1X3ZB

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
GSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords peptide: N-glycanase
total genus 16
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1x3zB01
1X3ZB 3ESWB 2QSGX 1PVEA 2F4OB 2QSHX 2QSFX 1QZEA 1TP4A 4YIRX 1X3WB 1OQYA 2F4MB
chains in the Genus database with same CATH superfamily
5J6XA 5ILUA 3JRFA 5HVQC 1PUEE 2HYFA 2BEOA 2MD5A 4PK4A 3CMMA 4RGRA 1HLVA 2R5YB 2E1OA 2H6CA 3HPHA 3WE2A 3ZQQA 3ZQFA 1X1PA 1BI1A 5D4SA 3CCLI 1OR7C 4IXAA 1WJEA 4G7ZF 2KHMA 1GT0C 2K3FA 2VBZA 2OZUA 3RZOJ 3F8NA 3OYKA 3QWLA 2E1MC 1OYIA 2QUFA 4AIHA 3FM5A 3H36A 3FISA 3ECOA 4ZYEA 3H0DA 4I2OA 1MSEC 2XF5A 4IL6C 2X1CA 4QIWN 4RM3A 2QF7A 3WTSC 2NVQJ 4A3EJ 4JK1X 1NK3P 3LSKA 2BHYA 4AVPA 1TTYA 4B48A 2GXGA 5KAIC 2XF7A 2IBDA 3NWTA 2XUBA 1FWZA 1IC8A 5GTHC 3TBIA 3J7AY 4UUTA 3Q9SA 3QQAA 1E2XA 2I8DA 2R7ZJ 3OY9A 3S17J 3M1CA 3RIRA 2AQEA 1UMQA 2IS6A 3DKWA 3LAJA 1ZAOA 3DXJF 2F4MB 4RLQA 5EGOB 1MBHA 1WWXA 4Z2YA 5B5EC 2ZSHB 4A0YA 2Q1ZB 1TQIA 1S6LA 1YJNI 4PCQA 3AKZA 3K10A 2DPUA 2PEXA 2XPWA 2RREA 3C3WA 4BJ5C 4RMNA 1MMGA 5IP7J 1POGA 3RKQA 2A5WA 1R5GA 3ZMUA 3BJ6A 2LD5A 1P2FA 1P4AA 3ZQCA 1IN6A 3KP2A 4ZZDA 4C2UA 1FPQA 3HSFA 4NUBA 5DS9A 4J01A 2HKXA 4M3DA 4Y13A 2LSOA 5AIQA 2ZMEB 4C30A 1ZLKA 5F1JA 4XLEA 3VEPA 1MBJA 1K78A 1JTYA 3GO5A 5E3OA 5DV5A 3VOEA 5FD6A 2Q2EA 3ABLH 1JHFA 2KRFA 3CC7I 4BQNA 2ETHA 2RQQA 2K9LA 1W5CC 1T33A 2VN2A 2R7SA 4EGYA 1TQMA 3BQYA 1JUMA 1Z77A 3A1YA 1KGSA 2HPMA 4N4NB 1R5ID 5J47A 2XGXA 4F3QA 2GIVA 3ROUA 1X1BA 1Y8QB 4HLYA 2XRNA 1LUJB 2HTJA 3LA3A 3O2PE 2O3FA 3KEQA 4F52A 2H1KA 2ZB9A 5J8CA 5L3GA 2HZTA 5KAFC 3FK6A 3F0CA 5E3NA 2KZVA 1U9OA 3HKZA 1KU3A 2CG4A 3QP6A 1GUUA 1S29A 1U9NA 4CCLA 4U0YA 1VNDA 2M2EA 3JCUC 2X1DA 2COMA 3M7GA 2M5WA 2D1HA 4UHTA 4M74A 2F4IA 1HF0A 2DOEA 2ISZA 2IAIA 2YR2A 2FQ4A 4IF4A 2DI3A 3FMRA 3FF5A 3HRSA 1H88C 2B0LA 4IEJA 4OWRB 1FOWA 1GV2A 3T1BA 2ZKZA 5TGTA 2W84A 2X0LA 3K7AJ 1WJFA 2K5CA 3ML6A 1YYVA 3OS2A 2PMZN 4E7IA 4B09A 3FKJA 1FTZA 2M8GX 1XGOA 1H9GA 1A6IA 3NQOA 2H27A 2CW7A 1XSXA 2EQRA 3K4NA 2I5UA 3K4BA 3OR1C 5FKKA 1I3QJ 3CCSI 1IRFA 3E5QA 4LGWA 4BDYA 4BEHB 2PJPA 2RN7A 1VQPI 2DU9A 3G1MA 1TT0A 2XSJC 2PN6A 2IEKA 2TCTA 1O4XA 4U0VA 1LB2A 4BXFA 3SFIA 2PQ8A 1JT0A 4FISA 3G2BA 2JJ7A 5CQGA 3FHZA 2F4OB 4XMYA 2XIGA 1IN7A 2L01A 2PBIA 2PX9A 3TO9A 1FEXA 4M9ZA 2L7MP 1HKSA 2ID6A 3HM5A 4ZYDA 1FIPA 4GO1A 2HOAA 4KIFA 1IO2A 3KZZA 1W7PB 1MJ9A 3MZYA 3TP0A 1IN8A 1F36A 1FC3A 3CUOA 2E1NA 1MSFC 1TC3C 4OIQF 1BOAA 1D1AA 3J81Z 4LIVA 4WCGA 1WRJA 4RM2A 3W3CA 2HXOA 3BG5A 5IYCJ 1T95A 3O8GA 5LFAA 3HHGA 5LRSA 2L02A 1OYWA 5GAHJ 3JSPA 3BR1A 1MBEA 2K4JA 2WA0A 4HDUA 2EFNA 2DO7A 5LD2C 1Z67A 2M3AA 3BG3A 1XSVA 2VKVA 3ZCOA 5GAEJ 4YRVA 5K1YA 3BR3A 1YLFA 2ZFUA 3F23A 2HOTA 5FD5A 2KP6A 4IHSA 5AONA 2DMUA 3ABTA 3HOWJ 1X4OA 1KA8A 2P5VA 1Z91A 2FMYA 2KZGA 2L9SA 3U1KA 1VQ5I 2GM4A 1MMNA 1HXDA 2DLLA 2BBYA 4KIBA 2VKHA 1SD7A 5F64A 2HPIA 2Y0SA 2UV1A 3OYCA 1LJ9A 3CC2I 3O8HA 1G2HA 3DKXA 1Z3XA 2E5ZA 4R79A 2Y48A 1AHDP 2DA7A 3DPLC 3HL2A 2B63J 2DT6A 3F8MA 2JPCA 3LQQA 4A0ZA 3Q5FA 4XK4A 2MLGA 1ITYA 4I76A 5CJ9A 2X1EA 3I4NJ 2W4SA 4HW0A 2IS4A 5BQTA 2QQBA 2KJBA 3SZTA 3HBLA 2JRTA 5H2FC 2ZJQF 5K5QA 2E19A 1T0FC 4UXNA 2BW3B 1W36D 3MKZA 1V55H 5EJCA 5M3FJ 2HQAA 1S7OA 1S7EA 3HEFA 2KDZA 1EH6A 4HNVA 3GZ6A 4LOCA 1HW1A 1YHQI 2GQQA 2NS0A 2K9QA 2ICWG 3MN2A 3WHCA 2WB1N 3CZ6A 3WGIA 2Q0OA 3C7JA 1LFPA 1EJ9A 2E60A 5HDKA 2YS9A 4L9TA 2YU3A 5F6FA 1MJBA 2ZBKA 4HNTA 1OCPA 5FKMA 1B1BA 3ZMSA 5CPRB 1ORKA 1SFKA 2VXDA 4XRSA 4Y52J 3ZOBA 4FE7A 2KQRA 3K1PA 1MBKA 1LDDA 1LE8A 4P5OA 2JK3A 5LRRA 3JR9A 2XB5A 1YW8A 4LB6B 4KT6A 2EINH 3LL7A 3DWLE 3MQ0A 1B9NA 4JX5A 1O3SA 2KRCA 3FZVA 4P1WA 1BIAA 2L3DA 1UCRA 2MC4A 3WTYC 4G9YA 3LSTA 1VI0A 1MMDA 1IUFA 3OIPA 2XROA 4A3JJ 2QSHX 2MABA 1QO0D 4RGXA 5IT9Z 1CQTA 3DBHB 3SFZA 1LPQA 2Q8KA 3M4OJ 2BY3A 2HQ5A 3T0YA 2LVSA 3ABUA 2R7VA 1S9HA 3G4SI 2STTA 1LNWA 5L3EA 1AKHB 1BL0A 2HS5A 4YELA 4AD9A 5C3EJ 3A03A 4IHVA 3GTMJ 4IRHA 4JX6A 1QPMA 5EEAA 3PSFA 4FE4A 4A3FJ 2L54A 2PI0A 5FJ8J 1FJLA 2ZNYA 2IGMA 1A6QA 3F8CA 5LGNA 5FKLA 3U21A 2QVOA 2W7NA 1VTNC 1XDUA 4E7HA 1I1GA 1BN5A 3GFJA 1WQ2A 1KQ9A 4GRIA 3K4MA 4B1RA 5ILVA 3PUFA 4G6QA 2MLKA 4ZYAA 4JOMA 4N9IA 2JRMA 4CZZA 4EJWA 1ZGAA 4II3A 1WSUA 5EEHA 3QRFF 4AIKA 4KMFA 4MQ9F 4C2TA 1DP3A 3JSOA 3L09A 1YX5A 1H8AC 4LLLA 4KMUX 3QU6A 3W6JB 4QSHA 4EM2A 2R7TA 1RPWA 2BXYA 2GA2A 4XRSG 1Y1WJ 3S16J 5HS7A 3HUGB 1SFUA 2QSFX 3L7WA 1B72B 4BJTA 1F1ZA 2KDOA 3HOZJ 1G3TA 1JXSA 5J1RA 4XNFA 4MIMA 2CQKA 5GADJ 4HF2A 2DJNA 5F0FA 1XGMA 1KONA 5FFXA 1FMVA 4Q47A 5HNFA 1QZYA 2FBHA 2RKHA 2GOXB 2R7WA 3ZR8X 2DT5A 1OISA 5L3CA 2XAUA 3KX2A 1VQKI 1E17A 4WK8F 4EM1A 3M9AA 4BY1J 4KN7X 3GBGA 4X6AJ 4UB6C 2OA4A 2HZDA 3SEQA 1GHCA 3ABKH 1J7KA 1WGXA 2VODA 1WFXA 5C4XJ 4XICA 3M07A 3BTJA 3F9KA 5JVTA 3I71A 3JRGA 1ZYRF 3JRIA 3K70D 4ZDOA 1U2WA 5CVRA 1SMYF 1RKWA 3E97A 2NS7A 2XC7A 2IGKA 3WU2C 4L0ZB 3F6VA 1B72A 1W4MA 3W6VA 1NG7A 1WKMA 2EIMH 1V54H 4A3CJ 1RESA 3Q0WA 5K5OA 3ERED 5ERIA 1OCTC 3H9QA 2VE8A 4EJVA 4UVBA 3V42A 2LBFA 4JYKA 5HLTA 2OTJI 1SD5A 3V4GA 2NNNA 5BMZA 1D8KA 5K7HA 3PJRA 3N4MA 3IKVA 1G3YA 1FZPB 3PNTA 4RS8A 5DM7F 3CCEI 4G7OF 1O57A 3EUKL 4HPQA 3ZN0A 2FRHA 3GW2A 1IRXA 4BHPA 1DPUA 2OQRA 5ILSA 3L2RA 1MIJA 4UVCA 1WH7A 3VODA 4O5VA 5IYDJ 3KYLA 4EQQA 3S2HJ 3RJPA 2MH9A 4BGDA 1X3WB 1J2XA 3ESWB 1YQAA 2X6YA 4A12A 2XV4S 4EV0A 4ZDPA 3WGHA 5JFRA 3QYBA 2KRHA 3HSRA 4A3KJ 3MMYB 3JW4A 4ZZLA 2DDAA 4ITVA 2MH2A 2YUSA 1FSHA 4CCJA 3KEYA 3EYIA 1Z6RA 5LBQA 3OYHA 1BC7C 3K2AA 2VOPA 4KFCA 3DF8A 3TL4X 5LHGA 4IHWA 3BCBA 3WU0A 5H6QA 2AS5F 3RYRA 4L5JA 3TOAA 1AOYA 2JQ7A 2W82A 3HTUA 2FEZA 3IRQA 2XAJA 3K4CA 3AFHA 2NVXJ 1NHAA 3R6SA 4XSZF 3PQKA 1QHHD 1S8NA 4RAFA 1T2KA 2QBYB 4UVAA 3FBIB 3M3YJ 2OBPA 1J5YA 3U2RA 1JKPC 1ZH5A 1A36A 1LDKB 2W25A 3GTPJ 5D5XB 2PG4A 2QWWA 4XSXF 5J1UA 3BJOA 4W1UA 3S3OA 3RYPA 4WX9A 4M72A 4I09A 1I27A 1ETOA 4XLHA 1FYKA 5JHFA 2XSDC 2E2HJ 2QA4I 1XDSA 5K5RA 3EETA 2PFBA 3BTCA 2LH9A 3S93A 3OSGA 2EILH 3ZMVA 5F0HA 2LY2A 3DU6A 5FO5A 3QPHA 3BZCA 1RI7A 3K6GA 1QA6A 3EUHA 2DA2A 1STZA 4D7MA 4LMYA 3CLOA 2Y2ZA 4OIPF 3R61A 1RKTA 3HGGA 2HVRA 