1X3ZA

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
320
structure length
320
Chain Sequence
NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptide: N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
total genus 113
structure length 320
sequence length 320
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.90 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1x3zA03
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x3zA04
3S1MI 5C44I 1TWFI 3GKQA 3S17I 4NBHA 1Y1VS 3S1QI 5C3EI 5IP7I 3HOWI 1PFTA 1LQLA 1TWHI 4A3EI 1I6HI 4BBSI 3I4MI 3S16I 3S2HI 3GTQI 3VMIA 2F4MA 4NBGA 1DL6A 3HOUI 1WCMI 3S2DI 3S1NI 1R9TI 3U50C 3D6WA 3ESWA 4BY7I 2J6AA 3RZDI 2DE6A 1ZB9A 2JA6I 3GTOI 1SFOI 4NBEA 1X3WA 3GTMI 1USPA 2JA5I 2JR6A 4Y7NI 3GTGI 5CM2M 4A3II 3GCFA 2R7ZI 1YUAA 2DE5A 3VMGA 4XX2A 3HOXI 4BY1I 2JA8I 3H3VJ 3M4OI 3LUSA 4QTTA 1WW9A 4A3GI 1X3ZA 3M3YI 2P3YA 4NBCA 2NVTI 2AKLA 1ML8A 2E2JI 5C4XI 4A3DI 2JA7I 3CQZI 4A3MI 1RO4A 4QTUA 3FKII 3GTMS 2R93I 4NB9A 3I4NI 4BBRI 3HOZI 4Y52I 3PO2I 2F4OA 1TWGI 4A3FI 2KPIA 2VUMI 1TWAI 3S1RI 4A93I 1NUIA 5C4JI 1ZB8A 5FLMI 3HOVI 3PO3I 3GTPI 1I50I 2NVXI 4NBBA 3S15I 4A3LI 2B63I 4MH4A 3HOYI 3S14I 4BXXI 3Q87A 2NVYI 3EERA 1TFIA 2BJOA 3VMHA 1N2FA 3GTLI 1K83I 2PK7A 2RBLA 2JNYA 4A3JI 1VLAA 1Y1WI 2NVQI 2E2HI 2HF1A 3PO3S 2JS4A 3VB9A 4A3BI 3GTJI 1USPB 1TWCI 3I07A 1I3QI 4NOZA 1Y1VI 4NBFA 5IP9I 3K7AI 4A3KI 2YU9I 2R92I 3GTKI 4X6AI 3H0GI 1QYPA 4NB8A 2K5RA 2DE7A 4NBDA 4A3CI 3RZOI 1L1OC 1RLYA 2E2II 4NBAA
chains in the Genus database with same CATH superfamily
4CXFA 2ZXGA 2KI7B 3TDHB 5C44I 1VQPZ 4RVHA 3HOWI 1PFTA 4AR9A 2A7OA 1TWHI 1Q7Y2 4ZN6A 1YITZ 1YIT1 4BBSI 3I4MI 4JNDA 4K5OA 4TNUA 3VMIA 3AU8A 4XN9A 2QLVB 3KEDA 1VQL1 4BY7I 2WB1A 4CL1A 3D2LA 1M901 1JJ2Y 2OOYB 5DYFA 2V45A 1SFOI 2Q4ZA 4AR8A 4NBEA 1X3WA 1FDIA 5A2Qf 1QVGZ 3GTMI 4FLOA 1S72Z 3GTGI 3CCV1 5HLTA 3NH4A 4XNBA 4X2UA 3HOXI 3EBIA 3CCQ1 1YJWZ 1M1K2 3LUSA 3I56Z 1Q811 3I561 3KIFA 1RP3A 2AKLA 3CCMZ 2M48A 3CCM1 3FUHA 3RASA 1SIWA 4GAAA 4ZW3A 3GTMS 3Q44A 2JIMA 4E2ZA 1VQKZ 4ZQFA 1K732 1VQK1 2Y1EA 2QR1B 1S7MA 4Y52I 3PO2I 4XMVA 4RVBA 1SG7A 2JD2A 2IZ4A 3G6E1 4ZQTA 3CHSA 1NUIA 5C4JI 1ZB8A 2PMZA 5FLMI 1KC81 1I50I 4RS4A 2QJ1A 4AICA 3FTUA 1VQ4Z 2B63I 3J7A4 4MH4A 2RIQA 1RO0A 1VQ41 1JWHC 3Q87A 5T64A 3ANMA 2O4HA 3T4NB 2PM9A 2R70A 5JMPA 1KQSY 3HW2A 1ONPA 3IF8A 4QMEA 5EV7A 2BJOA 3P5JB 1K9M1 1N2FA 5JMWA 2JNYA 2QEXZ 1VQM1 3FUKA 4PW4A 3VB9A 4XNDA 3CZLA 2R6MA 4QIRA 3UCQA 1YJ9Z 3I07A 4NOZA 2HPTA 5A2Qb 3KIHA 1MW3A 2JIPA 1WIIA 3K7AI 3OW2Z 1VQ81 2I3CA 2W04A 2YU9I 4X6AI 4XNAA 1WZNA 4R5XA 4XO3A 2QREB 4S1TA 4R7LA 2GU2A 3CIAA 3FUNA 4NB8A 1X0TA 2RJIA 4DQYB 4NBDA 1Q821 3RZOI 4A3CI 1RLYA 4E2YA 1KD11 4Y6RA 1GW6A 4J3BA 5JC1A 4E33A 4MONA 3IIEA 2QRCB 4HGZA 3FTVA 3CCR1 4NBHA 5IP7I 2YADA 2G2KA 1JG9A 2R72A 1Q862 1I6HI 3B7RL 4RSYA 3S16I 3GTQI 3FTXA 3CC41 2F4MA 3R0IA 2LFUA 1VQN1 4FLRA 1MW1A 4ZQHA 1WCMI 3T0YA 4A03A 4HGYA 3U50C 3ESWA 3VTNA 2E9HA 4E31A 2XQ0A 4XO4A 2V3VA 2Y1DA 4EWCA 1Y8CA 1Z01A 4RVFA 4ZX3A 3IFUA 2OOXB 3GTOI 4Y67A 2V8KA 3UEQA 3VVLA 4MS6A 4LUPA 4Y7NI 3FTZA 1VQ61 5CM2M 2PGGA 4A3II 3CMA1 2K3RA 5D1OA 4K5LA 3TE5B 2DE5A 4XX2A 2JA8I 3H3VJ 3NH8A 5BPPA 2P28A 1WW9A 4A3GI 3CCEZ 4XMTA 1X3ZA 3CCE1 3CXCY 1ML8A 4A3DI 3FU5A 1VQLZ 3QJXA 3B7TA 