1X3ZB

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
b'GSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide: N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1x3zB01
2QSFX 1PVEA 3ESWB 1TP4A 1X3ZB 1OQYA 4YIRX 1QZEA 1X3WB 2F4MB 2QSGX 2QSHX 2F4OB
chains in the Genus database with same CATH superfamily
2YS9A 4BEHB 1W36D 4LLLA 1ZKGA 2DT7B 3EUAA 4WXDA 5CPRB 2V9KA 2GIZA 4BY7J 2MYSA 4CA0A 2FOKA 3IAM2 5F0HA 4G6DA 3DEUA 4MEXF 4RB0A 1KGSA 1JUSA 2H6CA 3MN2A 5KK1A 4L0ZB 1SVOA 2CU7A 3GLXA 2ACJA 3S2WA 2N8GA 1RUNA 1ZAOA 4RAGA 5GAEJ 1RESA 4PUSA 2X9DA 4DW6A 1IUFA 4XNFA 1OFCX 2XB0X 2Y0SN 2DT5A 3NEUA 2XDVA 1P4AA 2W4SA 3G1LA 1FMVA 2RGVA 3KP6A 2H6BA 3W2WA 2IGNA 3FXLA 3CDLA 2EZKA 1V3FA 2P81A 3CMEI 2J5PA 1KU2A 3V7RA 1ETXA 5IT9Z 1MBFA 4A3LJ 4NQWB 3DXJF 4H4KC 4KJZA 3L1PA 3F22A 5TISC 3CUOA 3BWGA 1HKQA 3QYEA 3GW2A 3ZMSA 2LOOA 1XSVA 2Z99A 4BBRJ 2MC3A 5BQTA 1MBEA 2DA7A 3DU5A 4IHWA 1DU6A 4CCJA 1MBGA 2KZGA 3E6BA 5HS8A 1BR1A 3CC7I 2EIKH 3BCBA 3OOPA 2HOAA 5EG0A 1WJDA 2KT0A 3TO6A 2F4OB 1H0MA 4IL6C 1B8IA 5EEAA 1LVKA 4E7SA 4C2MJ 1OMIA 1HKSA 5LHHA 1BL0A 2KQRA 1HA8A 1OR7C 2JPCA 1DGRM 4ZDOA 1XGMA 1R4MB 4PJNA 3N4MA 5DM7F 2H27A 5KCMA 1R71A 5FLXK 1RI7A 4CZZA 1N25A 1IJWC 4HEA2 5IPAA 3HRSA 5KVRA 3IUOA 5FD5A 2LSOA 4KITB 3M1CA 4OIRF 4A2UA 3LSTA 4HX7A 2P0WA 1EJ9A 2KISA 4A3FJ 1FX7A 2PJRA 2XV4S 4I02A 3WGHA 2P5KA 4UXNA 1ZRDA 4ASNA 4RS8A 2XRNA 3NWTA 4KISA 3A03A 1SMTA 4I0BA 1YRNB 2BVMA 4BXXJ 1SFOJ 5E3MA 2ZNYA 1Z9CA 1TP4A 2HKOA 2VOPA 1VQOI 2CUZA 3RKWA 2NNNA 3I4PA 2IS2A 4P1WA 1N75A 1XS9A 3S3OA 4XSZF 1ZGJA 3KLNA 5HODA 2L9VA 3JSPA 3IL2A 2LVSA 1KYWA 4DQ2A 1HSTA 4RB1A 3QPTA 3GZ6A 2M3AA 1YX5A 3C18A 1I39A 3OYKA 4M72A 4RGSA 4R8HA 4NC7A 3E5UA 4GCVA 2W7NA 5D5VB 2CW7A 2E19A 2JVHA 3CUQC 3BG6A 1IGNA 5FLXZ 4CH7A 3R4KA 1WI9A 1Z67A 4CCMA 4KFCA 5E1WA 5JR3A 1Z6TA 3WTXC 5F0FA 1K4SA 2I8DA 3A2KA 2A69F 4RGXA 1ZTRA 2FQ4A 2VLAA 1B72B 2FBIA 1SC7A 4CCLA 2BHYA 1FNNA 1UHSA 4ENKA 3AG3H 1PUFA 1XSDA 2IXSA 3WU0A 2EH3A 4FISA 2MSYA 2F5VA 2QEXI 4MGRA 4QPQA 2DXIA 2L3DA 3SZPA 1S8NA 3HPGA 4EJWA 1UB9A 2XGXA 4XKBA 3WTUC 3E6DA 3A01A 2KIUA 4YIIA 3VWBA 2KZVA 5DCMB 4D0PA 1IN4A 1IRXA 4II3A 3M8FA 3TBIA 4BAYA 2EA4A 2LYCA 4ZZDA 3MZHA 1Z05A 3S3MA 3OV8A 5FKMA 4XQFA 3LFKA 3I5UA 2O8XA 3ULQB 2WAQN 1OYWA 2ZXJA 1H88C 2V1NA 2UXXA 3ZMVA 2PMHA 4M9ZA 4I0AA 2KIQA 5HOOA 4M74A 3HM5A 2NVTJ 3F8CA 4MNUA 1X1CA 3S2DJ 3CDIA 5FRNA 3AG1H 2XGDA 3L9FA 5K1YA 1WJEA 3M8EA 3MAJA 2DPUA 5CJ9A 3EETA 3FBNB 5KAFC 2O6GE 3OYFA 1T33A 5ERIA 2HVSA 3ZRGA 1VQ6I 2DOEA 2UUZA 1G6NA 1RC9A 3BR3A 1JT6A 3QODA 4HW0A 4XKWA 2VXDA 1LB2A 5LRSA 1YFHA 3KP7A 2L01A 2DI3A 4CXFA 1GUUA 3E5XA 3MEXA 4YFKF 4IRIA 3CCEI 1HKTA 1VZ0A 3TO9A 4EJVA 3K1MA 5IT3A 1DGWY 3QU3A 2CUEA 3IKTA 3G71I 4IOCF 2JSCA 3MWMA 4YFNF 3VB2A 3QPHA 1WZ2A 4A3JJ 3ECHA 3T8TA 2QBYA 1ETYA 4A3GJ 1MKMA 5B5EC 2YR2A 1T6SA 2DJNA 1E3HA 1OLTA 2M0MA 5HLGA 3N97A 3GTJJ 4B3XA 1LE8A 4ETSA 5F64A 2E36A 3CMYA 5M5XJ 3ABKH 3BR6A 1VF9A 3SZGA 4A0XA 2F5CA 4RAYA 4RGRA 4UVCA 3K4NA 2NRAC 3GVAA 5L3FA 1RUOA 2LKSA 3T5XA 3IRQA 5FKNA 3BDDA 1Q1HA 4BS9A 1YOVB 1I1GA 3VOEA 3X2QH 1WH5A 1AKHB 1JTYA 3EYIA 2EZHA 2QYOA 1A6IA 1ETVA 3J80K 4OIQF 1T0FC 2VJ5A 2ZJQF 3OSGA 3HRTA 4JP0A 3J7ZI 4EVIA 2V1UA 2WC2A 1BW6A 3GFJA 2DJIA 1YHQI 3GTQJ 2OV7A 3JRBA 2GXAA 4A93J 1YE9A 4EV0A 1BI1A 5BMZA 4RM3A 3ZOBA 5ICFA 4DBRA 4BHPA 3AFHA 4FASD 3A1YA 3K10A 2PBIA 4ZH4F 1CQTA 4NDLA 2J5OA 2BW3B 1G4DA 2TCTA 2LP0A 2A6TA 3DKWA 1DP7P 2IPQX 2R3SA 4JOMA 3FF5A 2HXOA 3RJPA 5HNHA 1Y1WJ 1ON1A 3P9KA 2KDOA 1J9IA 1JGGA 2G0EA 3KP5A 1WVRA 5BOXA 1X2MA 1W4MA 3BG3A 3E97A 4P55A 2FBKA 4HLXA 2LY9A 3RKXA 1LEAA 4OWRB 3J80Z 2DA2A 2E5NA 4XKCA 2YU3A 1RR7A 1MJBA 4HBLA 4N4OB 5EGOB 1HW1A 1O7LA 2R5ZB 1KZHA 5K7HA 4X1EA 1YLFA 3JRFA 1I6XA 3FZVA 3QAHA 4M73A 3IAS2 2ZSHB 1ZGWA 1Z77A 3E0JB 1IN6A 4Q4ZF 4I76A 1TNSA 1K83J 2WY7Q 1N78A 2RREA 3OL4A 4BGDA 3BY6A 2FF4A 2BY2A 4M6YA 1T2KA 4XICA 2OA4A 1MH4A 2ZFUA 2NXNB 1MMSA 1XSXA 2VODA 4DYRA 3L7WA 3CUQB 2WADA 2Z9OA 3PUFA 3RQIA 3KIOA 4IF4A 3VODA 5E18F 1U9NA 1BI3A 2I10A 5CQEA 2V1XA 1XTAA 3HHHA 3KYLA 2GOXB 1GT0C 3ABUA 4N0BA 4IHXA 2EFWA 3BJ6A 2HDDA 1Y6IA 2H1LA 2KJBA 4HNUA 3SZTA 5E1XA 4FE7A 3P9IA 4OMYA 1NG7A 2JMWA 1E17A 4ZYAA 4R1HA 3F8MA 3QU6A 1LPQA 3GFLA 4D9JA 1FYLA 1W5TA 3GXOA 2VQHA 4UB6C 1A5JA 3OY9A 3PIPF 4L9VA 3G1OA 5F0CA 2DMNA 1S29A 2F5DA 2ISYA 1FP1D 2ZJ2A 2HZDA 3DPUA 3BT9A 3DTIA 3TKYA 2IS1A 1ETWA 2FU4A 4CO8A 2K86A 3DEEA 1P9QC 2KLOA 4GDFA 2K3FA 3BZKA 2EINH 5HLHA 1WJCA 2VI6A 5E3NA 1I6HJ 4KUMA 4ZC3A 3RCOA 3OS0A 3D5RC 2LMDA 1FTTA 2DTRA 4PFOA 3G2BA 1TWHJ 1LNWA 1ZHFA 2P7VB 1ODDA 2L9RA 3WGGA 5EF6A 1X4PA 5TRDA 2R5YA 4RLFA 2P6SA 3FMRA 3SQNA 3KCCA 3S15J 1UCRA 1Y0NA 3QYBA 5GAHJ 3F6OA 4GO1A 3WHCA 4XLNF 1SANA 4DOZA 1FPQA 1QU3A 3OYNA 1L3LA 1M1EB 3PSFA 4LG0A 2GLOA 3BTJA 2TDXA 5D4SA 1W1WE 3EDPA 4J00A 1YJWI 2CRGA 5ICEA 3L2UA 4FQGA 1TL8A 4UVBA 2VPLA 3ABLH 1ITYA 1D8KA 1QNTA 1KU3A 1QO0D 2ECBA 2E34A 1IC8A 3KYCB 3ZGKA 4KNYA 4Y15A 4FT8A 2LF8A 1XG1A 4XLCA 2FD5A 4NBQA 2OUMA 2X1DA 1YI2I 1X1DA 2R7WA 2O61A 3GTLJ 4PSXA 1MDMB 3WTSC 4DYQA 2Y2ZA 1X3WB 1GHCA 3WTYC 1JE8A 1LQ1A 2R7DA 3GF2A 1BOBA 2GA2A 4ZDLA 3CQZJ 2B9SA 2JA5J 2IS6A 2A5WA 1TT5B 1LUJB 3ZQGA 1XDSA 3K4KA 1JUMA 2PQ8A 2QQBA 4AM3A 2AQEA 2AXLA 4ZYEA 2LY1A 4JX4A 5DUKA 5JHUA 2IA2A 1SFKA 3HOVJ 3TO7A 1AOYA 4LIVA 1KA8A 3ESWB 3DF8A 5JI6A 4EGZA 5D4RA 4IPAA 4XK4A 1VFCA 1BIBA 4ENJA 2CYYA 5H20A 1DU0A 2IGKA 4DIQA 1BA5A 1R9TJ 1YITI 1QBJA 4BJTA 1RPWA 1U78A 3PSIA 5FGMA 3I53A 4S0HB 3ISPA 3IWZA 1FOKA 2NAZA 1MNDA 2XSDC 4CYCA 1VQLI 5J40A 2HZTA 1I27A 2ETHA 2V7FA 3KE2A 3RYRA 1R1TA 4M3FA 2C6YA 2ECCA 1B59A 2EFQA 2D5VA 3J7AO 1GDTA 4C30A 2R92J 3CP2A 4BJ5C 3U1KA 3M9AA 3GZ5A 1S5LC 2Z3YA 2V9PA 1LFBA 1VQPI 4UB8C 1JJ8C 4ENMA 1Y0UA 1G59A 4IRHA 3CO6C 1DDNA 4Y52J 4P9UA 2R7FA 3NRVA 2EJRA 4IQJA 4NNJA 1JUPA 4YIRX 2DA1A 3ZN0A 4BQOA 5C4JJ 1KQ9A 2DCEA 4MTEA 3OYGA 3BQYA 4HQEA 2M7BA 4BHBA 4OIOF 1R7JA 5IY5H 1QZZA 2X1CA 1QQIA 2WV1A 5CVJA 4Y7NJ 3HSRA 3H5RA 3AAFA 5EYRA 1IUYA 4D7MA 4B4CA 3JRCA 1IAWA 5HS9A 5B1BH 3VFZA 3HGYA 2XPWA 5EEHA 5IYDJ 1XB4A 1KYZA 4LITA 3HPHA 3ZQ7A 2DU9A 2GBYA 3HOUJ 3C3WA 3BJAA 1PP8F 