3I4MJ 2DQRA 2M4GA 4S05A 1UG2A 3DEEA 2CFXA 2FMLA 1HCRA 1HC8A 4D5CA 4LG3A 1EKEA 1Z7UA 1NK2P 4G6DA 1WZ2A 3KETA 4ZH4F 5D5UB 1PYVA 1Z3YA 4I0BA 2V1UA 1QHGA 4D7NA 3OIQA 3E5UA 4OIOF 2LRDA 1T39A 1ZRCA 1P7JA 1B8IB 2W24A 2W57A 1P7IA 3GCMA 1RR7A 4ZC3A 3TDZC 1ZRDA 6PAXA 4ANJA 1MDMB 4FHTA 1R5HA 2GLOA 5CYVA 5KHDA 2VUMJ 2VL8A 4I6ZA 1R1UA 3GTQJ 2R7OA 1MH4A 2GXBA 2LK2A 3H0GJ 4HQEA 4F7ZA 2L9VA 2XAGA 3ZGKA 5F04A 4XONA 4Y4RA 1MBGA 1V4RA 2IA2A 3K1MA 1J75A 2AO9A 4A3LJ 2J5PA 2LF7A 2XRLA 3W6KB 3JRAA 4KISA 4X1EA 4KICA 1MW7A 5FLMJ 3IUOA 2DFFA 3PQJA 3DV8A 3BROA 2XVCA 2CWEA 4U0WA 4IX7A 2A05A 1D0XA 2V6EA 3FXOA 1ETVA 5B1AH 3JTGA 1PJRA 2P7VB 5CKTA 5AIPA 3G73A 2HDDA 3QPLA 3DBLB 4MFDA 2HI3A 3BG9A 3P9IA 1D0ZA 2A68F 1JGSA 5K7FA 2FJ1A 5BPDA 1Z6TA 1K83J 2DMPA 1YJ9I 5LEJA 2QQ9A 3V7RA 2MA3A 2XKPA 2HOSA 1YW9A 4PJMA 2DA5A 2CV2A 3UKGA 1ZHFA 3KEOA 3KZYA 3L00A 3M8EA 3S8PA 1SC7A 2R7FA 3CCJI 2E5NA 4II2A 4G8XA 5IPAA 2V6CA 4LK0F 2IA0A 4YFKF 2UWMA 4Q5SF 3IP4B 4NQWA 3RKYA 2JWTA 1GLNA 1YOVB 2IS1A 4M9XA 1R71A 1W0TA 4M73A 3WG9A 1R1VA 3KFWX 2JA8J 2Z1DA 5M5YJ 1E0EA 3F8BA 3DFGA 3A02A 3C1DA 1W5TA 4ESFA 1D8JA 2ZMEA 5B66C 1B9MA 4YIRX 4QTRA 3CCQI 1S3JA 2CS3A 4RB2C 2P81A 1Y6IA 3F6OA 4X0GA 1ZR4A 2QZ8A 2JA2A 2E35A 3WODF 5F1RA 1Y56A 2X4HA 3K70C 1K78B 2QCOA 3S32A 5DUIA 2E1CA 2CMPA 2RAEA 4YIFA 1NH3A 2D45A 1ZK8A 3OYMA 2K40A 1RUOA 2VE9A 4HV6A 2CQNA 1ON2A 5E8IA 2FUG2 4I7HA 4I01A 1BC8C 4XOPA 2WAEA 4NQWB 1J9IA 4CH7A 2WC2A 1RRJA 3DQVC 2VC1A 3JRBA 4E7SA 1UB9A 3CJNA 3L2UA 3BCAA 5EYRA 1GVJA 4XLFA 1BJZA 2HR3A 4CCOA 3ZMDA 3KIOA 1T6SA 1JTXA 1N25A 2L2OA 2P6TA 2VQGA 2EV6A 3OYNA 4S04A 2HEOA 3C2HA 1Z7LA 4BU2A 2HYJA 2CFOA 1Y0UA 2WAQN 4A69C 1XS9A 1OR7A 5E3LA 3OYLA 4O3MA 3CUQB 3HZJA 2V26A 5BPIA 3PFIA 3TW7A 4I02A 1A5JA 2HDWA 3F72A 3FK7A 2W00A 3MWMA 1W7PD 3G6EI 1IN5A 5HLGA 3I56I 3AG3H 3B6AA 2CUEA 1E3OC 4GDFA 2EWNA 5E1ZB 4A0XA 1K61A 2Y0SN 1R9TJ 5ICCA 5EEGA 5ICFA 3BR6A 2E71A 1MH3A 5KNLA 3FIWA 4UV8A 2M30A 2E1MB 1XGNA 3VPRA 4CCMA 1SD6A 2NNYA 3G1LA 3V8JA 4ZYGA 4ON0A 4YFXF 1LEBA 2OUMA 4NBQA 2VQHA 3KE2A 4MFEA 3H5AA 2AXLA 2A5YB 1FBQA 3QOEA 4IPAA 2CGPA 3BC8A 5F08A 1TP4A 1X1CA 1IG7A 2O7OA 2L9RA 2CV1A 1KU2A 2DFIA 4NC6A 2EB7A 2FE3A 2L7KA 5EDNA 2M4KA 2R4GA 3OOPA 4GYIA 2P5LC 5HDGA 3I59B 2AHQA 2COBA 3V7SA 1JKOC 5K7ZA 3IRRA 2K9NA 1MKMA 2ID3A 1MMSA 2H1LA 2A6EF 1MNDA 1O7LA 4EMSA 4H4KC 2RC4A 3HUGA 1JI8A 2LY1A 3FMQA 2GBYA 2LREA 1QPIA 3E1SA 3S1QJ 2N8GA 2DYRH 3L1PA 2C6YA 4U88A 1X3ZB 2XPUA 4ENNA 1BIBA 1U8RA 4P96A 3B6CA 2FOKA 2MGQA 5ICEA 4KT5C 3TGNA 2WWYA 4IRIA 1KU7A 1I6HJ 1P6RA 4Y3OA 1APLC 5FLVA 1TNSA 4D9JA 4JQFA 3I54A 2DA3A 2ACJA 1O3RA 1XC5A 1XGSA 3BWGA 4HX8A 4QLCU 2UZKA 1T08B 3H9JA 1PP8F 2WB1A 1W1WE 1TZLA 4Y33A 1I1SA 5KCMA 1WHUA 1TQPA 4LB5A 3PNYA 2MW8A 1IXRC 1DGWY 3HOYJ 2V7FA 1YG2A 4GFBA 2OCEA 3I3LA 2JVHA 2CQQA 4D5FA 1YS6A 3LSMA 3A2KA 2LNBA 3ZN1A 1B59A 2KISA 2DJIA 4K2EA 2WY7Q 1R4MB 4A3DJ 3VYSB 2V1XA 2DCEA 2QLZA 3AG1H 1IDYA 3ERMA 4PGGA 3WTVC 3GEZA 4L9NA 4PGHA 4MEXF 4YFNF 1EH7A 4A3IJ 1Z9CA 1W0UA 4XN3A 1USTA 1D5VA 1OFCX 2DODA 1D3YA 3IH4A 1DDNA 3K1NA 4LITA 2VOOA 4HAMA 2WAFA 2FXAA 4QPQA 4AYBA 3CD6I 1BOBA 3BG7A 4XRFA 1U6GA 2ZCWA 3P9CA 2JPBA 4O6JA 3GMEA 1ETYA 3JREA 3EQLF 4ENKA 2GIZA 3RQIA 2ELKA 3WGGA 3GX4X 2XHKA 2XB0X 2LOOA 3T8TA 1FP2A 3S14J 3I4PA 2IRFG 2LR8A 1X4PA 3CDIA 5CVUA 3ECHA 2V1NA 3CDLA 4KIGA 3AG2H 1NG6A 4C3JJ 2Z99A 3OIOA 3DPUA 4M9SA 2BVLA 1RIOH 2TDXA 1S7AA 3SJMA 1J0RA 2V1DA 4MTEA 4HBLA 3TO7A 4GYGA 3LQRA 4BACA 2NOGA 4WWCA 3DTEA 3D0SA 2UUZA 4HDVA 4AIDA 1E3PA 2PJRB 4DQ2A 1ZR2A 4PJNA 2G0EA 3RPUA 4AVZA 1QZEA 4XORA 2QENA 2QQAA 4WF2A 3OL3A 2FOWA 4NNJA 3CCRI 2P4WA 4BE1A 2K3PA 2YX7A 2RV8A 3RI4A 3CC4I 3LFUA 3OV8A 1XX5A 1IN4A 1DUXC 4C3HJ 1MD0A 4N9HA 1E3HA 1ONVA 2DOAA 3FBNB 2BXZA 4HF0A 5FB2A 2JUGA 2KFDA 2BV6A 2CQ7A 2Z5UA 4EJTA 4LIUA 5KVRA 3GF2A 2ISYA 2CUJA 4HEA2 4NC7A 2CO5A 4BBRJ 5M5WJ 4AU7A 1IV8A 2PMZA 3CP2A 5D6FA 5HOOA 1HDDC 2IJLA 4CA0A 5DDGA 3V7CA 1A31A 1QNTA 2QKMB 2RNGA 3Q3SA 2XAFA 3ZQ7A 3BLYA 3MVPA 2X9DA 2LY9A 3DTKA 5H20A 3PFYA 5IOZA 5D6EA 1TBXA 3EUAA 1I5ZA 3I5UA 3TKYA 1Z1DA 2VLAA 1LQ1A 2CUFA 1RZ4A 2NVUB 4NDLA 2HDCA 2F5DA 4B3AA 5FLXK 2DT7B 4KJZA 2LKSA 5TJJA 4HRIA 4RAZA 3O3KA 3LFKA 4YG2F 3HXLA 1PUFB 3VWBA 3HSEA 2JVGA 3ZQLA 3MAJA 2BY0A 2PMUA 1UJ8A 4M6XA 3R4KA 1MDMA 5GPAA 4A93J 1VQ8I 1B6AA 1ZTRA 2XAQA 4EEFG 3H35A 2OAZA 3IAM2 1DP7P 5JVGF 3PO3J 4BJ6C 4XL9A 1XPXA 1XCBA 4BKXA 2EFWA 1ZARA 1L3LA 2IVMA 1N78A 4L5IA 3PNVA 5JI6A 3TP3A 2K02A 5GP9A 4S0HB 1SEUA 1OMIA 2PLYA 1M1EB 3S15J 2Z3YA 4DOZA 2M0MA 3ONQA 3CUQC 2EH3A 3L2CA 1DGRM 3TEDA 4ENMA 4ZTJA 3MZHA 2D5VA 3KP5A 3MFKA 3RZDJ 3LSJA 1YW7A 2JUCA 4HYEA 2FSWA 4BE2A 2YPRA 4PZJA 4B3XA 5IP6A 2R93J 4RLFA 3C2BA 3IHUA 3OS0A 3H3ZA 2L4AA 3VB2A 3ZQHA 2R5ZA 1YRNA 3LOCA 4C3IJ 4E70A 3AL0B 3PSIA 1RC9A 2JA6J 4E7LA 3E7LA 4M3EA 2XKOA 2IGNA 2FF4A 1GVDA 1MMAA 3A0BC 1GXQA 1K79A 2Q2EB 1IGNA 4DNCA 3A4CA 3C2GA 4KA4A 3VYTB 2VKEA 1JHHA 5EF6A 4E7JA 1YJWI 2M7BA 5L3BA 3Q0VA 4CZCA 2ZFWA 2OV7A 2FX0A 2HQNA 2E36A 2NOJB 1I3AA 4MEYF 1O3QA 3P7NA 2EK5A 2VPRA 1N77A 1WJDA 1FBSA 1FTTA 4H0EA 4KDPA 4XKBA 1HKQA 2VASA 3I64A 1XN7A 2NYXA 3MZ8A 5ED4A 2KT0A 4DBRA 2KIQA 3ZMZA 4U7BA 3F8FA 3TDUC 1XCVA 3WTZA 2R5ZB 1FYMA 3BDDA 1ETKA 3KYCB 3FHNA 2KPMA 4HSRA 2ESHA 5D8KB 2CSOA 3I9V2 4G94A 1GXPA 2DTRA 4HF1A 2DA4A 4FX4A 3S1MJ 1U3EM 4MLOA 2GOMA 4XKWA 1P4XA 3L9FA 5DD8A 2BY2A 2QSGX 1X58A 4IHTA 1UHMA 5HNHA 2DA1A 2K27A 5D4RA 3HJEA 1YRNB 1HW5A 1XMAA 2NRAC 2RNJA 1DQUA 2KIFA 5C4JJ 3S2DJ 5GPCA 3D5SC 1FSEA 3HRMA 4W97A 2DDBA 4OOIA 5E8GA 4Y7NJ 3IC7A 4YEJA 2GXAA 3VSLA 5LHIA 3QPTA 2H8RA 2HVQA 3X2QH 1G3WA 1Y8RB 2IW5A 4R1HA 4RB1A 1BJAA 3CF5F 5DCFA 1U5TC 2L9NA 1MBFA 3MKWB 4L9JA 4IVNA 5E1WA 3BP8A 1W7PA 2H94A 3EUHC 1ETQA 1JKQC 1U0JA 1WJCA 3FWEA 4WXHA 4XM3A 3HOSA 1K4TA 3WTTC 4BQAA 2DOFA 2UXXA 4D0PA 3EYYA 1U5TA 1SFXA 4ZTFA 1J59A 3D1NI 4ENJA 3DP7A 5F27A 2F6CA 3W2WA 4CDGA 4AM3A 2B9SA 1TT5B 4HA8A 3WTXC 4R8HA 2V9KA 1QZZA 2R3SA 3CJQB 4LG0A 4PFOA 3L2VA 3D5RC 2IT0A 2F5CA 3ISPA 4P55A 3H9GA 5A2QZ 4FETA 4FX0A 2IA1A 2BHZA 1TWHJ 3NARA 1SMTA 1QU3A 3DLAA 3U1DA 3COAC 5E17F 3Q0UA 2K7LA 2VJ5A 2AQFA 2NXNB 4BXUA 3NRVA 2VBWA 