4BBRI 3CD61 3NH5A 3CCS1 1TWGI 5HNHA 2KPIA 3CCVZ 3RC8A 4FLSA 2DQMA 3S1RI 2VPZA 4A93I 4AR1A 4FCAA 3CCQZ 3HOVI 3PO3I 3GTPI 2V8IA 2NVXI 2JIQA 2LIYA 4QHPA 3AU9A 3F3FC 3EERA 4E2WA 3FU3A 1VQ71 2XPYA 4ZX6A 3ZHXA 3VMHA 2W03A 1RO2A 2RBLA 3EBGA 4XO5A 2VJ8A 1WJ2A 1K8A1 2E2HI 3B2PA 2HF1A 1K731 3NFZA 3PO3S 2VUGA 1Q812 2Y1CA 3G6EZ 3GTJI 4RCVA 2Y1FA 1I3QI 3A14A 1Y1VI 1MVYA 3QWUA 2OTL1 1HS6A 3MONA 3GTKI 4ZW8A 2WZFA 3CZEA 3CMEZ 3T8VA 3CME1 1JJ2Z 2NAPA 3FH8A 4NBAA 2JD1A 2MAPA 1MW0A 3G4SZ 3S1MI 2V8JA 3G4S1 1TWFI 4PVBA 3FULA 3GKQA 2VPWA 2PUSA 1Q16A 1VQMZ 3S17I 1Y1VS 3ZHYA 1NJI1 1KC82 5C3EI 3S1QI 3FQQA 1Q0HA 1LQLA 1P9NA 2B61A 2JUBA 2QA4Z 1N8R2 2QA41 1VQ8Z 3CZKA 4Y6SA 4NBGA 4MXUA 4XN5A 1R0LA 1DL6A 3S2DI 3S1NI 2OTJ1 3D6WA 5IT9b 2R59A 3FUEA 3BG0B 1RNIA 4ZW7A 2J6AA 3NDJA 3F3PC 3RC3A 4PU2A 1USPA 4QUOA 3D9XA 3CCRZ 5DLLA 3CCL1 4XN2A 4AYSA 4FLQA 1Z02A 1SC5A 3GCFA 3FH7A 3U9WA 5T67A 4K5MA 4MKTA 2AYDA 5DULA 1YUAA 3WQRA 4BY1I 3CCU1 2O7GA 4L2LA 4XN7A 3CC4Z 1Q861 1VQNZ 3M3YI 2P3YA 3FUDA 4NBCA 1KD12 2ZAEB 1KQSZ 2EGHA 2NVTI 4XMZA 5C4XI 5AN9F 2JA7I 2VLAA 4KP7A 5FWQA 3AUAA 4BKXA 3CQZI 4A3MI 2GTIA 3FKII 5FLXb 4NB9A 2R93I 2M6NA 4E30A 1QXFA 4MD7A 3I4NI 5LL6f 4XMWA 3ANNA 3G71Z 1H19A 2F4OA 3G711 1VQ6Z 3PUUA 1VQ91 1QVGY 2VUMI 2WPGA 4MD8A 3CMAZ 3IR7A 1YHQZ 3FUJA 1QF8A 1YHQ1 5HNFA 1JGIA 3WQQA 1Q7Y1 3S15I 4A3LI 3HOYI 1YIJZ 3ANLA 1VQO1 4XN4A 1YIJ1 3ZI0A 1H3LA 4HH4A 1VQ5Z 3CC21 3CHOA 2PK7A 1ZH1A 1VQ51 3CD6Z 4A3JI 3CCSZ 1VQP1 1R0KA 3I55Z 2JS4A 3I551 3B34A 3FTWA 3B37A 5JNLA 4A3BI 2GTHA 2MAOA 1TWCI 2JIOA 1JVSA 5IP9I 2JCXA 2R92I 3NDIA 5D1OB 3B2XA 5IT9f 4ZW5A 5JAZA 1M1K1 3A06A 2K5RA 1M902 2FFLA 1S46A 1YJNZ 1L1OC 2E2II 1YJN1 1VQ7Z 4DK1A 1NP6A 2JV7A 3J80b 3CHPA 2C5ZA 3ZHZA 2RT9A 4NFRA 1FDOA 2O53A 3CC7Z 2EGTA 1S721 4E2XA 2LEXA 3CC71 3FTSA 1Q0QA 3CZGA 4ZX4A 4A3EI 5JO0A 2VF1A 2Y0SA 1ZS2A 4XN8A 1YJW1 2QVWA 4DGLA 3CXCZ 3FTYA 2OTLZ 3S2HI 3FUIA 3JAMb 3J81b 2PL5A 5FLXf 5JBIA 2QRDB 3FUMA 1QVFY 3OW2Y 3HOUI 4ZQGA 1ONOA 3VVMA 3UERA 1R9TI 2HU9A 2IZ3A 1K8A2 3RZDI 4ZW6A 1ZB9A 2DE6A 4RVGA 5T6BA 2JA6I 3B3BA 1OR7A 4R5TA 2JA5I 2JR6A 3CPWY 5AENA 4K5NA 3FH5A 3B7SA 4ARFA 3FUFA 4XMUA 2R7ZI 3VMGA 1W2BY 3B7UX 3M4OI 3CHRA 4QTTA 1MW2A 4E32A 2E2JI 1N8R1 4OOFA 2HPOA 1K9M2 4RVDA 2OTJZ 3CHQA 1RO4A 3MZLB 4QTUA 1SQMA 4XN1A 1NJI2 2WZGA 2IV2X 2Y1GA 3EEDA 3IX0A 2WAQA 3HOZI 1KRLA 1T1SA 2QEX1 3FHEA 3CCLZ 4A3FI 4AYBA 2RHBA 4OOEA 3CXBA 4NQWA 4RV9A 1YJ91 1T1RA 1TWAI 4DPRA 3CCJZ 4MD9A 2QKDA 1QVFZ 3CCJ1 3JT1A 3CCUZ 1Q0LA 2JMOA 3FU0A 2DQ6A 1Z03A 4NBBA 1Q822 4XMXA 4MRIA 3J80f 2Q51A 1RQFA 3S14I 4BXXI 2NVYI 4GAEA 4QPEA 4Q4IA 1TFIA 2H85A 1ONNA 4ZX5A 2E7ZA 3CPWZ 1YI2Z 3FU6A 4K5PA 3FQMA 1YI21 2RPRA 3BG1B 3GTLI 1K83I 3EBHA 1K5HA 2VPYA 2OZKA 1VLAA 1Y1WI 2NVQI 4ZQEA 1W2BZ 2C82A 3HKZA 2GTQA 4Y6PA 1VQ9Z 5D1PA 3JAMf 3J81f 1USPB 3MZKB 3JSZA 4NBFA 4A3KI 1YUKA 2JCVA 2XPZA 1AA6A 3H0GI 4R5VA 1QYPA 2DE7A 1VQOZ 1G5AA 2JIRA 2VPXA 2JD0A 2JCYA 4NH1C 3Q43A 4Q4EA 3WQSB 3CC2Z
chains in the Genus database with same CATH topology