3G6EI 1Z3XA 4L9TA 1MH3A 1FBUA 1TWAJ 4DYCA 4BKXA 3K4BA 1PDNC 1EV7A 1O3TA 1J5YA 1TBXA 5AIPA 2KRHA 3GWZA 3FISA 2B7EA 1P6RA 4M9XA 4KICA 2XAUA 2YPRA 4LFUA 3L09A 3ABTA 3VYSB 1BIAA 5F1JA 3HC7A 4S04A 3JCUC 4WXHA 4ZJZA 1MSFC 1D3YA 3L2WA 4LGWA 3H0DA 3WE2A 1WI3A 4EEFG 3HKZA 2OTLI 1VQMI 3FXQA 1R5ID 2JK3A 1ZLKA 3ABMH 1EKEA 3I4NJ 1ETQA 1KONA 1IV6A 3FXMA 1SFUA 2KIMA 4UV8A 1Z1DA 4I7HA 4Z2YA 3CC2I 3KLOA 5D5XB 1A35A 2DLLA 4G7ZF 3CJRB 2NOGA 3DBLB 3I64A 1X1AA 1XGOA 3QWLA 2HTJA 3ZXSA 4FX4A 2VKDA 3I3LA 3M4OJ 4Q5SF 2XGEA 5JVGF 3BOQA 3EUKL 2IAIA 1LFPA 3DPTA 3BTCA 4L5IA 1Y39A 4HF2A 3LL7A 1YIJI 4WCGA 2VIXA 4V2FA 1O4XA 2RV8A 1D1CA 4BE0A 9ANTA 1Y8QB 5CKTA 1FT9A 2IT0A 3PNVA 2O7OA 3RPQA 1O7FA 4LG3A 1H9GA 2EA2A 2OQRA 2Y9YA 3C2BA 3KEQA 2PEXA 2VKHA 3V42A 4DGWB 3WG7H 5C44J 2M34A 5CVIA 4AIKA 3PQJA 3F9KA 4MFDA 3QRFF 5LGUA 4FX0A 5E8IA 3OYDA 1NHAA 2BXZA 3GEZA 4YRVA 2IP2A 2UV1A 1T38A 1FBSA 2XF7A 4OINF 3RQ4A 4U87A 1B6AA 1FWZA 2O9LA 3PFYA 1QRYA 2DQRA 1QVUA 3FXRA 4PGGA 3JRDA 1S7AA 1F43A 1WJ5A 5EZGA 2QGUA 2OD5A 3ERMA 2AS5F 4MLOA 5E20A 1MMNA 3BJOA 1FP2A 5HDKA 4F3QA 2EZLA 4AIDA 3SFIA 4LMYA 4IRGA 2LC2A 3OR2C 3REOA 2CQ7A 3PFIA 1FTZA 1DUXC 3GX4X 1MGTA 3SXYA 1S72I 3TDZC 2JUCA 3ASNH 4EM1A 1ENHA 1X1PA 1R49A 4DBQA 1YO5C 3OS2A 1OCTC 3U21A 4WF2A 3OYIA 3I55I 4HNTA 2GWRA 2WBMA 3A02A 2CV1A 1DPRA 3IKVA 2YX4A 2JTVA 1R4NB 4Y33A 2GXGA 3T0YA 2ZXIA 4BU2A 2JJ7A 3Q3SA 4IHTA 1G3WA 2ELKA 4ZZLA 1ZQ3P 3HOYJ 2A6HF 1HSJA 2K4JA 4A0YA 4BJ6C 3WE3A 2RDPA 1BBYA 3GBGA 4B47A 1R5GA 2LTPA 1WGXA 4CCOA 1LDJA 3FDYA 2WAEA 1TNTA 4Y3OA 2L7ZA 5C4XJ 3KP4A 2ZO4A 3GTPJ 2EQRA 3DKYA 2M0CA 1T56A 2DA3A 1AKHA 1IW7F 4ZYGA 2P4WA 2NS8A 3K4MA 2ZNZA 2A61A 2XGCA 1K78A 1O57A 1CF7B 3FMQA 2R7ZJ 3RSNA 2XB5A 5E79C 3V4GA 3OR1C 1SD5A 1E3PA 2ZMEA 2PI0A 1LDDA 3LWFA 2JA2A 2E7WA 3SFZA 5FKLA 2HKXA 3IC7A 4CGZA 2ID3A 3H1CA 4CHUA 2K27A 1FSHA 4BQNA 2BW3A 2Y0SA 4BXFA 3CJQB 1UJ8A 3FHNA 2VONA 2HR3A 1B9NA 2ZXHA 2GAUA 3M7GA 3ZQQA 4E7IA 4XRMA 3DKXA 1OR7A 2XKPA 4U0VA 1LVAA 2ZXWH 5ILSA 2P7CB 1MJAA 4XIDA 3S1NJ 1I3AA 2FNAA 2Q2EB 4KN4X 5FROA 1K7AA 2RN7A 4M3GA 3PJRA 1MMAA 4ANJA 1WHUA 4JQFA 5K7ZA 3OYCA 3WODF 1VQNI 1HOMA 5KNLA 2DA4A 4P96A 1WPKA 1PP7U 3ECOA 3LQRA 2KRCA 2LRDA 4AWXB 5LEJA 3HOTA 2B63J 1DPUA 1XC5A 2V9VA 3M8JA 4XL9A 2STTA 3OYAA 5K5OA 5EGOA 1Y8RB 3COAC 1MZBA 2OTJI 1F9NA 5L3DA 1ZG1A 2CH0A 3U2RA 1RRJA 5JLXA 4GFBA 3RDIA 2A05A 3KP2A 3NARA 3QP5A 2ZJRF 1IDZA 1Y56A 4A69C 3IHUA 1SD6A 2NS0A 1MJ9A 2MH2A 4PZJA 1Y1VJ 2X4HA 3RKYA 3QYFA 2XAGA 2LNBA 2FA5A 1XCBA 3BR0A 3ERED 4HG2A 4WWCA 3GTOJ 2PJPA 3S1MJ 2L02A 2NOJB 4LLNA 3W2AA 3CZ6A 1ZREA 4FE4A 2Y75A 5CYVA 1YG2A 3RKQA 4JBAA 3J81K 3E5QA 4A6EA 4QPOA 2DDBA 4XRFA 4YG2F 1FYMA 1T08B 2VXZA 1WKMA 2E2IJ 1WQ2A 2GOMA 3L2CA 5ED4A 3LAPA 1B4AA 4OMZA 3HUGA 3HZJA 4IKFA 5IOZA 4XM3A 2XC7A 3RIRA 1XGSA 3OIOA 4PGHA 3BR5A 2O0YA 1QHHD 3F8FA 3H9QA 4PSWA 1VQ9I 3HYIA 2K7LA 2RKHA 2X0LA 1UELB 4G6QA 2P5LC 5FLVA 5FD6A 3HL2A 4A3KJ 3L2VA 1Z21A 1X3ZB 1RR8C 2W82A 2QENA 4D5CA 5EG0B 3CCMI 4BACA 4EJTA 2BZTA 1Z7LA 4KN7X 5B3SH 1U9OA 3G1MA 4UNOA 2R7SA 3J81Z 1OCOH 3F72A 4L5JA 3VYUB 4X0GA 5LRRA 3CD6I 4E7JA 3IH4A 3MVPA 4L5EA 4O3MA 1SAUA 2H09A 5LLQA 4UUSA 2E2HJ 1BJAA 4IHSA 2OU2A 3GMEA 2W25A 2R7UA 2BVLA 4WXCA 2QKLB 4B1RA 1KQ0A 4L9JA 3FKJA 2MA3A 3K1PA 3T1BA 3VPRA 2K5CA 4RMNA 2XAJA 1P7JA 4XMYA 1TLHB 3FWEA 4LOCA 1TW3A 2HDWA 3CLOA 4B09A 3DU6A 2XROA 2LH9A 5DTDA 3QP6A 2R7QA 3FIWA 3LNQA 2HPMA 4HDVA 5FRMA 2GXBA 2WWYA 4AYBN 2K9QA 1Q1VA 3CF2A 3O8GA 5E3OA 2UXNA 3S17J 1Z6RA 4RB2C 2VBYA 4XR6A 1G3SA 1P4XA 2VC0A 1SFEA 2ISZA 1FY7A 2MH9A 3BQZA 3I59B 4EGYA 1N77A 2NVUB 3RZDJ 1UHWA 2QSHX 2WAQA 4GRIA 1DP3A 1TW2A 1FEXA 1QZEA 5CVVA 2M4KA 1U5TA 4HA8A 4B48A 1E3OC 2KP6A 1HDDC 3I71A 1ZK8A 1JJ6C 3F8NA 1IRGA 4ON0A 1YS6A 2O03A 1ZRCA 4ZDPA 2DW4A 4E4HA 4EATA 3CCUI 4LB5A 2HVRA 5H2FC 5J4YA 3ZQLA 1D1BA 4C3IJ 1IN7A 2DK8A 5K5RA 4K2EA 3GTMJ 2JSPA 4C3JJ 1D0YA 2W1OA 3EUHA 3FK7A 4XONA 1BR2A 1AU7A 3CDHA 1YYVA 2W85A 4OAYA 3D0SA 3RI4A 1VQKI 1H89C 1RNLA 3JRAA 3MMYB 1W5SA 3A01B 3R0AA 1MMGA 1ACIA 4BQAA 2KMUA 3G3ZA 2XIGA 3RTRA 1P7IA 2O8KA 1QPIA 2X6OA 3F0CA 3MZYA 3IWFA 1HF0A 1D5VA 4HPQA 3GLLA 4YIFA 4ZYHA 4EM2A 2OZ6A 1BM9A 4MO7A 4BDZA 2MBFA 3DFGA 1IN5A 5L3EA 2EV5A 4M6XA 2OCEA 2FOWA 2VASA 3H5AA 3OYMA 3FHZA 3HOZJ 2IEKA 4M6VA 5HS7A 1TZLA 3TOAA 2GZWA 2FE3A 2XPVA 3GYHX 2WB1N 2Y48A 5TGTA 4E70A 3HGGA 1S6LA 3H3UA 3O3KA 5B1AH 3AG4H 1K6OA 1VTNC 2V26A 4QTRA 2PMZN 3CTAA 4DZPA 1ZELA 2QA4I 3CCRI 1J7KA 3H0GJ 2HFHA 4DNCA 4ABZA 2HOTA 3F21A 5E1ZB 4PJLA 4W97A 5D6EA 3TOBA 3K2AA 3WTWC 1GXPA 2PN6A 3PO2J 4U7BA 3FXJA 3ZCOA 2DMPA 3HTSB 2IS4A 2XKOA 3HHGA 4HX4A 5LHGA 2RQQA 1ETKA 5J4VA 5DCFA 2QWWA 5LEKA 2JPBA 5HDNA 3TGNA 1STZA 3VEPA 2ZBKA 3GUDA 2GA1A 3OSFA 1A36A 1RIOH 2VL8A 4KIGA 2BY1A 2E60A 3CCLI 1XX5A 4RA2A 2KL4A 1A31A 5IOYA 2ESHA 1MSEC 2QBYB 1WSUA 3EQLF 5M3FJ 2AQFA 4AC0A 5GAGJ 2BBYA 3Q5FA 3MKZA 2LFBA 2QQ8A 4E7KA 4A3BJ 1LE8B 4UUTA 5IP6A 2R7RA 2F6CA 1LFUP 5J47A 4QSHA 2CUJA 3PUBA 3CLQA 3K70C 4GYIA 4B43A 2BOLA 3PQKA 2ZC2A 4F93B 1FOXA 2NVYJ 2Z5UA 3L00A 3O6BB 3BG9A 1VI0A 2L7MP 1FLIA 2R7OA 2IA1A 1K61A 2WA0A 3JTHA 3W6KB 1FSEA 2FQ3A 2M8EA 3SHFA 4CZCA 1EF4A 1D5YA 5D5WB 3MKYB 2W84A 2LDUA 4BEHA 1GVJA 4JK1X 2H94A 4KMUX 3LSKA 2K9NA 3UNGC 2CUFA 3DTKA 2D1VA 3TL4X 4G9YA 2HVQA 3B6AA 1OYIA 4WK8F 1UFMA 2KHMA 2ZJPF 1WJBA 2D1HA 2JN6A 1E0EA 2KPMA 1HCRA 2X51A 3ZR8X 2LG4A 3A0BC 3CCQI 3DBRB 2Z2SB 1RKTA 3LA3A 2Z1DA 5EEGA 2F2EA 2L7KA 3LSPA 1YW8A 4ZTFA 3SJMA 4G6TB 2KFDA 3B6CA 2WTEA 3DQVC 4ESBA 5LGTA 3GTGJ 1SFXA 5CQGA 1U8BA 1ZYRF 2DN0A 3H92A 4KT6A 1XDUA 1H9TA 1V54H 5L3GA 1NK3P 3HB9A 4M71A 2M87A 4PFPA 2MW8A 4Q47A 4JX6A 4NQWA 5AIQA 1QA6A 1GV2A 4KDPA 1D0ZA 3BR1A 3BG5A 4I09A 5J8CA 3KFWX 2H8WA 5F04A 2JRMA 2YSRA 1UAAA 1S3JA 4P5OA 1Z7UA 1JT0A 2HQ5A 2H8RA 4XLHA 5M5WJ 4QLCU 2HTSA 4B8XA 1MNMC 2QQAA 1TTYA 3MFKA 1SD7A 3FX3A 1RKWA 5FB2A 3IH3A 3IRRA 1X58A 2EV6A 3K4CA 3KYDB 1W0UA 4U7DA 2V79A 3MD2A 3C7JA 3H5NA 3W6VA 2UZKA 1K4TA 2NVQJ 3GZNB 2JWTA 2E71A 2E5ZA 2X6YA 2AHQA 3K4JA 3S16J 4FCYA 1VNDA 3OS1A 4PJJA 4OAZA 3L2QA 2L54A 2Y9ZA 3HOWJ 3CCJI 3E6MA 4DZJA 3GFIA 3H9JA 1OJLA 3HG9A 2KJCA 4XOTA 4I01A 