4XKCA 2XGDA 5FRNA 3OYEA 1G6NA 1R22A 1BI0A 2R7QA 1KYWA 3FDYA 3IKTA 2R7DA 3N97A 2EZLA 1FT9A 4CHUA 4LLGF 4C9YA 3S2WA 5L3FA 1U5TB 4ESBA 4EGZA 2BVMA 1Y1VJ 4Q4ZF 5BOXA 2DBBA 2VBYA 2WBMA 3HYIA 2DK5A 2LDUA 3KPHA 1VQOI 4A3GJ 3TQNA 1FLIA 3PIOF 3E3VA 3K4JA 1S5LC 2W1OA 3MCZA 5HLIA 1XMXA 2ME0A 3ZQIA 1ZG1A 1P92A 5GAGJ 1K7AA 4FT8A 4HV5A 3BTLA 5E20A 3LA2A 2JA7J 1SFEA 3CJRB 1SANA 2NVYJ 4GCVA 4I99C 1ULYA 2EZHA 4B47A 2HXIA 2X6XA 2KIMA 3WTUC 3GYHX 4F91B 1IRGA 3HRUA 4C2MJ 5HS8A 1XD7A 1XSDA 3HOVJ 1USSA 1QBJA 2VXZA 3CCMI 5JLWA 3QP5A 2Y75A 4L5EA 4EM0B 3HG9A 4D1QA 1PP7U 3IWFA 3RTRA 1I50J 3J7YJ 3WU1B 1TNTA 2FBIA 2A61A 2V9PA 3KZIC 2I10A 1AU7A 4PJLA 2QBYA 4ABZA 4A6EA 2DFEA 3IWZA 4FCYA 1WJ5A 2M9HA 2WY8Q 2W85A 2M1BA 3ULQB 3VSKA 1G3SA 1R7JA 2VQCA 5M3MJ 3J7ZI 2EA2A 2V4JC 2HFHA 2H6BA 4A5NA 2O5RA 2E7XA 3QYEA 4PSXA 1TLHB 2OPTA 1HBXG 4P9UA 1JT6A 1OYYA 3JRHA 1HQCA 3G3ZA 3RCOA 2YU9J 1JUSA 2HTSA 4AC0A 1OCRH 4RB3C 2LLKA 4L9VA 2NVTJ 3J7AO 2DMTA 3D5LA 3FXMA 5IYBJ 1VQ9I 4G12A 3L2WA 2VONA 1VF9A 5FRMA 4E7ZA 4AWXB 4L0YB 1WVRA 2R92J 4IQJA 4IOAF 1BA5A 1T0FA 1IDZA 4XLAA 1JGGA 2CRGA 3V8KA 3BQZA 3J80K 3KP7A 2IGOA 3CMYA 2O03A 1YTYA 3A01B 3FMSA 4HNUA 3DPTA 3CMEI 1XTAA 2BY1A 1YO5C 3WHBA 2E2JJ 1U8BA 3GTLJ 5TISC 4ETSA 3C18A 3SEZA 4BS9A 4OMZA 2VJIA 1LVAA 4M6YA 1DU6A 2CH0A 2JMWA 3SYTA 5J8FA 3N05A 2BYVE 2KLOA 4AUXA 3ZRGA 2VT3A 1WI9A 3GTOJ 3H3VK 2FQ3A 3HRTA 2ZMEC 5L3DA 4E7KA 4YIIA 2X48A 2VT2A 3Q9VA 3OSFA 2O0YA 3OYJA 3VYRB 4OINF 2GA1A 5CLSA 5IY5H 5FKOA 1FY7A 3PUBA 4GXOA 4LLNA 3CJTB 1EA3A 1X2MA 1PUFA 1LDJA 2L7ZA 2FA5A 3F21A 5FLXZ 4IRGA 4ESJA 1PDNC 4RGUA 1FOKA 3K4LA 3HOTA 3SDBA 1RUNA 3KYDB 3T8RA 4U7DA 3E5XA 4GGGA 3I55I 2HNHA 1IV6A 2F48A 2K4BA 4V2FA 5IT9K 3QAHA 1U78A 3P9KA 2HVSA 1R00A 1X19A 4N4OB 5JLXA 1Z21A 3FXLA 3IH3A 5CVJA 3V8LA 1P9QC 2BZTA 1WPKA 1HA8A 5EG0A 2ESNA 4CCKA 4UUVA 3REOA 3R0JA 1PVEA 5JR3A 4G6TB 2VC0A 5D8LB 2LP0A 3FXJA 4XOTA 1Q1HA 3LMMA 4RDUA 3F3XA 4B44A 4J00A 4M3GA 3TMOA 4BBSJ 4Z6YA 3ZXSA 3JRDA 4EVIA 4HLXA 9ANTA 2JN6A 3HKZN 3K69A 3P5JA 3BJAA 3HGYA 2D1VA 3HB9A 3I58A 2DQLA 3CCYA 3RSNA 1CF7A 2EZKA 3OYDA 1ZQ3P 2ZXWH 4HSTA 1XB4A 1I6XA 4DYQA 3K9TA 3QYFA 3I53A 2EV0A 1ZKGA 3OWTA 1FYLA 1A04A 4WXDA 4V19K 1SD4A 5HODA 1ODDA 4BEHA 1ETWA 1K6OA 3KLOA 2XGCA 1ZREA 1FBUA 4LD5A 2HGCA 3ASNH 2DTZA 3OS1A 2DMQA 3GLXA 2H8WA 1EH8A 2OD5A 4DW6A 2LG4A 2J5OA 5A2QK 1WH5A 4U87A 5LGTA 5D5WB 1D0YA 1Z0XA 4DBQA 3A01A 3MEXA 4PFPA 3OYAA 4WXCA 5FROA 2QM3A 1TW2A 1IF1A 1H89C 1H0MA 1R49A 2CJJA 4MGRA 4E4HA 2M0CA 1BBYA 2Y30A 1D1CA 1VZ0A 3JAMK 3CCUI 2OQGA 5IT3A 2FNAA 1AKHA 4CUGA 2RVCA 1MNMC 5ICGA 2R7RA 3FM3A 3IV5A 2V9VA 2EZIA 2TRTA 3K2ZA 4BNCA 3GXOA 4M6VA 5DCMA 2JT1A 5J40A 1AWCA 5FGMA 2DA6A 2QGUA 1MZBA 4BUPA 3CO7C 4A6DA 2O8XA 3BPVA 2L7FP 2K9SA 4QPOA 1VQLI 1FX7A 1KZHA 1ETXA 1SFOJ 4OMYA 4IHYA 2L5QA 1W36C 2L4MA 4LFUA 2JSCA 2Z16A 1ACIA 3IL2A 1QRYA 2UXNA 1LE8B 4B43A 3E6DA 3W2VA 3CLQA 1I39A 3TO6A 3SHFA 3A0HC 1K6YA 3NWSA 1MNEA 2CW0F 5JHUA 3ZP5A 2ELJA 3OOUA 1EF4A 2M45A 4G7HF 2BE5F 4RBOA 2ZO4A 3JRCA 3EDPA 2VI6A 1R36A 5DTDA 1OCCH 5CVVA 5EZGA 1R4NB 4BY7J 5J4VA 5FFZA 4BL0B 2HYGD 5CQEA 4DYRA 1ZLJA 2E7WA 1S72I 3HOXJ 1L0OC 2OTLI 2EFPA 2VJ4A 4ASNA 1UZCA 4E6KG 3LSHA 3GTKJ 1EV7A 2STWA 2KIUA 2LMDA 5DM6F 2K85A 4DIQA 5E3MA 4J19A 2PJRA 3B73A 2O8KA 2V79A 3BT9A 2X85A 2G7UA 1IAWA 1QQIA 1IXSB 5KK1A 2O9LA 4MO7A 3OL4A 2JSPA 2HWVA 3CO6C 2OF7A 3CP8A 4RAYA 3LWFA 2JA5J 4UY8I 4AIJA 2WV1A 1AA7A 4RB0A 2Y9YA 3BTIA 2MFZA 3GFMA 3J80Z 1XMKA 3DEWA 4FTHA 2EJRA 3B02A 1YE9A 4EJOA 1LVKA 3DKYA 3J81K 3PIPF 2Y69H 2VB6A 2DW4A 2P6SA 1YITI 2M87A 3DLLF 1LEAA 1WJAA 2O61A 4EJUA 5LGUA 2ZSIB 5B3SH 1R1TA 3MD2A 4XLPF 1X1AA 2OJED 1R58A 1UFMA 4N0BA 4KITB 4UUSA 2EBIA 2XPVA 2XAHA 4HG2A 4M3FA 4RGSA 5BNGA 5BS6A 2JZYA 3CESA 2EIJH 5E79C 2RGVA 2FBKA 1TWAJ 1OJLA 2M34A 3R0AA 3ZPLA 2KMUA 2CV0A 4IZZA 2L0KA 2Z33A 3GVAA 3K4KA 2EFOA 3LSGA 2Y0MA 4BHBA 3VFZA 4A2UA 2WAQA 2CYYA 1FOXA 1YIJI 1F4KA 3FKIJ 4IQ4A 2F5EA 1ENHA 4BAYA 3BR2A 1D1BA 4FASD 1BW5A 2P5KA 1BI2A 4UUSB 2GAUA 3BR0A 3RQ4A 3S1NJ 2JTVA 3GFIA 1F5TA 3ZQGA 4HZFA 1F9NA 2ADUA 1V5EA 2CUZA 4BYYA 2Y31A 1WCMJ 4BQQA 1B8IA 2P0WA 2R5YA 1SVMA 3WG7H 2D2WA 4ZDLA 1HDPA 4LJZF 1YS7A 4QWQA 4DJAA 2DYSH 4HX4A 2XDVA 2X6OA 1VQ4I 1ZRFA 2MD0A 2HKOA 2H09A 4DZJA 1BR1A 2F2EA 4BHCA 1X2NA 4BDZA 3KCCA 4MHGA 5M5XJ 3BG6A 3CQZJ 4Y15A 4IO9F 1KU9A 2ZXJA 3BY6A 4L18B 1B4AA 1ZGWA 2NAZA 3CUQA 1LKXA 4UB8C 2OC6A 2R7UA 5C44J 2A07F 3DEUA 3MKYB 5J1YA 3QU3A 3AG4H 1QVTA 1HW2A 2IPQX 2BW3A 2XGEA 4TV7A 2HOEA 4Y17A 1IJWC 3RKWA 3G1OA 3VDXA 1YIOA 3BZ6A 5B1BH 4B8XA 1CGPA 1OKRA 3CMAI 3M1EA 1W5SA 4XLCA 5DCMB 4A5MA 5IP9J 4Q48A 3LAPA 5HDNA 2XF6A 1OQYA 3KP3A 1BM9A 4V2GA 2KKOA 2WV0A 3OR2C 4MTDA 2ZNZA 3LSPA 2LC2A 1OCOH 2CQXA 5CVIA 2F5VA 3H3UA 1JJ6C 1DU0A 4NHJA 1JE8A 1OLTA 4HOBA 2KJCA 3BPXA 1RETA 1P4WA 3AL0C 4EATA 2K86A 4DYCA 3CTAA 3WE3A 3LA7A 5F0CA 4P9FA 1JKRC 2LTPA 3OYBA 2YSRA 3HHHA 2NS8A 1KQ8A 1Y0NA 2M7AA 3JTHA 4I0AA 4XLNF 4IOCF 2OCCH 1FOYA 5D5VB 2ZJRF 3LNQA 3O6BB 3GUDA 3OYIA 1FMWA 4ZYHA 1ZN2A 3KP4A 1LFUP 4AYBN 2ZJPF 1R23A 3E6BA 2ECCA 4LK1F 5DUKA 2KL4A 4PSWA 3GWZA 1LFBA 2AXTC 1VQNI 4CXFA 3GZNB 2ECBA 3FXQA 5H6RA 4FQGA 4BQOA 3RPQA 3HOUJ 2DMNA 2Z9OA 1K4SA 3WTWC 1TW3A 2M8EA 4BXXJ 2DN0A 4A3BJ 2QYOA 2WTEA 1G8XA 3HC7A 5HS9A 1ON1A 4DZPA 1V3FA 4XRMA 1TL8A 1ZELA 1TWFJ 4PUSA 4KYWA 2VIXA 3GLLA 1XG1A 3H1CA 3I59A 4IJAA 4XR6A 3LSIA 4A3MJ 3VYUB 4JP0A 4KN4X 3HPGA 2DAOA 2EFQA 3S3MA 2IXSA 2OZ6A 2P7CB 3UNGC 1G59A 4DGWB 2EIKH 1T56A 2CU7A 5LEKA 3MKLA 1HOMA 3HIFA 1O7FA 2LKXA 1D5YA 3PM1A 2LYCA 2ZXHA 1Q1VA 2FU4A 1OCZH 2A3SA 2QQ8A 4IHXA 2A6HF 3NAUA 4CYDA 1F43A 2X51A 2IP2A 4LG0B 1X1DA 2R7XA 3GTGJ 2LFBA 2YX4A 1JJ8C 2EV5A 3KP6A 4RA2A 2MC3A 5FKNA 2VQLA 1IXCA 1UHWA 2WADA 3SXYA 3CCVI 1Y39A 1N75A 1HSTA 1V5FA 3QODA 1V5GA 3SQNA 1CF7B 1A35A 2E34A 3EPZA 2X6WA 2VPLA 2BGCA 2DPDA 1BR2A 3OYFA 2DXIA 1IUYA 1OPCA 3OYGA 4BE0A 1FIAA 4CGZA 3S3NA 3QOPA 4M71A 4MQVA 4I98B 1HSJA 1QGPA 4BH9A 5J4YA 4PJ0C 2CW8A 3NEUA 4CO8A 1G4DA 3FX3A 2GWRA 2RDPA 1ZG3A 5E18F 2VBXA 2O6GE 4JBAA 1BW6A 2P8TA 3DBRB 5GTIC 1MGTA 5EG0B 2HU9A 1BI3A 4OIRF 1QVUA 5DD4A 2GZWA 1IZ1A 1BR4A 3FXKA 