4CXFA 2ZXGA 2KI7B 3TDHB 5C44I 1VQPZ 4RVHA 3HOWI 1PFTA 4AR9A 2A7OA 1TWHI 1Q7Y2 4ZN6A 1YITZ 1YIT1 4BBSI 3I4MI 4JNDA 4K5OA 4TNUA 3VMIA 3AU8A 4XN9A 2QLVB 3KEDA 1VQL1 4BY7I 2WB1A 4CL1A 1M901 1JJ2Y 2OOYB 5DYFA 1SFOI 2Q4ZA 4AR8A 4NBEA 1X3WA 5A2Qf 1QVGZ 3GTMI 4FLOA 1S72Z 3GTGI 3CCV1 5HLTA 3NH4A 4XNBA 4X2UA 3HOXI 3EBIA 3CCQ1 1YJWZ 1M1K2 3LUSA 3I56Z 1Q811 3I561 3KIFA 1RP3A 2AKLA 3CCMZ 2M48A 3CCM1 3FUHA 3RASA 4GAAA 4ZW3A 3GTMS 3Q44A 4E2ZA 1VQKZ 4ZQFA 1K732 1VQK1 2Y1EA 2QR1B 1S7MA 4Y52I 3PO2I 4XMVA 4RVBA 1SG7A 2JD2A 2IZ4A 3G6E1 4ZQTA 3CHSA 1NUIA 5C4JI 1ZB8A 2PMZA 5FLMI 1KC81 1I50I 4RS4A 2QJ1A 4AICA 3FTUA 1VQ4Z 2B63I 3J7A4 4MH4A 2RIQA 1RO0A 1VQ41 1JWHC 3Q87A 5T64A 3ANMA 2O4HA 3T4NB 2PM9A 2R70A 5JMPA 1KQSY 1ONPA 3IF8A 4QMEA 5EV7A 2BJOA 3P5JB 1K9M1 1N2FA 5JMWA 2JNYA 2QEXZ 1VQM1 3FUKA 4PW4A 3VB9A 4XNDA 3CZLA 2R6MA 4QIRA 3UCQA 1YJ9Z 3I07A 4NOZA 2HPTA 5A2Qb 3KIHA 1MW3A 3OW2Z 1WIIA 3K7AI 1VQ81 2I3CA 2W04A 2YU9I 4X6AI 4XNAA 4R5XA 4XO3A 2QREB 4S1TA 4R7LA 2GU2A 3CIAA 3FUNA 4NB8A 1X0TA 2RJIA 4DQYB 4NBDA 1Q821 3RZOI 4A3CI 1RLYA 4E2YA 1KD11 4Y6RA 1GW6A 4J3BA 5JC1A 4E33A 4MONA 3IIEA 2QRCB 4HGZA 3FTVA 3CCR1 4NBHA 5IP7I 2YADA 2G2KA 1JG9A 2R72A 1Q862 1I6HI 3B7RL 4RSYA 3S16I 3GTQI 3FTXA 3CC41 2F4MA 3R0IA 2LFUA 1VQN1 4FLRA 1MW1A 4ZQHA 1WCMI 3T0YA 4A03A 4HGYA 3U50C 3ESWA 3VTNA 2E9HA 4E31A 2XQ0A 4XO4A 2Y1DA 4EWCA 1Z01A 4RVFA 4ZX3A 3IFUA 2OOXB 3GTOI 4Y67A 2V8KA 3UEQA 3VVLA 4MS6A 4LUPA 4Y7NI 3FTZA 1VQ61 5CM2M 2PGGA 4A3II 3CMA1 2K3RA 5D1OA 4K5LA 3TE5B 2DE5A 4XX2A 2JA8I 3H3VJ 3NH8A 5BPPA 2P28A 1WW9A 4A3GI 3CCEZ 4XMTA 1X3ZA 3CCE1 3CXCY 1ML8A 4A3DI 3FU5A 1VQLZ 3QJXA 3B7TA 4BBRI 3CD61 3NH5A 3CCS1 1TWGI 5HNHA 2KPIA 3CCVZ 3RC8A 4FLSA 2DQMA 3S1RI 4A93I 4AR1A 4FCAA 3CCQZ 3HOVI 3PO3I 3GTPI 2V8IA 2NVXI 2LIYA 4QHPA 3AU9A 3F3FC 3EERA 4E2WA 3FU3A 1VQ71 2XPYA 4ZX6A 3ZHXA 3VMHA 2W03A 1RO2A 2RBLA 3EBGA 4XO5A 2VJ8A 1K8A1 2E2HI 3B2PA 2HF1A 1K731 3NFZA 3PO3S 2VUGA 1Q812 2Y1CA 3G6EZ 3GTJI 4RCVA 2Y1FA 1I3QI 3A14A 1Y1VI 1MVYA 3QWUA 2OTL1 1HS6A 3MONA 3GTKI 4ZW8A 2WZFA 3CZEA 3CMEZ 3T8VA 3CME1 1JJ2Z 3FH8A 4NBAA 2JD1A 2MAPA 1MW0A 3G4SZ 3S1MI 2V8JA 3G4S1 1TWFI 4PVBA 3FULA 3GKQA 1VQMZ 2PUSA 3S17I 1Y1VS 3ZHYA 1NJI1 1KC82 5C3EI 3S1QI 3FQQA 1Q0HA 1LQLA 1P9NA 2B61A 2JUBA 2QA4Z 1N8R2 2QA41 1VQ8Z 3CZKA 4Y6SA 4NBGA 4MXUA 4XN5A 1R0LA 1DL6A 3S2DI 3S1NI 2OTJ1 3D6WA 5IT9b 2R59A 3FUEA 3BG0B 1RNIA 4ZW7A 2J6AA 3NDJA 3F3PC 3RC3A 4PU2A 1USPA 4QUOA 3D9XA 3CCRZ 5DLLA 3CCL1 4XN2A 4AYSA 4FLQA 1Z02A 1SC5A 3GCFA 3FH7A 3U9WA 5T67A 4K5MA 4MKTA 5DULA 1YUAA 3WQRA 4BY1I 3CCU1 2O7GA 4L2LA 4XN7A 3CC4Z 1Q861 1VQNZ 3M3YI 2P3YA 3FUDA 4NBCA 1KD12 2ZAEB 1KQSZ 2EGHA 2NVTI 4XMZA 5C4XI 5AN9F 2JA7I 2VLAA 4KP7A 5FWQA 3AUAA 4BKXA 3CQZI 4A3MI 2GTIA 3FKII 5FLXb 4NB9A 2R93I 2M6NA 4E30A 4MD7A 3I4NI 5LL6f 4XMWA 3ANNA 3G71Z 1H19A 2F4OA 3G711 1VQ6Z 3PUUA 1VQ91 1QVGY 2VUMI 2WPGA 4MD8A 3CMAZ 1YHQZ 3FUJA 1QF8A 1YHQ1 5HNFA 1JGIA 3WQQA 1Q7Y1 3S15I 4A3LI 3HOYI 1YIJZ 3ANLA 1VQO1 4XN4A 1YIJ1 3ZI0A 1H3LA 4HH4A 1VQ5Z 3CC21 3CHOA 2PK7A 1ZH1A 1VQ51 3CD6Z 4A3JI 3CCSZ 1VQP1 1R0KA 3I55Z 2JS4A 3I551 3B34A 3FTWA 3B37A 5JNLA 4A3BI 2GTHA 2MAOA 1TWCI 1JVSA 5IP9I 2JCXA 2R92I 3NDIA 5D1OB 3B2XA 5IT9f 4ZW5A 5JAZA 1M1K1 3A06A 2K5RA 1M902 2FFLA 1S46A 1YJNZ 1L1OC 2E2II 1YJN1 1VQ7Z 4DK1A 1NP6A 2JV7A 3J80b 3CHPA 2C5ZA 3ZHZA 2RT9A 4NFRA 2O53A 3CC7Z 2EGTA 1S721 4E2XA 3CC71 3FTSA 1Q0QA 3CZGA 4ZX4A 4A3EI 5JO0A 2VF1A 2Y0SA 1ZS2A 4XN8A 1YJW1 2QVWA 4DGLA 3CXCZ 3FTYA 2OTLZ 3S2HI 3FUIA 3JAMb 3J81b 2PL5A 5FLXf 5JBIA 2QRDB 3FUMA 1QVFY 3OW2Y 3HOUI 4ZQGA 1ONOA 