1X3ZA

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
320
structure length
320
Chain Sequence
NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords peptide: N-glycanase
total genus 113
structure length 320
sequence length 320
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.90 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1x3zA03
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x3zA04
3U50C 3FKII 2JA6I 2F4MA 2JA7I 2DE7A 1YUAA 4A3LI 2DE5A 2YU9I 3S1MI 3PO2I 1R9TI 3HOZI 3GTPI 3EERA 1USPB 2DE6A 5C3EI 3S2DI 2E2II 5IP7I 3LUSA 5C4XI 3GTQI 4A3CI 1ZB9A 2NVXI 3I4NI 1NUIA 2R7ZI 4A3BI 2JS4A 1Y1WI 1I3QI 4BY1I 4QTUA 1SFOI 5IP9I 1RLYA 1WCMI 1TWHI 4BBSI 4A3KI 1Y1VI 4A3DI 2NVQI 5C44I 1Y1VS 2E2HI 3PO3S 2E2JI 4NBGA 3GTOI 3S16I 3K7AI 1ZB8A 4NBHA 3M4OI 4MH4A 4NBBA 2NVYI 3VB9A 4A3GI 3H0GI 3S1QI 3CQZI 3VMIA 4BXXI 4NBFA 3HOXI 3S1RI 3VMHA 4NBEA 4A3JI 2F4OA 4NBCA 3GTLI 3HOWI 1DL6A 4QTTA 3S1NI 3I4MI 1I50I 1TFIA 3GTMS 5C4JI 3HOUI 4A3II 3GTJI 1N2FA 4Y7NI 3HOYI 1X3ZA 2JR6A 4NBDA 3RZDI 1TWCI 3GKQA 4A3MI 2KPIA 1USPA 3S17I 4A93I 2K5RA 4A3FI 3S15I 1TWGI 2HF1A 4BY7I 3PO3I 1QYPA 1PFTA 1ML8A 4Y52I 1WW9A 2JNYA 1K83I 2JA5I 4NB9A 3GTKI 1RO4A 2BJOA 2RBLA 2NVTI 2PK7A 2R93I 1LQLA 2AKLA 3GTGI 2P3YA 3GCFA 3D6WA 3RZOI 1TWAI 3S2HI 1I6HI 4NBAA 4NOZA 3GTMI 1L1OC 1VLAA 5CM2M 3S14I 3VMGA 2JA8I 2VUMI 1X3WA 4A3EI 3M3YI 2B63I 2R92I 2J6AA 3Q87A 3ESWA 3HOVI 4X6AI 1TWFI 3I07A 4XX2A 3H3VJ 5FLMI 4NB8A 4BBRI
chains in the Genus database with same CATH superfamily
3D2LA 5EV7A 2JA6I 2Q51A 4XMWA 1RO0A 2DE7A 2JA7I 3CCQZ 2DE5A 3CCE1 3AUAA 2JIRA 2W04A 3CPWY 4ZQFA 3HOZI 1Z01A 3EERA 2DE6A 1VQ7Z 4ZX3A 1K732 1P9NA 1YHQZ 2OOXB 4E33A 5C4XI 3CCSZ 3CHRA 4HH4A 3WQRA 3FU6A 3FULA 1QF8A 1I3QI 1FDIA 4JNDA 4ZX4A 5D1PA 4XMUA 4E2WA 3CHQA 1RLYA 1YJ9Z 3CCL1 3G6EZ 3TE5B 5T6BA 4ZX6A 5JMWA 3B37A 5JC1A 4A3DI 2JCYA 1Y1VS 1N8R2 1VQ4Z 4HGZA 4A03A 1JJ2Z 2E2JI 1VQKZ 3WQSB 4ZW5A 1MVYA 4CL1A 3FHEA 1WJ2A 2NAPA 1G5AA 4LUPA 2NVYI 1S7MA 2R72A 3FTVA 3VTNA 3FUIA 1S46A 4RVBA 4XMVA 4NBFA 2Y0SA 1MW2A 4E2ZA 3HOWI 3GTLI 1NP6A 1SC5A 4QUOA 1Z02A 4XN4A 2V8KA 3ZHXA 3S1NI 1VQM1 3FTWA 4X2UA 4NQWA 1TFIA 4XNAA 5C4JI 1MW0A 1RQFA 3F3FC 1WIIA 3FUNA 4R5XA 5LL6f 1NJI2 1YITZ 1QVFY 1H19A 3GKQA 4XMXA 4RVFA 2I3CA 4A93I 3FTSA 1VQP1 1Z03A 2K5RA 1KC82 4XNBA 3S15I 1TWGI 3JT1A 5A2Qb 5BPPA 1QYPA 1ML8A 2VUGA 3FU3A 1WW9A 1FDOA 2JNYA 4E30A 2QKDA 4ZN6A 3TDHB 5DYFA 2JA5I 5A2Qf 4GAEA 3B2PA 4RVGA 4Y6PA 3FUEA 3KEDA 3CC21 1Q7Y1 2Q4ZA 2P3YA 3GCFA 4R7LA 1OR7A 1MW3A 3ANLA 1Q812 3NH8A 3Q44A 3FH8A 3CCRZ 2JD2A 3VMGA 4FLQA 2A7OA 1QVGY 2R59A 3B7SA 3Q87A 5AN9F 3HOVI 1TWFI 3CD61 4OOFA 2PM9A 1YIJZ 4NB8A 3FUMA 4E32A 3J81b 1K8A1 2OZKA 4AR9A 2GTHA 4K5PA 1YUAA 3J80b 5JNLA 3FUJA 3CXCZ 3CZKA 3FTXA 2OTLZ 1R9TI 1Y8CA 3G4SZ 4BKXA 3U9WA 3CCS1 5C3EI 3CCR1 1KQSY 2KI7B 2RPRA 3LUSA 5IP7I 1ZS2A 1VQL1 3NH4A 4A3CI 3CXCY 1M1K1 3Q43A 4AR8A 2JS4A 1KRLA 2RHBA 4MONA 5T67A 3CD6Z 4ZW6A 3CZGA 5JMPA 4ZQTA 4QTUA 2PL5A 3CMA1 3AU8A 1Q0QA 2FFLA 2IZ4A 1M902 2G2KA 1Q862 3IX0A 3FQQA 1K5HA 3FU0A 4OOEA 4RCVA 3JAMb 1Y1VI 3G711 3CZEA 5C44I 1Q822 2NVQI 1Q0LA 3NDJA 4R5TA 2JD1A 4XNDA 2QJ1A 1HS6A 1VQ71 3CXBA 1VQPZ 4XO4A 4PU2A 1VQ6Z 3T0YA 1K9M1 1KD12 2VPYA 2WB1A 4Y67A 3KIFA 4A3GI 2PUSA 3H0GI 1VQ91 3VMIA 3CCJ1 