3U9GA 2QEXI 4IKFA 5LHHA 2LF8A 5J3LA 1SVLA 3SZPA 1GDTA 3CDHA 2K9MA 2HQRA 1TWCJ 1R6RA 4UV9A 4NB5A 3ASOH 2FNPA 1NTCA 5IOYA 2R0QC 1WJBA 2EPFA 2PMHA 2A69F 4XIDA 3SZGA 1FNNA 1MJAA 3JAMZ 1Z05A 1UHSA 4OAZA 4M3BA 2QKLB 5LLQA 3GFLA 3M8JA 1X3UA 1UG0A 3RKXA 1VQMI 4KUMA 3OMYA 4ZJZA 2BOLA 2IS2A 2ZC2A 3CF2A 3L2QA 2MYSA 1VQ6I 3H92A 3RPUD 2RQPA 3DU5A 3LSRA 4CSWA 3UR3C 1VFCA 1WI3A 3FXRA 4F92B 3HDDA 2ELHA 3AAFA 4OU0A 2G7HA 1SAXA 2LKPA 3DCFA 3E6MA 1T98A 1UAAA 1HKTA 3TOBA 4OAYA 2MBFA 4PJJA 4CCNA 3DTIA 4XN0A 3HTSB 3W2AA 3PL8A 4F55A 3R60A 1J09A 3H5RA 2DK8A 3H5NA 1H9TA 1YX3A 1JUPA 4XKVA 2MSYA 1SAUA 5HLHA 5E1XA 1UELB 1T38A 3SDGA 5EZHA 3ZMTA 2W48A 3KLNA 4PDKA 3T5XA 3FXUA 5TRDA 1ZG5A 4KNYA 3QPSA 1REPC 3GZ5A 3F22A 3G71I 4UNOA 2Z2SB 1IW7F 4CICA 2OU2A 4HQMA 4MNUA 2LBFB 3RDIA 3TW6A 3S1RJ 1VQ7I 5DEQA 3BOQA 2XASA 4B4CA 2DFHA 3GTJJ 2Y9ZA 3BZKA 1TWGJ 3IH2A 1YFHA 3E0JB 2ME6A 2EA4A 2VKDA 1YI2I 3K0LA 4F93B 2A6TA 4HX7A 3PO2J 1T8IA 1KYZA 2VJJA 3ABMH 4CYCA 1GV5A 1KQ0A 1SVOA 4JX4A 5EGOA 2E2IJ 2ZXIA 1RR8C 4NC8A 2ZJ2A 2MG4A 1IRZA 2F5FA 2G9WA 5DYMA 1C0WA 4CYCB 3I0TA 1FP1D 4XQFA 4XBFA 2B7EA 1ZGJA 3ELKA 3IAS2 1RNLA 2FD5A 1DPRA 1O3TA 3M8FA 3E6CC 1ERDA 3BR5A 4RAGA
chains in the Genus database with same CATH topology
1X3ZB 3ESWB 2QSGX 1PVEA 2F4OB 2QSHX 2QSFX 1QZEA 1TP4A 4YIRX 1X3WB 1OQYA 2F4MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Z B;  3ESW B;  2QSG X;  1PVE A;  2F4O B;  2QSH X;  2QSF X;  1QZE A;  1TP4 A;  4YIR X;  1X3W B;  1OQY A;  2F4M B; 
#chains in the Genus database with same CATH topology
 5J6X A;  5ILU A;  3JRF A;  5HVQ C;  1PUE E;  2HYF A;  2BEO A;  2MD5 A;  4PK4 A;  3CMM A;  4RGR A;  1HLV A;  2R5Y B;  2E1O A;  2H6C A;  3HPH A;  3WE2 A;  3ZQQ A;  3ZQF A;  1X1P A;  1BI1 A;  5D4S A;  3CCL I;  1OR7 C;  4IXA A;  1WJE A;  4G7Z F;  2KHM A;  1GT0 C;  2K3F A;  2VBZ A;  2OZU A;  3RZO J;  3F8N A;  3OYK A;  3QWL A;  2E1M C;  1OYI A;  2QUF A;  4AIH A;  3FM5 A;  3H36 A;  3FIS A;  3ECO A;  4ZYE A;  3H0D A;  4I2O A;  1MSE C;  2XF5 A;  4IL6 C;  2X1C A;  4QIW N;  4RM3 A;  2QF7 A;  3WTS C;  2NVQ J;  4A3E J;  4JK1 X;  1NK3 P;  3LSK A;  2BHY A;  4AVP A;  1TTY A;  4B48 A;  2GXG A;  5KAI C;  2XF7 A;  2IBD A;  3NWT A;  2XUB A;  1FWZ A;  1IC8 A;  5GTH C;  3TBI A;  3J7A Y;  4UUT A;  3Q9S A;  3QQA A;  1E2X A;  2I8D A;  2R7Z J;  3OY9 A;  3S17 J;  3M1C A;  3RIR A;  2AQE A;  1UMQ A;  2IS6 A;  3DKW A;  3LAJ A;  1ZAO A;  3DXJ F;  2F4M B;  4RLQ A;  5EGO B;  1MBH A;  1WWX A;  4Z2Y A;  5B5E C;  2ZSH B;  4A0Y A;  2Q1Z B;  1TQI A;  1S6L A;  1YJN I;  4PCQ A;  3AKZ A;  3K10 A;  2DPU A;  2PEX A;  2XPW A;  2RRE A;  3C3W A;  4BJ5 C;  4RMN A;  1MMG A;  5IP7 J;  1POG A;  3RKQ A;  2A5W A;  1R5G A;  3ZMU A;  3BJ6 A;  2LD5 A;  1P2F A;  1P4A A;  3ZQC A;  1IN6 A;  3KP2 A;  4ZZD A;  4C2U A;  1FPQ A;  3HSF A;  4NUB A;  5DS9 A;  4J01 A;  2HKX A;  4M3D A;  4Y13 A;  2LSO A;  5AIQ A;  2ZME B;  4C30 A;  1ZLK A;  5F1J A;  4XLE A;  3VEP A;  1MBJ A;  1K78 A;  1JTY A;  3GO5 A;  5E3O A;  5DV5 A;  3VOE A;  5FD6 A;  2Q2E A;  3ABL H;  1JHF A;  2KRF A;  3CC7 I;  4BQN A;  2ETH A;  2RQQ A;  2K9L A;  1W5C C;  1T33 A;  2VN2 A;  2R7S A;  4EGY A;  1TQM A;  3BQY A;  1JUM A;  1Z77 A;  3A1Y A;  1KGS A;  2HPM A;  4N4N B;  1R5I D;  5J47 A;  2XGX A;  4F3Q A;  2GIV A;  3ROU A;  1X1B A;  1Y8Q B;  4HLY A;  2XRN A;  1LUJ B;  2HTJ A;  3LA3 A;  3O2P E;  2O3F A;  3KEQ A;  4F52 A;  2H1K A;  2ZB9 A;  5J8C A;  5L3G A;  2HZT A;  5KAF C;  3FK6 A;  3F0C A;  5E3N A;  2KZV A;  1U9O A;  3HKZ A;  1KU3 A;  2CG4 A;  3QP6 A;  1GUU A;  1S29 A;  1U9N A;  4CCL A;  4U0Y A;  1VND A;  2M2E A;  3JCU C;  2X1D A;  2COM A;  3M7G A;  2M5W A;  2D1H A;  4UHT A;  4M74 A;  2F4I A;  1HF0 A;  2DOE A;  2ISZ A;  2IAI A;  2YR2 A;  2FQ4 A;  4IF4 A;  2DI3 A;  3FMR A;  3FF5 A;  3HRS A;  1H88 C;  2B0L A;  4IEJ A;  4OWR B;  1FOW A;  1GV2 A;  3T1B A;  2ZKZ A;  5TGT A;  2W84 A;  2X0L A;  3K7A J;  1WJF A;  2K5C A;  3ML6 A;  1YYV A;  3OS2 A;  2PMZ N;  4E7I A;  4B09 A;  3FKJ A;  1FTZ A;  2M8G X;  1XGO A;  1H9G A;  1A6I A;  3NQO A;  2H27 A;  2CW7 A;  1XSX A;  2EQR A;  3K4N A;  2I5U A;  3K4B A;  3OR1 C;  5FKK A;  1I3Q J;  3CCS I;  1IRF A;  3E5Q A;  4LGW A;  4BDY A;  4BEH B;  2PJP A;  2RN7 A;  1VQP I;  2DU9 A;  3G1M A;  1TT0 A;  2XSJ C;  2PN6 A;  2IEK A;  2TCT A;  1O4X A;  4U0V A;  1LB2 A;  4BXF A;  3SFI A;  2PQ8 A;  1JT0 A;  4FIS A;  3G2B A;  2JJ7 A;  5CQG A;  3FHZ A;  2F4O B;  4XMY A;  2XIG A;  1IN7 A;  2L01 A;  2PBI A;  2PX9 A;  3TO9 A;  1FEX A;  4M9Z A;  2L7M P;  1HKS A;  2ID6 A;  3HM5 A;  4ZYD A;  1FIP A;  4GO1 A;  2HOA A;  4KIF A;  1IO2 A;  3KZZ A;  1W7P B;  1MJ9 A;  3MZY A;  3TP0 A;  1IN8 A;  1F36 A;  1FC3 A;  3CUO A;  2E1N A;  1MSF C;  1TC3 C;  4OIQ F;  1BOA A;  1D1A A;  3J81 Z;  4LIV A;  4WCG A;  1WRJ A;  4RM2 A;  3W3C A;  2HXO A;  3BG5 A;  5IYC J;  1T95 A;  3O8G A;  5LFA A;  3HHG A;  5LRS A;  2L02 A;  1OYW A;  5GAH J;  3JSP A;  3BR1 A;  1MBE A;  2K4J A;  2WA0 A;  4HDU A;  2EFN A;  2DO7 A;  5LD2 C;  1Z67 A;  2M3A A;  3BG3 A;  1XSV A;  2VKV A;  3ZCO A;  5GAE J;  4YRV A;  5K1Y A;  3BR3 A;  1YLF A;  2ZFU A;  3F23 A;  2HOT A;  5FD5 A;  2KP6 A;  4IHS A;  5AON A;  2DMU A;  3ABT A;  3HOW J;  1X4O A;  1KA8 A;  2P5V A;  1Z91 A;  2FMY A;  2KZG A;  2L9S A;  3U1K A;  1VQ5 I;  2GM4 A;  1MMN A;  1HXD A;  2DLL A;  2BBY A;  4KIB A;  2VKH A;  1SD7 A;  5F64 A;  2HPI A;  2Y0S A;  2UV1 A;  3OYC A;  1LJ9 A;  3CC2 I;  3O8H A;  1G2H A;  3DKX A;  1Z3X A;  2E5Z A;  4R79 A;  2Y48 A;  1AHD P;  2DA7 A;  3DPL C;  3HL2 A;  2B63 J;  2DT6 A;  3F8M A;  2JPC A;  3LQQ A;  4A0Z A;  3Q5F A;  4XK4 A;  2MLG A;  1ITY A;  4I76 A;  5CJ9 A;  2X1E A;  3I4N J;  2W4S A;  4HW0 A;  2IS4 A;  5BQT A;  2QQB A;  2KJB A;  3SZT A;  3HBL A;  2JRT A;  5H2F C;  2ZJQ F;  5K5Q A;  2E19 A;  1T0F C;  4UXN A;  2BW3 B;  1W36 D;  3MKZ A;  1V55 H;  5EJC A;  5M3F J;  2HQA A;  1S7O A;  1S7E A;  3HEF A;  2KDZ A;  1EH6 A;  4HNV A;  3GZ6 A;  4LOC A;  1HW1 A;  1YHQ I;  2GQQ A;  2NS0 A;  2K9Q A;  2ICW G;  3MN2 A;  3WHC A;  2WB1 N;  3CZ6 A;  3WGI A;  2Q0O A;  3C7J A;  