3VVMA 3UERA 1R9TI 2HU9A 2IZ3A 1K8A2 3RZDI 4ZW6A 1ZB9A 2DE6A 4RVGA 5T6BA 2JA6I 3B3BA 1OR7A 4R5TA 2JA5I 2JR6A 3CPWY 5AENA 4K5NA 3FH5A 3B7SA 4ARFA 3FUFA 4XMUA 2R7ZI 3VMGA 1W2BY 3B7UX 3M4OI 3CHRA 4QTTA 1MW2A 4E32A 2E2JI 1N8R1 4OOFA 2HPOA 1K9M2 4RVDA 2OTJZ 3CHQA 1RO4A 3MZLB 4QTUA 1SQMA 4XN1A 1NJI2 2WZGA 2Y1GA 3EEDA 3IX0A 2WAQA 3HOZI 1KRLA 1T1SA 2QEX1 3FHEA 3CCLZ 4A3FI 4AYBA 2RHBA 4OOEA 4NQWA 4RV9A 1YJ91 1T1RA 1TWAI 4DPRA 3CCJZ 4MD9A 2QKDA 1QVFZ 3CCJ1 3JT1A 3CCUZ 1Q0LA 2JMOA 3FU0A 2DQ6A 1Z03A 4NBBA 1Q822 4XMXA 4MRIA 3J80f 2Q51A 1RQFA 3S14I 4BXXI 2NVYI 4GAEA 4QPEA 4Q4IA 1TFIA 2H85A 1ONNA 4ZX5A 3CPWZ 1YI2Z 3FU6A 4K5PA 3FQMA 1YI21 2RPRA 3BG1B 3GTLI 1K83I 3EBHA 1K5HA 2OZKA 1VLAA 1Y1WI 2NVQI 4ZQEA 1W2BZ 2C82A 3HKZA 2GTQA 4Y6PA 1VQ9Z 5D1PA 3JAMf 3J81f 1USPB 3MZKB 3JSZA 4NBFA 4A3KI 1YUKA 2JCVA 2XPZA 3H0GI 4R5VA 1QYPA 2DE7A 1VQOZ 1G5AA 2JD0A 2JCYA 4NH1C 3Q43A 4Q4EA 3WQSB 3CC2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M I;  5C44 I;  1TWF I;  3GKQ A;  3S17 I;  4NBH A;  1Y1V S;  3S1Q I;  5C3E I;  5IP7 I;  3HOW I;  1PFT A;  1LQL A;  1TWH I;  4A3E I;  1I6H I;  4BBS I;  3I4M I;  3S16 I;  3S2H I;  3GTQ I;  3VMI A;  2F4M A;  4NBG A;  1DL6 A;  3HOU I;  1WCM I;  3S2D I;  3S1N I;  1R9T I;  3U50 C;  3D6W A;  3ESW A;  4BY7 I;  2J6A A;  3RZD I;  2DE6 A;  1ZB9 A;  2JA6 I;  3GTO I;  1SFO I;  4NBE A;  1X3W A;  3GTM I;  1USP A;  2JA5 I;  2JR6 A;  4Y7N I;  3GTG I;  5CM2 M;  4A3I I;  3GCF A;  2R7Z I;  1YUA A;  2DE5 A;  3VMG A;  4XX2 A;  3HOX I;  4BY1 I;  2JA8 I;  3H3V J;  3M4O I;  3LUS A;  4QTT A;  1WW9 A;  4A3G I;  1X3Z A;  3M3Y I;  2P3Y A;  4NBC A;  2NVT I;  2AKL A;  1ML8 A;  2E2J I;  5C4X I;  4A3D I;  2JA7 I;  3CQZ I;  4A3M I;  1RO4 A;  4QTU A;  3FKI I;  3GTM S;  2R93 I;  4NB9 A;  3I4N I;  4BBR I;  3HOZ I;  4Y52 I;  3PO2 I;  2F4O A;  1TWG I;  4A3F I;  2KPI A;  2VUM I;  1TWA I;  3S1R I;  4A93 I;  1NUI A;  5C4J I;  1ZB8 A;  5FLM I;  3HOV I;  3PO3 I;  3GTP I;  1I50 I;  2NVX I;  4NBB A;  3S15 I;  4A3L I;  2B63 I;  4MH4 A;  3HOY I;  3S14 I;  4BXX I;  3Q87 A;  2NVY I;  3EER A;  1TFI A;  2BJO A;  3VMH A;  1N2F A;  3GTL I;  1K83 I;  2PK7 A;  2RBL A;  2JNY A;  4A3J I;  1VLA A;  1Y1W I;  2NVQ I;  2E2H I;  2HF1 A;  3PO3 S;  2JS4 A;  3VB9 A;  4A3B I;  3GTJ I;  1USP B;  1TWC I;  3I07 A;  1I3Q I;  4NOZ A;  1Y1V I;  4NBF A;  5IP9 I;  3K7A I;  4A3K I;  2YU9 I;  2R92 I;  3GTK I;  4X6A I;  3H0G I;  1QYP A;  4NB8 A;  2K5R A;  2DE7 A;  4NBD A;  4A3C I;  3RZO I;  1L1O C;  1RLY A;  2E2I I;  4NBA A; 
#chains in the Genus database with same CATH topology
 4CXF A;  2ZXG A;  2KI7 B;  3TDH B;  5C44 I;  1VQP Z;  4RVH A;  3HOW I;  1PFT A;  4AR9 A;  2A7O A;  1TWH I;  1Q7Y 2;  4ZN6 A;  1YIT Z;  1YIT 1;  4BBS I;  3I4M I;  4JND A;  4K5O A;  4TNU A;  3VMI A;  3AU8 A;  4XN9 A;  2QLV B;  3KED A;  1VQL 1;  4BY7 I;  2WB1 A;  4CL1 A;  3D2L A;  1M90 1;  1JJ2 Y;  2OOY B;  5DYF A;  2V45 A;  1SFO I;  2Q4Z A;  4AR8 A;  4NBE A;  1X3W A;  1FDI A;  5A2Q f;  1QVG Z;  3GTM I;  4FLO A;  1S72 Z;  3GTG I;  3CCV 1;  5HLT A;  3NH4 A;  4XNB A;  4X2U A;  3HOX I;  3EBI A;  3CCQ 1;  1YJW Z;  1M1K 2;  3LUS A;  3I56 Z;  1Q81 1;  3I56 1;  3KIF A;  1RP3 A;  2AKL A;  3CCM Z;  2M48 A;  3CCM 1;  3FUH A;  3RAS A;  1SIW A;  4GAA A;  4ZW3 A;  