4QMEA 3T8VA 1DL6A 4XN8A 4NBCA 5D1OB 1K731 3GTMS 3CMAZ 3IF8A 4A3II 4MKTA 4AYBA 4XMTA 3HOYI 1AA6A 2Y1DA 2XQ0A 1T1SA 3ANMA 5IT9b 1VQ51 4J3BA 1SQMA 2KPIA 1VQO1 1QXFA 3BG1B 3S17I 4XN1A 4E31A 1VQ81 2ZXGA 5JBIA 2QA41 2MAPA 3FU5A 3VVLA 2VPZA 4R5VA 3FUFA 1YUKA 2WAQA 1N8R1 1W2BY 4RVHA 3OW2Z 4NB9A 1RO4A 2NVTI 2EGHA 4ZQHA 2RT9A 4ZW3A 3MONA 3RZOI 4Y6RA 4NH1C 3IIEA 2JIMA 2M6NA 2QLVB 4ZW7A 3CCMZ 2QR1B 3GTMI 3S14I 2DQ6A 5CM2M 1X3WA 1VQ61 2B63I 5JO0A 4PW4A 3CHOA 2LIYA 3BG0B 5JAZA 1W2BZ 3CC4Z 3J81f 2C82A 3I07A 1ONNA 3G71Z 3EBHA 3H3VJ 4FLRA 4RVDA 4XN5A 3CZLA 2F4MA 4MD9A 3MZLB 2HPTA 3VVMA 4A3LI 2VJ8A 4QHPA 3S1MI 3PO2I 5HNFA 1ZH1A 4ZQGA 3RC8A 4HGYA 1USPB 3B7UX 2H85A 1Q16A 4Q4EA 2O4HA 3GTQI 5FWQA 2NVXI 2WZFA 1NUIA 3I4NI 4A3BI 1Q7Y2 4AICA 4K5LA 4L2LA 2VLAA 3EEDA 4NFRA 4DGLA 1YI21 4BY1I 1VQNZ 3I56Z 3G6E1 5FLXf 3CC7Z 1WCMI 3MZKB 4ZX5A 4RS4A 4BBSI 1VQN1 3ZHYA 4XN7A 3CCM1 2JIQA 4GAAA 2E2HI 3PO3S 3QWUA 3CMEZ 2R6MA 2PGGA 3GTOI 2JCVA 1YHQ1 3FUDA 3K7AI 3A14A 1YIT1 1ZB8A 3FH5A 4NBHA 4MH4A 2OTL1 1H3LA 4MD7A 2GTQA 2O53A 2Y1EA 4NBBA 4ARFA 3VB9A 4K5MA 4MRIA 2IV2X 4BXXI 5DULA 2EGTA 3I561 3B7TA 2GU2A 2M48A 1JVSA 1SIWA 2V45A 3VMHA 4MXUA 4NBEA 4A3JI 2P28A 1Q0HA 4XMZA 4QTTA 5HLTA 3I4MI 1I50I 2QRDB 3CC41 1KQSZ 2E7ZA 1M1K2 2QEX1 4Y7NI 1X3ZA 2RJIA 3F3PC 1X0TA 3D9XA 4A3MI 1M901 5D1OA 1VQ41 3FTUA 3FTYA 1QVGZ 4RSYA 4DPRA 3EBIA 4AR1A 3CIAA 4DQYB 2Y1FA 4EWCA 2AYDA 1Q821 4BY7I 1PFTA 2QEXZ 3J7A4 3FTZA 4Y52I 2VPXA 4RV9A 1VQ9Z 1K9M2 1KD11 2PK7A 3B7RL 2AKLA 3HKZA 3NFZA 2YADA 3GTGI 2IZ3A 2QREB 1S721 3NH5A 4XN9A 3S2HI 3IFUA 4NOZA 1L1OC 1VLAA 2VUMI 3M3YI 3ZI0A 2V8IA 4ZW8A 2R70A 2R92I 1YJNZ 3I551 3QJXA 3ESWA 5AENA 1WZNA 5FLMI 3PUUA 2Y1GA 1TWCI 3JSZA 1YJ91 3U50C 3FKII 1VQ8Z 3CCJZ 1RNIA 2ZAEB 1JJ2Y 2YU9I 1VQ5Z 4QPEA 2OTJZ 1ONPA 3GTPI 2JUBA 3RC3A 2DQMA 3IR7A 3J80f 3S2DI 1SG7A 3R0IA 2Y1CA 3B2XA 4XO5A 2E2II 2VF1A 2LFUA 4S1TA 3FUKA 1ZB9A 5IT9f 2WPGA 4MS6A 1MW1A 2R7ZI 3B3BA 2PMZA 3FQMA 4MD8A 1NJI1 2GTIA 3CCLZ 1Y1WI 3CCQ1 4PVBA 1SFOI 4Y6SA 5IP9I 3CCV1 3WQQA 5T64A 1TWHI 1YI2Z 3RASA 4A3KI 1KC81 5FLXb 4CXFA 4K5NA 3UERA 3ANNA 3CPWZ 3CHPA 4XN2A 4ZQEA 2V8JA 4NBGA 2OOYB 3S16I 3FUHA 2HPOA 2JCXA 3A06A 2E9HA 3M4OI 4Q4IA 3CC2Z 3CCEZ 1T1RA 4AYSA 3S1QI 3KIHA 2WZGA 3CQZI 1QVFZ 1Q811 2MAOA 1YJWZ 3HOXI 3S1RI 4QIRA 3OW2Y 2F4OA 2JIOA 2HU9A 1VQLZ 4FLSA 3UEQA 4TNUA 3HOUI 3GTJI 2JV7A 1N2FA 2V3VA 3CCU1 2JR6A 4NBDA 3RZDI 4E2YA 1USPA 1RP3A 1K8A2 1RO2A 2JIPA 3CME1 1VQK1 1VQMZ 2RIQA 4A3FI 5HNHA 2OTJ1 2HF1A 2QVWA 3PO3I 1R0KA 3HW2A 3CCVZ 2XPYA 1K83I 4DK1A 4FLOA 3GTKI 2BJOA 2RBLA 4E2XA 2C5ZA 1JG9A 3AU9A 2W03A 2XPZA 2R93I 2JD0A 1GW6A 1LQLA 1YJW1 2K3RA 2QA4Z 3ZHZA 2QRCB 4KP7A 3D6WA 2O7GA 1VQOZ 1TWAI 5DLLA 3JAMf 2JMOA 2B61A 3T4NB 3G4S1 3NDIA 1Q861 4XO3A 1I6HI 3CHSA 3CCUZ 4NBAA 2LEXA 1JWHC 2JA8I 4A3EI 2VPWA 1S72Z 4FCAA 3CC71 2J6AA 1YIJ1 1JGIA 3FH7A 4X6AI 3UCQA 4K5OA 1ONOA 3B34A 1R0LA 4XX2A 3EBGA 3P5JB 3I55Z 1YJN1 4BBRI
chains in the Genus database with same CATH topology
