1X3ZB

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
GSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide: N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1x3zB01
2QSGX 1TP4A 1OQYA 3ESWB 2QSHX 1X3WB 2F4MB 4YIRX 2F4OB 1QZEA 1PVEA 1X3ZB 2QSFX
chains in the Genus database with same CATH superfamily
1I1GA 2A3SA 1R1UA 2V6EA 2KL4A 1PUFA 3RKWA 3HUGA 2IA1A 4ZJZA 3VSLA 1Z0XA 3S15J 4UVAA 5F0FA 2R5YB 3G6EI 1EH7A 2VBWA 2IXSA 2LRDA 2OAZA 2DJNA 4G94A 3ZR8X 2DA6A 1YLFA 1JXSA 4N0BA 2LF7A 4A3JJ 1WWXA 1XCBA 4RM2A 5EZGA 4GDFA 2ESHA 1FC3A 2XC7A 1LQ1A 2I10A 3DPUA 1ZRFA 2KIFA 3W6VA 2FQ3A 1Q1HA 5K7ZA 1W36D 5FLXZ 3WHCA 2Y75A 3F8NA 4XSXF 3RSNA 4L9NA 4KYWA 3IHUA 3BG3A 1CF7B 1D1BA 2R7FA 4XL9A 2EIMH 1L0OC 4XLFA 1WZ2A 1JUPA 4IZZA 1E17A 2AXTC 1YJNI 4M6VA 1DPRA 3IKTA 5EYRA 4DQ2A 2VQHA 3RKQA 2UZKA 2XGXA 3HRMA 4MQVA 4L9JA 3R4KA 5E1WA 2L4AA 4BHCA 1GXPA 4KUMA 1GLNA 1TZLA 2D5VA 3DP7A 2GXBA 1MBHA 1FP2A 1P4AA 1S7AA 2CH0A 1U2WA 3CMAI 4QPOA 3QYEA 3LSIA 1I27A 5IT3A 2VPLA 1RZ4A 2BVLA 3OYLA 2IS6A 3K4KA 5EZHA 2BGCA 5E18F 4JOMA 3ZQCA 3I64A 3K4LA 3FXJA 2Z33A 3ASNH 3FHZA 2F5FA 2M30A 3ERMA 2UXXA 4XLPF 3F6OA 2JSPA 2Z2SB 3F8MA 1PUFB 2DO7A 3MKLA 3HOYJ 3JRAA 2XGDA 5J1RA 3CO7C 1CQTA 1JGSA 3HOXJ 3QAHA 5BS6A 2F5VA 3H9QA 4LJZF 1FMWA 2CMPA 3BJ6A 1K61A 1SFEA 2E1MB 1YO5C 3AG4H 4BHPA 5DUKA 1BC8C 2VPRA 5EJCA 2MG4A 4DBQA 3GXOA 3DKXA 2CS3A 4XNFA 2R7VA 5HLHA 1VQ8I 4C3IJ 1F9NA 1GUUA 1BOAA 2EIKH 3ZQFA 1P9QC 4EMSA 4CCKA 3ASOH 5LBQA 4KISA 2DN0A 3BR5A 3H9JA 4CCMA 4KITB 3LAJA 4J01A 1B9NA 4BQQA 5L3FA 1IJWC 2KIMA 4C30A 1OYWA 3CC2I 1USTA 5FKMA 4Q47A 4DNCA 3KX2A 1RPWA 3PNYA 4FISA 3VB2A 1TWAJ 2Y0MA 4MO7A 3D1NI 3OYKA 3LOCA 4W97A 4E4HA 1YQAA 2DLLA 3CDLA 4CDGA 2E35A 1UFMA 1SMYF 3MKYB 