1LFP A;  1EJ9 A;  2E60 A;  5HDK A;  2YS9 A;  4L9T A;  2YU3 A;  5F6F A;  1MJB A;  2ZBK A;  4HNT A;  1OCP A;  5FKM A;  1B1B A;  3ZMS A;  5CPR B;  1ORK A;  1SFK A;  2VXD A;  4XRS A;  4Y52 J;  3ZOB A;  4FE7 A;  2KQR A;  3K1P A;  1MBK A;  1LDD A;  1LE8 A;  4P5O A;  2JK3 A;  5LRR A;  3JR9 A;  2XB5 A;  1YW8 A;  4LB6 B;  4KT6 A;  2EIN H;  3LL7 A;  3DWL E;  3MQ0 A;  1B9N A;  4JX5 A;  1O3S A;  2KRC A;  3FZV A;  4P1W A;  1BIA A;  2L3D A;  1UCR A;  2MC4 A;  3WTY C;  4G9Y A;  3LST A;  1VI0 A;  1MMD A;  1IUF A;  3OIP A;  2XRO A;  4A3J J;  2QSH X;  2MAB A;  1QO0 D;  4RGX A;  5IT9 Z;  1CQT A;  3DBH B;  3SFZ A;  1LPQ A;  2Q8K A;  3M4O J;  2BY3 A;  2HQ5 A;  3T0Y A;  2LVS A;  3ABU A;  2R7V A;  1S9H A;  3G4S I;  2STT A;  1LNW A;  5L3E A;  1AKH B;  1BL0 A;  2HS5 A;  4YEL A;  4AD9 A;  5C3E J;  3A03 A;  4IHV A;  3GTM J;  4IRH A;  4JX6 A;  1QPM A;  5EEA A;  3PSF A;  4FE4 A;  4A3F J;  2L54 A;  2PI0 A;  5FJ8 J;  1FJL A;  2ZNY A;  2IGM A;  1A6Q A;  3F8C A;  5LGN A;  5FKL A;  3U21 A;  2QVO A;  2W7N A;  1VTN C;  1XDU A;  4E7H A;  1I1G A;  1BN5 A;  3GFJ A;  1WQ2 A;  1KQ9 A;  4GRI A;  3K4M A;  4B1R A;  5ILV A;  3PUF A;  4G6Q A;  2MLK A;  4ZYA A;  4JOM A;  4N9I A;  2JRM A;  4CZZ A;  4EJW A;  1ZGA A;  4II3 A;  1WSU A;  5EEH A;  3QRF F;  4AIK A;  4KMF A;  4MQ9 F;  4C2T A;  1DP3 A;  3JSO A;  3L09 A;  1YX5 A;  1H8A C;  4LLL A;  4KMU X;  3QU6 A;  3W6J B;  4QSH A;  4EM2 A;  2R7T A;  1RPW A;  2BXY A;  2GA2 A;  4XRS G;  1Y1W J;  3S16 J;  5HS7 A;  3HUG B;  1SFU A;  2QSF X;  3L7W A;  1B72 B;  4BJT A;  1F1Z A;  2KDO A;  3HOZ J;  1G3T A;  1JXS A;  5J1R A;  4XNF A;  4MIM A;  2CQK A;  5GAD J;  4HF2 A;  2DJN A;  5F0F A;  1XGM A;  1KON A;  5FFX A;  1FMV A;  4Q47 A;  5HNF A;  1QZY A;  2FBH A;  2RKH A;  2GOX B;  2R7W A;  3ZR8 X;  2DT5 A;  1OIS A;  5L3C A;  2XAU A;  3KX2 A;  1VQK I;  1E17 A;  4WK8 F;  4EM1 A;  3M9A A;  4BY1 J;  4KN7 X;  3GBG A;  4X6A J;  4UB6 C;  2OA4 A;  2HZD A;  3SEQ A;  1GHC A;  3ABK H;  1J7K A;  1WGX A;  2VOD A;  1WFX A;  5C4X J;  4XIC A;  3M07 A;  3BTJ A;  3F9K A;  5JVT A;  3I71 A;  3JRG A;  1ZYR F;  3JRI A;  3K70 D;  4ZDO A;  1U2W A;  5CVR A;  1SMY F;  1RKW A;  3E97 A;  2NS7 A;  2XC7 A;  2IGK A;  3WU2 C;  4L0Z B;  3F6V A;  1B72 A;  1W4M A;  3W6V A;  1NG7 A;  1WKM A;  2EIM H;  1V54 H;  4A3C J;  1RES A;  3Q0W A;  5K5O A;  3ERE D;  5ERI A;  1OCT C;  3H9Q A;  2VE8 A;  4EJV A;  4UVB A;  3V42 A;  2LBF A;  4JYK A;  5HLT A;  2OTJ I;  1SD5 A;  3V4G A;  2NNN A;  5BMZ A;  1D8K A;  5K7H A;  3PJR A;  3N4M A;  3IKV A;  1G3Y A;  1FZP B;  3PNT A;  4RS8 A;  5DM7 F;  3CCE I;  4G7O F;  1O57 A;  3EUK L;  4HPQ A;  3ZN0 A;  2FRH A;  3GW2 A;  1IRX A;  4BHP A;  1DPU A;  2OQR A;  5ILS A;  3L2R A;  1MIJ A;  4UVC A;  1WH7 A;  3VOD A;  4O5V A;  5IYD J;  3KYL A;  4EQQ A;  3S2H J;  3RJP A;  2MH9 A;  4BGD A;  1X3W B;  1J2X A;  3ESW B;  1YQA A;  2X6Y A;  4A12 A;  2XV4 S;  4EV0 A;  4ZDP A;  3WGH A;  5JFR A;  3QYB A;  2KRH A;  3HSR A;  4A3K J;  3MMY B;  3JW4 A;  4ZZL A;  2DDA A;  4ITV A;  2MH2 A;  2YUS A;  1FSH A;  4CCJ A;  3KEY A;  3EYI A;  1Z6R A;  5LBQ A;  3OYH A;  1BC7 C;  3K2A A;  2VOP A;  4KFC A;  3DF8 A;  3TL4 X;  5LHG A;  4IHW A;  3BCB A;  3WU0 A;  5H6Q A;  2AS5 F;  3RYR A;  4L5J A;  3TOA A;  1AOY A;  2JQ7 A;  2W82 A;  3HTU A;  2FEZ A;  3IRQ A;  2XAJ A;  3K4C A;  3AFH A;  2NVX J;  1NHA A;  3R6S A;  4XSZ F;  3PQK A;  1QHH D;  1S8N A;  4RAF A;  1T2K A;  2QBY B;  4UVA A;  3FBI B;  3M3Y J;  2OBP A;  1J5Y A;  3U2R A;  1JKP C;  1ZH5 A;  1A36 A;  1LDK B;  2W25 A;  3GTP J;  5D5X B;  2PG4 A;  2QWW A;  4XSX F;  5J1U A;  3BJO A;  4W1U A;  3S3O A;  3RYP A;  4WX9 A;  4M72 A;  4I09 A;  1I27 A;  1ETO A;  4XLH A;  1FYK A;  5JHF A;  2XSD C;  2E2H J;  2QA4 I;  1XDS A;  5K5R A;  3EET A;  2PFB A;  3BTC A;  2LH9 A;  3S93 A;  3OSG A;  2EIL H;  3ZMV A;  5F0H A;  2LY2 A;  3DU6 A;  5FO5 A;  3QPH A;  3BZC A;  1RI7 A;  3K6G A;  1QA6 A;  3EUH A;  2DA2 A;  1STZ A;  4D7M A;  4LMY A;  3CLO A;  2Y2Z A;  4OIP F;  3R61 A;  1RKT A;  3HGG A;  2HVR A;  3I4M J;  2DQR A;  2M4G A;  4S05 A;  1UG2 A;  3DEE A;  2CFX A;  2FML A;  1HCR A;  1HC8 A;  4D5C A;  4LG3 A;  1EKE A;  1Z7U A;  1NK2 P;  4G6D A;  1WZ2 A;  3KET A;  4ZH4 F;  5D5U B;  1PYV A;  1Z3Y A;  4I0B A;  2V1U A;  1QHG A;  4D7N A;  3OIQ A;  3E5U A;  4OIO F;  2LRD A;  1T39 A;  1ZRC A;  1P7J A;  1B8I B;  2W24 A;  2W57 A;  1P7I A;  3GCM A;  1RR7 A;  4ZC3 A;  3TDZ C;  1ZRD A;  6PAX A;  4ANJ A;  1MDM B;  4FHT A;  1R5H A;  2GLO A;  5CYV A;  5KHD A;  2VUM J;  2VL8 A;  4I6Z A;  1R1U A;  3GTQ J;  2R7O A;  1MH4 A;  2GXB A;  2LK2 A;  3H0G J;  4HQE A;  4F7Z A;  2L9V A;  2XAG A;  3ZGK A;  5F04 A;  4XON A;  4Y4R A;  1MBG A;  1V4R A;  2IA2 A;  3K1M A;  1J75 A;  2AO9 A;  4A3L J;  2J5P A;  2LF7 A;  2XRL A;  3W6K B;  3JRA A;  4KIS A;  4X1E A;  4KIC A;  1MW7 A;  5FLM J;  3IUO A;  2DFF A;  3PQJ A;  3DV8 A;  3BRO A;  2XVC A;  2CWE A;  4U0W A;  4IX7 A;  2A05 A;  1D0X A;  2V6E A;  3FXO A;  1ETV A;  5B1A H;  3JTG A;  1PJR A;  2P7V B;  5CKT A;  5AIP A;  3G73 A;  2HDD A;  3QPL A;  3DBL B;  4MFD A;  2HI3 A;  3BG9 A;  3P9I A;  1D0Z A;  2A68 F;  1JGS A;  5K7F A;  2FJ1 A;  5BPD A;  1Z6T A;  1K83 J;  2DMP A;  1YJ9 I;  5LEJ A;  2QQ9 A;  3V7R A;  2MA3 A;  2XKP A;  2HOS A;  1YW9 A;  4PJM A;  2DA5 A;  2CV2 A;  3UKG A;  1ZHF A;  3KEO A;  3KZY A;  3L00 A;  3M8E A;  3S8P A;  1SC7 A;  2R7F A;  3CCJ I;  2E5N A;  4II2 A;  4G8X A;  5IPA A;  2V6C A;  4LK0 F;  2IA0 A;  4YFK F;  2UWM A;  4Q5S F;  3IP4 B;  4NQW A;  3RKY A;  2JWT A;  1GLN A;  1YOV B;  2IS1 A;  4M9X A;  1R71 A;  1W0T A;  4M73 A;  3WG9 A;  1R1V A;  3KFW X;  2JA8 J;  2Z1D A;  5M5Y J;  1E0E A;  3F8B A;  3DFG A;  3A02 A;  3C1D A;  1W5T A;  4ESF A;  1D8J A;  2ZME A;  5B66 C;  1B9M A;  4YIR X;  4QTR A;  3CCQ I;  1S3J A;  2CS3 A;  4RB2 C;  2P81 A;  1Y6I A;  3F6O A;  4X0G A;  1ZR4 A;  2QZ8 A;  2JA2 A;  2E35 A;  3WOD F;  5F1R A;  1Y56 A;  2X4H A;  3K70 C;  1K78 B;  2QCO A;  3S32 A;  5DUI A;  2E1C A;  2CMP A;  2RAE A;  4YIF A;  1NH3 A;  2D45 A;  1ZK8 A;  3OYM A;  2K40 A;  1RUO