5EV7A 2JA6I 2Q51A 4XMWA 1RO0A 2DE7A 2JA7I 3CCQZ 2DE5A 3CCE1 3AUAA 2W04A 3CPWY 4ZQFA 3HOZI 1Z01A 3EERA 2DE6A 1VQ7Z 4ZX3A 1K732 1P9NA 1YHQZ 2OOXB 4E33A 5C4XI 3CCSZ 3CHRA 4HH4A 3WQRA 3FU6A 3FULA 1QF8A 1I3QI 4JNDA 4ZX4A 5D1PA 4XMUA 4E2WA 3CHQA 1RLYA 1YJ9Z 3CCL1 3G6EZ 3TE5B 5T6BA 4ZX6A 5JMWA 3B37A 5JC1A 4A3DI 2JCYA 1Y1VS 1N8R2 1VQ4Z 4HGZA 4A03A 1JJ2Z 2E2JI 1VQKZ 3WQSB 4ZW5A 1MVYA 4CL1A 3FHEA 1G5AA 4LUPA 2NVYI 1S7MA 2R72A 3FTVA 3VTNA 3FUIA 1S46A 4RVBA 4XMVA 4NBFA 2Y0SA 1MW2A 4E2ZA 3HOWI 3GTLI 1NP6A 1SC5A 4QUOA 1Z02A 4XN4A 2V8KA 3ZHXA 3S1NI 1VQM1 3FTWA 4X2UA 4NQWA 1TFIA 4XNAA 5C4JI 1MW0A 1RQFA 3F3FC 1WIIA 3FUNA 4R5XA 5LL6f 1NJI2 1YITZ 1QVFY 1H19A 3GKQA 4XMXA 4RVFA 2I3CA 4A93I 3FTSA 1VQP1 1Z03A 2K5RA 1KC82 4XNBA 3S15I 1TWGI 3JT1A 5A2Qb 5BPPA 1QYPA 1ML8A 2VUGA 3FU3A 1WW9A 2JNYA 4E30A 2QKDA 4ZN6A 3TDHB 5DYFA 2JA5I 5A2Qf 4GAEA 3B2PA 4RVGA 4Y6PA 3FUEA 3KEDA 3CC21 1Q7Y1 2Q4ZA 2P3YA 3GCFA 4R7LA 1OR7A 1MW3A 3ANLA 1Q812 3NH8A 3Q44A 3FH8A 3CCRZ 2JD2A 3VMGA 4FLQA 2A7OA 1QVGY 2R59A 3B7SA 3Q87A 5AN9F 3HOVI 1TWFI 3CD61 4OOFA 2PM9A 1YIJZ 4NB8A 3FUMA 4E32A 3J81b 1K8A1 2OZKA 4AR9A 2GTHA 4K5PA 1YUAA 3J80b 5JNLA 3FUJA 3CXCZ 3CZKA 3FTXA 2OTLZ 1R9TI 3G4SZ 4BKXA 3U9WA 3CCS1 5C3EI 3CCR1 1KQSY 2KI7B 2RPRA 3LUSA 5IP7I 1ZS2A 1VQL1 3NH4A 4A3CI 3CXCY 1M1K1 3Q43A 4AR8A 2JS4A 1KRLA 2RHBA 4MONA 5T67A 3CD6Z 4ZW6A 3CZGA 5JMPA 4ZQTA 4QTUA 2PL5A 3CMA1 3AU8A 1Q0QA 2FFLA 2IZ4A 1M902 2G2KA 1Q862 3IX0A 3FQQA 1K5HA 3FU0A 4OOEA 4RCVA 3JAMb 1Y1VI 3G711 3CZEA 5C44I 1Q822 2NVQI 1Q0LA 3NDJA 4R5TA 2JD1A 4XNDA 2QJ1A 1HS6A 1VQ71 1VQPZ 4XO4A 4PU2A 1VQ6Z 3T0YA 1K9M1 1KD12 2WB1A 4Y67A 3KIFA 4A3GI 2PUSA 3H0GI 1VQ91 3VMIA 3CCJ1 4QMEA 3T8VA 1DL6A 4XN8A 4NBCA 5D1OB 1K731 3GTMS 3CMAZ 3IF8A 4A3II 4MKTA 4AYBA 4XMTA 3HOYI 2Y1DA 2XQ0A 1T1SA 3ANMA 5IT9b 1VQ51 4J3BA 1SQMA 2KPIA 1VQO1 3BG1B 3S17I 4XN1A 4E31A 1VQ81 2ZXGA 5JBIA 2QA41 2MAPA 3FU5A 3VVLA 4R5VA 3FUFA 1YUKA 2WAQA 1N8R1 1W2BY 4RVHA 3OW2Z 4NB9A 1RO4A 2NVTI 2EGHA 4ZQHA 2RT9A 4ZW3A 3MONA 3RZOI 4Y6RA 4NH1C 3IIEA 2M6NA 2QLVB 4ZW7A 3CCMZ 2QR1B 3GTMI 3S14I 2DQ6A 5CM2M 1X3WA 1VQ61 2B63I 5JO0A 4PW4A 3CHOA 2LIYA 3BG0B 5JAZA 1W2BZ 3CC4Z 3J81f 2C82A 3I07A 1ONNA 3G71Z 3EBHA 3H3VJ 4FLRA 4RVDA 4XN5A 3CZLA 2F4MA 4MD9A 3MZLB 2HPTA 3VVMA 4A3LI 2VJ8A 4QHPA 3S1MI 3PO2I 5HNFA 1ZH1A 4ZQGA 3RC8A 4HGYA 1USPB 3B7UX 2H85A 4Q4EA 2O4HA 3GTQI 5FWQA 2NVXI 2WZFA 1NUIA 3I4NI 4A3BI 1Q7Y2 4AICA 4K5LA 4L2LA 2VLAA 3EEDA 4NFRA 4DGLA 1YI21 4BY1I 1VQNZ 3I56Z 3G6E1 5FLXf 3CC7Z 1WCMI 3MZKB 4ZX5A 4RS4A 4BBSI 1VQN1 3ZHYA 4XN7A 3CCM1 4GAAA 2E2HI 3PO3S 3QWUA 3CMEZ 2R6MA 2PGGA 3GTOI 2JCVA 1YHQ1 3FUDA 3K7AI 3A14A 1YIT1 1ZB8A 3FH5A 4NBHA 4MH4A 2OTL1 1H3LA 4MD7A 2GTQA 2O53A 2Y1EA 4NBBA 4ARFA 3VB9A 4K5MA 4MRIA 4BXXI 5DULA 2EGTA 3I561 3B7TA 2GU2A 2M48A 1JVSA 3VMHA 4MXUA 4NBEA 4A3JI 2P28A 1Q0HA 4XMZA 4QTTA 5HLTA 3I4MI 1I50I 2QRDB 3CC41 1KQSZ 1M1K2 2QEX1 4Y7NI 1X3ZA 2RJIA 3F3PC 1X0TA 3D9XA 4A3MI 1M901 5D1OA 1VQ41 3FTUA 3FTYA 1QVGZ 4RSYA 4DPRA 3EBIA 4AR1A 3CIAA 4DQYB 2Y1FA 4EWCA 1Q821 4BY7I 1PFTA 2QEXZ 3J7A4 3FTZA 4Y52I 4RV9A 1VQ9Z 1K9M2 1KD11 2PK7A 3B7RL 2AKLA 3HKZA 3NFZA 2YADA 3GTGI 2IZ3A 2QREB 1S721 3NH5A 4XN9A 3S2HI 3IFUA 4NOZA 1L1OC 1VLAA 2VUMI 3M3YI 3ZI0A 2V8IA 4ZW8A 2R70A 2R92I 1YJNZ 3I551 3QJXA 3ESWA 5AENA 5FLMI 3PUUA 2Y1GA 1TWCI 3JSZA 1YJ91 3U50C 3FKII 1VQ8Z 3CCJZ 1RNIA 2ZAEB 1JJ2Y 2YU9I 1VQ5Z 4QPEA 2OTJZ 1ONPA 3GTPI 2JUBA 3RC3A 2DQMA 3J80f 3S2DI 1SG7A 3R0IA 2Y1CA 3B2XA 4XO5A 2E2II 2VF1A 2LFUA 4S1TA 3FUKA 1ZB9A 5IT9f 2WPGA 4MS6A 1MW1A 2R7ZI 3B3BA 2PMZA 3FQMA 4MD8A 1NJI1 2GTIA 3CCLZ 1Y1WI 