;  3FU0 A;  2Y1G A;  1S7M A;  2QRC B;  3OW2 Y;  5AEN A;  3M3Y I;  4BBS I;  1YJN 1;  3CHS A;  3CC4 1;  1VQ5 Z;  3NH5 A;  4A3B I;  3CCQ 1;  1VQK 1;  3Q44 A;  1LQL A;  3BG0 B;  4AR8 A;  4MRI A;  4X6A I;  4XN9 A;  2QRE B;  3NH4 A;  1QF8 A;  2OZK A;  2V8J A;  3IF8 A;  4BXX I;  3D9X A;  1YIJ Z;  1ZH1 A;  1VQL Z;  1I3Q I;  2E2I I;  3G71 Z;  3FUL A;  2JD0 A;  1YHQ Z;  1GW6 A;  1N8R 2;  3FH7 A;  1K9M 2;  4RCV A;  4XO4 A;  1VQO Z;  1K83 I;  2Y1F A;  2GTQ A;  3ZI0 A;  1MW2 A;  3CMA Z;  4R7L A;  3CCJ 1;  3CCU 1;  3B2X A;  3AU9 A;  5T6B A;  2VUM I;  2V8K A;  3M4O I;  4XO5 A;  3JAM b;  5AN9 F;  2C82 A;  3TE5 B;  3CCQ Z;  1VQK Z;  5EV7 A;  1YJ9 1;  3R0I A;  4XN7 A;  3UEQ A;  3AUA A;  4ZX5 A;  3JT1 A;  2VPX A;  4QME A;  2K5R A;  2V45 A;  1H19 A;  4A3I I;  2R93 I;  4RVB A;  3CZK A;  3B7U X;  5IP9 I;  3B3B A;  3CCV 1;  1JVS A;  1YI2 Z;  3GTO I;  2GTI A;  4E33 A;  4GAA A;  1YUA A;  2P3Y A;  2OTL 1;  1MW1 A;  4ZQT A;  1Y1V I;  4E2Z A;  5FLM I;  4MD8 A;  3FUI A;  3S1Q I;  3CCJ Z;  3CCU Z;  3RC8 A;  2IZ3 A;  3ESW A;  3P5J B;  3HOY I;  3NH8 A;  2NVQ I;  4R5V A;  4Y7N I;  3FH5 A;  4PU2 A;  4XMU A;  3MON A;  3GTK I;  3WQR A;  1I50 I;  2Y1D A;  1YJ9 Z;  4XO3 A;  1VQ7 1;  3KIF A;  3KIH A;  2Q4Z A;  5C3E I;  1SG7 A;  3QJX A;  5JMP A;  2P28 A;  4ZW5 A;  2YAD A;  1ZB9 A;  1I6H I;  1MW3 A;  4ZX4 A;  1SIW A;  1MVY A;  4MON A;  5A2Q b;  1Q82 2;  3CCV Z;  4XMX A;  4XMW A;  2JA5 I;  4AIC A;  4E30 A;  1TWG I;  2OTL Z;  2NVY I;  4X2U A;  2JIR A;  1R0K A;  3CME 1;  2R6M A;  3QWU A;  1USP A;  3B37 A;  2W03 A;  5T64 A;  3CZL A;  2NVX I;  3PO3 I;  5FLX f;  2GU2 A;  2NVT I;  1VQ5 1;  1K73 1;  1WCM I;  1VQ7 Z;  3NFZ A;  3EED A;  2B63 I;  4BKX A;  4HGY A;  3B34 A;  1Q86 2;  1WZN A;  3VVL A;  1M90 2;  1RP3 A;  3S1R I;  3CPW Y;  3D6W A;  4NBH A;  4KP7 A;  1SQM A;  3CPW Z;  3G6E 1;  1Z03 A;  1KC8 2;  4QPE A;  3ZHY A;  1VQ9 1;  3RAS A;  3CME Z;  3FKI I;  3GTP I;  