5FFZA 3SEZA 1ON2A 2CJJA 3FK6A 4UHTA 2M8GX 3E1SA 3E7LA 3KEOA 2HDCA 2EFPA 4IZZA 4A0ZA 3SDBA 4Q48A 1R00A 2L2OA 4A5NA 3DWLE 4AIJA 1GLNA 1W5CC 4RAZA 3S1RJ 2L7FP 2KRFA 3BROA 4W1UA 1K79A 1SAXA 4CYDA 4YEJA 3LMMA 4V19K 4IJAA 5ICGA 2L4AA 5TJJA 5DUIA 1YRNA 3SEQA 2M9HA 1YJ9I 3HSEA 1H8AC 4IXAA 1W7PB 1CGPA 3C2GA 4ITVA 5LHIA 5J8FA 2K40A 1OCPA 3BR2A 4IHVA 2K02A 2LK2A 3NQOA 4HSTA 3OMYA 2JA8J 4AD9A 1MD0A 1YW9A 2CS3A 3CJTB 3S3NA 1X1BA 2WAFA 2Z16A 4M9SA 2FRHA 2W57A 2ZB9A 2QZ8A 3T8RA 1IN8A 4CUGA 3ZQHA 5FKOA 5GPAA 1U2WA 3I54A 2R5YB 4KA4A 3LSIA 4Z6YA 4M3DA 4HNVA 2JVGA 5HDGA 4HRIA 3ML6A 5LFAA 2BYVE 2M7AA 5ILUA 1XCVA 2DK5A 3LSMA 3PL8A 1C0WA 3P5JA 2MLGA 2VBZA 4XLAA 2AXTC 4RB3C 1B72A 2E1CA 4BNCA 4LG0B 2XHKA 3AKZA 1QPMA 5H6RA 4KMFA 3AL0C 4BBSJ 3FBIB 4IX7A 4XKVA 4IQ4A 3PM1A 4XORA 5DD4A 2G7UA 3K7AJ 1WCMJ 2HNHA 2ZCWA 4ZYDA 5EJCA 3LQQA 1BR4A 2ID6A 3W3CA 5FLMJ 6PAXA 2BY0A 1L0OC 1HBXG 2RVCA 1P92A 2IBDA 3K2ZA 5DCMA 4QIWN 1VQ8I 3E3VA 5HVQC 1PUEE 1WJAA 2D45A 3OOUA 2VJ4A 1BC7C 3KZYA 2DYRH 5C3EJ 3KP3A 2D2WA 1TQIA 4CCNA 5ICCA 4P9FA 3Q0UA 2VQGA 4KT5C 2E1MC 2BY3A 2DA5A 2OCCH 4QWQA 5CVRA 1HW2A 2LBFB 2KDZA 4RBOA 1HXDA 5FFXA 3ZMDA 4D5FA 1D8JA 2CQKA 4HOBA 3BPXA 4C3HJ 4UY8I 2CWEA 3P9CA 2CW8A 1SMYF 3DTEA 4O6JA 4EQQA 2FNPA 1V5GA 1T98A 2DFFA 1YW7A 5D8KB 2OF7A 1XPXA 5FKKA 2WY8Q 2V6EA 3WU2C 2O5RA 3RPUD 5BNGA 2IGMA 3CCVI 1YJNI 2OPTA 4XLFA 2EILH 4NC6A 3D5SC 4ESJA 4MIMA 3PNYA 4CCKA 2VT2A 3DLAA 5GADJ 5F27A 4CYCB 5B66C 1XMAA 5BS6A 4F92B 4E7HA 3LFUA 3OL3A 1APLC 5FJ8J 1ZG5A 1V5FA 5GTHC 4ZTJA 3KX2A 4XSXF 5AONA 3W6JB 1P4WA 2HEOA 1PJRA 1FC3A 3F23A 2ZMEC 3TW6A 1BI2A 2G7HA 3OYHA 1JHFA 3CCSI 4H0EA 2LD5A 1ZN2A 3ONQA 2VQCA 2M30A 5E3LA 2IGOA 1K6YA 5JFRA 2EIJH 3H35A 3WHBA 3GO5A 2F5EA 3UKGA 4NHJA 3JAMK 2NS7A 2DODA 4M3BA 4BUPA 1XMXA 2EZIA 2HPIA 3FXOA 1JKPC 3B02A 3I56I 1R22A 2YX7A 4C2TA 4G7HF 1XD7A 2MABA 1T39A 3HBLA 2UWMA 2IVMA 2X6WA 3ZQFA 5D5UB 4N9IA 3QPLA 1ULYA 2Q1ZB 4YFXF 1LDKB 3QPSA 4NC8A 2HYGD 4HV6A 3JSOA 3TEDA 3D5LA 4O5VA 2COBA 4G94A 3S8PA 1V4RA 4EJUA 1UZCA 5DS9A 2OZUA 1YQAA 5J1UA 3G4SI 3U1DA 2VQLA 4D1QA 2HOEA 4HYEA 4XRSG 4A3CJ 2P5VA 1TC3C 3LSRA 1QZYA 1REPC 1W0TA 1MBHA 4OIPF 4LD5A 1POGA 5K7FA 1JKQC 3MCZA 3I59A 1SD4A 3EYYA 4E6KG 2VOOA 1DQUA 4U0YA 1U0JA 3VSLA 3JTGA 1IF1A 1BW5A 3JAMZ 1R1UA 2X48A 4LB6B 4BH9A 2DYSH 1V5EA 3KZIC 2I5UA 1BC8C 2BV6A 2JT1A 1LKXA 4Y13A 5GTIC 3VYRB 2VBWA 3W2VA 4A3IJ 2JZYA 2KKOA 1IO2A 2FEZA 1MBKA 1O3RA 2A3SA 1Z91A 1JI8A 1BOAA 2OQGA 3HJEA 3DBHB 5H6QA 1A04A 2CFXA 1OCCH 3I58A 1G3YA 3K69A 2R5ZA 1W7PD 1RZ4A 2L5QA 3CMMA 2AO9A 4X6AJ 3BZCA 1J09A 4AVZA 4FETA 2DBBA 1X3UA 3F3XA 1F5TA 5JHFA 4ESFA 2RNJA 2CGPA 3FM5A 4LIUA 4F7ZA 5D6FA 1W36C 4GYGA 3FKIJ 2QKMB 5F6FA 3OIQA 3DLLF 1EH7A 3K9TA 3R60A 4HQMA 2IRFG 2R7VA 3R61A 1GV5A 5E17F 5IP9J 3DPLC 2IW5A 3VDXA 1T8IA 3CUQA 4I6ZA 2QSGX 2IJLA 2MGQA 4KIBA 4N4NB 4S05A 3WGIA 3BZ6A 5GP9A 3ZMUA 2OC6A 4MEYF 1LJ9A 2XSJC 5FO5A 4CDGA 5CVUA 3I9V2 2Y31A 3TQNA 2M1BA 1R36A 1ZGAA 4RGUA 4GXOA 2CFOA 1IRFA 1R58A 1FYKA 3H3ZA 1OQYA 1IRZA 2BXYA 1MNEA 3AL0B 5F1RA 2XAHA 4NUBA 2EIMH 2Z33A 5GPCA 1BI0A 5BPIA 1U3EM 3PIOF 2DTZA 4A3EJ 2XASA 4MFEA 1IDYA 2V4JC 1I1SA 3MQ0A 1X2NA 3PO3J 3H9GA 1IXSB 3BLYA 2HQRA 3J7YJ 3JRGA 5DDGA 1B8IB 3LSGA 2L4MA 5HLTA 2E7XA 3PNTA 3BC8A 4L9NA 2E1MB 2YUSA 1KU9A 4IVNA 4IEJA 3CCYA 3K70D 1G8XA 3MZ8A 4HF1A 1U5TC 3TDUC 1RETA 2CQXA 4C2UA 1VQ5I 2PMUA 3JREA 3OYJA 2HQAA 1SEUA 2ICWG 4C9YA 2PFBA 1UG2A 2PJRB 5J6XA 5F08A 2FBHA 5K5QA 2COMA 5KAIC 2PLYA 2HU9A 3ZQCA 4BY1J 2ME0A 2A68F 2XAQA 1ETOA 1QHGA 4U88A 3ZPLA 3DCFA 1WH7A 1HQCA 2W24A 3EUHC 4CICA 1WWXA 3HRMA 4HLYA 4OU0A 1T95A 5IP7J 2ELJA 4HSRA 2LKXA 2X85A 4PJMA 2F4IA 3O2PE 3GCMA 3QOPA 4A6DA 1JGSA 4A3MJ 3VYTB 1J75A 3RPUA 2VT3A 3QOEA 1MDMA 1FMWA 1UHMA 1K78B 1KU7A 2ELHA 2K9MA 3A4CA 3V8KA 5LD2C 3C1DA 2FX0A 2EK5A 4Y17A 4EM0B 4CSWA 4I2OA 1G2HA 3QQAA 1B9MA 2ZMEB 4XLEA 1Z3YA 2JRTA 5IYBJ 1S9HA 3HXLA 3ZN1A 5EDNA 5CLSA 4F55A 2VKEA 3ASOH 2E1OA 4IO9F 4BYYA 2LREA 4RM2A 5J1YA 2XF5A 3MKLA 2XF6A 4AIHA 1ZLJA 1UG0A 2MD5A 3TP0A 4HX8A 2LR8A 3EPZA 1VQ4I 3BTLA 3BPVA 4JYKA 3SDGA 5DD8A 1NH3A 1E2XA 3TMOA 1USSA 2LY2A 1PUFB 4Y4RA 2ADUA 1HC8A 1U8RA 4G7OF 2K9SA 2VUMJ 2DQLA 1JKOC 2PX9A 2MFZA 4EJOA 5JLWA 1VQ7I 1YTYA 3GFMA 2V1DA 2KIFA 3D1NI 1A6QA 1EH6A 5M3MJ 1T0FA 1ZRFA 4EMSA 3DP7A 3FM3A 4E7ZA 4I99C 4L18B 2RC4A 1JXSA 1XGNA 2HI3A 2EB7A 4MHGA 2EPFA 4G8XA 1FIAA 3JR9A 5IYCJ 2FMYA 1ORKA 4BQQA 1TWFJ 4XN3A 2CV2A 3L2RA 3F6VA 3OYEA 1HLVA 2JUGA 1U6GA 1R6RA 2L0KA 4E7LA 3I4MJ 3BP8A 3HIFA 5DEQA 4LLGF 3UR3C 2ESNA 3V8LA 2CW0F 2HYJA 1MBJA 4UVAA 1I5ZA 1HDPA 2VKVA 2RAEA 3HTUA 2QQ9A 4HV5A 4J19A 2DO7A 3G73A 2CQQA 3E6CC 3ZQIA 3FXKA 4B44A 3V7CA 3N05A 2GIVA 1FOYA 1SVMA 3FXUA 2EFOA 3R6SA 3VSKA 3WTTC 1I50J 2HYFA 3HUGB 4IHYA 3CO7C 3KPHA 1B1BA 2DMTA 4MQVA 1JKRC 1FOWA 4HF0A 1F36A 2JA6J 1IXRC 2DAOA 2ME6A 4RDUA 2M2EA 1PYVA 4XLPF 3U9GA 3V7SA 2CQNA 2GM4A 1G3TA 4AYBA 2VJIA 2DPDA 1EA3A 4R79A 4HZFA 2XRLA 3H3VK 4LJZF 3S14J 3M07A 3S1QJ 4LK1F 2DT6A 3R0JA 4XOPA 1EH8A 3RYPA 1O3QA 3KETA 1Z0XA 1O3SA 2EBIA 1W7PA 2VJJA 4BHCA 1OYYA 2ZKZA 3Q0WA 2OAZA 1ZR2A 4XRSA 3LSJA 2M5WA 5E8GA 2FSWA 1IXCA 3DEWA 3NWSA 5LBQA 2X1EA 4XBFA 2QVOA 3CESA 1WJFA 4A5MA 1OCRH 3Q9VA 5D8LB 2NYXA 4JX5A 2STWA 2K9LA 2CG4A 1UMQA 1PVEA 4GGGA 4UUSB 1FBQA 1XMKA 1V55H 3LSHA 3K1NA 1KQ8A 2GQQA 2BHZA 3RZOJ 1XN7A 1R1VA 5J3LA 1TQPA 1NTCA 5A2QK 4AUXA 1X4OA 1OKRA 3BTIA 2E35A 3ZMZA 2HGCA 3H36A 3HSFA 3FMSA 2H1KA 1WRJA 2DOAA 4A12A 3OWTA 2G9WA 1YS7A 1ZR4A 1IG7A 4U0WA 4BL0B 4G12A 2R7TA 1D0XA 2VE9A 2HQNA 3P7NA 2VPRA 1IZ1A 1MW7A 4RAFA 2K85A 3CMAI 2RQPA 5M5YJ 4A3DJ 5JVTA 4AVPA 3GTKJ 4IOAF 2HS5A 1YX3A 1FJLA 5LGNA 3WU1B 3AG2H 2XPUA 3DV8A 3TW7A 4HDUA 5DM6F 2LF7A 1AWCA 2FUG2 2MD0A 3F8BA 1R5HA 1NG6A 2BE5F 1NK2P 4DJAA 4XN0A 3ROUA 3K6GA 2MLKA 2CMPA 2W00A 1BN5A 1GVDA 1U5TB 2K3PA 2O3FA 2CO5A 2WB1A 5A2QZ 2Q0OA 2LBFA 3NAUA 3OIPA 2DFHA 5EZHA 4ENNA 3CP8A 3HKZN 2LLKA 1D1AA 2LKPA 2M45A 2PMZA 2VC1A 4PK4A 3LA7A 4J01A 2QCOA 3HEFA 1F1ZA 2QM3A 4UUVA 1USTA 2XAFA 4MTDA 2FMLA 2QLZA 1TQMA 4M3EA 4AU7A 1S7OA 2V6CA 2JA7J 2CSOA 4N9HA 1HW5A 2HWVA 1ZH5A 2P6TA 2VB6A 3LOCA 2F5FA 3HRUA 4RLQA 