3CCQ1 4PVBA 1SFOI 4Y6SA 5IP9I 3CCV1 3WQQA 5T64A 1TWHI 1YI2Z 3RASA 4A3KI 1KC81 5FLXb 4CXFA 4K5NA 3UERA 3ANNA 3CPWZ 3CHPA 4XN2A 4ZQEA 2V8JA 4NBGA 2OOYB 3S16I 3FUHA 2HPOA 2JCXA 3A06A 2E9HA 3M4OI 4Q4IA 3CC2Z 3CCEZ 1T1RA 4AYSA 3S1QI 3KIHA 2WZGA 3CQZI 1QVFZ 1Q811 2MAOA 1YJWZ 3HOXI 3S1RI 4QIRA 3OW2Y 2F4OA 2HU9A 1VQLZ 4FLSA 3UEQA 4TNUA 3HOUI 3GTJI 2JV7A 1N2FA 3CCU1 2JR6A 4NBDA 3RZDI 4E2YA 1USPA 1RP3A 1K8A2 1RO2A 1VQK1 3CME1 1VQMZ 2RIQA 4A3FI 5HNHA 2OTJ1 2HF1A 2QVWA 3PO3I 1R0KA 3CCVZ 2XPYA 1K83I 4DK1A 4FLOA 3GTKI 2BJOA 2RBLA 4E2XA 2C5ZA 1JG9A 3AU9A 2W03A 2XPZA 2R93I 2JD0A 1GW6A 1LQLA 1YJW1 2K3RA 2QA4Z 3ZHZA 2QRCB 4KP7A 3D6WA 2O7GA 1VQOZ 1TWAI 5DLLA 3JAMf 2JMOA 2B61A 3T4NB 3G4S1 3NDIA 1Q861 4XO3A 1I6HI 3CHSA 3CCUZ 4NBAA 1JWHC 2JA8I 4A3EI 1S72Z 4FCAA 3CC71 2J6AA 1YIJ1 1JGIA 3FH7A 4X6AI 3UCQA 4K5OA 1ONOA 3B34A 1R0LA 4XX2A 3EBGA 3P5JB 3I55Z 1YJN1 4BBRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U50 C;  3FKI I;  2JA6 I;  2F4M A;  2JA7 I;  2DE7 A;  1YUA A;  4A3L I;  2DE5 A;  2YU9 I;  3S1M I;  3PO2 I;  1R9T I;  3HOZ I;  3GTP I;  3EER A;  1USP B;  2DE6 A;  5C3E I;  3S2D I;  2E2I I;  5IP7 I;  3LUS A;  5C4X I;  3GTQ I;  4A3C I;  1ZB9 A;  2NVX I;  3I4N I;  1NUI A;  2R7Z I;  4A3B I;  2JS4 A;  1Y1W I;  1I3Q I;  4BY1 I;  4QTU A;  1SFO I;  5IP9 I;  1RLY A;  1WCM I;  1TWH I;  4BBS I;  4A3K I;  1Y1V I;  4A3D I;  2NVQ I;  5C44 I;  1Y1V S;  2E2H I;  3PO3 S;  2E2J I;  4NBG A;  3GTO I;  3S16 I;  3K7A I;  1ZB8 A;  4NBH A;  3M4O I;  4MH4 A;  4NBB A;  2NVY I;  3VB9 A;  4A3G I;  3H0G I;  3S1Q I;  3CQZ I;  3VMI A;  4BXX I;  4NBF A;  3HOX I;  3S1R I;  3VMH A;  4NBE A;  4A3J I;  2F4O A;  4NBC A;  3GTL I;  3HOW I;  1DL6 A;  4QTT A;  3S1N I;  3I4M I;  1I50 I;  1TFI A;  3GTM S;  5C4J I;  3HOU I;  4A3I I;  3GTJ I;  1N2F A;  4Y7N I;  3HOY I;  1X3Z A;  2JR6 A;  4NBD A;  3RZD I;  1TWC I;  3GKQ A;  4A3M I;  2KPI A;  1USP A;  3S17 I;  4A93 I;  2K5R A;  4A3F I;  3S15 I;  1TWG I;  2HF1 A;  4BY7 I;  3PO3 I;  1QYP A;  1PFT A;  1ML8 A;  4Y52 I;  1WW9 A;  2JNY A;  1K83 I;  2JA5 I;  4NB9 A;  3GTK I;  1RO4 A;  2BJO A;  2RBL A;  2NVT I;  2PK7 A;  2R93 I;  1LQL A;  2AKL A;  3GTG I;  2P3Y A;  3GCF A;  3D6W A;  3RZO I;  1TWA I;  3S2H I;  1I6H I;  4NBA A;  4NOZ A;  3GTM I;  1L1O C;  1VLA A;  5CM2 M;  3S14 I;  3VMG A;  2JA8 I;  2VUM I;  1X3W A;  4A3E I;  3M3Y I;  2B63 I;  2R92 I;  2J6A A;  3Q87 A;  3ESW A;  3HOV I;  4X6A I;  1TWF I;  3I07 A;  4XX2 A;  3H3V J;  5FLM I;  4NB8 A;  4BBR I; 
#chains in the Genus database with same CATH topology
 3D2L A;  5EV7 A;  2JA6 I;  2Q51 A;  4XMW A;  1RO0 A;  2DE7 A;  2JA7 I;  3CCQ Z;  2DE5 A;  3CCE 1;  3AUA A;  2JIR A;  2W04 A;  3CPW Y;  4ZQF A;  3HOZ I;  1Z01 A;  3EER A;  2DE6 A;  1VQ7 Z;  4ZX3 A;  1K73 2;  1P9N A;  1YHQ Z;  2OOX B;  4E33 A;  5C4X I;  3CCS Z;  3CHR A;  4HH4 A;  3WQR A;  3FU6 A;  3FUL A;  1QF8 A;  1I3Q I;  1FDI A;  4JND A;  4ZX4 A;  5D1P A;  4XMU A;  4E2W A;  3CHQ A;  1RLY A;  1YJ9 Z;  3CCL 1;  3G6E Z;  3TE5 B;  5T6B A;  4ZX6 A;  5JMW A;  3B37 A;  5JC1 A;  4A3D I;  2JCY A;  1Y1V S;  1N8R 2;  1VQ4 Z;  4HGZ A;  4A03 A;  1JJ2 Z;  2E2J I;  1VQK Z;  3WQS B;  4ZW5 A;  1MVY A;  4CL1 A;  3FHE A;  1WJ2 A;  2NAP A;  1G5A A;  4LUP A;  2NVY I;  1S7M A;  2R72 A;  