3GTM S;  3Q44 A;  2JIM A;  4E2Z A;  1VQK Z;  4ZQF A;  1K73 2;  1VQK 1;  2Y1E A;  2QR1 B;  1S7M A;  4Y52 I;  3PO2 I;  4XMV A;  4RVB A;  1SG7 A;  2JD2 A;  2IZ4 A;  3G6E 1;  4ZQT A;  3CHS A;  1NUI A;  5C4J I;  1ZB8 A;  2PMZ A;  5FLM I;  1KC8 1;  1I50 I;  4RS4 A;  2QJ1 A;  4AIC A;  3FTU A;  1VQ4 Z;  2B63 I;  3J7A 4;  4MH4 A;  2RIQ A;  1RO0 A;  1VQ4 1;  1JWH C;  3Q87 A;  5T64 A;  3ANM A;  2O4H A;  3T4N B;  2PM9 A;  2R70 A;  5JMP A;  1KQS Y;  3HW2 A;  1ONP A;  3IF8 A;  4QME A;  5EV7 A;  2BJO A;  3P5J B;  1K9M 1;  1N2F A;  5JMW A;  2JNY A;  2QEX Z;  1VQM 1;  3FUK A;  4PW4 A;  3VB9 A;  4XND A;  3CZL A;  2R6M A;  4QIR A;  3UCQ A;  1YJ9 Z;  3I07 A;  4NOZ A;  2HPT A;  5A2Q b;  3KIH A;  1MW3 A;  2JIP A;  1WII A;  3K7A I;  3OW2 Z;  1VQ8 1;  2I3C A;  2W04 A;  2YU9 I;  4X6A I;  4XNA A;  1WZN A;  4R5X A;  4XO3 A;  2QRE B;  4S1T A;  4R7L A;  2GU2 A;  3CIA A;  3FUN A;  4NB8 A;  1X0T A;  2RJI A;  4DQY B;  4NBD A;  1Q82 1;  3RZO I;  4A3C I;  1RLY A;  4E2Y A;  1KD1 1;  4Y6R A;  1GW6 A;  4J3B A;  5JC1 A;  4E33 A;  4MON A;  3IIE A;  2QRC B;  4HGZ A;  3FTV A;  3CCR 1;  4NBH A;  5IP7 I;  2YAD A;  2G2K A;  1JG9 A;  2R72 A;  1Q86 2;  1I6H I;  3B7R L;  4RSY A;  3S16 I;  3GTQ I;  3FTX A;  3CC4 1;  2F4M A;  3R0I A;  2LFU A;  1VQN 1;  4FLR A;  1MW1 A;  4ZQH A;  1WCM I;  3T0Y A;  4A03 A;  4HGY A;  3U50 C;  3ESW A;  3VTN A;  2E9H A;  4E31 A;  2XQ0 A;  4XO4 A;  2V3V A;  2Y1D A;  4EWC A;  1Y8C A;  1Z01 A;  4RVF A;  4ZX3 A;  3IFU A;  2OOX B;  3GTO I;  4Y67 A;  2V8K A;  3UEQ A;  3VVL A;  4MS6 A;  4LUP A;  4Y7N I;  3FTZ A;  1VQ6 1;  5CM2 M;  2PGG A;  4A3I I;  3CMA 1;  2K3R A;  5D1O A;  4K5L A;  3TE5 B;  2DE5 A;  4XX2 A;  2JA8 I;  3H3V J;  3NH8 A;  5BPP A;  2P28 A;  1WW9 A;  4A3G I;  3CCE Z;  4XMT A;  1X3Z A;  3CCE 1;  3CXC Y;  1ML8 A;  4A3D I;  3FU5 A;  1VQL Z;  3QJX A;  3B7T A;  4BBR I;  3CD6 1;  3NH5 A;  3CCS 1;  1TWG I;  5HNH A;  2KPI A;  3CCV Z;  3RC8 A;  4FLS A;  2DQM A;  3S1R I;  2VPZ A;  4A93 I;  4AR1 A;  4FCA A;  3CCQ Z;  3HOV I;  3PO3 I;  3GTP I;  2V8I A;  2NVX I;  2JIQ A;  2LIY A;  4QHP A;  3AU9 A;  3F3F C;  3EER A;  4E2W A;  3FU3 A;  1VQ7 1;  2XPY A;  4ZX6 A;  3ZHX A;  3VMH A;  2W03 A;  1RO2 A;  2RBL A;  3EBG A;  4XO5 A;  2VJ8 A;  1WJ2 A;  1K8A 1;  2E2H I;  3B2P A;  2HF1 A;  1K73 1;  3NFZ A;  3PO3 S;  2VUG A;  1Q81 2;  2Y1C A;  3G6E Z;  3GTJ I;  4RCV A;  2Y1F A;  1I3Q I;  3A14 A;  1Y1V I;  1MVY A;  3QWU A;  2OTL 1;  1HS6 A;  3MON A;  3GTK I;  4ZW8 A;  2WZF A;  3CZE A;  3CME Z;  3T8V A;  3CME 1;  1JJ2 Z;  2NAP A;  3FH8 A;  4NBA A;  2JD1 A;  2MAP A;  1MW0 A;  3G4S Z;  3S1M I;  2V8J A;  3G4S 1;  1TWF I;  4PVB A;  3FUL A;  3GKQ A;  2VPW A;  2PUS A;  1Q16 A;  1VQM Z;  3S17 I;  1Y1V S;  3ZHY A;  1NJI 1;  1KC8 2;  5C3E I;  3S1Q I;  3FQQ A;  1Q0H A;  1LQL A;  1P9N A;  2B61 A;  2JUB A;  2QA4 Z;  1N8R 2;  2QA4 1;  1VQ8 Z;  3CZK A;  4Y6S A;  4NBG A;  4MXU A;  4XN5 A;  1R0L A;  1DL6 A;  3S2D I;  3S1N I;  2OTJ 1;  3D6W A;  5IT9 b;  2R59 A;  3FUE A;  3BG0 B;  1RNI A;  4ZW7 A;  2J6A A;  3NDJ A;  3F3P C;  3RC3 A;  4PU2 A;  1USP A;  4QUO A;  3D9X A;  3CCR Z;  5DLL A;  3CCL 1;  4XN2 A;  4AYS A;  4FLQ A;  1Z02 A;  1SC5 A;  3GCF A;  3FH7 A;  3U9W A;  5T67 A;  4K5M A;  4MKT A;  2AYD A;  5DUL A;  1YUA A;  