2BGCA 2Y0MA 1S7EA 2ZFWA 1J0RA 2P8TA 3BCAA 4I98B 2M4GA 1GXQA 2Y30A 4KYWA 1LEBA 3TP3A 2QUFA 4MQ9F 2VN2A 2XUBA 3SYTA 4LK0F 2EV0A 3C2HA 2XVCA 1BJZA 2HXIA 1WFXA 2X6XA 2NVXJ 1AHDP 2VE8A 3K0LA 3V8JA 3O8HA 3A0HC 3B73A 2OJED 3J7AY 2NNYA 4F91B 2A07F 1MMDA 3JW4A 2R7XA 2E1NA 2DA6A 3M1EA 1F4KA 2DMQA 4B3AA 3JRHA 3HDDA 1TT0A 3CJNA 3S93A 1QGPA 1ERDA 1ZG3A 4WX9A 3OYBA 2QF7A 2EFNA 3S2HJ 4NB5A 2FJ1A 2MC4A 3CC4I 4FTHA 2IA0A 2Y69H 1P2FA 3BG7A 1IV8A 2W48A 2OBPA 3ZMTA 1FIPA 2RNGA 3ELKA 4BXUA 2A5YB 1TWCJ 5HNFA 4PDKA 4D7NA 5ILVA 5L3BA 1J2XA 1SVLA 3WTVC 2A6EF 2FXAA 1FZPB 1I3QJ 1JHHA 4KIFA 3CF5F 5KHDA 1CF7A 4OOIA 2Q8KA 3IH2A 2F4MB 4II2A 2MG4A 2ZSIB 3MKWB 2QSFX 2R93J 2DOFA 2K4BA 3Q9SA 2F48A 3HOSA 4YELA 2VBXA 1AA7A 1OPCA 2PG4A 3WG9A 1TWGJ 1OCZH 3HOXJ 3M3YJ 4PCQA 2HOSA 2DDAA 3K4LA 2CV0A 1OISA 2DFIA 2YU9J 2E2JJ 1X19A 1ZARA 4UV9A 4FHTA 1YIOA 3WTZA 3JRIA 1ONVA 1R23A 3IP4B 5DYMA 5BPDA 3I0TA 2DFEA 3ZP5A 4PJ0C 4F52A 4BDYA 3KEYA 2L9SA 3KZZA 2Q2EA 2TRTA 5L3CA 1QVTA 4BE2A 2JQ7A 1JTXA 1J59A 3IV5A 2R0QC 4HAMA 4BE1A 3Q0VA 4V2GA 1MIJA 3LAJA 5HLIA 2EWNA 3LA2A 3S32A 5IT9K 2WV0A 4TV7A 2DMUA 5DV5A 2BEOA 3OYLA 2B0LA 2L9NA 4L0YB 2R4GA 5J1RA
chains in the Genus database with same CATH topology
2QSFX 1PVEA 3ESWB 1TP4A 1X3ZB 1OQYA 4YIRX 1QZEA 1X3WB 2F4MB 2QSGX 2QSHX 2F4OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSF X;  1PVE A;  3ESW B;  1TP4 A;  1X3Z B;  1OQY A;  4YIR X;  1QZE A;  1X3W B;  2F4M B;  2QSG X;  2QSH X;  2F4O B; 
#chains in the Genus database with same CATH topology
 2YS9 A;  4BEH B;  1W36 D;  4LLL A;  1ZKG A;  2DT7 B;  3EUA A;  4WXD A;  5CPR B;  2V9K A;  2GIZ A;  4BY7 J;  2MYS A;  4CA0 A;  2FOK A;  3IAM 2;  5F0H A;  4G6D A;  3DEU A;  4MEX F;  4RB0 A;  1KGS A;  1JUS A;  2H6C A;  3MN2 A;  5KK1 A;  4L0Z B;  1SVO A;  2CU7 A;  3GLX A;  2ACJ A;  3S2W A;  2N8G A;  1RUN A;  1ZAO A;  4RAG A;  5GAE J;  1RES A;  4PUS A;  2X9D A;  4DW6 A;  1IUF A;  4XNF A;  1OFC X;  2XB0 X;  2Y0S N;  2DT5 A;  3NEU A;  2XDV A;  1P4A A;  2W4S A;  3G1L A;  1FMV A;  2RGV A;  3KP6 A;  2H6B A;  3W2W A;  2IGN A;  3FXL A;  3CDL A;  2EZK A;  1V3F A;  2P81 A;  3CME I;  2J5P A;  1KU2 A;  3V7R A;  1ETX A;  5IT9 Z;  1MBF A;  4A3L J;  4NQW B;  3DXJ F;  4H4K C;  4KJZ A;  3L1P A;  3F22 A;  5TIS C;  3CUO A;  3BWG A;  1HKQ A;  3QYE A;  3GW2 A;  3ZMS A;  2LOO A;  1XSV A;  2Z99 A;  4BBR J;  2MC3 A;  5BQT A;  1MBE A;  2DA7 A;  3DU5 A;  4IHW A;  1DU6 A;  4CCJ A;  1MBG A;  2KZG A;  3E6B A;  5HS8 A;  1BR1 A;  3CC7 I;  2EIK H;  3BCB A;  3OOP A;  2HOA A;  5EG0 A;  1WJD A;  2KT0 A;  3TO6 A;  2F4O B;  1H0M A;  4IL6 C;  1B8I A;  5EEA A;  1LVK A;  4E7S A;  4C2M J;  1OMI A;  1HKS A;  5LHH A;  1BL0 A;  2KQR A;  1HA8 A;  1OR7 C;  2JPC A;  1DGR M;  4ZDO A;  1XGM A;  1R4M B;  4PJN A;  3N4M A;  5DM7 F;  2H27 A;  5KCM A;  1R71 A;  5FLX K;  1RI7 A;  4CZZ A;  1N25 A;  1IJW C;  4HEA 2;  5IPA A;  3HRS A;  5KVR A;  3IUO A;  5FD5 A;  2LSO A;  4KIT B;  3M1C A;  4OIR F;  4A2U A;  3LST A;  4HX7 A;  2P0W A;  1EJ9 A;  2KIS A;  4A3F J;  1FX7 A;  2PJR A;  2XV4 S;  4I02 A;  3WGH A;  2P5K A;  4UXN A;  1ZRD A;  4ASN A;  4RS8 A;  2XRN A;  3NWT A;  4KIS A;  3A03 A;  1SMT A;  4I0B A;  1YRN B;  2BVM A;  4BXX J;  1SFO J;  5E3M A;  2ZNY A;  1Z9C A;  1TP4 A;  2HKO A;  2VOP A;  1VQO I;  2CUZ A;  3RKW A;  2NNN A;  3I4P A;  2IS2 A;  4P1W A;  1N75 A;  1XS9 A;  3S3O A;  4XSZ F;  1ZGJ A;  3KLN A;  5HOD A;  2L9V A;  3JSP A;  3IL2 A;  2LVS A;  1KYW A;  4DQ2 A;  1HST A;  4RB1 A;  3QPT A;  3GZ6 A;  2M3A A;  1YX5 A;  3C18 A;  1I39 A;  3OYK A;  4M72 A;  4RGS A;  4R8H A;  4NC7 A;  3E5U A;  4GCV A;  2W7N A;  5D5V B;  2CW7 A;  2E19 A;  2JVH A;  3CUQ C;  3BG6 A;  1IGN A;  5FLX Z;  4CH7 A;  3R4K A;  1WI9 A;  1Z67 A;  4CCM A;  4KFC A;  5E1W A;  5JR3 A;  1Z6T A;  3WTX C;  5F0F A;  1K4S A;  2I8D A;  3A2K A;  2A69 F;  4RGX A;  1ZTR A;  2FQ4 A;  2VLA A;  1B72 B;  2FBI A;  1SC7 A;  4CCL A;  2BHY A;  1FNN A;  1UHS A;  4ENK A;  3AG3 H;  1PUF A;  1XSD A;  2IXS A;  3WU0 A;  2EH3 A;  4FIS A;  2MSY A;  2F5V A;  2QEX I;  4MGR A;  4QPQ A;  2DXI A;  2L3D A;  3SZP A;  1S8N A;  3HPG A;  4EJW A;  1UB9 A;  2XGX A;  4XKB A;  3WTU C;  3E6D A;  3A01 A;  2KIU A;  4YII A;  3VWB A;  2KZV A;  5DCM B;  4D0P A;  1IN4 A;  1IRX A;  4II3 A;  3M8F A;  3TBI A;  4BAY A;  2EA4 A;  2LYC A;  4ZZD A;  3MZH A;  1Z05 A;  3S3M A;  3OV8 A;  5FKM A;  4XQF A;  3LFK A;  3I5U A;  2O8X A;  3ULQ B;  2WAQ N;  1OYW A;  2ZXJ A;  1H88 C;  2V1N A;  2UXX A;  3ZMV A;  2PMH A;  4M9Z A;  4I0A A;  2KIQ A;  5HOO A;  4M74 A;  3HM5 A;  2NVT J;  3F8C A;  4MNU A;  1X1C A;  3S2D J;  3CDI A;  5FRN A;  3AG1 H;  2XGD A;  3L9F A;  5K1Y A;  1WJE A;  3M8E A;  3MAJ A;  2DPU A;  5CJ9 A;  3EET A;  3FBN B;  5KAF C;  2O6G E;  3OYF A;  1T33 A;  5ERI A;  2HVS A;  3ZRG A;  1VQ6 I;  2DOE A;  2UUZ A;  1G6N A;  1RC9 A;  3BR3 A;  1JT6 A;  3QOD A;  4HW0 A;  4XKW A;  2VXD A;  1LB2 A;  5LRS A;  1YFH A;  3KP7 A;  2L01 A;  2DI3 A;  4CXF A;  1GUU A;  3E5X A;  3MEX A;  4YFK F;  4IRI A;  3CCE I;  1HKT A;  1VZ0 A;  3TO9 A;  4EJV A;  3K1M A;  5IT3 A;  1DGW Y;  3QU3 A;  2CUE A;  3IKT A;  3G71 I;  4IOC F;  2JSC A;  3MWM A;  4YFN F;  3VB2 A;  3QPH A;  1WZ2 A;  4A3J J;  3ECH A;  3T8T A;  2QBY A;  1ETY A;  4A3G J;  1MKM A;  5B5E C;  2YR2 A;  1T6S A;  2DJN A;  1E3H A;  1OLT A;  2M0M A;  5HLG A;  3N97 A;  3GTJ J;  4B3X A;  1LE8 A;  4ETS A;  5F64 A;  2E36 A;  3CMY A;  5M5X J;  3ABK H;  3BR6 A;  1VF9 A;  3SZG A;  4A0X A;  2F5C A;  4RAY A;  4RGR A;  4UVC A;  3K4N A;  2NRA C;  3GVA A;  5L3F A;  1RUO A;  2LKS A;  3T5X A;  3IRQ A;  5FKN A;  3BDD A;  1Q1H A;  4BS9 A;  1YOV B;  1I1G A;  3VOE A;  3X2Q H;  1WH5 A;  1AKH B;  1JTY A;  3EYI A;  2EZH A;  2QYO A;  1A6I A;  1ETV A;  3J80 K;  4OIQ F;  1T0F C;  2VJ5 A;  2ZJQ F;  3OSG A;  3HRT A;  4JP0 A;  3J7Z I;  4EVI A;  2V1U A;  2WC2 A;  1BW6 A;  3GFJ A;  2DJI A;  1YHQ I;  3GTQ J;  2OV7 A;  3JRB A;  2GXA A;  4A93 J;  1YE9 A;  4EV0 A;  1BI1 A;  5BMZ A;  4RM3 A;  3ZOB A;  5ICF A;  4DBR A;  4BHP A;  3AFH A;  4FAS D;  3A1Y A;  3K10 A;  2PBI