3FTV A;  3VTN A;  3FUI A;  1S46 A;  4RVB A;  4XMV A;  4NBF A;  2Y0S A;  1MW2 A;  4E2Z A;  3HOW I;  3GTL I;  1NP6 A;  1SC5 A;  4QUO A;  1Z02 A;  4XN4 A;  2V8K A;  3ZHX A;  3S1N I;  1VQM 1;  3FTW A;  4X2U A;  4NQW A;  1TFI A;  4XNA A;  5C4J I;  1MW0 A;  1RQF A;  3F3F C;  1WII A;  3FUN A;  4R5X A;  5LL6 f;  1NJI 2;  1YIT Z;  1QVF Y;  1H19 A;  3GKQ A;  4XMX A;  4RVF A;  2I3C A;  4A93 I;  3FTS A;  1VQP 1;  1Z03 A;  2K5R A;  1KC8 2;  4XNB A;  3S15 I;  1TWG I;  3JT1 A;  5A2Q b;  5BPP A;  1QYP A;  1ML8 A;  2VUG A;  3FU3 A;  1WW9 A;  1FDO A;  2JNY A;  4E30 A;  2QKD A;  4ZN6 A;  3TDH B;  5DYF A;  2JA5 I;  5A2Q f;  4GAE A;  3B2P A;  4RVG A;  4Y6P A;  3FUE A;  3KED A;  3CC2 1;  1Q7Y 1;  2Q4Z A;  2P3Y A;  3GCF A;  4R7L A;  1OR7 A;  1MW3 A;  3ANL A;  1Q81 2;  3NH8 A;  3Q44 A;  3FH8 A;  3CCR Z;  2JD2 A;  3VMG A;  4FLQ A;  2A7O A;  1QVG Y;  2R59 A;  3B7S A;  3Q87 A;  5AN9 F;  3HOV I;  1TWF I;  3CD6 1;  4OOF A;  2PM9 A;  1YIJ Z;  4NB8 A;  3FUM A;  4E32 A;  3J81 b;  1K8A 1;  2OZK A;  4AR9 A;  2GTH A;  4K5P A;  1YUA A;  3J80 b;  5JNL A;  3FUJ A;  3CXC Z;  3CZK A;  3FTX A;  2OTL Z;  1R9T I;  1Y8C A;  3G4S Z;  4BKX A;  3U9W A;  3CCS 1;  5C3E I;  3CCR 1;  1KQS Y;  2KI7 B;  2RPR A;  3LUS A;  5IP7 I;  1ZS2 A;  1VQL 1;  3NH4 A;  4A3C I;  3CXC Y;  1M1K 1;  3Q43 A;  4AR8 A;  2JS4 A;  1KRL A;  2RHB A;  4MON A;  5T67 A;  3CD6 Z;  4ZW6 A;  3CZG A;  5JMP A;  4ZQT A;  4QTU A;  2PL5 A;  3CMA 1;  3AU8 A;  1Q0Q A;  2FFL A;  2IZ4 A;  1M90 2;  2G2K A;  1Q86 2;  3IX0 A;  3FQQ A;  1K5H A;  3FU0 A;  4OOE A;  4RCV A;  3JAM b;  1Y1V I;  3G71 1;  3CZE A;  5C44 I;  1Q82 2;  2NVQ I;  1Q0L A;  3NDJ A;  4R5T A;  2JD1 A;  4XND A;  2QJ1 A;  1HS6 A;  1VQ7 1;  3CXB A;  1VQP Z;  4XO4 A;  4PU2 A;  1VQ6 Z;  3T0Y A;  1K9M 1;  1KD1 2;  2VPY A;  2WB1 A;  4Y67 A;  3KIF A;  4A3G I;  2PUS A;  3H0G I;  1VQ9 1;  3VMI A;  3CCJ 1;  4QME A;  3T8V A;  1DL6 A;  4XN8 A;  4NBC A;  5D1O B;  1K73 1;  3GTM S;  3CMA Z;  3IF8 A;  4A3I I;  4MKT A;  4AYB A;  4XMT A;  3HOY I;  1AA6 A;  2Y1D A;  2XQ0 A;  1T1S A;  3ANM A;  5IT9 b;  1VQ5 1;  4J3B A;  1SQM A;  2KPI A;  1VQO 1;  1QXF A;  3BG1 B;  3S17 I;  4XN1 A;  4E31 A;  1VQ8 1;  2ZXG A;  5JBI A;  2QA4 1;  2MAP A;  3FU5 A;  3VVL A;  2VPZ A;  4R5V A;  3FUF A;  1YUK A;  2WAQ A;  1N8R 1;  1W2B Y;  4RVH A;  3OW2 Z;  4NB9 A;  1RO4 A;  2NVT I;  2EGH A;  4ZQH A;  2RT9 A;  4ZW3 A;  3MON A;  3RZO I;  4Y6R A;  4NH1 C;  3IIE A;  2JIM A;  2M6N A;  2QLV B;  4ZW7 A;  3CCM Z;  2QR1 B;  3GTM I;  3S14 I;  2DQ6 A;  5CM2 M;  1X3W A;  1VQ6 1;  2B63 I;  5JO0 A;  4PW4 A;  3CHO A;  2LIY A;  3BG0 B;  5JAZ A;  1W2B Z;  3CC4 Z;  3J81 f;  2C82 A;  3I07 A;  1ONN A;  3G71 Z;  3EBH A;  3H3V J;  4FLR A;  4RVD A;  4XN5 A;  3CZL A;  2F4M A;  4MD9 A;  3MZL B;  2HPT A;  3VVM A;  4A3L I;  2VJ8 A;  4QHP A;  3S1M I;  3PO2 I;  5HNF A;  1ZH1 A;  4ZQG A;  3RC8 A;  4HGY A;  1USP B;  3B7U X;  2H85 A;  1Q16 A;  4Q4E A;  2O4H A;  3GTQ I;  5FWQ A;  2NVX I;  2WZF A;  1NUI A;  3I4N I;  4A3B I;  1Q7Y 2;  4AIC A;  4K5L A;  4L2L A;  2VLA A;  3EED A;  4NFR A;  4DGL A;  1YI2 1;  4BY1 I;  1VQN Z;  3I56 Z;  3G6E 1;  5FLX f;  3CC7 Z;  1WCM I;  3MZK B;  4ZX5 A;  4RS4 A;  4BBS I;  1VQN 1;  3ZHY A;  4XN7 A;  3CCM 1;  2JIQ A;  4GAA A;  2E2H