4Y67 A;  4K5O A;  5JBI A;  2Y1E A;  3FUK A;  2JA7 I;  5D1O A;  4E31 A;  2JA8 I;  3MZL B;  2JUB A;  2JA6 I;  3H3V J;  1QYP A;  4XN4 A;  1Q81 2;  3I4M I;  3FUE A;  4FLO A;  2JCV A;  4R5T A;  5JC1 A;  4Y6R A;  3I4N I;  1ONN A;  5D1P A;  1VQ4 1;  1JGI A;  1ZS2 A;  1KRL A;  1VQ8 1;  3JAM f;  4FLS A;  1T1S A;  2VPW A;  1Q0Q A;  5DUL A;  4ZW3 A;  2PMZ A;  2PUS A;  1R9T I;  3UER A;  1VQP 1;  2NAP A;  3A06 A;  3FUN A;  4NBE A;  2C5Z A;  3VTN A;  3G6E Z;  3ZHZ A;  1YI2 1;  3CC2 Z;  2RJI A;  3FTX A;  3CXB A;  4RVH A;  1VQ9 Z;  2MAP A;  1RNI A;  1NJI 1;  4RV9 A;  2A7O A;  2JIO A;  3EBG A;  2WB1 A;  4J3B A;  4QUO A;  3CCL 1;  2JD1 A;  4ZN6 A;  3I07 A;  3B7S A;  3FUH A;  4NB9 A;  3FHE A;  1JWH C;  1QVG Z;  1Z01 A;  4ZW7 A;  3PUU A;  2E7Z A;  2G2K A;  4NQW A;  1KD1 1;  4PVB A;  3J80 b;  4Q4I A;  5JMW A;  5BPP A;  4CXF A;  1Q7Y 1;  4NBB A;  1VQ4 Z;  1MW0 A;  3T0Y A;  1VQ8 Z;  3NDI A;  2OOX B;  3U9W A;  4ZQE A;  3PO3 S;  1VQP Z;  2OTJ 1;  1Q0H A;  2XPZ A;  4Q4E A;  1USP B;  2LEX A;  1W2B Y;  2WZG A;  2RIQ A;  1W2B Z;  2LFU A;  2R70 A;  2KPI A;  4K5N A;  1JG9 A;  3GTM S;  3FUF A;  3EBH A;  2B61 A;  1X0T A;  1N8R 1;  4A3G I;  5A2Q f;  3ANN A;  2O4H A;  3CCL Z;  1K9M 1;  3S1M I;  2XQ0 A;  3MZK B;  1T1R A;  3S15 I;  2HF1 A;  2V8I A;  3CHR A;  3Q43 A;  2JD2 A;  4DGL A;  2JIP A;  2QRD B;  3EBI A;  4OOF A;  1VQ6 Z;  2MAO A;  3EER A;  3AU8 A;  1YUK A;  2ZXG A;  2PGG A;  5T67 A;  4E2X A;  4DK1 A;  1VQN 1;  2KI7 B;  5C4J I;  2DQM A;  2QR1 B;  1RQF A;  3JSZ A;  2RPR A;  4RVG A;  4TNU A;  2R7Z I;  2OTJ Z;  3CHO A;  5LL6 f;  2RT9 A;  1M1K 1;  4A3F I;  3FUM A;  3GCF A;  5JNL A;  5DLL A;  3GTJ I;  5D1O B;  3D2L A;  2QJ1 A;  4AR9 A;  4MD9 A;  3FUJ A;  1Y1W I;  4A3M I;  3CCE 1;  1S46 A;  4XN2 A;  3GTG I;  2PM9 A;  2RBL A;  2O7G A;  1VQM Z;  1X3W A;  3HOW I;  3CIA A;  1QXF A;  1X3Z A;  2E2J I;  2R72 A;  1P9N A;  3CCM 1;  4XN8 A;  4BBR I;  3S2H I;  2HPT