A;  4ZH4 F;  1CQT A;  4NDL A;  2J5O A;  2BW3 B;  1G4D A;  2TCT A;  2LP0 A;  2A6T A;  3DKW A;  1DP7 P;  2IPQ X;  2R3S A;  4JOM A;  3FF5 A;  2HXO A;  3RJP A;  5HNH A;  1Y1W J;  1ON1 A;  3P9K A;  2KDO A;  1J9I A;  1JGG A;  2G0E A;  3KP5 A;  1WVR A;  5BOX A;  1X2M A;  1W4M A;  3BG3 A;  3E97 A;  4P55 A;  2FBK A;  4HLX A;  2LY9 A;  3RKX A;  1LEA A;  4OWR B;  3J80 Z;  2DA2 A;  2E5N A;  4XKC A;  2YU3 A;  1RR7 A;  1MJB A;  4HBL A;  4N4O B;  5EGO B;  1HW1 A;  1O7L A;  2R5Z B;  1KZH A;  5K7H A;  4X1E A;  1YLF A;  3JRF A;  1I6X A;  3FZV A;  3QAH A;  4M73 A;  3IAS 2;  2ZSH B;  1ZGW A;  1Z77 A;  3E0J B;  1IN6 A;  4Q4Z F;  4I76 A;  1TNS A;  1K83 J;  2WY7 Q;  1N78 A;  2RRE A;  3OL4 A;  4BGD A;  3BY6 A;  2FF4 A;  2BY2 A;  4M6Y A;  1T2K A;  4XIC A;  2OA4 A;  1MH4 A;  2ZFU A;  2NXN B;  1MMS A;  1XSX A;  2VOD A;  4DYR A;  3L7W A;  3CUQ B;  2WAD A;  2Z9O A;  3PUF A;  3RQI A;  3KIO A;  4IF4 A;  3VOD A;  5E18 F;  1U9N A;  1BI3 A;  2I10 A;  5CQE A;  2V1X A;  1XTA A;  3HHH A;  3KYL A;  2GOX B;  1GT0 C;  3ABU A;  4N0B A;  4IHX A;  2EFW A;  3BJ6 A;  2HDD A;  1Y6I A;  2H1L A;  2KJB A;  4HNU A;  3SZT A;  5E1X A;  4FE7 A;  3P9I A;  4OMY A;  1NG7 A;  2JMW A;  1E17 A;  4ZYA A;  4R1H A;  3F8M A;  3QU6 A;  1LPQ A;  3GFL A;  4D9J A;  1FYL A;  1W5T A;  3GXO A;  2VQH A;  4UB6 C;  1A5J A;  3OY9 A;  3PIP F;  4L9V A;  3G1O A;  5F0C A;  2DMN A;  1S29 A;  2F5D A;  2ISY A;  1FP1 D;  2ZJ2 A;  2HZD A;  3DPU A;  3BT9 A;  3DTI A;  3TKY A;  2IS1 A;  1ETW A;  2FU4 A;  4CO8 A;  2K86 A;  3DEE A;  1P9Q C;  2KLO A;  4GDF A;  2K3F A;  3BZK A;  2EIN H;  5HLH A;  1WJC A;  2VI6 A;  5E3N A;  1I6H J;  4KUM A;  4ZC3 A;  3RCO A;  3OS0 A;  3D5R C;  2LMD A;  1FTT A;  2DTR A;  4PFO A;  3G2B A;  1TWH J;  1LNW A;  1ZHF A;  2P7V B;  1ODD A;  2L9R A;  3WGG A;  5EF6 A;  1X4P A;  5TRD A;  2R5Y A;  4RLF A;  2P6S A;  3FMR A;  3SQN A;  3KCC A;  3S15 J;  1UCR A;  1Y0N A;  3QYB A;  5GAH J;  3F6O A;  4GO1 A;  3WHC A;  4XLN F;  1SAN A;  4DOZ A;  1FPQ A;  1QU3 A;  3OYN A;  1L3L A;  1M1E B;  3PSF A;  4LG0 A;  2GLO A;  3BTJ A;  2TDX A;  5D4S A;  1W1W E;  3EDP A;  4J00 A;  1YJW I;  2CRG A;  5ICE A;  3L2U A;  4FQG A;  1TL8 A;  4UVB A;  2VPL A;  3ABL H;  1ITY A;  1D8K A;  1QNT A;  1KU3 A;  1QO0 D;  2ECB A;  2E34 A;  1IC8 A;  3KYC B;  3ZGK A;  4KNY A;  4Y15 A;  4FT8 A;  2LF8 A;  1XG1 A;  4XLC A;  2FD5 A;  4NBQ A;  2OUM A;  2X1D A;  1YI2 I;  1X1D A;  2R7W A;  2O61 A;  3GTL J;  4PSX A;  1MDM B;  3WTS C;  4DYQ A;  2Y2Z A;  1X3W B;  1GHC A;  3WTY C;  1JE8 A;  1LQ1 A;  2R7D A;  3GF2 A;  1BOB A;  2GA2 A;  4ZDL A;  3CQZ J;  2B9S A;  2JA5 J;  2IS6 A;  2A5W A;  1TT5 B;  1LUJ B;  3ZQG A;  1XDS A;  3K4K A;  1JUM A;  2PQ8 A;  2QQB A;  4AM3 A;  2AQE A;  2AXL A;  4ZYE A;  2LY1 A;  4JX4 A;  5DUK A;  5JHU A;  2IA2 A;  1SFK A;  3HOV J;  3TO7 A;  1AOY A;  4LIV A;  1KA8 A;  3ESW B;  3DF8 A;  5JI6 A;  4EGZ A;  5D4R A;  4IPA A;  4XK4 A;  1VFC A;  1BIB A;  4ENJ A;  2CYY A;  5H20 A;  1DU0 A;  2IGK A;  4DIQ A;  1BA5 A;  1R9T J;  1YIT I;  1QBJ A;  4BJT A;  1RPW A;  1U78 A;  3PSI A;  5FGM A;  3I53 A;  4S0H B;  3ISP A;  3IWZ A;  1FOK A;  2NAZ A;  1MND A;  2XSD C;  4CYC A;  1VQL I;  5J40 A;  2HZT A;  1I27 A;  2ETH A;  2V7F A;  3KE2 A;  3RYR A;  1R1T A;  4M3F A;  2C6Y A;  2ECC A;  1B59 A;  2EFQ A;  2D5V A;  3J7A O;  1GDT A;  4C30 A;  2R92 J;  3CP2 A;  4BJ5 C;  3U1K A;  3M9A A;  3GZ5 A;  1S5L C;  2Z3Y A;  2V9P A;  1LFB A;  1VQP I;  4UB8 C;  1JJ8 C;  4ENM A;  1Y0U A;  1G59 A;  4IRH A;  3CO6 C;  1DDN A;  4Y52 J;  4P9U A;  2R7F A;  3NRV A;  2EJR A;  4IQJ A;  4NNJ A;  1JUP A;  4YIR X;  2DA1 A;  3ZN0 A;  4BQO A;  5C4J J;  1KQ9 A;  2DCE A;  4MTE A;  3OYG A;  3BQY A;  4HQE A;  2M7B A;  4BHB A;  4OIO F;  1R7J A;  5IY5 H;  1QZZ A;  2X1C A;  1QQI A;  2WV1 A;  5CVJ A;  4Y7N J;  3HSR A;  3H5R A;  3AAF A;  5EYR A;  1IUY A;  4D7M A;  4B4C A;  3JRC A;  1IAW A;  5HS9 A;  5B1B H;  3VFZ A;  3HGY A;  2XPW A;  5EEH A;  5IYD J;  1XB4 A;  1KYZ A;  4LIT A;  3HPH A;  3ZQ7 A;  2DU9 A;  2GBY A;  3HOU J;  3C3W A;  3BJA A;  1PP8 F;  3G6E I;  1Z3X A;  4L9T A;  1MH3 A;  1FBU A;  1TWA J;  4DYC A;  4BKX A;  3K4B A;  1PDN C;  1EV7 A;  1O3T A;  1J5Y A;  1TBX A;  5AIP A;  2KRH A;  3GWZ A;  3FIS A;  2B7E A;  1P6R A;  4M9X A;  4KIC A;  2XAU A;  2YPR A;  4LFU A;  3L09 A;  3ABT A;  3VYS B;  1BIA A;  5F1J A;  3HC7 A;  4S04 A;  3JCU C;  4WXH A;  4ZJZ A;  1MSF C;  1D3Y A;  3L2W A;  4LGW A;  3H0D A;  3WE2 A;  1WI3 A;  4EEF G;  3HKZ A;  2OTL I;  1VQM I;  3FXQ A;  1R5I D;  2JK3 A;  1ZLK A;  3ABM H;  1EKE A;  3I4N J;  1ETQ A;  1KON A;  1IV6 A;  3FXM A;  1SFU A;  2KIM A;  4UV8 A;  1Z1D A;  4I7H A;  4Z2Y A;  3CC2 I;  3KLO A;  5D5X B;  1A35 A;  2DLL A;  4G7Z F;  3CJR B;  2NOG A;  3DBL B;  3I64 A;  1X1A A;  1XGO A;  3QWL A;  2HTJ A;  3ZXS A;  4FX4 A;  2VKD A;  3I3L A;  3M4O J;  4Q5S F;  2XGE A;  5JVG F;  3BOQ A;  3EUK L;  2IAI A;  1LFP A;  3DPT A;  3BTC A;  4L5I A;  1Y39 A;  4HF2 A;  3LL7 A;  1YIJ I;  4WCG A;  2VIX A;  4V2F A;  1O4X A;  2RV8 A;  1D1C A;  4BE0 A;  9ANT A;  1Y8Q B;  5CKT A;  1FT9 A;  2IT0 A;  3PNV A;  2O7O A;  3RPQ A;  1O7F A;  4LG3 A;  1H9G A;  2EA2 A;  2OQR A;  2Y9Y A;  3C2B A;  3KEQ A;  2PEX A;  2VKH A;  3V42 A;  4DGW B;  3WG7 H;  5C44 J;  2M34 A;  5CVI A;  4AIK A;  3PQJ A;  3F9K A;  4MFD A;  3QRF F;  5LGU A;  4FX0 A;  5E8I A;  3OYD A;  1NHA A;  2BXZ A;  3GEZ A;  4YRV A;  2IP2 A;  2UV1 A;  1T38 A;  1FBS A;  2XF7 A;  4OIN F;  3RQ4 A;  4U87 A;  1B6A A;  1FWZ A;  2O9L A;  3PFY A;  1QRY A;  2DQR A;  1QVU A;  3FXR A;  4PGG A;  3JRD A;  1S7A A;  1F43 A;  1WJ5 A;  5EZG A;  2QGU A;  2OD5 A;  3ERM A;  2AS5 F;  4MLO A;  5E20 A;  1MMN A;  3BJO A;  1FP2 A;  5HDK A;  4F3Q A;  2EZL A;  4AID A;  3SFI A;  4LMY A;  4IRG A;  2LC2 A;  3OR2 C;  3REO A;  2CQ7 A;  3PFI A;  1FTZ A;  1DUX C;  3GX4 X;  1MGT A;  3SXY A;  1S72 I;  3TDZ C;  2JUC A;  3ASN H;  4EM1 A;  1ENH A;  1X1P A;  1R49 A;  4DBQ A;  1YO5 C;  3OS2 A;  1OCT C;  3U21 A;  4WF2 A;  3OYI A;  3I55 I;  4HNT A;  2GWR A;  2WBM A;  3A02 A;  2CV1 A;  1DPR A;  