3WQR A;  4BY1 I;  3CCU 1;  2O7G A;  4L2L A;  4XN7 A;  3CC4 Z;  1Q86 1;  1VQN Z;  3M3Y I;  2P3Y A;  3FUD A;  4NBC A;  1KD1 2;  2ZAE B;  1KQS Z;  2EGH A;  2NVT I;  4XMZ A;  5C4X I;  5AN9 F;  2JA7 I;  2VLA A;  4KP7 A;  5FWQ A;  3AUA A;  4BKX A;  3CQZ I;  4A3M I;  2GTI A;  3FKI I;  5FLX b;  4NB9 A;  2R93 I;  2M6N A;  4E30 A;  1QXF A;  4MD7 A;  3I4N I;  5LL6 f;  4XMW A;  3ANN A;  3G71 Z;  1H19 A;  2F4O A;  3G71 1;  1VQ6 Z;  3PUU A;  1VQ9 1;  1QVG Y;  2VUM I;  2WPG A;  4MD8 A;  3CMA Z;  3IR7 A;  1YHQ Z;  3FUJ A;  1QF8 A;  1YHQ 1;  5HNF A;  1JGI A;  3WQQ A;  1Q7Y 1;  3S15 I;  4A3L I;  3HOY I;  1YIJ Z;  3ANL A;  1VQO 1;  4XN4 A;  1YIJ 1;  3ZI0 A;  1H3L A;  4HH4 A;  1VQ5 Z;  3CC2 1;  3CHO A;  2PK7 A;  1ZH1 A;  1VQ5 1;  3CD6 Z;  4A3J I;  3CCS Z;  1VQP 1;  1R0K A;  3I55 Z;  2JS4 A;  3I55 1;  3B34 A;  3FTW A;  3B37 A;  5JNL A;  4A3B I;  2GTH A;  2MAO A;  1TWC I;  2JIO A;  1JVS A;  5IP9 I;  2JCX A;  2R92 I;  3NDI A;  5D1O B;  3B2X A;  5IT9 f;  4ZW5 A;  5JAZ A;  1M1K 1;  3A06 A;  2K5R A;  1M90 2;  2FFL A;  1S46 A;  1YJN Z;  1L1O C;  2E2I I;  1YJN 1;  1VQ7 Z;  4DK1 A;  1NP6 A;  2JV7 A;  3J80 b;  3CHP A;  2C5Z A;  3ZHZ A;  2RT9 A;  4NFR A;  1FDO A;  2O53 A;  3CC7 Z;  2EGT A;  1S72 1;  4E2X A;  2LEX A;  3CC7 1;  3FTS A;  1Q0Q A;  3CZG A;  4ZX4 A;  4A3E I;  5JO0 A;  2VF1 A;  2Y0S A;  1ZS2 A;  4XN8 A;  1YJW 1;  2QVW A;  4DGL A;  3CXC Z;  3FTY A;  2OTL Z;  3S2H I;  3FUI A;  3JAM b;  3J81 b;  2PL5 A;  5FLX f;  5JBI A;  2QRD B;  3FUM A;  1QVF Y;  3OW2 Y;  3HOU I;  4ZQG A;  1ONO A;  3VVM A;  3UER A;  1R9T I;  2HU9 A;  2IZ3 A;  1K8A 2;  3RZD I;  4ZW6 A;  1ZB9 A;  2DE6 A;  4RVG A;  5T6B A;  2JA6 I;  3B3B A;  1OR7 A;  4R5T A;  2JA5 I;  2JR6 A;  3CPW Y;  5AEN A;  4K5N A;  3FH5 A;  3B7S A;  4ARF A;  3FUF A;  4XMU A;  2R7Z I;  3VMG A;  1W2B Y;  3B7U X;  3M4O I;  3CHR A;  4QTT A;  1MW2 A;  4E32 A;  2E2J I;  1N8R 1;  4OOF A;  2HPO A;  1K9M 2;  4RVD A;  2OTJ Z;  3CHQ A;  1RO4 A;  3MZL B;  4QTU A;  1SQM A;  4XN1 A;  1NJI 2;  2WZG A;  2IV2 X;  2Y1G A;  3EED A;  3IX0 A;  2WAQ A;  3HOZ I;  1KRL A;  1T1S A;  2QEX 1;  3FHE A;  3CCL Z;  4A3F I;  4AYB A;  2RHB A;  4OOE A;  3CXB A;  4NQW A;  4RV9 A;  1YJ9 1;  1T1R A;  1TWA I;  4DPR A;  3CCJ Z;  4MD9 A;  2QKD A;  1QVF Z;  3CCJ 1;  3JT1 A;  3CCU Z;  1Q0L A;  2JMO A;  3FU0 A;  2DQ6 A;  1Z03 A;  4NBB A;  1Q82 2;  4XMX A;  4MRI A;  3J80 f;  2Q51 A;  1RQF A;  3S14 I;  4BXX I;  2NVY I;  4GAE A;  4QPE A;  4Q4I A;  1TFI A;  2H85 A;  1ONN A;  4ZX5 A;  2E7Z A;  3CPW Z;  1YI2 Z;  3FU6 A;  4K5P A;  3FQM A;  1YI2 1;  2RPR A;  3BG1 B;  3GTL I;  1K83 I;  3EBH A;  1K5H A;  2VPY A;  2OZK A;  1VLA A;  1Y1W I;  2NVQ I;  4ZQE A;  1W2B Z;  2C82 A;  3HKZ A;  2GTQ A;  4Y6P A;  1VQ9 Z;  5D1P A;  3JAM f;  3J81 f;  1USP B;  3MZK B;  3JSZ A;  4NBF A;  4A3K I;  1YUK A;  2JCV A;  2XPZ A;  1AA6 A;  3H0G I;  4R5V A;  1QYP A;  2DE7 A;  1VQO Z;  1G5A A;  2JIR A;  2VPX A;  2JD0 A;  2JCY A;  4NH1 C;  3Q43 A;  4Q4E A;  3WQS B;  3CC2 Z; 
#chains in the Genus database with same CATH homology