A;  4A3J I;  1VQN Z;  2VPY A;  3K7A I;  2R59 A;  2F4M A;  3F3F C;  1TWC I;  3CHQ A;  2JIM A;  1ONP A;  3FUD A;  5C4X I;  1ONO A;  1K8A 2;  3CCR 1;  2WPG A;  2HPO A;  3ANL A;  3WQS B;  3CHP A;  1OR7 A;  5IP7 I;  3HOX I;  4PW4 A;  3RZO I;  2BJO A;  4NFR A;  4XMV A;  3B7R L;  3CQZ I;  3CC2 1;  3CD6 1;  2PL5 A;  3Q87 A;  5JO0 A;  1RLY A;  1AA6 A;  2XPY A;  3H0G I;  3I56 1;  3CCE Z;  4AR1 A;  3VB9 A;  2DE5 A;  2QVW A;  1NUI A;  2AKL A;  3CCS 1;  2M6N A;  2Y0S A;  3CCM Z;  4ZW8 A;  4Y6S A;  4ARF A;  1Y1V S;  1NP6 A;  4K5M A;  4A3E I;  1NJI 2;  3ZHX A;  2EGH A;  4XN5 A;  3VVM A;  1Z02 A;  2JIQ A;  2QA4 1;  1YJW 1;  4LUP A;  3J7A 4;  4A3C I;  1KQS Y;  5IT9 b;  2JMO A;  1KQS Z;  3FQM A;  3CCR Z;  1JJ2 Y;  2O53 A;  3LUS A;  5FWQ A;  3S2D I;  1WW9 A;  4A93 I;  1JJ2 Z;  3J80 f;  2J6A A;  1KD1 2;  4A3D I;  4GAE A;  4QTT A;  3CZG A;  2V3V A;  3A14 A;  3J81 b;  3S1N I;  3CD6 Z;  1Q86 1;  1RO2 A;  1M90 1;  1Q7Y 2;  3FTY A;  3I56 Z;  4BY7 I;  4E2W A;  4XX2 A;  4RS4 A;  3FTU A;  2AYD A;  4E2Y A;  3OW2 Z;  1DL6 A;  4NOZ A;  4MXU A;  1S72 1;  2Q51 A;  1KC8 1;  4NBF A;  1QVG Y;  1TFI A;  4NH1 C;  4ZQF A;  3CCS Z;  4AYB A;  4Y52 I;  3PO2 I;  2M48 A;  5CM2 M;  3UCQ A;  3B7T A;  3FQQ A;  3FTS A;  3G4S Z;  1VQ6 1;  1VLA A;  1K5H A;  1YJW Z;  2QA4 Z;  3FH8 A;  1TWA I;  3S16 I;  2QKD A;  3CC7 1;  4ZQG A;  2PK7 A;  4S1T A;  3RZD I;  1Q81 1;  4A03 A;  1Q16 A;  2LIY A;  4XNA A;  4DPR A;  5C44 I;  3FTZ A;  2R92 I;  2QLV B;  4HGZ A;  1L1O C;  1WJ2 A;  4FCA A;  4ZX6 A;  4HH4 A;  2QEX 1;  4DQY B;  1Y8C A;  2FFL A;  3ANM A;  2E2H I;  4NBC A;  1G5A A;  3VMH A;  1YJN Z;  3CC4 Z;  3IX0 A;  2W04 A;  5DYF A;  3IR7 A;  1S72 Z;  4JND A;  1M1K 2;  3U50 C;  1VQM 1;  2OOY B;  3GTQ I;  1ML8 A;  5HNF A;  3VMI A;  1HS6 A;  4XNB A;  2VJ8 A;  3FU6 A;  3FTW A;  3GTL I;  4E32 A;  4QHP A;  4R5X A;  3WQQ A;  3CC7 Z;  3TDH B;  3KED A;  4L2L A;  2VPZ A;  4A3L I;  4RVD A;  