A;  2VE9 A;  4HV6 A;  2CQN A;  1ON2 A;  5E8I A;  2FUG 2;  4I7H A;  4I01 A;  1BC8 C;  4XOP A;  2WAE A;  4NQW B;  1J9I A;  4CH7 A;  2WC2 A;  1RRJ A;  3DQV C;  2VC1 A;  3JRB A;  4E7S A;  1UB9 A;  3CJN A;  3L2U A;  3BCA A;  5EYR A;  1GVJ A;  4XLF A;  1BJZ A;  2HR3 A;  4CCO A;  3ZMD A;  3KIO A;  1T6S A;  1JTX A;  1N25 A;  2L2O A;  2P6T A;  2VQG A;  2EV6 A;  3OYN A;  4S04 A;  2HEO A;  3C2H A;  1Z7L A;  4BU2 A;  2HYJ A;  2CFO A;  1Y0U A;  2WAQ N;  4A69 C;  1XS9 A;  1OR7 A;  5E3L A;  3OYL A;  4O3M A;  3CUQ B;  3HZJ A;  2V26 A;  5BPI A;  3PFI A;  3TW7 A;  4I02 A;  1A5J A;  2HDW A;  3F72 A;  3FK7 A;  2W00 A;  3MWM A;  1W7P D;  3G6E I;  1IN5 A;  5HLG A;  3I56 I;  3AG3 H;  3B6A A;  2CUE A;  1E3O C;  4GDF A;  2EWN A;  5E1Z B;  4A0X A;  1K61 A;  2Y0S N;  1R9T J;  5ICC A;  5EEG A;  5ICF A;  3BR6 A;  2E71 A;  1MH3 A;  5KNL A;  3FIW A;  4UV8 A;  2M30 A;  2E1M B;  1XGN A;  3VPR A;  4CCM A;  1SD6 A;  2NNY A;  3G1L A;  3V8J A;  4ZYG A;  4ON0 A;  4YFX F;  1LEB A;  2OUM A;  4NBQ A;  2VQH A;  3KE2 A;  4MFE A;  3H5A A;  2AXL A;  2A5Y B;  1FBQ A;  3QOE A;  4IPA A;  2CGP A;  3BC8 A;  5F08 A;  1TP4 A;  1X1C A;  1IG7 A;  2O7O A;  2L9R A;  2CV1 A;  1KU2 A;  2DFI A;  4NC6 A;  2EB7 A;  2FE3 A;  2L7K A;  5EDN A;  2M4K A;  2R4G A;  3OOP A;  4GYI A;  2P5L C;  5HDG A;  3I59 B;  2AHQ A;  2COB A;  3V7S A;  1JKO C;  5K7Z A;  3IRR A;  2K9N A;  1MKM A;  2ID3 A;  1MMS A;  2H1L A;  2A6E F;  1MND A;  1O7L A;  4EMS A;  4H4K C;  2RC4 A;  3HUG A;  1JI8 A;  2LY1 A;  3FMQ A;  2GBY A;  2LRE A;  1QPI A;  3E1S A;  3S1Q J;  2N8G A;  2DYR H;  3L1P A;  2C6Y A;  4U88 A;  1X3Z B;  2XPU A;  4ENN A;  1BIB A;  1U8R A;  4P96 A;  3B6C A;  2FOK A;  2MGQ A;  5ICE A;  4KT5 C;  3TGN A;  2WWY A;  4IRI A;  1KU7 A;  1I6H J;  1P6R A;  4Y3O A;  1APL C;  5FLV A;  1TNS A;  4D9J A;  4JQF A;  3I54 A;  2DA3 A;  2ACJ A;  1O3R A;  1XC5 A;  1XGS A;  3BWG A;  4HX8 A;  4QLC U;  2UZK A;  1T08 B;  3H9J A;  1PP8 F;  2WB1 A;  1W1W E;  1TZL A;  4Y33 A;  1I1S A;  5KCM A;  1WHU A;  1TQP A;  4LB5 A;  3PNY A;  2MW8 A;  1IXR C;  1DGW Y;  3HOY J;  2V7F A;  1YG2 A;  4GFB A;  2OCE A;  3I3L A;  2JVH A;  2CQQ A;  4D5F A;  1YS6 A;  3LSM A;  3A2K A;  2LNB A;  3ZN1 A;  1B59 A;  2KIS A;  2DJI A;  4K2E A;  2WY7 Q;  1R4M B;  4A3D J;  3VYS B;  2V1X A;  2DCE A;  2QLZ A;  3AG1 H;  1IDY A;  3ERM A;  4PGG A;  3WTV C;  3GEZ A;  4L9N A;  4PGH A;  4MEX F;  4YFN F;  1EH7 A;  4A3I J;  1Z9C A;  1W0U A;  4XN3 A;  1UST A;  1D5V A;  1OFC X;  2DOD A;  1D3Y A;  3IH4 A;  1DDN A;  3K1N A;  4LIT A;  2VOO A;  4HAM A;  2WAF A;  2FXA A;  4QPQ A;  4AYB A;  3CD6 I;  1BOB A;  3BG7 A;  4XRF A;  1U6G A;  2ZCW A;  3P9C A;  2JPB A;  4O6J A;  3GME A;  1ETY A;  3JRE A;  3EQL F;  4ENK A;  2GIZ A;  3RQI A;  2ELK A;  3WGG A;  3GX4 X;  2XHK A;  2XB0 X;  2LOO A;  3T8T A;  1FP2 A;  3S14 J;  3I4P A;  2IRF G;  2LR8 A;  1X4P A;  3CDI A;  5CVU A;  3ECH A;  2V1N A;  3CDL A;  4KIG A;  3AG2 H;  1NG6 A;  4C3J J;  2Z99 A;  3OIO A;  3DPU A;  4M9S A;  2BVL A;  1RIO H;  2TDX A;  1S7A A;  3SJM A;  1J0R A;  2V1D A;  4MTE A;  4HBL A;  3TO7 A;  4GYG A;  3LQR A;  4BAC A;  2NOG A;  4WWC A;  3DTE A;  3D0S A;  2UUZ A;  4HDV A;  4AID A;  1E3P A;  2PJR B;  4DQ2 A;  1ZR2 A;  4PJN A;  2G0E A;  3RPU A;  4AVZ A;  1QZE A;  4XOR A;  2QEN A;  2QQA A;  4WF2 A;  3OL3 A;  2FOW A;  4NNJ A;  3CCR I;  2P4W A;  4BE1 A;  2K3P A;  2YX7 A;  2RV8 A;  3RI4 A;  3CC4 I;  3LFU A;  3OV8 A;  1XX5 A;  1IN4 A;  1DUX C;  4C3H J;  1MD0 A;  4N9H A;  1E3H A;  1ONV A;  2DOA A;  3FBN B;  2BXZ A;  4HF0 A;  5FB2 A;  2JUG A;  2KFD A;  2BV6 A;  2CQ7 A;  2Z5U A;  4EJT A;  4LIU A;  5KVR A;  3GF2 A;  2ISY A;  2CUJ A;  4HEA 2;  4NC7 A;  2CO5 A;  4BBR J;  5M5W J;  4AU7 A;  1IV8 A;  2PMZ A;  3CP2 A;  5D6F A;  5HOO A;  1HDD C;  2IJL A;  4CA0 A;  5DDG A;  3V7C A;  1A31 A;  1QNT A;  2QKM B;  2RNG A;  3Q3S A;  2XAF A;  3ZQ7 A;  3BLY A;  3MVP A;  2X9D A;  2LY9 A;  3DTK A;  5H20 A;  3PFY A;  5IOZ A;  5D6E A;  1TBX A;  3EUA A;  1I5Z A;  3I5U A;  3TKY A;  1Z1D A;  2VLA A;  1LQ1 A;  2CUF A;  1RZ4 A;  2NVU B;  4NDL A;  2HDC A;  2F5D A;  4B3A A;  5FLX K;  2DT7 B;  4KJZ A;  2LKS A;  5TJJ A;  4HRI A;  4RAZ A;  3O3K A;  3LFK A;  4YG2 F;  3HXL A;  1PUF B;  3VWB A;  3HSE A;  2JVG A;  3ZQL A;  3MAJ A;  2BY0 A;  2PMU A;  1UJ8 A;  4M6X A;  3R4K A;  1MDM A;  5GPA A;  4A93 J;  1VQ8 I;  1B6A A;  1ZTR A;  2XAQ A;  4EEF G;  3H35 A;  2OAZ A;  3IAM 2;  1DP7 P;  5JVG F;  3PO3 J;  4BJ6 C;  4XL9 A;  1XPX A;  1XCB A;  4BKX A;  2EFW A;  1ZAR A;  1L3L A;  2IVM A;  1N78 A;  4L5I A;  3PNV A;  5JI6 A;  3TP3 A;  2K02 A;  5GP9 A;  4S0H B;  1SEU A;  1OMI A;  2PLY A;  1M1E B;  3S15 J;  2Z3Y A;  4DOZ A;  2M0M A;  3ONQ A;  3CUQ C;  2EH3 A;  3L2C A;  1DGR M;  3TED A;  4ENM A;  4ZTJ A;  3MZH A;  2D5V A;  3KP5 A;  3MFK A;  3RZD J;  3LSJ A;  1YW7 A;  2JUC A;  4HYE A;  2FSW A;  4BE2 A;  2YPR A;  4PZJ A;  4B3X A;  5IP6 A;  2R93 J;  4RLF A;  3C2B A;  3IHU A;  3OS0 A;  3H3Z A;  2L4A A;  3VB2 A;  3ZQH A;  2R5Z A;  1YRN A;  3LOC A;  4C3I J;  4E70 A;  3AL0 B;  3PSI A;  1RC9 A;  2JA6 J;  4E7L A;  3E7L A;  4M3E A;  2XKO A;  2IGN A;  2FF4 A;  1GVD A;  1MMA A;  3A0B C;  1GXQ A;  1K79 A;  2Q2E B;  1IGN A;  4DNC A;  3A4C A;  3C2G A;  4KA4 A;  3VYT B;  2VKE A;  1JHH A;  5EF6 A;  4E7J A;  1YJW I;  2M7B A;  5L3B A;  3Q0V A;  4CZC A;  2ZFW A;  2OV7 A;  2FX0 A;  2HQN A;  2E36 A;  2NOJ B;  1I3A A;  4MEY F;  1O3Q A;  3P7N A;  2EK5 A;  2VPR A;  1N77 A;  1WJD A;  1FBS A;  1FTT A;  4H0E A;  4KDP A;  4XKB A;  1HKQ A;  2VAS A;  3I64 A;  1XN7 A;  2NYX A;  3MZ8 A;  5ED4 A;  2KT0 A;  4DBR A;  2KIQ A;  3ZMZ A;  4U7B A;  3F8F A;  3TDU C;  1XCV A;  3WTZ A;  2R5Z B;  1FYM A;  3BDD A;  1ETK A;  3KYC B;  3FHN A;  2KPM A;  4HSR A;  2ESH A;  5D8K B;  2CSO A;  3I9V 2;  4G94 A;  1GXP A;  2DTR A;  4HF1 A;  2DA4 A;  4FX4 A;  3S1M J;  1U3E M;  4MLO A;  2GOM A;  4XKW A;  1P4X A;  3L9F A;  5DD8 A;  2BY2 A;  2QSG X;  1X58 A;  4IHT A;  1UHM A;  5HNH A;  2DA1 A;  2K27 A;  5D4R A;  3HJE A;  1YRN B;  1HW5 A;  1XMA A;  2NRA C;  2RNJ A;  1DQU