 4CXF A;  2ZXG A;  2KI7 B;  3TDH B;  5C44 I;  1VQP Z;  4RVH A;  3HOW I;  1PFT A;  4AR9 A;  2A7O A;  1TWH I;  1Q7Y 2;  4ZN6 A;  1YIT Z;  1YIT 1;  4BBS I;  3I4M I;  4JND A;  4K5O A;  4TNU A;  3VMI A;  3AU8 A;  4XN9 A;  2QLV B;  3KED A;  1VQL 1;  4BY7 I;  2WB1 A;  4CL1 A;  1M90 1;  1JJ2 Y;  2OOY B;  5DYF A;  1SFO I;  2Q4Z A;  4AR8 A;  4NBE A;  1X3W A;  5A2Q f;  1QVG Z;  3GTM I;  4FLO A;  1S72 Z;  3GTG I;  3CCV 1;  5HLT A;  3NH4 A;  4XNB A;  4X2U A;  3HOX I;  3EBI A;  3CCQ 1;  1YJW Z;  1M1K 2;  3LUS A;  3I56 Z;  1Q81 1;  3I56 1;  3KIF A;  1RP3 A;  2AKL A;  3CCM Z;  2M48 A;  3CCM 1;  3FUH A;  3RAS A;  4GAA A;  4ZW3 A;  3GTM S;  3Q44 A;  4E2Z A;  1VQK Z;  4ZQF A;  1K73 2;  1VQK 1;  2Y1E A;  2QR1 B;  1S7M A;  4Y52 I;  3PO2 I;  4XMV A;  4RVB A;  1SG7 A;  2JD2 A;  2IZ4 A;  3G6E 1;  4ZQT A;  3CHS A;  1NUI A;  5C4J I;  1ZB8 A;  2PMZ A;  5FLM I;  1KC8 1;  1I50 I;  4RS4 A;  2QJ1 A;  4AIC A;  3FTU A;  1VQ4 Z;  2B63 I;  3J7A 4;  4MH4 A;  2RIQ A;  1RO0 A;  1VQ4 1;  1JWH C;  3Q87 A;  5T64 A;  3ANM A;  2O4H A;  3T4N B;  2PM9 A;  2R70 A;  5JMP A;  1KQS Y;  1ONP A;  3IF8 A;  4QME A;  5EV7 A;  2BJO A;  3P5J B;  1K9M 1;  1N2F A;  5JMW A;  2JNY A;  2QEX Z;  1VQM 1;  3FUK A;  4PW4 A;  3VB9 A;  4XND A;  3CZL A;  2R6M A;  4QIR A;  3UCQ A;  1YJ9 Z;  3I07 A;  4NOZ A;  2HPT A;  5A2Q b;  3KIH A;  1MW3 A;  3OW2 Z;  1WII A;  3K7A I;  1VQ8 1;  2I3C A;  2W04 A;  2YU9 I;  4X6A I;  4XNA A;  4R5X A;  4XO3 A;  2QRE B;  4S1T A;  4R7L A;  2GU2 A;  3CIA A;  3FUN A;  4NB8 A;  1X0T A;  2RJI A;  4DQY B;  4NBD A;  1Q82 1;  3RZO I;  4A3C I;  1RLY A;  4E2Y A;  1KD1 1;  4Y6R A;  1GW6 A;  4J3B A;  5JC1 A;  4E33 A;  4MON A;  3IIE A;  2QRC B;  4HGZ A;  3FTV A;  3CCR 1;  4NBH A;  5IP7 I;  2YAD A;  2G2K A;  1JG9 A;  2R72 A;  1Q86 2;  1I6H I;  3B7R L;  4RSY A;  3S16 I;  3GTQ I;  3FTX A;  3CC4 1;  2F4M A;  3R0I A;  2LFU A;  1VQN 1;  4FLR A;  1MW1 A;  4ZQH A;  1WCM I;  3T0Y A;  4A03 A;  4HGY A;  3U50 C;  3ESW A;  3VTN A;  2E9H A;  4E31 A;  2XQ0 A;  4XO4 A;  2Y1D A;  4EWC A;  1Z01 A;  4RVF A;  4ZX3 A;  3IFU A;  2OOX B;  3GTO I;  4Y67 A;  2V8K A;  3UEQ A;  3VVL A;  4MS6 A;  4LUP A;  4Y7N I;  3FTZ A;  1VQ6 1;  5CM2 M;  2PGG A;  4A3I I;  3CMA 1;  2K3R A;  5D1O A;  4K5L A;  3TE5 B;  2DE5 A;  4XX2 A;  2JA8 I;  3H3V J;  3NH8 A;  5BPP A;  2P28 A;  1WW9 A;  4A3G I;  3CCE Z;  4XMT A;  1X3Z A;  3CCE 1;  3CXC Y;  1ML8 A;  4A3D I;  3FU5 A;  1VQL Z;  3QJX A;  3B7T A;  4BBR I;  3CD6 1;  3NH5 A;  3CCS 1;  1TWG I;  5HNH A;  2KPI A;  3CCV Z;  3RC8 A;  4FLS A;  2DQM A;  3S1R I;  4A93 I;  4AR1 A;  4FCA A;  3CCQ Z;  3HOV I;  3PO3 I;  3GTP I;  2V8I A;  2NVX I;  2LIY A;  4QHP A;  3AU9 A;  3F3F C;  3EER A;  4E2W A;  3FU3 A;  1VQ7 1;  2XPY A;  4ZX6 A;  3ZHX A;  3VMH A;  2W03 A;  1RO2 A;  2RBL A;  3EBG A;  4XO5 A;  2VJ8 A;  1K8A 1;  2E2H I;  3B2P A;  2HF1 A;  1K73 1;  3NFZ A;  3PO3 S;  2VUG A;  1Q81 2;  2Y1C A;  3G6E Z;  3GTJ I;  4RCV A;  2Y1F A;  1I3Q I;  3A14 A;  1Y1V I;  1MVY A;  3QWU A;  2OTL 1;  1HS6 A;  3MON A;  3GTK I;  4ZW8 A;  2WZF A;  3CZE A;  3CME Z;  3T8V A;  3CME 1;  1JJ2 Z;  3FH8 A;  4NBA A;  2JD1 A;  2MAP A;  1MW0 A;  3G4S Z;  3S1M I;  2V8J A;  3G4S 1;  1TWF I;  4PVB A;  3FUL A;  3GKQ A;  1VQM Z;  2PUS A;  3S17 I;  1Y1V S;  3ZHY A;  1NJI 1;  1KC8 2;  5C3E I;  3S1Q I;  3FQQ A;  1Q0H A;  1LQL A;  1P9N A;  2B61 A;  2JUB A;  2QA4 Z;  1N8R 2;  2QA4 1;  1VQ8 Z;  3CZK A;  4Y6S A;  4NBG A;  4MXU A;  4XN5 A;  1R0L A;  1DL6 