2JV7 A;  4AYS A;  4BY1 I;  1TWF I;  2IZ4 A;  2QEX Z;  3HOZ I;  2WAQ A;  1K73 2;  3FU3 A;  3NDJ A;  1SFO I;  3B2P A;  4ZW6 A;  2YU9 I;  2DE6 A;  3IIE A;  5JAZ A;  1RO4 A;  1FDI A;  4OOE A;  1WII A;  2I3C A;  3HKZ A;  4MD7 A;  2WZF A;  5HLT A;  3CZE A;  2H85 A;  1FDO A;  2F4O A;  4XMT A;  2JNY A;  3BG1 B;  2HU9 A;  2JCY A;  3CXC Y;  2ZAE B;  1YIT 1;  3CXC Z;  3HW2 A;  3S17 I;  1QVF Y;  1SC5 A;  4NBD A;  3S14 I;  1QVF Z;  3IFU A;  4FLQ A;  3I55 1;  1TWH I;  4MS6 A;  5IT9 f;  3F3P C;  4RVF A;  2IV2 X;  2EGT A;  4QTU A;  1Q82 1;  2VF1 A;  1N2F A;  3HOV I;  1H3L A;  4XN1 A;  4MKT A;  3FU5 A;  4NBG A;  3J81 f;  2JCX A;  3RC3 A;  1PFT A;  1Q0L A;  2K3R A;  3GTM I;  4QIR A;  5HNH A;  4CL1 A;  1YIJ 1;  4NB8 A;  2JR6 A;  2RHB A;  2DE7 A;  4XMZ A;  2VLA A;  3G4S 1;  1VQL 1;  2Y1C A;  3VMG A;  4Y6P A;  4A3K I;  3G71 1;  1YHQ 1;  3GKQ A;  4XND A;  2JS4 A;  2VUG A;  4K5P A;  4ZQH A;  1VQO 1;  1RO0 A;  1YIT Z;  2E9H A; 
#chains in the Genus database with same CATH homology
 1ZB8 A;  4FLR A;  2GTH A;  5FLX b;  3FTV A;  4EWC A;  3CMA 1;  4ZX3 A;  4NBA A;  3T8V A;  3I55 Z;  4K5L A;  3HOU I;  1R0L A;  4MH4 A;  1K8A 1;  3T4N B;  4RSY A;  2DQ6 A;  3FU0 A;  2Y1G A;  1S7M A;  2QRC B;  3OW2 Y;  5AEN A;  3M3Y I;  4BBS I;  1YJN 1;  3CHS A;  3CC4 1;  1VQ5 Z;  3NH5 A;  4A3B I;  3CCQ 1;  1VQK 1;  3Q44 A;  1LQL A;  3BG0 B;  4AR8 A;  4MRI A;  4X6A I;  4XN9 A;  2QRE B;  3NH4 A;  1QF8 A;  2OZK A;  2V8J A;  3IF8 A;  4BXX I;  3D9X A;  1YIJ Z;  1ZH1 A;  1VQL Z;  1I3Q I;  2E2I I;  3G71 Z;  3FUL A;  2JD0 A;  1YHQ Z;  1GW6 A;  1N8R 2;  3FH7 A;  1K9M 2;  4RCV A;  4XO4 A;  1VQO Z;  1K83 I;  2Y1F A;  2GTQ A;  3ZI0 A;  1MW2 A;  3CMA Z;  4R7L A;  3CCJ 1;  3CCU 1;  3B2X A;  3AU9 A;  5T6B A;  2VUM I;  2V8K A;  3M4O I;  4XO5 A;  3JAM b;  5AN9 F;  2C82 A;  3TE5 B;  3CCQ Z;  1VQK Z;  5EV7 A;  1YJ9 1;  3R0I A;  4XN7 A;  3UEQ A;  3AUA A;  4ZX5 A;  3JT1 A;  4QME A;  