3IKV A;  2YX4 A;  2JTV A;  1R4N B;  4Y33 A;  2GXG A;  3T0Y A;  2ZXI A;  4BU2 A;  2JJ7 A;  3Q3S A;  4IHT A;  1G3W A;  2ELK A;  4ZZL A;  1ZQ3 P;  3HOY J;  2A6H F;  1HSJ A;  2K4J A;  4A0Y A;  4BJ6 C;  3WE3 A;  2RDP A;  1BBY A;  3GBG A;  4B47 A;  1R5G A;  2LTP A;  1WGX A;  4CCO A;  1LDJ A;  3FDY A;  2WAE A;  1TNT A;  4Y3O A;  2L7Z A;  5C4X J;  3KP4 A;  2ZO4 A;  3GTP J;  2EQR A;  3DKY A;  2M0C A;  1T56 A;  2DA3 A;  1AKH A;  1IW7 F;  4ZYG A;  2P4W A;  2NS8 A;  3K4M A;  2ZNZ A;  2A61 A;  2XGC A;  1K78 A;  1O57 A;  1CF7 B;  3FMQ A;  2R7Z J;  3RSN A;  2XB5 A;  5E79 C;  3V4G A;  3OR1 C;  1SD5 A;  1E3P A;  2ZME A;  2PI0 A;  1LDD A;  3LWF A;  2JA2 A;  2E7W A;  3SFZ A;  5FKL A;  2HKX A;  3IC7 A;  4CGZ A;  2ID3 A;  3H1C A;  4CHU A;  2K27 A;  1FSH A;  4BQN A;  2BW3 A;  2Y0S A;  4BXF A;  3CJQ B;  1UJ8 A;  3FHN A;  2VON A;  2HR3 A;  1B9N A;  2ZXH A;  2GAU A;  3M7G A;  3ZQQ A;  4E7I A;  4XRM A;  3DKX A;  1OR7 A;  2XKP A;  4U0V A;  1LVA A;  2ZXW H;  5ILS A;  2P7C B;  1MJA A;  4XID A;  3S1N J;  1I3A A;  2FNA A;  2Q2E B;  4KN4 X;  5FRO A;  1K7A A;  2RN7 A;  4M3G A;  3PJR A;  1MMA A;  4ANJ A;  1WHU A;  4JQF A;  5K7Z A;  3OYC A;  3WOD F;  1VQN I;  1HOM A;  5KNL A;  2DA4 A;  4P96 A;  1WPK A;  1PP7 U;  3ECO A;  3LQR A;  2KRC A;  2LRD A;  4AWX B;  5LEJ A;  3HOT A;  2B63 J;  1DPU A;  1XC5 A;  2V9V A;  3M8J A;  4XL9 A;  2STT A;  3OYA A;  5K5O A;  5EGO A;  1Y8R B;  3COA C;  1MZB A;  2OTJ I;  1F9N A;  5L3D A;  1ZG1 A;  2CH0 A;  3U2R A;  1RRJ A;  5JLX A;  4GFB A;  3RDI A;  2A05 A;  3KP2 A;  3NAR A;  3QP5 A;  2ZJR F;  1IDZ A;  1Y56 A;  4A69 C;  3IHU A;  1SD6 A;  2NS0 A;  1MJ9 A;  2MH2 A;  4PZJ A;  1Y1V J;  2X4H A;  3RKY A;  3QYF A;  2XAG A;  2LNB A;  2FA5 A;  1XCB A;  3BR0 A;  3ERE D;  4HG2 A;  4WWC A;  3GTO J;  2PJP A;  3S1M J;  2L02 A;  2NOJ B;  4LLN A;  3W2A A;  3CZ6 A;  1ZRE A;  4FE4 A;  2Y75 A;  5CYV A;  1YG2 A;  3RKQ A;  4JBA A;  3J81 K;  3E5Q A;  4A6E A;  4QPO A;  2DDB A;  4XRF A;  4YG2 F;  1FYM A;  1T08 B;  2VXZ A;  1WKM A;  2E2I J;  1WQ2 A;  2GOM A;  3L2C A;  5ED4 A;  3LAP A;  1B4A A;  4OMZ A;  3HUG A;  3HZJ A;  4IKF A;  5IOZ A;  4XM3 A;  2XC7 A;  3RIR A;  1XGS A;  3OIO A;  4PGH A;  3BR5 A;  2O0Y A;  1QHH D;  3F8F A;  3H9Q A;  4PSW A;  1VQ9 I;  3HYI A;  2K7L A;  2RKH A;  2X0L A;  1UEL B;  4G6Q A;  2P5L C;  5FLV A;  5FD6 A;  3HL2 A;  4A3K J;  3L2V A;  1Z21 A;  1X3Z B;  1RR8 C;  2W82 A;  2QEN A;  4D5C A;  5EG0 B;  3CCM I;  4BAC A;  4EJT A;  2BZT A;  1Z7L A;  4KN7 X;  5B3S H;  1U9O A;  3G1M A;  4UNO A;  2R7S A;  3J81 Z;  1OCO H;  3F72 A;  4L5J A;  3VYU B;  4X0G A;  5LRR A;  3CD6 I;  4E7J A;  3IH4 A;  3MVP A;  4L5E A;  4O3M A;  1SAU A;  2H09 A;  5LLQ A;  4UUS A;  2E2H J;  1BJA A;  4IHS A;  2OU2 A;  3GME A;  2W25 A;  2R7U A;  2BVL A;  4WXC A;  2QKL B;  4B1R A;  1KQ0 A;  4L9J A;  3FKJ A;  2MA3 A;  3K1P A;  3T1B A;  3VPR A;  2K5C A;  4RMN A;  2XAJ A;  1P7J A;  4XMY A;  1TLH B;  3FWE A;  4LOC A;  1TW3 A;  2HDW A;  3CLO A;  4B09 A;  3DU6 A;  2XRO A;  2LH9 A;  5DTD A;  3QP6 A;  2R7Q A;  3FIW A;  3LNQ A;  2HPM A;  4HDV A;  5FRM A;  2GXB A;  2WWY A;  4AYB N;  2K9Q A;  1Q1V A;  3CF2 A;  3O8G A;  5E3O A;  2UXN A;  3S17 J;  1Z6R A;  4RB2 C;  2VBY A;  4XR6 A;  1G3S A;  1P4X A;  2VC0 A;  1SFE A;  2ISZ A;  1FY7 A;  2MH9 A;  3BQZ A;  3I59 B;  4EGY A;  1N77 A;  2NVU B;  3RZD J;  1UHW A;  2QSH X;  2WAQ A;  4GRI A;  1DP3 A;  1TW2 A;  1FEX A;  1QZE A;  5CVV A;  2M4K A;  1U5T A;  4HA8 A;  4B48 A;  1E3O C;  2KP6 A;  1HDD C;  3I71 A;  1ZK8 A;  1JJ6 C;  3F8N A;  1IRG A;  4ON0 A;  1YS6 A;  2O03 A;  1ZRC A;  4ZDP A;  2DW4 A;  4E4H A;  4EAT A;  3CCU I;  4LB5 A;  2HVR A;  5H2F C;  5J4Y A;  3ZQL A;  1D1B A;  4C3I J;  1IN7 A;  2DK8 A;  5K5R A;  4K2E A;  3GTM J;  2JSP A;  4C3J J;  1D0Y A;  2W1O A;  3EUH A;  3FK7 A;  4XON A;  1BR2 A;  1AU7 A;  3CDH A;  1YYV A;  2W85 A;  4OAY A;  3D0S A;  3RI4 A;  1VQK I;  1H89 C;  1RNL A;  3JRA A;  3MMY B;  1W5S A;  3A01 B;  3R0A A;  1MMG A;  1ACI A;  4BQA A;  2KMU A;  3G3Z A;  2XIG A;  3RTR A;  1P7I A;  2O8K A;  1QPI A;  2X6O A;  3F0C A;  3MZY A;  3IWF A;  1HF0 A;  1D5V A;  4HPQ A;  3GLL A;  4YIF A;  4ZYH A;  4EM2 A;  2OZ6 A;  1BM9 A;  4MO7 A;  4BDZ A;  2MBF A;  3DFG A;  1IN5 A;  5L3E A;  2EV5 A;  4M6X A;  2OCE A;  2FOW A;  2VAS A;  3H5A A;  3OYM A;  3FHZ A;  3HOZ J;  2IEK A;  4M6V A;  5HS7 A;  1TZL A;  3TOA A;  2GZW A;  2FE3 A;  2XPV A;  3GYH X;  2WB1 N;  2Y48 A;  5TGT A;  4E70 A;  3HGG A;  1S6L A;  3H3U A;  3O3K A;  5B1A H;  3AG4 H;  1K6O A;  1VTN C;  2V26 A;  4QTR A;  2PMZ N;  3CTA A;  4DZP A;  1ZEL A;  2QA4 I;  3CCR I;  1J7K A;  3H0G J;  2HFH A;  4DNC A;  4ABZ A;  2HOT A;  3F21 A;  5E1Z B;  4PJL A;  4W97 A;  5D6E A;  3TOB A;  3K2A A;  3WTW C;  1GXP A;  2PN6 A;  3PO2 J;  4U7B A;  3FXJ A;  3ZCO A;  2DMP A;  3HTS B;  2IS4 A;  2XKO A;  3HHG A;  4HX4 A;  5LHG A;  2RQQ A;  1ETK A;  5J4V A;  5DCF A;  2QWW A;  5LEK A;  2JPB A;  5HDN A;  3TGN A;  1STZ A;  3VEP A;  2ZBK A;  3GUD A;  2GA1 A;  3OSF A;  1A36 A;  1RIO H;  2VL8 A;  4KIG A;  2BY1 A;  2E60 A;  3CCL I;  1XX5 A;  4RA2 A;  2KL4 A;  1A31 A;  5IOY A;  2ESH A;  1MSE C;  2QBY B;  1WSU A;  3EQL F;  5M3F J;  2AQF A;  4AC0 A;  5GAG J;  2BBY A;  3Q5F A;  3MKZ A;  2LFB A;  2QQ8 A;  4E7K A;  4A3B J;  1LE8 B;  4UUT A;  5IP6 A;  2R7R A;  2F6C A;  1LFU P;  5J47 A;  4QSH A;  2CUJ A;  3PUB A;  3CLQ A;  3K70 C;  4GYI A;  4B43 A;  2BOL A;  3PQK A;  2ZC2 A;  4F93 B;  1FOX A;  2NVY J;  2Z5U A;  3L00 A;  3O6B B;  3BG9 A;  1VI0 A;  2L7M P;  1FLI A;  2R7O A;  2IA1 A;  1K61 A;  2WA0 A;  3JTH A;  3W6K B;  1FSE A;  2FQ3 A;  2M8E A;  3SHF A;  4CZC A;  1EF4 A;  1D5Y A;  5D5W B;  3MKY B;  2W84 A;  2LDU A;  4BEH A;  1GVJ A;  4JK1 X;  2H94 A;  4KMU X;  3LSK A;  2K9N A;  3UNG C;  2CUF A;  3DTK A;  2D1V A;  3TL4 X;  4G9Y A;  2HVQ A;  3B6A A;  1OYI A;  4WK8 F;  1UFM A;  2KHM A;  2ZJP F;  1WJB A;  2D1H A;  2JN6 A;  1E0E A;  2KPM A;  1HCR A;  2X51 A;  3ZR8 X;  2LG4 A;  3A0B C;  3CCQ I;  3DBR B;  2Z2S B;  1RKT A;  3LA3 A;  2Z1D A;  5EEG A;  2F2E A;  