3HSEA 1X58A 3PL8A 4M9ZA 4MGRA 1YJ9I 5HLIA 3I54A 4BS9A 2DDAA 1X19A 2LTPA 2DFFA 1WJ5A 1T39A 3CMMA 1Q1VA 1LVAA 4BACA 3WTZA 2Z3YA 4ENNA 1ZGAA 3K7AJ 3ML6A 2AO9A 5LEKA 1J75A 1P4XA 4P5OA 2VJIA 2DK5A 5JI6A 4CO8A 4M9XA 1BM9A 4HV6A 3IH3A 5D8LB 1NH3A 2IP2A 2HI3A 2EWNA 3GMEA 1IN6A 2X1EA 5DCMA 1RI7A 3HL2A 4PSXA 2YPRA 3NWTA 2GA1A 3OYBA 2L7KA 1SD6A 3OOUA 2NAZA 5FLMJ 4XLEA 3HRUA 3E6BA 3KEYA 4NC7A 3X2QH 3TW7A 1Y8RB 4IRIA 1VI0A 2GQQA 4U87A 2F48A 5HDGA 3C2HA 2ELHA 3BWGA 1N78A 4A0YA 1KONA 3AFHA 2A61A 4AIKA 2XAQA 1FBQA 2DBBA 1GV2A 2KIQA 4E7KA 2W85A 4M3GA 4RDUA 3GWZA 3HHGA 1RKWA 5L3EA 3PUFA 4M9SA 3L2CA 1TLHB 2HGCA 1QU3A 3V8JA 2IA2A 5DUIA 4LG0B 3LSKA 4L0ZB 1YW9A 4OOIA 5JHUA 5EG0A 2BEOA 3V4GA 3LNQA 2M7BA 2IGKA 4B1RA 4M73A 2VJ4A 3QPHA 1JTYA 2NNNA 4KN4X 4Q4ZF 1HKQA 4LITA 1IC8A 2FRHA 2QSFX 5FKLA 4RB2C 4PCQA 2P5LC 2W57A 3SFIA 3BDDA 2WAFA 3E3VA 1FNNA 2W84A 3R0AA 2ECCA 4MHGA 1JKQC 3Q0UA 3H35A 3HSFA 5GPCA 2BOLA 4PFPA 3LA3A 4I01A 2VASA 1XDUA 1VQ4I 1V5EA 3HPHA 3ISPA 1IXCA 5M3FJ 1RUNA 2O61A 2VJJA 1DPUA 2RNJA 3S32A 2ADUA 2P6TA 3F8FA 1JJ8C 1ZK8A 4HLYA 2L4MA 1Z21A 2IGOA 1U3EM 4KFCA 1GDTA 4UXNA 4C3JJ 1Z77A 3JRBA 2TRTA 3A0HC 3B02A 1ZG1A 1BIBA 1Y0UA 2A69F 4FE4A 1R5GA 4BY7J 4NQWA 4XLNF 2KP6A 4RBOA 1LE8A 1IRFA 1AA7A 3LMMA 4WK8F 4OWRB 4ZDOA 3CJQB 1XGOA 3CJRB 2CYYA 3HEFA 2CQQA 5FFZA 2CV2A 2WV0A 2ZCWA 3JRCA 4ZYDA 3LSHA 2ZSHB 2EZKA 3HIFA 4LGWA 2OTLI 3OYDA 3BC8A 1MNMC 4V19K 1KZHA 1I3QJ 2ZC2A 2M87A 3FX3A 2W48A 3FXQA 1BA5A 3OS1A 4RLQA 5CQGA 4X6AJ 4I0AA 2XAFA 2HKXA 2JJ7A 3HC7A 1ON1A 2QWWA 1X3ZB 4L5EA 2VODA 2H94A 3T0YA 1LVKA 2Q1ZB 5ILSA 1DGWY 2ECBA 2MW8A 4Z6YA 5M5YJ 1X3WB 1XSVA 1GXQA 4XKWA 4U88A 1W5SA 2ELJA 3TO9A 4JX6A 2VUMJ 1Z91A 5K1YA 2VT3A 1D1AA 5A2QK 1P7IA 1R00A 4F3QA 3TP3A 