2K5R A;  1H19 A;  4A3I I;  2R93 I;  4RVB A;  3CZK A;  3B7U X;  5IP9 I;  3B3B A;  3CCV 1;  1JVS A;  1YI2 Z;  3GTO I;  2GTI A;  4E33 A;  4GAA A;  1YUA A;  2P3Y A;  2OTL 1;  1MW1 A;  4ZQT A;  1Y1V I;  4E2Z A;  5FLM I;  4MD8 A;  3FUI A;  3S1Q I;  3CCJ Z;  3CCU Z;  3RC8 A;  2IZ3 A;  3ESW A;  3P5J B;  3HOY I;  3NH8 A;  2NVQ I;  4R5V A;  4Y7N I;  3FH5 A;  4PU2 A;  4XMU A;  3MON A;  3GTK I;  3WQR A;  1I50 I;  2Y1D A;  1YJ9 Z;  4XO3 A;  1VQ7 1;  3KIF A;  3KIH A;  2Q4Z A;  5C3E I;  1SG7 A;  3QJX A;  5JMP A;  2P28 A;  4ZW5 A;  2YAD A;  1ZB9 A;  1I6H I;  1MW3 A;  4ZX4 A;  1MVY A;  4MON A;  5A2Q b;  1Q82 2;  3CCV Z;  4XMX A;  4XMW A;  2JA5 I;  4AIC A;  4E30 A;  1TWG I;  2OTL Z;  2NVY I;  4X2U A;  1R0K A;  3CME 1;  2R6M A;  3QWU A;  1USP A;  3B37 A;  2W03 A;  5T64 A;  3CZL A;  2NVX I;  3PO3 I;  5FLX f;  2GU2 A;  2NVT I;  1VQ5 1;  1K73 1;  1WCM I;  1VQ7 Z;  3NFZ A;  3EED A;  2B63 I;  4BKX A;  4HGY A;  3B34 A;  1Q86 2;  3VVL A;  1M90 2;  1RP3 A;  3S1R I;  3CPW Y;  3D6W A;  4NBH A;  4KP7 A;  1SQM A;  3CPW Z;  3G6E 1;  1Z03 A;  1KC8 2;  4QPE A;  3ZHY A;  1VQ9 1;  3RAS A;  3CME Z;  3FKI I;  3GTP I;  4Y67 A;  4K5O A;  5JBI A;  2Y1E A;  3FUK A;  2JA7 I;  5D1O A;  4E31 A;  2JA8 I;  3MZL B;  2JUB A;  2JA6 I;  3H3V J;  1QYP A;  4XN4 A;  1Q81 2;  3I4M I;  3FUE A;  4FLO A;  2JCV A;  4R5T A;  5JC1 A;  4Y6R A;  3I4N I;  1ONN A;  5D1P A;  1VQ4 1;  1JGI A;  1ZS2 A;  1KRL A;  1VQ8 1;  3JAM f;  4FLS A;  1T1S A;  1Q0Q A;  5DUL A;  4ZW3 A;  2PMZ A;  2PUS A;  1R9T I;  3UER A;  1VQP 1;  3A06 A;  3FUN A;  4NBE A;  2C5Z A;  3VTN A;  3G6E Z;  3ZHZ A;  1YI2 1;  3CC2 Z;  2RJI A;  3FTX A;  4RVH A;  1VQ9 Z;  2MAP A;  1RNI A;  1NJI 1;  4RV9 A;  2A7O A;  3EBG A;  2WB1 A;  4J3B A;  4QUO A;  3CCL 1;  2JD1 A;  4ZN6 A;  3I07 A;  3B7S A;  3FUH A;  4NB9 A;  3FHE A;  1JWH C;  1QVG Z;  1Z01 A;  4ZW7 A;  3PUU A;  2G2K A;  4NQW A;  1KD1 1;  4PVB A;  3J80 b;  4Q4I A;  5JMW