I;  3PO3 S;  3QWU A;  3CME Z;  2R6M A;  2PGG A;  3GTO I;  2JCV A;  1YHQ 1;  3FUD A;  3K7A I;  3A14 A;  1YIT 1;  1ZB8 A;  3FH5 A;  4NBH A;  4MH4 A;  2OTL 1;  1H3L A;  4MD7 A;  2GTQ A;  2O53 A;  2Y1E A;  4NBB A;  4ARF A;  3VB9 A;  4K5M A;  4MRI A;  2IV2 X;  4BXX I;  5DUL A;  2EGT A;  3I56 1;  3B7T A;  2GU2 A;  2M48 A;  1JVS A;  1SIW A;  2V45 A;  3VMH A;  4MXU A;  4NBE A;  4A3J I;  2P28 A;  1Q0H A;  4XMZ A;  4QTT A;  5HLT A;  3I4M I;  1I50 I;  2QRD B;  3CC4 1;  1KQS Z;  2E7Z A;  1M1K 2;  2QEX 1;  4Y7N I;  1X3Z A;  2RJI A;  3F3P C;  1X0T A;  3D9X A;  4A3M I;  1M90 1;  5D1O A;  1VQ4 1;  3FTU A;  3FTY A;  1QVG Z;  4RSY A;  4DPR A;  3EBI A;  4AR1 A;  3CIA A;  4DQY B;  2Y1F A;  4EWC A;  2AYD A;  1Q82 1;  4BY7 I;  1PFT A;  2QEX Z;  3J7A 4;  3FTZ A;  4Y52 I;  2VPX A;  4RV9 A;  1VQ9 Z;  1K9M 2;  1KD1 1;  2PK7 A;  3B7R L;  2AKL A;  3HKZ A;  3NFZ A;  2YAD A;  3GTG I;  2IZ3 A;  2QRE B;  1S72 1;  3NH5 A;  4XN9 A;  3S2H I;  3IFU A;  4NOZ A;  1L1O C;  1VLA A;  2VUM I;  3M3Y I;  3ZI0 A;  2V8I A;  4ZW8 A;  2R70 A;  2R92 I;  1YJN Z;  3I55 1;  3QJX A;  3ESW A;  5AEN A;  1WZN A;  5FLM I;  3PUU A;  2Y1G A;  1TWC I;  3JSZ A;  1YJ9 1;  3U50 C;  3FKI I;  1VQ8 Z;  3CCJ Z;  1RNI A;  2ZAE B;  1JJ2 Y;  2YU9 I;  1VQ5 Z;  4QPE A;  2OTJ Z;  1ONP A;  3GTP I;  2JUB A;  3RC3 A;  2DQM A;  3IR7 A;  3J80 f;  3S2D I;  1SG7 A;  3R0I A;  2Y1C A;  3B2X A;  4XO5 A;  2E2I I;  2VF1 A;  2LFU A;  4S1T A;  3FUK A;  1ZB9 A;  5IT9 f;  2WPG A;  4MS6 A;  1MW1 A;  2R7Z I;  3B3B A;  2PMZ A;  3FQM A;  4MD8 A;  1NJI 1;  2GTI A;  3CCL Z;  1Y1W I;  3CCQ 1;  4PVB A;  1SFO I;  4Y6S A;  5IP9 I;  3CCV 1;  3WQQ A;  5T64 A;  1TWH I;  1YI2 Z;  3RAS A;  4A3K I;  1KC8 1;  5FLX b;  4CXF A;  4K5N A;  3UER A;  3ANN A;  3CPW Z;  3CHP A;  4XN2 A;  4ZQE A;  2V8J A;  4NBG A;  2OOY B;  3S16 I;  3FUH A;  2HPO A;  2JCX A;  3A06 A;  2E9H A;  3M4O I;  4Q4I A;  3CC2 Z;  3CCE Z;  1T1R A;  4AYS A;  3S1Q I;  3KIH A;  2WZG A;  3CQZ I;  1QVF Z;  1Q81 1;  2MAO A;  1YJW Z;  3HOX I;  3S1R I;  4QIR A;  3OW2 Y;  2F4O A;  2JIO A;  2HU9 A;  1VQL Z;  4FLS A;  3UEQ A;  4TNU A;  3HOU I;  3GTJ I;  2JV7 A;  1N2F A;  2V3V A;  3CCU 1;  2JR6 A;  4NBD A;  3RZD I;  4E2Y A;  1USP A;  1RP3 A;  1K8A 2;  1RO2 A;  2JIP A;  3CME 1;  1VQK 1;  1VQM Z;  2RIQ A;  4A3F I;  5HNH A;  2OTJ 1;  2HF1 A;  2QVW A;  3PO3 I;  1R0K A;  3HW2 A;  3CCV Z;  2XPY A;  1K83 I;  4DK1 A;  4FLO A;  3GTK I;  2BJO A;  2RBL A;  4E2X A;  2C5Z A;  1JG9 A;  3AU9 A;  2W03 A;  2XPZ A;  2R93 I;  2JD0 A;  1GW6 A;  1LQL A;  1YJW 1;  2K3R A;  2QA4 Z;  3ZHZ A;  2QRC B;  4KP7 A;  3D6W A;  2O7G A;  1VQO Z;  1TWA I;  5DLL A;  3JAM f;  2JMO A;  2B61 A;  3T4N B;  3G4S 1;  3NDI A;  1Q86 1;  4XO3 A;  1I6H I;  3CHS A;  3CCU Z;  4NBA A;  2LEX A;  1JWH C;  2JA8 I;  4A3E I;  2VPW A;  1S72 Z;  4FCA A;  3CC7 1;  2J6A A;  1YIJ 1;  1JGI A;  3FH7 A;  4X6A I;  3UCQ A;  4K5O A;  1ONO A;  3B34 A;  1R0L A;  4XX2 A;  3EBG A;  3P5J B;  3I55 Z;  1YJN 1;  4BBR I; 
#chains in the Genus database with same CATH homology