4CSWA 3GX4X 1G3YA 1R5HA 1XSXA 5KNLA 2VQLA 4B43A 1KU3A 1JGGA 4E6KG 2HWVA 3F22A 2O0YA 1ZGWA 3GZNB 2D2WA 1FEXA 2V9VA 4I09A 3CCSI 5BPIA 3CLOA 4XLAA 2LD5A 4XLHA 2QF7A 3EPZA 2XAJA 1WJEA 1T56A 4RGSA 2FSWA 3ZXSA 4EQQA 4UUSA 1V5FA 5BQTA 3DTEA 4ASNA 3DPLC 2CW8A 1VQLI 4HEA2 1LE8B 3DXJF 4BJ5C 1WRJA 3I9V2 2AQEA 2RQQA 3IC7A 3PM1A 1NK2P 4DOZA 4XKBA 1ZG3A 1J0RA 3QOPA 3NWSA 1OLTA 1UAAA 4S05A 3A01A 2BV6A 2QZ8A 3OIPA 2W00A 4PGGA 1IN5A 4DW6A 4P55A 2B7EA 4AUXA 4L0YB 4B48A 1W5CC 2G7UA 2OZ6A 2X1CA 2JVHA 4FT8A 5HNHA 1FOWA 2COBA 3W6JB 3GBGA 1XD7A 5GADJ 3GFIA 3I3LA 4BH9A 3MFKA 2B63J 3P9IA 1QPMA 1OISA 3DKWA 1MJ9A 4IHTA 5E3OA 1PJRA 1BOBA 4RAYA 1ZQ3P 1U8RA 3FXUA 4MQ9F 1LFPA 2NS7A 5FKNA 1Z05A 5DS9A 3S1NJ 5D4SA 4GXOA 2IS4A 4KMFA 2J5OA 4MTDA 1UZCA 2O03A 2RGVA 4RMNA 1WPKA 1H9TA 1DUXC 4BYYA 4HAMA 4XSZF 2FOKA 1Y6IA 4AIHA 2FU4A 3AG1H 3LWFA 5E8IA 3IRQA 3A4CA 1FOYA 4WWCA 1OCZH 4R1HA 3MZYA 3MAJA 1QZEA 2W24A 4PFOA 4U7DA 3RYRA 1HQCA 2JT1A 4EJWA 5IP6A 4UUSB 1KU2A 4JX5A 3HOWJ 5B66C 2Z1DA 1XGMA 1P6RA 3LFUA 1IV8A 2BZTA 5DV5A 2HYJA 1STZA 3WTSC 2P0WA 1ZELA 2WBMA 1SVLA 3BPVA 2MH9A 2QBYA 4I7HA 4HG2A 4EATA 3TOAA 2GM4A 2O5RA 1ETWA 3S8PA 3ZMDA 2IVMA 4DYQA 2CQ7A 3A01B 2R92J 4LLLA 2OBPA 3SHFA 1RNLA 1SVOA 2X4HA 4UY8I 3S16J 3ABKH 4II3A 2MA3A 2W82A 3BR3A 3BQYA 3HKZA 2JVGA 1GV5A 3I59A 2QEXI 4F7ZA 4KMUX 4A93J 4IRGA 2IT0A 2XF7A 2OZUA 1JUMA 5E8GA 4NUBA 1O4XA 4XR6A 1HW2A 3S1QJ 2M0MA 4XKVA 3ZCOA 1VNDA 5ICCA 2QA4I 2F2EA 2PMZA 2HOTA 1TWHJ 3MD2A 2BVMA 3ZQHA 4A3MJ 3P9KA 2N8GA 2XAHA 3DWLE 4ZYGA 4KT6A 1U5TA 4FHTA 2CUEA 1HLVA 2VKEA 2E34A 3HRTA 4KIBA 3JCUC 4A3LJ 2LF8A 1P4WA 2JUCA 2F5EA 4LK1F 3RYPA 2HQAA 2VQGA 2O8KA 3HOZJ 4JP0A 2KDOA 3BTJA 2NVUB 4WCGA 1SC7A 5IOYA 3KEQA 3D5LA 2WADA 1OR7A 4OINF 2KZVA 