A;  5BPP A;  4CXF A;  1Q7Y 1;  4NBB A;  1VQ4 Z;  1MW0 A;  3T0Y A;  1VQ8 Z;  3NDI A;  2OOX B;  3U9W A;  4ZQE A;  3PO3 S;  1VQP Z;  2OTJ 1;  1Q0H A;  2XPZ A;  4Q4E A;  1USP B;  1W2B Y;  2WZG A;  2RIQ A;  1W2B Z;  2LFU A;  2R70 A;  2KPI A;  4K5N A;  1JG9 A;  3GTM S;  3FUF A;  3EBH A;  2B61 A;  1X0T A;  1N8R 1;  4A3G I;  5A2Q f;  3ANN A;  2O4H A;  3CCL Z;  1K9M 1;  3S1M I;  2XQ0 A;  3MZK B;  1T1R A;  3S15 I;  2HF1 A;  2V8I A;  3CHR A;  3Q43 A;  2JD2 A;  4DGL A;  2QRD B;  3EBI A;  4OOF A;  1VQ6 Z;  2MAO A;  3EER A;  3AU8 A;  1YUK A;  2ZXG A;  2PGG A;  5T67 A;  4E2X A;  4DK1 A;  1VQN 1;  2KI7 B;  5C4J I;  2DQM A;  2QR1 B;  1RQF A;  3JSZ A;  2RPR A;  4RVG A;  4TNU A;  2R7Z I;  2OTJ Z;  3CHO A;  5LL6 f;  2RT9 A;  1M1K 1;  4A3F I;  3FUM A;  3GCF A;  5JNL A;  5DLL A;  3GTJ I;  5D1O B;  2QJ1 A;  4AR9 A;  4MD9 A;  3FUJ A;  1Y1W I;  4A3M I;  3CCE 1;  1S46 A;  4XN2 A;  3GTG I;  2PM9 A;  2RBL A;  2O7G A;  1VQM Z;  1X3W A;  3HOW I;  3CIA A;  1X3Z A;  2E2J I;  2R72 A;  1P9N A;  3CCM 1;  4XN8 A;  4BBR I;  3S2H I;  2HPT A;  4A3J I;  1VQN Z;  3K7A I;  2R59 A;  2F4M A;  3F3F C;  1TWC I;  3CHQ A;  1ONP A;  3FUD A;  5C4X I;  1ONO A;  1K8A 2;  3CCR 1;  2WPG A;  2HPO A;  3ANL A;  3WQS B;  3CHP A;  1OR7 A;  5IP7 I;  3HOX I;  4PW4 A;  3RZO I;  2BJO A;  4NFR A;  4XMV A;  3B7R L;  3CQZ I;  3CC2 1;  3CD6 1;  2PL5 A;  3Q87 A;  5JO0 A;  1RLY A;  2XPY A;  3H0G I;  3I56 1;  3CCE Z;  4AR1 A;  3VB9 A;  2DE5 A;  2QVW A;  1NUI A;  2AKL A;  3CCS 1;  2M6N A;  2Y0S A;  3CCM Z;  4ZW8 A;  4Y6S A;  4ARF A;  1Y1V S;  1NP6 A;  4K5M A;  4A3E I;  1NJI 2;  3ZHX A;  2EGH A;  4XN5 A;  3VVM A;  1Z02 A;  1YJW 1;  2QA4 1;  3J7A 4;  4LUP A;  4A3C I;  1KQS Y;  5IT9 b;  2JMO A;  1KQS Z;  3FQM A;  3CCR Z;  1JJ2 Y;  2O53 A;  3LUS A;  5FWQ A;  3S2D I;  1WW9 A;  4A93 I;  1JJ2 Z;  3J80 f;  2J6A A;  1KD1 2;  4A3D I;  4GAE A;  4QTT A;  3CZG A;  3A14 A;  3J81 b;  3S1N I;  3CD6 Z;  