2L7K A;  3LSP A;  1YW8 A;  4ZTF A;  3SJM A;  4G6T B;  2KFD A;  3B6C A;  2WTE A;  3DQV C;  4ESB A;  5LGT A;  3GTG J;  1SFX A;  5CQG A;  1U8B A;  1ZYR F;  2DN0 A;  3H92 A;  4KT6 A;  1XDU A;  1H9T A;  1V54 H;  5L3G A;  1NK3 P;  3HB9 A;  4M71 A;  2M87 A;  4PFP A;  2MW8 A;  4Q47 A;  4JX6 A;  4NQW A;  5AIQ A;  1QA6 A;  1GV2 A;  4KDP A;  1D0Z A;  3BR1 A;  3BG5 A;  4I09 A;  5J8C A;  3KFW X;  2H8W A;  5F04 A;  2JRM A;  2YSR A;  1UAA A;  1S3J A;  4P5O A;  1Z7U A;  1JT0 A;  2HQ5 A;  2H8R A;  4XLH A;  5M5W J;  4QLC U;  2HTS A;  4B8X A;  1MNM C;  2QQA A;  1TTY A;  3MFK A;  1SD7 A;  3FX3 A;  1RKW A;  5FB2 A;  3IH3 A;  3IRR A;  1X58 A;  2EV6 A;  3K4C A;  3KYD B;  1W0U A;  4U7D A;  2V79 A;  3MD2 A;  3C7J A;  3H5N A;  3W6V A;  2UZK A;  1K4T A;  2NVQ J;  3GZN B;  2JWT A;  2E71 A;  2E5Z A;  2X6Y A;  2AHQ A;  3K4J A;  3S16 J;  4FCY A;  1VND A;  3OS1 A;  4PJJ A;  4OAZ A;  3L2Q A;  2L54 A;  2Y9Z A;  3HOW J;  3CCJ I;  3E6M A;  4DZJ A;  3GFI A;  3H9J A;  1OJL A;  3HG9 A;  2KJC A;  4XOT A;  4I01 A;  5FFZ A;  3SEZ A;  1ON2 A;  2CJJ A;  3FK6 A;  4UHT A;  2M8G X;  3E1S A;  3E7L A;  3KEO A;  2HDC A;  2EFP A;  4IZZ A;  4A0Z A;  3SDB A;  4Q48 A;  1R00 A;  2L2O A;  4A5N A;  3DWL E;  4AIJ A;  1GLN A;  1W5C C;  4RAZ A;  3S1R J;  2L7F P;  2KRF A;  3BRO A;  4W1U A;  1K79 A;  1SAX A;  4CYD A;  4YEJ A;  3LMM A;  4V19 K;  4IJA A;  5ICG A;  2L4A A;  5TJJ A;  5DUI A;  1YRN A;  3SEQ A;  2M9H A;  1YJ9 I;  3HSE A;  1H8A C;  4IXA A;  1W7P B;  1CGP A;  3C2G A;  4ITV A;  5LHI A;  5J8F A;  2K40 A;  1OCP A;  3BR2 A;  4IHV A;  2K02 A;  2LK2 A;  3NQO A;  4HST A;  3OMY A;  2JA8 J;  4AD9 A;  1MD0 A;  1YW9 A;  2CS3 A;  3CJT B;  3S3N A;  1X1B A;  2WAF A;  2Z16 A;  4M9S A;  2FRH A;  2W57 A;  2ZB9 A;  2QZ8 A;  3T8R A;  1IN8 A;  4CUG A;  3ZQH A;  5FKO A;  5GPA A;  1U2W A;  3I54 A;  2R5Y B;  4KA4 A;  3LSI A;  4Z6Y A;  4M3D A;  4HNV A;  2JVG A;  5HDG A;  4HRI A;  3ML6 A;  5LFA A;  2BYV E;  2M7A A;  5ILU A;  1XCV A;  2DK5 A;  3LSM A;  3PL8 A;  1C0W A;  3P5J A;  2MLG A;  2VBZ A;  4XLA A;  2AXT C;  4RB3 C;  1B72 A;  2E1C A;  4BNC A;  4LG0 B;  2XHK A;  3AKZ A;  1QPM A;  5H6R A;  4KMF A;  3AL0 C;  4BBS J;  3FBI B;  4IX7 A;  4XKV A;  4IQ4 A;  3PM1 A;  4XOR A;  5DD4 A;  2G7U A;  3K7A J;  1WCM J;  2HNH A;  2ZCW A;  4ZYD A;  5EJC A;  3LQQ A;  1BR4 A;  2ID6 A;  3W3C A;  5FLM J;  6PAX A;  2BY0 A;  1L0O C;  1HBX G;  2RVC A;  1P92 A;  2IBD A;  3K2Z A;  5DCM A;  4QIW N;  1VQ8 I;  3E3V A;  5HVQ C;  1PUE E;  1WJA A;  2D45 A;  3OOU A;  2VJ4 A;  1BC7 C;  3KZY A;  2DYR H;  5C3E J;  3KP3 A;  2D2W A;  1TQI A;  4CCN A;  5ICC A;  4P9F A;  3Q0U A;  2VQG A;  4KT5 C;  2E1M C;  2BY3 A;  2DA5 A;  2OCC H;  4QWQ A;  5CVR A;  1HW2 A;  2LBF B;  2KDZ A;  4RBO A;  1HXD A;  5FFX A;  3ZMD A;  4D5F A;  1D8J A;  2CQK A;  4HOB A;  3BPX A;  4C3H J;  4UY8 I;  2CWE A;  3P9C A;  2CW8 A;  1SMY F;  3DTE A;  4O6J A;  4EQQ A;  2FNP A;  1V5G A;  1T98 A;  2DFF A;  1YW7 A;  5D8K B;  2OF7 A;  1XPX A;  5FKK A;  2WY8 Q;  2V6E A;  3WU2 C;  2O5R A;  3RPU D;  5BNG A;  2IGM A;  3CCV I;  1YJN I;  2OPT A;  4XLF A;  2EIL H;  4NC6 A;  3D5S C;  4ESJ A;  4MIM A;  3PNY A;  4CCK A;  2VT2 A;  3DLA A;  5GAD J;  5F27 A;  4CYC B;  5B66 C;  1XMA A;  5BS6 A;  4F92 B;  4E7H A;  3LFU A;  3OL3 A;  1APL C;  5FJ8 J;  1ZG5 A;  1V5F A;  5GTH C;  4ZTJ A;  3KX2 A;  4XSX F;  5AON A;  3W6J B;  1P4W A;  2HEO A;  1PJR A;  1FC3 A;  3F23 A;  2ZME C;  3TW6 A;  1BI2 A;  2G7H A;  3OYH A;  1JHF A;  3CCS I;  4H0E A;  2LD5 A;  1ZN2 A;  3ONQ A;  2VQC A;  2M30 A;  5E3L A;  2IGO A;  1K6Y A;  5JFR A;  2EIJ H;  3H35 A;  3WHB A;  3GO5 A;  2F5E A;  3UKG A;  4NHJ A;  3JAM K;  2NS7 A;  2DOD A;  4M3B A;  4BUP A;  1XMX A;  2EZI A;  2HPI A;  3FXO A;  1JKP C;  3B02 A;  3I56 I;  1R22 A;  2YX7 A;  4C2T A;  4G7H F;  1XD7 A;  2MAB A;  1T39 A;  3HBL A;  2UWM A;  2IVM A;  2X6W A;  3ZQF A;  5D5U B;  4N9I A;  3QPL A;  1ULY A;  2Q1Z B;  4YFX F;  1LDK B;  3QPS A;  4NC8 A;  2HYG D;  4HV6 A;  3JSO A;  3TED A;  3D5L A;  4O5V A;  2COB A;  4G94 A;  3S8P A;  1V4R A;  4EJU A;  1UZC A;  5DS9 A;  2OZU A;  1YQA A;  5J1U A;  3G4S I;  3U1D A;  2VQL A;  4D1Q A;  2HOE A;  4HYE A;  4XRS G;  4A3C J;  2P5V A;  1TC3 C;  3LSR A;  1QZY A;  1REP C;  1W0T A;  1MBH A;  4OIP F;  4LD5 A;  1POG A;  5K7F A;  1JKQ C;  3MCZ A;  3I59 A;  1SD4 A;  3EYY A;  4E6K G;  2VOO A;  1DQU A;  4U0Y A;  1U0J A;  3VSL A;  3JTG A;  1IF1 A;  1BW5 A;  3JAM Z;  1R1U A;  2X48 A;  4LB6 B;  4BH9 A;  2DYS H;  1V5E A;  3KZI C;  2I5U A;  1BC8 C;  2BV6 A;  2JT1 A;  1LKX A;  4Y13 A;  5GTI C;  3VYR B;  2VBW A;  3W2V A;  4A3I J;  2JZY A;  2KKO A;  1IO2 A;  2FEZ A;  1MBK A;  1O3R A;  2A3S A;  1Z91 A;  1JI8 A;  1BOA A;  2OQG A;  3HJE A;  3DBH B;  5H6Q A;  1A04 A;  2CFX A;  1OCC H;  3I58 A;  1G3Y A;  3K69 A;  2R5Z A;  1W7P D;  1RZ4 A;  2L5Q A;  3CMM A;  2AO9 A;  4X6A J;  3BZC A;  1J09 A;  4AVZ A;  4FET A;  2DBB A;  1X3U A;  3F3X A;  1F5T A;  5JHF A;  4ESF A;  2RNJ A;  2CGP A;  3FM5 A;  4LIU A;  4F7Z A;  5D6F A;  1W36 C;  4GYG A;  3FKI J;  2QKM B;  5F6F A;  3OIQ A;  3DLL F;  1EH7 A;  3K9T A;  3R60 A;  4HQM A;  2IRF G;  2R7V A;  3R61 A;  1GV5 A;  5E17 F;  5IP9 J;  3DPL C;  2IW5 A;  3VDX A;  1T8I A;  3CUQ A;  4I6Z A;  2QSG X;  2IJL A;  2MGQ A;  4KIB A;  4N4N B;  4S05 A;  3WGI A;  3BZ6 A;  5GP9 A;  3ZMU A;  2OC6 A;  4MEY F;  1LJ9 A;  2XSJ C;  5FO5 A;  4CDG A;  5CVU A;  3I9V 2;  2Y31 A;  3TQN A;  2M1B A;  1R36 A;  1ZGA A;  4RGU A;  4GXO A;  2CFO A;  1IRF A;  1R58 A;  1FYK A;  3H3Z A;  1OQY A;  1IRZ A;  2BXY A;  1MNE A;  3AL0 B;  5F1R A;  2XAH A;  4NUB A;  2EIM H;  2Z33 A;  5GPC A;  1BI0 A;  5BPI A;  1U3E M;  3PIO F;  2DTZ A;  4A3E J;  2XAS A;  4MFE A;  1IDY A;  2V4J C;  1I1S A;  3MQ0 A;  1X2N A;  3PO3 J;  3H9G A;  1IXS B;  3BLY A;  2HQR A;  3J7Y J;  3JRG A;  5DDG A;  1B8I B;  3LSG A;  2L4M A;  5HLT A;  2E7X A;  3PNT A;  3BC8 A;  4L9N A;  2E1M B;  2YUS A;  1KU9 A;  4IVN A;  4IEJ A;  3CCY A;  3K70 D;  1G8X A;  3MZ8 A;  4HF1 A;  1U5T C;  3TDU C;  1RET A;  2CQX A;  4C2U A;  1VQ5 I;  2PMU