5LFAA 2NXNB 3QODA 3WGHA 4W1UA 3VPRA 4XRSA 3FMQA 1HKTA 3ECHA 2LYCA 2PBIA 3GTPJ 1A35A 4NDLA 3IV5A 5JVGF 4RB3C 3OS0A 5DCFA 2DDBA 5KK1A 2QBYB 2YX7A 2DA4A 2L9SA 2Z16A 3REOA 2DFIA 3ECOA 2CW0F 4Y7NJ 5KVRA 4OAZA 1Y39A 5EDNA 1F36A 4PUSA 4B44A 1HKSA 2E71A 1D8JA 4AVPA 2ACJA 1KQ0A 2JA2A 3ZN0A 4A3GJ 2MYSA 3RPQA 4U7BA 4G8XA 3S3OA 3M1CA 2DT7B 4I99C 3DU5A 2QQ9A 4NNJA 3GTLJ 4G6QA 4E70A 4LLGF 5A2QZ 1AKHA 3G4SI 3O2PE 1TTYA 4FETA 4BL0B 1YG2A 2EA4A 5J4YA 2KKOA 4HPQA 4BDZA 3J7AO 2LDUA 5B3SH 4L18B 3OYCA 1OJLA 5LEJA 1Z6TA 2JMWA 2WAQN 5GP9A 3SDBA 3ZQ7A 1S6LA 3LSMA 1TT0A 2K5CA 1QGPA 3QYFA 3E6DA 5D6FA 4A3DJ 2M0CA 4OMYA 2PMUA 3K69A 2QSGX 2OF7A 4RGUA 2CG4A 4GYGA 2Y9YA 3U1DA 2EK5A 5C3EJ 5HS9A 2HQ5A 1R4MB 1ZKGA 4M71A 1O3RA 1WJAA 3WU2C 2R5YA 1EV7A 4DYRA 3L2WA 2A05A 2NYXA 4BBSJ 1D8KA 3H0GJ 3BPXA 1ETVA 5L3CA 3LQQA 2G0EA 1P7JA 4IEJA 1I50J 3LSJA 3AL0B 2PG4A 1JT6A 4I02A 2CRGA 5FRNA 3ONQA 1YI2I 1MNEA 2WWYA 1EJ9A 5H6RA 4CCLA 1R5ID 4A6EA 1ITYA 1TWCJ 3SZTA 2QENA 4RA2A 2BY1A 5EGOA 3BTCA 2ISZA 5ERIA 4RAFA 5CVRA 1O57A 3JW4A 1UG0A 2HFHA 2BY0A 4X1EA 2RVCA 2VE8A 4RLFA 4B8XA 3S1RJ 1JKPC 1ERDA 2ZFUA 2FNPA 4DBRA 4A3CJ 1OKRA 2XDVA 1HF0A 4DZJA 2JA8J 2DYSH 3PSIA 4BUPA 4EJTA 4L9VA 4FTHA 2AS5F 2P6SA 3JTGA 2GAUA 4BU2A 3ZOBA 1ZR4A 1X2MA 3OIOA 1RESA 2EV6A 3S3NA 1LFUP 1NHAA 3S93A 3C2BA 4EM0B 2NS8A 5CPRB 4CXFA 1QO0D 3W2AA 2H27A 3GTQJ 5E3MA 2ID3A 2DTZA 5FD6A 2KRCA 3UNGC 1U0JA 2Y0SN 3KP4A 1W36C 4KIFA 1U5TC 3SFZA 4B4CA 2PX9A 3C3WA 3LA7A 3GFMA 1Z67A 3QQAA 3C18A 2W1OA 5IOZA 2IJLA 1ENHA 1ETQA 5K5QA 3CUQA 1G59A 3GO5A 2K9MA 2K40A 4V2FA 5HOOA 1PP7U 4UVCA 3A0BC 4XONA 5IP7J 5GTIC 1R22A 2NVXJ 4XM3A 2L3DA 2M8GX 3H36A 2VOPA 2HEOA 2L7FP 2QVOA 2VBZA 3GW2A 4HRIA 3U21A 3LSGA 2XF6A 5J3LA 5TISC 3M3YJ 1VQMI 