1Q86 1;  1RO2 A;  1M90 1;  1Q7Y 2;  3FTY A;  3I56 Z;  4BY7 I;  4E2W A;  4XX2 A;  4RS4 A;  3FTU A;  4E2Y A;  3OW2 Z;  1DL6 A;  4NOZ A;  4MXU A;  1S72 1;  2Q51 A;  1KC8 1;  4NBF A;  1QVG Y;  1TFI A;  4NH1 C;  4ZQF A;  3CCS Z;  4AYB A;  4Y52 I;  3PO2 I;  2M48 A;  5CM2 M;  3UCQ A;  3B7T A;  3FQQ A;  3FTS A;  3G4S Z;  1VQ6 1;  1VLA A;  1K5H A;  1YJW Z;  2QA4 Z;  3FH8 A;  1TWA I;  3S16 I;  2QKD A;  3CC7 1;  4ZQG A;  2PK7 A;  4S1T A;  3RZD I;  1Q81 1;  4A03 A;  2LIY A;  4XNA A;  4DPR A;  5C44 I;  3FTZ A;  2R92 I;  2QLV B;  4HGZ A;  1L1O C;  4HH4 A;  4FCA A;  4ZX6 A;  2QEX 1;  4DQY B;  2FFL A;  3ANM A;  2E2H I;  4NBC A;  1G5A A;  3VMH A;  1YJN Z;  3CC4 Z;  3IX0 A;  2W04 A;  5DYF A;  1S72 Z;  4JND A;  1M1K 2;  3U50 C;  1VQM 1;  2OOY B;  3GTQ I;  1ML8 A;  5HNF A;  3VMI A;  1HS6 A;  4XNB A;  2VJ8 A;  3FU6 A;  3FTW A;  3GTL I;  4E32 A;  4QHP A;  4R5X A;  3WQQ A;  3CC7 Z;  3TDH B;  3KED A;  4L2L A;  4A3L I;  4RVD A;  2JV7 A;  4AYS A;  4BY1 I;  1TWF I;  2IZ4 A;  2QEX Z;  3HOZ I;  2WAQ A;  1K73 2;  3FU3 A;  3NDJ A;  1SFO I;  3B2P A;  4ZW6 A;  2YU9 I;  2DE6 A;  3IIE A;  5JAZ A;  1RO4 A;  4OOE A;  1WII A;  2I3C A;  3HKZ A;  4MD7 A;  2WZF A;  5HLT A;  3CZE A;  2H85 A;  2F4O A;  4XMT A;  2JNY A;  3BG1 B;  2HU9 A;  2JCY A;  3CXC Y;  2ZAE B;  1YIT 1;  3CXC Z;  3S17 I;  1QVF Y;  1SC5 A;  4NBD A;  3S14 I;  1QVF Z;  3IFU A;  4FLQ A;  3I55 1;  1TWH I;  4MS6 A;  5IT9 f;  3F3P C;  4RVF A;  2EGT A;  4QTU A;  1Q82 1;  2VF1 A;  1N2F A;  3HOV I;  1H3L A;  4XN1 A;  4MKT A;  3FU5 A;  4NBG A;  3J81 f;  2JCX A;  3RC3 A;  1PFT A;  1Q0L A;  2K3R A;  3GTM I;  4QIR A;  5HNH A;  4CL1 A;  1YIJ 1;  4NB8 A;  2JR6 A;  2RHB A;  2DE7 A;  4XMZ A;  2VLA A;  3G4S 1;  1VQL 1;  2Y1C A;  3VMG A;  4Y6P A;  4A3K I;  3G71 1;  1YHQ 1;  3GKQ A;  4XND A;  2JS4 A;  2VUG A;  4K5P A;  4ZQH A;  1VQO 1;  1RO0 A;  1YIT Z;  2E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...