A;  3S2D I;  3S1N I;  2OTJ 1;  3D6W A;  5IT9 b;  2R59 A;  3FUE A;  3BG0 B;  1RNI A;  4ZW7 A;  2J6A A;  3NDJ A;  3F3P C;  3RC3 A;  4PU2 A;  1USP A;  4QUO A;  3D9X A;  3CCR Z;  5DLL A;  3CCL 1;  4XN2 A;  4AYS A;  4FLQ A;  1Z02 A;  1SC5 A;  3GCF A;  3FH7 A;  3U9W A;  5T67 A;  4K5M A;  4MKT A;  5DUL A;  1YUA A;  3WQR A;  4BY1 I;  3CCU 1;  2O7G A;  4L2L A;  4XN7 A;  3CC4 Z;  1Q86 1;  1VQN Z;  3M3Y I;  2P3Y A;  3FUD A;  4NBC A;  1KD1 2;  2ZAE B;  1KQS Z;  2EGH A;  2NVT I;  4XMZ A;  5C4X I;  5AN9 F;  2JA7 I;  2VLA A;  4KP7 A;  5FWQ A;  3AUA A;  4BKX A;  3CQZ I;  4A3M I;  2GTI A;  3FKI I;  5FLX b;  4NB9 A;  2R93 I;  2M6N A;  4E30 A;  4MD7 A;  3I4N I;  5LL6 f;  4XMW A;  3ANN A;  3G71 Z;  1H19 A;  2F4O A;  3G71 1;  1VQ6 Z;  3PUU A;  1VQ9 1;  1QVG Y;  2VUM I;  2WPG A;  4MD8 A;  3CMA Z;  1YHQ Z;  3FUJ A;  1QF8 A;  1YHQ 1;  5HNF A;  1JGI A;  3WQQ A;  1Q7Y 1;  3S15 I;  4A3L I;  3HOY I;  1YIJ Z;  3ANL A;  1VQO 1;  4XN4 A;  1YIJ 1;  3ZI0 A;  1H3L A;  4HH4 A;  1VQ5 Z;  3CC2 1;  3CHO A;  2PK7 A;  1ZH1 A;  1VQ5 1;  3CD6 Z;  4A3J I;  3CCS Z;  1VQP 1;  1R0K A;  3I55 Z;  2JS4 A;  3I55 1;  3B34 A;  3FTW A;  3B37 A;  5JNL A;  4A3B I;  2GTH A;  2MAO A;  1TWC I;  1JVS A;  5IP9 I;  2JCX A;  2R92 I;  3NDI A;  5D1O B;  3B2X A;  5IT9 f;  4ZW5 A;  5JAZ A;  1M1K 1;  3A06 A;  2K5R A;  1M90 2;  2FFL A;  1S46 A;  1YJN Z;  1L1O C;  2E2I I;  1YJN 1;  1VQ7 Z;  4DK1 A;  1NP6 A;  2JV7 A;  3J80 b;  3CHP A;  2C5Z A;  3ZHZ A;  2RT9 A;  4NFR A;  2O53 A;  3CC7 Z;  2EGT A;  1S72 1;  4E2X A;  3CC7 1;  3FTS A;  1Q0Q A;  3CZG A;  4ZX4 A;  4A3E I;  5JO0 A;  2VF1 A;  2Y0S A;  1ZS2 A;  4XN8 A;  1YJW 1;  2QVW A;  4DGL A;  3CXC Z;  3FTY A;  2OTL Z;  3S2H I;  3FUI A;  3JAM b;  3J81 b;  2PL5 A;  5FLX f;  5JBI A;  2QRD B;  3FUM A;  1QVF Y;  3OW2 Y;  3HOU I;  4ZQG A;  1ONO A;  3VVM A;  3UER A;  1R9T I;  2HU9 A;  2IZ3 A;  1K8A 2;  3RZD I;  4ZW6 A;  1ZB9 A;  2DE6 A;  4RVG A;  5T6B A;  2JA6 I;  3B3B A;  1OR7 A;  4R5T A;  2JA5 I;  2JR6 A;  3CPW Y;  5AEN A;  4K5N A;  3FH5 A;  3B7S A;  4ARF A;  3FUF A;  4XMU A;  2R7Z I;  3VMG A;  1W2B Y;  3B7U X;  3M4O I;  3CHR A;  4QTT A;  1MW2 A;  4E32 A;  2E2J I;  1N8R 1;  4OOF A;  2HPO A;  1K9M 2;  4RVD A;  2OTJ Z;  3CHQ A;  1RO4 A;  3MZL B;  4QTU A;  1SQM A;  4XN1 A;  1NJI 2;  2WZG A;  2Y1G A;  3EED A;  3IX0 A;  2WAQ A;  3HOZ I;  1KRL A;  1T1S A;  2QEX 1;  3FHE A;  3CCL Z;  4A3F I;  4AYB A;  2RHB A;  4OOE A;  4NQW A;  4RV9 A;  1YJ9 1;  1T1R A;  1TWA I;  4DPR A;  3CCJ Z;  4MD9 A;  2QKD A;  1QVF Z;  3CCJ 1;  3JT1 A;  3CCU Z;  1Q0L A;  2JMO A;  3FU0 A;  2DQ6 A;  1Z03 A;  4NBB A;  1Q82 2;  4XMX A;  4MRI A;  3J80 f;  2Q51 A;  1RQF A;  3S14 I;  4BXX I;  2NVY I;  4GAE A;  4QPE A;  4Q4I A;  1TFI A;  2H85 A;  1ONN A;  4ZX5 A;  3CPW Z;  1YI2 Z;  3FU6 A;  4K5P A;  3FQM A;  1YI2 1;  2RPR A;  3BG1 B;  3GTL I;  1K83 I;  3EBH A;  1K5H A;  2OZK A;  1VLA A;  1Y1W I;  2NVQ I;  4ZQE A;  1W2B Z;  2C82 A;  3HKZ A;  2GTQ A;  4Y6P A;  1VQ9 Z;  5D1P A;  3JAM f;  3J81 f;  1USP B;  3MZK B;  3JSZ A;  4NBF A;  4A3K I;  1YUK A;  2JCV A;  2XPZ A;  3H0G I;  4R5V A;  1QYP A;  2DE7 A;  1VQO Z;  1G5A A;  2JD0 A;  2JCY A;  4NH1 C;  3Q43 A;  4Q4E A;  3WQS B;  3CC2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...