 5EV7 A;  2JA6 I;  2Q51 A;  4XMW A;  1RO0 A;  2DE7 A;  2JA7 I;  3CCQ Z;  2DE5 A;  3CCE 1;  3AUA A;  2W04 A;  3CPW Y;  4ZQF A;  3HOZ I;  1Z01 A;  3EER A;  2DE6 A;  1VQ7 Z;  4ZX3 A;  1K73 2;  1P9N A;  1YHQ Z;  2OOX B;  4E33 A;  5C4X I;  3CCS Z;  3CHR A;  4HH4 A;  3WQR A;  3FU6 A;  3FUL A;  1QF8 A;  1I3Q I;  4JND A;  4ZX4 A;  5D1P A;  4XMU A;  4E2W A;  3CHQ A;  1RLY A;  1YJ9 Z;  3CCL 1;  3G6E Z;  3TE5 B;  5T6B A;  4ZX6 A;  5JMW A;  3B37 A;  5JC1 A;  4A3D I;  2JCY A;  1Y1V S;  1N8R 2;  1VQ4 Z;  4HGZ A;  4A03 A;  1JJ2 Z;  2E2J I;  1VQK Z;  3WQS B;  4ZW5 A;  1MVY A;  4CL1 A;  3FHE A;  1G5A A;  4LUP A;  2NVY I;  1S7M A;  2R72 A;  3FTV A;  3VTN A;  3FUI A;  1S46 A;  4RVB A;  4XMV A;  4NBF A;  2Y0S A;  1MW2 A;  4E2Z A;  3HOW I;  3GTL I;  1NP6 A;  1SC5 A;  4QUO A;  1Z02 A;  4XN4 A;  2V8K A;  3ZHX A;  3S1N I;  1VQM 1;  3FTW A;  4X2U A;  4NQW A;  1TFI A;  4XNA A;  5C4J I;  1MW0 A;  1RQF A;  3F3F C;  1WII A;  3FUN A;  4R5X A;  5LL6 f;  1NJI 2;  1YIT Z;  1QVF Y;  1H19 A;  3GKQ A;  4XMX A;  4RVF A;  2I3C A;  4A93 I;  3FTS A;  1VQP 1;  1Z03 A;  2K5R A;  1KC8 2;  4XNB A;  3S15 I;  1TWG I;  3JT1 A;  5A2Q b;  5BPP A;  1QYP A;  1ML8 A;  2VUG A;  3FU3 A;  1WW9 A;  2JNY A;  4E30 A;  2QKD A;  4ZN6 A;  3TDH B;  5DYF A;  2JA5 I;  5A2Q f;  4GAE A;  3B2P A;  4RVG A;  4Y6P A;  3FUE A;  3KED A;  3CC2 1;  1Q7Y 1;  2Q4Z A;  2P3Y A;  3GCF A;  4R7L A;  1OR7 A;  1MW3 A;  3ANL A;  1Q81 2;  3NH8 A;  3Q44 A;  3FH8 A;  3CCR Z;  2JD2 A;  3VMG A;  4FLQ A;  2A7O A;  1QVG Y;  2R59 A;  3B7S A;  3Q87 A;  5AN9 F;  3HOV I;  1TWF I;  3CD6 1;  4OOF A;  2PM9 A;  1YIJ Z;  4NB8 A;  3FUM A;  4E32 A;  3J81 b;  1K8A 1;  2OZK A;  4AR9 A;  2GTH A;  4K5P A;  1YUA A;  3J80 b;  5JNL A;  3FUJ A;  3CXC Z;  3CZK A;  3FTX A;  2OTL Z;  1R9T I;  3G4S Z;  4BKX A;  3U9W A;  3CCS 1;  5C3E I;  3CCR 1;  1KQS Y;  2KI7 B;  2RPR A;  3LUS A;  5IP7 I;  1ZS2 A;  1VQL 1;  3NH4 A;  4A3C I;  3CXC Y;  1M1K 1;  3Q43 A;  4AR8 A;  2JS4 A;  1KRL A;  2RHB A;  4MON A;  5T67 A;  3CD6 Z;  4ZW6 A;  3CZG A;  5JMP A;  4ZQT A;  4QTU A;  2PL5 A;  3CMA 1;  3AU8 A;  1Q0Q A;  2FFL A;  2IZ4 A;  1M90 2;  2G2K A;  1Q86 2;  3IX0 A;  3FQQ A;  1K5H A;  3FU0 A;  4OOE A;  4RCV A;  3JAM b;  1Y1V I;  3G71 1;  3CZE A;  5C44 I;  1Q82 2;  2NVQ I;  1Q0L A;  3NDJ A;  4R5T A;  2JD1 A;  4XND A;  2QJ1 A;  1HS6 A;  1VQ7 1;  1VQP Z;  4XO4 A;  4PU2 A;  1VQ6 Z;  3T0Y A;  1K9M 1;  1KD1 2;  2WB1 A;  4Y67 A;  3KIF A;  4A3G I;  2PUS A;  3H0G I;  1VQ9 1;  3VMI A;  3CCJ 1;  4QME A;  3T8V A;  1DL6 A;  4XN8 A;  4NBC A;  5D1O B;  1K73 1;  3GTM S;  3CMA Z;  3IF8 A;  4A3I I;  4MKT A;  4AYB A;  4XMT A;  3HOY I;  2Y1D A;  2XQ0 A;  1T1S A;  3ANM A;  5IT9 b;  1VQ5 1;  4J3B A;  1SQM A;  2KPI A;  1VQO 1;  3BG1 B;  3S17 I;  4XN1 A;  4E31 A;  1VQ8 1;  2ZXG A;  5JBI A;  2QA4 1;  2MAP A;  3FU5 A;  3VVL A;  4R5V A;  3FUF A;  1YUK A;  2WAQ A;  1N8R 1;  1W2B Y;  4RVH A;  3OW2 Z;  4NB9 A;  1RO4 A;  2NVT I;  2EGH A;  4ZQH A;  2RT9 A;  4ZW3 A;  3MON A;  3RZO I;  4Y6R A;  4NH1 C;  3IIE A;  2M6N A;  2QLV B;  4ZW7 A;  3CCM Z;  2QR1 B;  3GTM I;  3S14 I;  2DQ6 A;  5CM2 M;  1X3W A;  1VQ6 1;  2B63 I;  5JO0 A;  4PW4 A;  3CHO A;  2LIY A;  3BG0 B;  5JAZ A;  1W2B Z;  3CC4 Z;  3J81 f;  2C82 A;  3I07 A;  1ONN A;  3G71 Z;  3EBH A;  3H3V J;  4FLR A;  4RVD A;  4XN5 A;  3CZL A;  2F4M A;  4MD9 A;  3MZL B;  2HPT A;  3VVM A;  4A3L I;  2VJ8 A;  4QHP A;  3S1M I;  3PO2 I;  5HNF A;  1ZH1 A;  4ZQG A;  3RC8 A;  4HGY A;  