A;  2KIF A;  5C4J J;  3S2D J;  5GPC A;  3D5S C;  1FSE A;  3HRM A;  4W97 A;  2DDB A;  4OOI A;  5E8G A;  4Y7N J;  3IC7 A;  4YEJ A;  2GXA A;  3VSL A;  5LHI A;  3QPT A;  2H8R A;  2HVQ A;  3X2Q H;  1G3W A;  1Y8R B;  2IW5 A;  4R1H A;  4RB1 A;  1BJA A;  3CF5 F;  5DCF A;  1U5T C;  2L9N A;  1MBF A;  3MKW B;  4L9J A;  4IVN A;  5E1W A;  3BP8 A;  1W7P A;  2H94 A;  3EUH C;  1ETQ A;  1JKQ C;  1U0J A;  1WJC A;  3FWE A;  4WXH A;  4XM3 A;  3HOS A;  1K4T A;  3WTT C;  4BQA A;  2DOF A;  2UXX A;  4D0P A;  3EYY A;  1U5T A;  1SFX A;  4ZTF A;  1J59 A;  3D1N I;  4ENJ A;  3DP7 A;  5F27 A;  2F6C A;  3W2W A;  4CDG A;  4AM3 A;  2B9S A;  1TT5 B;  4HA8 A;  3WTX C;  4R8H A;  2V9K A;  1QZZ A;  2R3S A;  3CJQ B;  4LG0 A;  4PFO A;  3L2V A;  3D5R C;  2IT0 A;  2F5C A;  3ISP A;  4P55 A;  3H9G A;  5A2Q Z;  4FET A;  4FX0 A;  2IA1 A;  2BHZ A;  1TWH J;  3NAR A;  1SMT A;  1QU3 A;  3DLA A;  3U1D A;  3COA C;  5E17 F;  3Q0U A;  2K7L A;  2VJ5 A;  2AQF A;  2NXN B;  4BXU A;  3NRV A;  2VBW A;  4XKC A;  2XGD A;  5FRN A;  3OYE A;  1G6N A;  1R22 A;  1BI0 A;  2R7Q A;  1KYW A;  3FDY A;  3IKT A;  2R7D A;  3N97 A;  2EZL A;  1FT9 A;  4CHU A;  4LLG F;  4C9Y A;  3S2W A;  5L3F A;  1U5T B;  4ESB A;  4EGZ A;  2BVM A;  1Y1V J;  4Q4Z F;  5BOX A;  2DBB A;  2VBY A;  2WBM A;  3HYI A;  2DK5 A;  2LDU A;  3KPH A;  1VQO I;  4A3G J;  3TQN A;  1FLI A;  3PIO F;  3E3V A;  3K4J A;  1S5L C;  2W1O A;  3MCZ A;  5HLI A;  1XMX A;  2ME0 A;  3ZQI A;  1ZG1 A;  1P92 A;  5GAG J;  1K7A A;  4FT8 A;  4HV5 A;  3BTL A;  5E20 A;  3LA2 A;  2JA7 J;  1SFE A;  3CJR B;  1SAN A;  2NVY J;  4GCV A;  4I99 C;  1ULY A;  2EZH A;  4B47 A;  2HXI A;  2X6X A;  2KIM A;  3WTU C;  3GYH X;  4F91 B;  1IRG A;  3HRU A;  4C2M J;  5HS8 A;  1XD7 A;  1XSD A;  3HOV J;  1USS A;  1QBJ A;  2VXZ A;  3CCM I;  5JLW A;  3QP5 A;  2Y75 A;  4L5E A;  4EM0 B;  3HG9 A;  4D1Q A;  1PP7 U;  3IWF A;  3RTR A;  1I50 J;  3J7Y J;  3WU1 B;  1TNT A;  2FBI A;  2A61 A;  2V9P A;  3KZI C;  2I10 A;  1AU7 A;  4PJL A;  2QBY A;  4ABZ A;  4A6E A;  2DFE A;  3IWZ A;  4FCY A;  1WJ5 A;  2M9H A;  2WY8 Q;  2W85 A;  2M1B A;  3ULQ B;  3VSK A;  1G3S A;  1R7J A;  2VQC A;  5M3M J;  3J7Z I;  2EA2 A;  2V4J C;  2HFH A;  2H6B A;  4A5N A;  2O5R A;  2E7X A;  3QYE A;  4PSX A;  1TLH B;  2OPT A;  1HBX G;  4P9U A;  1JT6 A;  1OYY A;  3JRH A;  1HQC A;  3G3Z A;  3RCO A;  2YU9 J;  1JUS A;  2HTS A;  4AC0 A;  1OCR H;  4RB3 C;  2LLK A;  4L9V A;  2NVT J;  3J7A O;  2DMT A;  3D5L A;  3FXM A;  5IYB J;  1VQ9 I;  4G12 A;  3L2W A;  2VON A;  1VF9 A;  5FRM A;  4E7Z A;  4AWX B;  4L0Y B;  1WVR A;  2R92 J;  4IQJ A;  4IOA F;  1BA5 A;  1T0F A;  1IDZ A;  4XLA A;  1JGG A;  2CRG A;  3V8K A;  3BQZ A;  3J80 K;  3KP7 A;  2IGO A;  3CMY A;  2O03 A;  1YTY A;  3A01 B;  3FMS A;  4HNU A;  3DPT A;  3CME I;  1XTA A;  2BY1 A;  1YO5 C;  3WHB A;  2E2J J;  1U8B A;  3GTL J;  5TIS C;  4ETS A;  3C18 A;  3SEZ A;  4BS9 A;  4OMZ A;  2VJI A;  1LVA A;  4M6Y A;  1DU6 A;  2CH0 A;  2JMW A;  3SYT A;  5J8F A;  3N05 A;  2BYV E;  2KLO A;  4AUX A;  3ZRG A;  2VT3 A;  1WI9 A;  3GTO J;  3H3V K;  2FQ3 A;  3HRT A;  2ZME C;  5L3D A;  4E7K A;  4YII A;  2X48 A;  2VT2 A;  3Q9V A;  3OSF A;  2O0Y A;  3OYJ A;  3VYR B;  4OIN F;  2GA1 A;  5CLS A;  5IY5 H;  5FKO A;  1FY7 A;  3PUB A;  4GXO A;  4LLN A;  3CJT B;  1EA3 A;  1X2M A;  1PUF A;  1LDJ A;  2L7Z A;  2FA5 A;  3F21 A;  5FLX Z;  4IRG A;  4ESJ A;  1PDN C;  4RGU A;  1FOK A;  3K4L A;  3HOT A;  3SDB A;  1RUN A;  3KYD B;  3T8R A;  4U7D A;  3E5X A;  4GGG A;  3I55 I;  2HNH A;  1IV6 A;  2F48 A;  2K4B A;  4V2F A;  5IT9 K;  3QAH A;  1U78 A;  3P9K A;  2HVS A;  1R00 A;  1X19 A;  4N4O B;  5JLX A;  1Z21 A;  3FXL A;  3IH3 A;  5CVJ A;  3V8L A;  1P9Q C;  2BZT A;  1WPK A;  1HA8 A;  5EG0 A;  2ESN A;  4CCK A;  4UUV A;  3REO A;  3R0J A;  1PVE A;  5JR3 A;  4G6T B;  2VC0 A;  5D8L B;  2LP0 A;  3FXJ A;  4XOT A;  1Q1H A;  3LMM A;  4RDU A;  3F3X A;  4B44 A;  4J00 A;  4M3G A;  3TMO A;  4BBS J;  4Z6Y A;  3ZXS A;  3JRD A;  4EVI A;  4HLX A;  9ANT A;  2JN6 A;  3HKZ N;  3K69 A;  3P5J A;  3BJA A;  3HGY A;  2D1V A;  3HB9 A;  3I58 A;  2DQL A;  3CCY A;  3RSN A;  1CF7 A;  2EZK A;  3OYD A;  1ZQ3 P;  2ZXW H;  4HST A;  1XB4 A;  1I6X A;  4DYQ A;  3K9T A;  3QYF A;  3I53 A;  2EV0 A;  1ZKG A;  3OWT A;  1FYL A;  1A04 A;  4WXD A;  4V19 K;  1SD4 A;  5HOD A;  1ODD A;  4BEH A;  1ETW A;  1K6O A;  3KLO A;  2XGC A;  1ZRE A;  1FBU A;  4LD5 A;  2HGC A;  3ASN H;  2DTZ A;  3OS1 A;  2DMQ A;  3GLX A;  2H8W A;  1EH8 A;  2OD5 A;  4DW6 A;  2LG4 A;  2J5O A;  5A2Q K;  1WH5 A;  4U87 A;  5LGT A;  5D5W B;  1D0Y A;  1Z0X A;  4DBQ A;  3A01 A;  3MEX A;  4PFP A;  3OYA A;  4WXC A;  5FRO A;  2QM3 A;  1TW2 A;  1IF1 A;  1H89 C;  1H0M A;  1R49 A;  2CJJ A;  4MGR A;  4E4H A;  2M0C A;  1BBY A;  2Y30 A;  1D1C A;  1VZ0 A;  3JAM K;  3CCU I;  2OQG A;  5IT3 A;  2FNA A;  1AKH A;  4CUG A;  2RVC A;  1MNM C;  5ICG A;  2R7R A;  3FM3 A;  3IV5 A;  2V9V A;  2EZI A;  2TRT A;  3K2Z A;  4BNC A;  3GXO A;  4M6V A;  5DCM A;  2JT1 A;  5J40 A;  1AWC A;  5FGM A;  2DA6 A;  2QGU A;  1MZB A;  4BUP A;  3CO7 C;  4A6D A;  2O8X A;  3BPV A;  2L7F P;  2K9S A;  4QPO A;  1VQL I;  1FX7 A;  1KZH A;  1ETX A;  1SFO J;  4OMY A;  4IHY A;  2L5Q A;  1W36 C;  2L4M A;  4LFU A;  2JSC A;  2Z16 A;  1ACI A;  3IL2 A;  1QRY A;  2UXN A;  1LE8 B;  4B43 A;  3E6D A;  3W2V A;  3CLQ A;  1I39 A;  3TO6 A;  3SHF A;  3A0H C;  1K6Y A;  3NWS A;  1MNE A;  2CW0 F;  5JHU A;  3ZP5 A;  2ELJ A;  3OOU A;  1EF4 A;  2M45 A;  4G7H F;  2BE5 F;  4RBO A;  2ZO4 A;  3JRC A;  3EDP A;  2VI6 A;  1R36 A;  5DTD A;  1OCC H;  5CVV A;  5EZG A;  1R4N B;  4BY7 J;  5J4V A;  5FFZ A;  4BL0 B;  2HYG D;  5CQE A;  4DYR A;  1ZLJ A;  2E7W A;  1S72 I;  3HOX J;  1L0O C;  2OTL I;  2EFP A;  2VJ4 A;  4ASN A;  1UZC A;  4E6K G;  3LSH A;  3GTK J;  1EV7 A;  2STW A;  2KIU A;  2LMD A;  5DM6 F;  2K85 A;  4DIQ A;  5E3M A;  4J19 A;  2PJR A;  3B73 A;  2O8K A;  2V79 A;  3BT9 A;  2X85 A;  2G7U A;  1IAW A;  1QQI A;  1IXS B;  5KK1 A;  2O9L A;  4MO7 A;  3OL4 A;  2JSP A;  2HWV A;  3CO6 C;  2OF7 A;  3CP8 A;  4RAY A;  3LWF A;  