A;  3JRE A;  3OYJ A;  2HQA A;  1SEU A;  2ICW G;  4C9Y A;  2PFB A;  1UG2 A;  2PJR B;  5J6X A;  5F08 A;  2FBH A;  5K5Q A;  2COM A;  5KAI C;  2PLY A;  2HU9 A;  3ZQC A;  4BY1 J;  2ME0 A;  2A68 F;  2XAQ A;  1ETO A;  1QHG A;  4U88 A;  3ZPL A;  3DCF A;  1WH7 A;  1HQC A;  2W24 A;  3EUH C;  4CIC A;  1WWX A;  3HRM A;  4HLY A;  4OU0 A;  1T95 A;  5IP7 J;  2ELJ A;  4HSR A;  2LKX A;  2X85 A;  4PJM A;  2F4I A;  3O2P E;  3GCM A;  3QOP A;  4A6D A;  1JGS A;  4A3M J;  3VYT B;  1J75 A;  3RPU A;  2VT3 A;  3QOE A;  1MDM A;  1FMW A;  1UHM A;  1K78 B;  1KU7 A;  2ELH A;  2K9M A;  3A4C A;  3V8K A;  5LD2 C;  3C1D A;  2FX0 A;  2EK5 A;  4Y17 A;  4EM0 B;  4CSW A;  4I2O A;  1G2H A;  3QQA A;  1B9M A;  2ZME B;  4XLE A;  1Z3Y A;  2JRT A;  5IYB J;  1S9H A;  3HXL A;  3ZN1 A;  5EDN A;  5CLS A;  4F55 A;  2VKE A;  3ASO H;  2E1O A;  4IO9 F;  4BYY A;  2LRE A;  4RM2 A;  5J1Y A;  2XF5 A;  3MKL A;  2XF6 A;  4AIH A;  1ZLJ A;  1UG0 A;  2MD5 A;  3TP0 A;  4HX8 A;  2LR8 A;  3EPZ A;  1VQ4 I;  3BTL A;  3BPV A;  4JYK A;  3SDG A;  5DD8 A;  1NH3 A;  1E2X A;  3TMO A;  1USS A;  2LY2 A;  1PUF B;  4Y4R A;  2ADU A;  1HC8 A;  1U8R A;  4G7O F;  2K9S A;  2VUM J;  2DQL A;  1JKO C;  2PX9 A;  2MFZ A;  4EJO A;  5JLW A;  1VQ7 I;  1YTY A;  3GFM A;  2V1D A;  2KIF A;  3D1N I;  1A6Q A;  1EH6 A;  5M3M J;  1T0F A;  1ZRF A;  4EMS A;  3DP7 A;  3FM3 A;  4E7Z A;  4I99 C;  4L18 B;  2RC4 A;  1JXS A;  1XGN A;  2HI3 A;  2EB7 A;  4MHG A;  2EPF A;  4G8X A;  1FIA A;  3JR9 A;  5IYC J;  2FMY A;  1ORK A;  4BQQ A;  1TWF J;  4XN3 A;  2CV2 A;  3L2R A;  3F6V A;  3OYE A;  1HLV A;  2JUG A;  1U6G A;  1R6R A;  2L0K A;  4E7L A;  3I4M J;  3BP8 A;  3HIF A;  5DEQ A;  4LLG F;  3UR3 C;  2ESN A;  3V8L A;  2CW0 F;  2HYJ A;  1MBJ A;  4UVA A;  1I5Z A;  1HDP A;  2VKV A;  2RAE A;  3HTU A;  2QQ9 A;  4HV5 A;  4J19 A;  2DO7 A;  3G73 A;  2CQQ A;  3E6C C;  3ZQI A;  3FXK A;  4B44 A;  3V7C A;  3N05 A;  2GIV A;  1FOY A;  1SVM A;  3FXU A;  2EFO A;  3R6S A;  3VSK A;  3WTT C;  1I50 J;  2HYF A;  3HUG B;  4IHY A;  3CO7 C;  3KPH A;  1B1B A;  2DMT A;  4MQV A;  1JKR C;  1FOW A;  4HF0 A;  1F36 A;  2JA6 J;  1IXR C;  2DAO A;  2ME6 A;  4RDU A;  2M2E A;  1PYV A;  4XLP F;  3U9G A;  3V7S A;  2CQN A;  2GM4 A;  1G3T A;  4AYB A;  2VJI A;  2DPD A;  1EA3 A;  4R79 A;  4HZF A;  2XRL A;  3H3V K;  4LJZ F;  3S14 J;  3M07 A;  3S1Q J;  4LK1 F;  2DT6 A;  3R0J A;  4XOP A;  1EH8 A;  3RYP A;  1O3Q A;  3KET A;  1Z0X A;  1O3S A;  2EBI A;  1W7P A;  2VJJ A;  4BHC A;  1OYY A;  2ZKZ A;  3Q0W A;  2OAZ A;  1ZR2 A;  4XRS A;  3LSJ A;  2M5W A;  5E8G A;  2FSW A;  1IXC A;  3DEW A;  3NWS A;  5LBQ A;  2X1E A;  4XBF A;  2QVO A;  3CES A;  1WJF A;  4A5M A;  1OCR H;  3Q9V A;  5D8L B;  2NYX A;  4JX5 A;  2STW A;  2K9L A;  2CG4 A;  1UMQ A;  1PVE A;  4GGG A;  4UUS B;  1FBQ A;  1XMK A;  1V55 H;  3LSH A;  3K1N A;  1KQ8 A;  2GQQ A;  2BHZ A;  3RZO J;  1XN7 A;  1R1V A;  5J3L A;  1TQP A;  1NTC A;  5A2Q K;  4AUX A;  1X4O A;  1OKR A;  3BTI A;  2E35 A;  3ZMZ A;  2HGC A;  3H36 A;  3HSF A;  3FMS A;  2H1K A;  1WRJ A;  2DOA A;  4A12 A;  3OWT A;  2G9W A;  1YS7 A;  1ZR4 A;  1IG7 A;  4U0W A;  4BL0 B;  4G12 A;  2R7T A;  1D0X A;  2VE9 A;  2HQN A;  3P7N A;  2VPR A;  1IZ1 A;  1MW7 A;  4RAF A;  2K85 A;  3CMA I;  2RQP A;  5M5Y J;  4A3D J;  5JVT A;  4AVP A;  3GTK J;  4IOA F;  2HS5 A;  1YX3 A;  1FJL A;  5LGN A;  3WU1 B;  3AG2 H;  2XPU A;  3DV8 A;  3TW7 A;  4HDU A;  5DM6 F;  2LF7 A;  1AWC A;  2FUG 2;  2MD0 A;  3F8B A;  1R5H A;  1NG6 A;  2BE5 F;  1NK2 P;  4DJA A;  4XN0 A;  3ROU A;  3K6G A;  2MLK A;  2CMP A;  2W00 A;  1BN5 A;  1GVD A;  1U5T B;  2K3P A;  2O3F A;  2CO5 A;  2WB1 A;  5A2Q Z;  2Q0O A;  2LBF A;  3NAU A;  3OIP A;  2DFH A;  5EZH A;  4ENN A;  3CP8 A;  3HKZ N;  2LLK A;  1D1A A;  2LKP A;  2M45 A;  2PMZ A;  2VC1 A;  4PK4 A;  3LA7 A;  4J01 A;  2QCO A;  3HEF A;  1F1Z A;  2QM3 A;  4UUV A;  1UST A;  2XAF A;  4MTD A;  2FML A;  2QLZ A;  1TQM A;  4M3E A;  4AU7 A;  1S7O A;  2V6C A;  2JA7 J;  2CSO A;  4N9H A;  1HW5 A;  2HWV A;  1ZH5 A;  2P6T A;  2VB6 A;  3LOC A;  2F5F A;  3HRU A;  4RLQ A;  2BGC A;  2Y0M A;  1S7E A;  2ZFW A;  1J0R A;  2P8T A;  3BCA A;  4I98 B;  2M4G A;  1GXQ A;  2Y30 A;  4KYW A;  1LEB A;  3TP3 A;  2QUF A;  4MQ9 F;  2VN2 A;  2XUB A;  3SYT A;  4LK0 F;  2EV0 A;  3C2H A;  2XVC A;  1BJZ A;  2HXI A;  1WFX A;  2X6X A;  2NVX J;  1AHD P;  2VE8 A;  3K0L A;  3V8J A;  3O8H A;  3A0H C;  3B73 A;  2OJE D;  3J7A Y;  2NNY A;  4F91 B;  2A07 F;  1MMD A;  3JW4 A;  2R7X A;  2E1N A;  2DA6 A;  3M1E A;  1F4K A;  2DMQ A;  4B3A A;  3JRH A;  3HDD A;  1TT0 A;  3CJN A;  3S93 A;  1QGP A;  1ERD A;  1ZG3 A;  4WX9 A;  3OYB A;  2QF7 A;  2EFN A;  3S2H J;  4NB5 A;  2FJ1 A;  2MC4 A;  3CC4 I;  4FTH A;  2IA0 A;  2Y69 H;  1P2F A;  3BG7 A;  1IV8 A;  2W48 A;  2OBP A;  3ZMT A;  1FIP A;  2RNG A;  3ELK A;  4BXU A;  2A5Y B;  1TWC J;  5HNF A;  4PDK A;  4D7N A;  5ILV A;  5L3B A;  1J2X A;  1SVL A;  3WTV C;  2A6E F;  2FXA A;  1FZP B;  1I3Q J;  1JHH A;  4KIF A;  3CF5 F;  5KHD A;  1CF7 A;  4OOI A;  2Q8K A;  3IH2 A;  2F4M B;  4II2 A;  2MG4 A;  2ZSI B;  3MKW B;  2QSF X;  2R93 J;  2DOF A;  2K4B A;  3Q9S A;  2F48 A;  3HOS A;  4YEL A;  2VBX A;  1AA7 A;  1OPC A;  2PG4 A;  3WG9 A;  1TWG J;  1OCZ H;  3HOX J;  3M3Y J;  4PCQ A;  2HOS A;  2DDA A;  3K4L A;  2CV0 A;  1OIS A;  2DFI A;  2YU9 J;  2E2J J;  1X19 A;  1ZAR A;  4UV9 A;  4FHT A;  1YIO A;  3WTZ A;  3JRI A;  1ONV A;  1R23 A;  3IP4 B;  5DYM A;  5BPD A;  3I0T A;  2DFE A;  3ZP5 A;  4PJ0 C;  4F52 A;  4BDY A;  3KEY A;  2L9S A;  3KZZ A;  2Q2E A;  2TRT A;  5L3C A;  1QVT A;  4BE2 A;  2JQ7 A;  1JTX A;  1J59 A;  3IV5 A;  2R0Q C;  4HAM A;  4BE1 A;  3Q0V A;  4V2G A;  1MIJ A;  3LAJ A;  5HLI A;  2EWN A;  3LA2 A;  3S32 A;  5IT9 K;  2WV0 A;  4TV7 A;  2DMU A;  5DV5 A;  2BEO A;  3OYL A;  2B0L A;  2L9N A;  4L0Y B;  2R4G A;  5J1R A; 
#chains in the Genus database with same CATH homology
 2QSF X;  1PVE A;  3ESW B;  1TP4 A;  1X3Z B;  1OQY A;  4YIR X;  1QZE A;  1X3W B;  2F4M B;  2QSG X;  2QSH X;  2F4O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...