1USP B;  3B7U X;  2H85 A;  4Q4E A;  2O4H A;  3GTQ I;  5FWQ A;  2NVX I;  2WZF A;  1NUI A;  3I4N I;  4A3B I;  1Q7Y 2;  4AIC A;  4K5L A;  4L2L A;  2VLA A;  3EED A;  4NFR A;  4DGL A;  1YI2 1;  4BY1 I;  1VQN Z;  3I56 Z;  3G6E 1;  5FLX f;  3CC7 Z;  1WCM I;  3MZK B;  4ZX5 A;  4RS4 A;  4BBS I;  1VQN 1;  3ZHY A;  4XN7 A;  3CCM 1;  4GAA A;  2E2H I;  3PO3 S;  3QWU A;  3CME Z;  2R6M A;  2PGG A;  3GTO I;  2JCV A;  1YHQ 1;  3FUD A;  3K7A I;  3A14 A;  1YIT 1;  1ZB8 A;  3FH5 A;  4NBH A;  4MH4 A;  2OTL 1;  1H3L A;  4MD7 A;  2GTQ A;  2O53 A;  2Y1E A;  4NBB A;  4ARF A;  3VB9 A;  4K5M A;  4MRI A;  4BXX I;  5DUL A;  2EGT A;  3I56 1;  3B7T A;  2GU2 A;  2M48 A;  1JVS A;  3VMH A;  4MXU A;  4NBE A;  4A3J I;  2P28 A;  1Q0H A;  4XMZ A;  4QTT A;  5HLT A;  3I4M I;  1I50 I;  2QRD B;  3CC4 1;  1KQS Z;  1M1K 2;  2QEX 1;  4Y7N I;  1X3Z A;  2RJI A;  3F3P C;  1X0T A;  3D9X A;  4A3M I;  1M90 1;  5D1O A;  1VQ4 1;  3FTU A;  3FTY A;  1QVG Z;  4RSY A;  4DPR A;  3EBI A;  4AR1 A;  3CIA A;  4DQY B;  2Y1F A;  4EWC A;  1Q82 1;  4BY7 I;  1PFT A;  2QEX Z;  3J7A 4;  3FTZ A;  4Y52 I;  4RV9 A;  1VQ9 Z;  1K9M 2;  1KD1 1;  2PK7 A;  3B7R L;  2AKL A;  3HKZ A;  3NFZ A;  2YAD A;  3GTG I;  2IZ3 A;  2QRE B;  1S72 1;  3NH5 A;  4XN9 A;  3S2H I;  3IFU A;  4NOZ A;  1L1O C;  1VLA A;  2VUM I;  3M3Y I;  3ZI0 A;  2V8I A;  4ZW8 A;  2R70 A;  2R92 I;  1YJN Z;  3I55 1;  3QJX A;  3ESW A;  5AEN A;  5FLM I;  3PUU A;  2Y1G A;  1TWC I;  3JSZ A;  1YJ9 1;  3U50 C;  3FKI I;  1VQ8 Z;  3CCJ Z;  1RNI A;  2ZAE B;  1JJ2 Y;  2YU9 I;  1VQ5 Z;  4QPE A;  2OTJ Z;  1ONP A;  3GTP I;  2JUB A;  3RC3 A;  2DQM A;  3J80 f;  3S2D I;  1SG7 A;  3R0I A;  2Y1C A;  3B2X A;  4XO5 A;  2E2I I;  2VF1 A;  2LFU A;  4S1T A;  3FUK A;  1ZB9 A;  5IT9 f;  2WPG A;  4MS6 A;  1MW1 A;  2R7Z I;  3B3B A;  2PMZ A;  3FQM A;  4MD8 A;  1NJI 1;  2GTI A;  3CCL Z;  1Y1W I;  3CCQ 1;  4PVB A;  1SFO I;  4Y6S A;  5IP9 I;  3CCV 1;  3WQQ A;  5T64 A;  1TWH I;  1YI2 Z;  3RAS A;  4A3K I;  1KC8 1;  5FLX b;  4CXF A;  4K5N A;  3UER A;  3ANN A;  3CPW Z;  3CHP A;  4XN2 A;  4ZQE A;  2V8J A;  4NBG A;  2OOY B;  3S16 I;  3FUH A;  2HPO A;  2JCX A;  3A06 A;  2E9H A;  3M4O I;  4Q4I A;  3CC2 Z;  3CCE Z;  1T1R A;  4AYS A;  3S1Q I;  3KIH A;  2WZG A;  3CQZ I;  1QVF Z;  1Q81 1;  2MAO A;  1YJW Z;  3HOX I;  3S1R I;  4QIR A;  3OW2 Y;  2F4O A;  2HU9 A;  1VQL Z;  4FLS A;  3UEQ A;  4TNU A;  3HOU I;  3GTJ I;  2JV7 A;  1N2F A;  3CCU 1;  2JR6 A;  4NBD A;  3RZD I;  4E2Y A;  1USP A;  1RP3 A;  1K8A 2;  1RO2 A;  1VQK 1;  3CME 1;  1VQM Z;  2RIQ A;  4A3F I;  5HNH A;  2OTJ 1;  2HF1 A;  2QVW A;  3PO3 I;  1R0K A;  3CCV Z;  2XPY A;  1K83 I;  4DK1 A;  4FLO A;  3GTK I;  2BJO A;  2RBL A;  4E2X A;  2C5Z A;  1JG9 A;  3AU9 A;  2W03 A;  2XPZ A;  2R93 I;  2JD0 A;  1GW6 A;  1LQL A;  1YJW 1;  2K3R A;  2QA4 Z;  3ZHZ A;  2QRC B;  4KP7 A;  3D6W A;  2O7G A;  1VQO Z;  1TWA I;  5DLL A;  3JAM f;  2JMO A;  2B61 A;  3T4N B;  3G4S 1;  3NDI A;  1Q86 1;  4XO3 A;  1I6H I;  3CHS A;  3CCU Z;  4NBA A;  1JWH C;  2JA8 I;  4A3E I;  1S72 Z;  4FCA A;  3CC7 1;  2J6A A;  1YIJ 1;  1JGI A;  3FH7 A;  4X6A I;  3UCQ A;  4K5O A;  1ONO A;  3B34 A;  1R0L A;  4XX2 A;  3EBG A;  3P5J B;  3I55 Z;  1YJN 1;  4BBR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...