2JA5 J;  4UY8 I;  4AIJ A;  2WV1 A;  1AA7 A;  4RB0 A;  2Y9Y A;  3BTI A;  2MFZ A;  3GFM A;  3J80 Z;  1XMK A;  3DEW A;  4FTH A;  2EJR A;  3B02 A;  1YE9 A;  4EJO A;  1LVK A;  3DKY A;  3J81 K;  3PIP F;  2Y69 H;  2VB6 A;  2DW4 A;  2P6S A;  1YIT I;  2M87 A;  3DLL F;  1LEA A;  1WJA A;  2O61 A;  4EJU A;  5LGU A;  2ZSI B;  5B3S H;  1R1T A;  3MD2 A;  4XLP F;  1X1A A;  2OJE D;  1R58 A;  1UFM A;  4N0B A;  4KIT B;  4UUS A;  2EBI A;  2XPV A;  2XAH A;  4HG2 A;  4M3F A;  4RGS A;  5BNG A;  5BS6 A;  2JZY A;  3CES A;  2EIJ H;  5E79 C;  2RGV A;  2FBK A;  1TWA J;  1OJL A;  2M34 A;  3R0A A;  3ZPL A;  2KMU A;  2CV0 A;  4IZZ A;  2L0K A;  2Z33 A;  3GVA A;  3K4K A;  2EFO A;  3LSG A;  2Y0M A;  4BHB A;  3VFZ A;  4A2U A;  2WAQ A;  2CYY A;  1FOX A;  1YIJ I;  1F4K A;  3FKI J;  4IQ4 A;  2F5E A;  1ENH A;  4BAY A;  3BR2 A;  1D1B A;  4FAS D;  1BW5 A;  2P5K A;  1BI2 A;  4UUS B;  2GAU A;  3BR0 A;  3RQ4 A;  3S1N J;  2JTV A;  3GFI A;  1F5T A;  3ZQG A;  4HZF A;  1F9N A;  2ADU A;  1V5E A;  2CUZ A;  4BYY A;  2Y31 A;  1WCM J;  4BQQ A;  1B8I A;  2P0W A;  2R5Y A;  1SVM A;  3WG7 H;  2D2W A;  4ZDL A;  1HDP A;  4LJZ F;  1YS7 A;  4QWQ A;  4DJA A;  2DYS H;  4HX4 A;  2XDV A;  2X6O A;  1VQ4 I;  1ZRF A;  2MD0 A;  2HKO A;  2H09 A;  4DZJ A;  1BR1 A;  2F2E A;  4BHC A;  1X2N A;  4BDZ A;  3KCC A;  4MHG A;  5M5X J;  3BG6 A;  3CQZ J;  4Y15 A;  4IO9 F;  1KU9 A;  2ZXJ A;  3BY6 A;  4L18 B;  1B4A A;  1ZGW A;  2NAZ A;  3CUQ A;  1LKX A;  4UB8 C;  2OC6 A;  2R7U A;  5C44 J;  2A07 F;  3DEU A;  3MKY B;  5J1Y A;  3QU3 A;  3AG4 H;  1QVT A;  1HW2 A;  2IPQ X;  2BW3 A;  2XGE A;  4TV7 A;  2HOE A;  4Y17 A;  1IJW C;  3RKW A;  3G1O A;  3VDX A;  1YIO A;  3BZ6 A;  5B1B H;  4B8X A;  1CGP A;  1OKR A;  3CMA I;  3M1E A;  1W5S A;  4XLC A;  5DCM B;  4A5M A;  5IP9 J;  4Q48 A;  3LAP A;  5HDN A;  2XF6 A;  1OQY A;  3KP3 A;  1BM9 A;  4V2G A;  2KKO A;  2WV0 A;  3OR2 C;  4MTD A;  2ZNZ A;  3LSP A;  2LC2 A;  1OCO H;  2CQX A;  5CVI A;  2F5V A;  3H3U A;  1JJ6 C;  1DU0 A;  4NHJ A;  1JE8 A;  1OLT A;  4HOB A;  2KJC A;  3BPX A;  1RET A;  1P4W A;  3AL0 C;  4EAT A;  2K86 A;  4DYC A;  3CTA A;  3WE3 A;  3LA7 A;  5F0C A;  4P9F A;  1JKR C;  2LTP A;  3OYB A;  2YSR A;  3HHH A;  2NS8 A;  1KQ8 A;  1Y0N A;  2M7A A;  3JTH A;  4I0A A;  4XLN F;  4IOC F;  2OCC H;  1FOY A;  5D5V B;  2ZJR F;  3LNQ A;  3O6B B;  3GUD A;  3OYI A;  1FMW A;  4ZYH A;  1ZN2 A;  3KP4 A;  1LFU P;  4AYB N;  2ZJP F;  1R23 A;  3E6B A;  2ECC A;  4LK1 F;  5DUK A;  2KL4 A;  4PSW A;  3GWZ A;  1LFB A;  2AXT C;  1VQN I;  4CXF A;  3GZN B;  2ECB A;  3FXQ A;  5H6R A;  4FQG A;  4BQO A;  3RPQ A;  3HOU J;  2DMN A;  2Z9O A;  1K4S A;  3WTW C;  1TW3 A;  2M8E A;  4BXX J;  2DN0 A;  4A3B J;  2QYO A;  2WTE A;  1G8X A;  3HC7 A;  5HS9 A;  1ON1 A;  4DZP A;  1V3F A;  4XRM A;  1TL8 A;  1ZEL A;  1TWF J;  4PUS A;  4KYW A;  2VIX A;  3GLL A;  1XG1 A;  3H1C A;  3I59 A;  4IJA A;  4XR6 A;  3LSI A;  4A3M J;  3VYU B;  4JP0 A;  4KN4 X;  3HPG A;  2DAO A;  2EFQ A;  3S3M A;  2IXS A;  2OZ6 A;  2P7C B;  3UNG C;  1G59 A;  4DGW B;  2EIK H;  1T56 A;  2CU7 A;  5LEK A;  3MKL A;  1HOM A;  3HIF A;  1O7F A;  2LKX A;  1D5Y A;  3PM1 A;  2LYC A;  2ZXH A;  1Q1V A;  2FU4 A;  1OCZ H;  2A3S A;  2QQ8 A;  4IHX A;  2A6H F;  3NAU A;  4CYD A;  1F43 A;  2X51 A;  2IP2 A;  4LG0 B;  1X1D A;  2R7X A;  3GTG J;  2LFB A;  2YX4 A;  1JJ8 C;  2EV5 A;  3KP6 A;  4RA2 A;  2MC3 A;  5FKN A;  2VQL A;  1IXC A;  1UHW A;  2WAD A;  3SXY A;  3CCV I;  1Y39 A;  1N75 A;  1HST A;  1V5F A;  3QOD A;  1V5G A;  3SQN A;  1CF7 B;  1A35 A;  2E34 A;  3EPZ A;  2X6W A;  2VPL A;  2BGC A;  2DPD A;  1BR2 A;  3OYF A;  2DXI A;  1IUY A;  1OPC A;  3OYG A;  4BE0 A;  1FIA A;  4CGZ A;  3S3N A;  3QOP A;  4M71 A;  4MQV A;  4I98 B;  1HSJ A;  1QGP A;  4BH9 A;  5J4Y A;  4PJ0 C;  2CW8 A;  3NEU A;  4CO8 A;  1G4D A;  3FX3 A;  2GWR A;  2RDP A;  1ZG3 A;  5E18 F;  2VBX A;  2O6G E;  4JBA A;  1BW6 A;  2P8T A;  3DBR B;  5GTI C;  1MGT A;  5EG0 B;  2HU9 A;  1BI3 A;  4OIR F;  1QVU A;  5DD4 A;  2GZW A;  1IZ1 A;  1BR4 A;  3FXK A;  3U9G A;  2QEX I;  4IKF A;  5LHH A;  2LF8 A;  5J3L A;  1SVL A;  3SZP A;  1GDT A;  3CDH A;  2K9M A;  2HQR A;  1TWC J;  1R6R A;  4UV9 A;  4NB5 A;  3ASO H;  2FNP A;  1NTC A;  5IOY A;  2R0Q C;  1WJB A;  2EPF A;  2PMH A;  2A69 F;  4XID A;  3SZG A;  1FNN A;  1MJA A;  3JAM Z;  1Z05 A;  1UHS A;  4OAZ A;  4M3B A;  2QKL B;  5LLQ A;  3GFL A;  3M8J A;  1X3U A;  1UG0 A;  3RKX A;  1VQM I;  4KUM A;  3OMY A;  4ZJZ A;  2BOL A;  2IS2 A;  2ZC2 A;  3CF2 A;  3L2Q A;  2MYS A;  1VQ6 I;  3H92 A;  3RPU D;  2RQP A;  3DU5 A;  3LSR A;  4CSW A;  3UR3 C;  1VFC A;  1WI3 A;  3FXR A;  4F92 B;  3HDD A;  2ELH A;  3AAF A;  4OU0 A;  2G7H A;  1SAX A;  2LKP A;  3DCF A;  3E6M A;  1T98 A;  1UAA A;  1HKT A;  3TOB A;  4OAY A;  2MBF A;  4PJJ A;  4CCN A;  3DTI A;  4XN0 A;  3HTS B;  3W2A A;  3PL8 A;  4F55 A;  3R60 A;  1J09 A;  3H5R A;  2DK8 A;  3H5N A;  1H9T A;  1YX3 A;  1JUP A;  4XKV A;  2MSY A;  1SAU A;  5HLH A;  5E1X A;  1UEL B;  1T38 A;  3SDG A;  5EZH A;  3ZMT A;  2W48 A;  3KLN A;  4PDK A;  3T5X A;  3FXU A;  5TRD A;  1ZG5 A;  4KNY A;  3QPS A;  1REP C;  3GZ5 A;  3F22 A;  3G71 I;  4UNO A;  2Z2S B;  1IW7 F;  4CIC A;  2OU2 A;  4HQM A;  4MNU A;  2LBF B;  3RDI A;  3TW6 A;  3S1R J;  1VQ7 I;  5DEQ A;  3BOQ A;  2XAS A;  4B4C A;  2DFH A;  3GTJ J;  2Y9Z A;  3BZK A;  1TWG J;  3IH2 A;  1YFH A;  3E0J B;  2ME6 A;  2EA4 A;  2VKD A;  1YI2 I;  3K0L A;  4F93 B;  2A6T A;  4HX7 A;  3PO2 J;  1T8I A;  1KYZ A;  2VJJ A;  3ABM H;  4CYC A;  1GV5 A;  1KQ0 A;  1SVO A;  4JX4 A;  5EGO A;  2E2I J;  2ZXI A;  1RR8 C;  4NC8 A;  2ZJ2 A;  2MG4 A;  1IRZ A;  2F5F A;  2G9W A;  5DYM A;  1C0W A;  4CYC B;  3I0T A;  1FP1 D;  4XQF A;  4XBF A;  2B7E A;  1ZGJ A;  3ELK A;  3IAS 2;  1RNL A;  2FD5 A;  1DPR A;  1O3T A;  3M8F A;  3E6C C;  1ERD A;  3BR5 A;  4RAG A; 
#chains in the Genus database with same CATH homology
 1X3Z B;  3ESW B;  2QSG X;  1PVE A;  2F4O B;  2QSH X;  2QSF X;  1QZE A;  1TP4 A;  4YIR X;  1X3W B;  1OQY A;  2F4M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...