3OY9A 4Q48A 1Y0NA 1IDZA 1XN7A 3KIOA 2FMYA 4BAYA 3BR0A 2EH3A 4LMYA 5FFXA 1FX7A 5EGOB 5EEGA 2DA1A 4C2MJ 4EGYA 3KP6A 1OCTC 2DJIA 2M45A 1S8NA 5DD4A 3I71A 4G6DA 1QNTA 3BQZA 3FXOA 4HV5A 1A31A 2STTA 1N25A 3GTMJ 4ESFA 2LP0A 1ONVA 2QQBA 2R5ZB 5L3BA 1Z1DA 2ESNA 3S17J 2XASA 3J80K 2ZMEC 3RTRA 2R7ZJ 2VJ5A 1R36A 2HR3A 1X4PA 2DODA 4OIQF 3KYLA 1UMQA 1MBJA 1W1WE 3RQIA 1VQPI 1UHMA 1IUFA 3LA2A 2MC3A 1R9TJ 3BY6A 1R6RA 3CCRI 4Y17A 2M34A 3HGYA 4KN7X 2JN6A 4A0XA 2NOJB 3EUKL 2L7ZA 3K4JA 3KEOA 1YIOA 3I58A 4UV8A 2CUFA 3RDIA 2LY2A 3BCAA 1D0ZA 2R3SA 1LUJB 1QRYA 2EQRA 3CUQB 3WTYC 1G4DA 4IX7A 3H3UA 5F0CA 1ZHFA 2M5WA 2E7WA 1Z6RA 2ZXHA 2KZGA 1KGSA 3JREA 1A6QA 1TQPA 1E3OC 2IW5A 4YFKF 4QIWN 1FYLA 1JHHA 3LQRA 4XN0A 4LB6B 1TP4A 1VZ0A 2PN6A 3SZGA 1YITI 4ZYAA 3ZQQA 1G3TA 3BG7A 3BG5A 1GHCA 2L02A 3FBIB 3ZMTA 3TQNA 3CESA 1BW6A 3CCMI 2DOFA 2YSRA 4BJ6C 3I0TA 3LSTA 3L2VA 1BL0A 1G8XA 4AWXB 1XX5A 1U9OA 1WHUA 3G2BA 3FXMA 2RN7A 3M4OJ 2X85A 3FXRA 3HB9A 4PJLA 2ETHA 3H92A 3ABLH 4LG0A 1HDDC 3SXYA 4TV7A 4A3KJ 2DCEA 3BG6A 4UVBA 2WC2A 3LSRA 2H1KA 3CQZJ 3BZ6A 1HXDA 1E3HA 4Y52J 2LBFA 5IYBJ 2R7RA 4EV0A 2KRFA 2EFOA 2V1NA 1Z3XA 2WB1A 3DFGA 3U9GA 1TBXA 4GGGA 5TGTA 3G1MA 4XRMA 2VONA 3ZMZA 1SD4A 3MKZA 3K2ZA 1SEUA 1FPQA 3H1CA 3KZYA 4BBRJ 2M3AA 4A3EJ 2HDCA 2EFNA 2HZDA 3VSKA 4Y15A 5K7HA 3EQLF 2X9DA 3J7AY 1RKTA 3CF2A 4MEXF 1IF1A 1FTZA 2BY2A 4BEHA 1YE9A 1QVUA 3OR1C 2E1MC 4BXXJ 4YELA 5GAHJ 1I39A 5D5VB 5E1XA 2RNGA 1YIJI 2EA2A 2DQLA 2M2EA 5J6XA 1MBFA 2PMHA 3J7ZI 3OSGA 1YFHA 1XGSA 3HOUJ 3H3ZA 2GXGA 4GFBA 3ROUA 1JI8A 4JQFA 5BPDA 2XAUA 5H6QA 1Z3YA 2ZXWH 1WCMJ 2LY1A 5E3NA 1B72A 5IYCJ 1WVRA 2ZJ2A 2EFQA 3K4BA 4B09A 1IN4A 2E1NA 4D1QA 4KA4A 4FQGA 1AOYA 3CC4I 3DBRB 4E7IA 3FK7A 2QLZA 2VXDA 2ZSIB 3EDPA 3BG9A 1ZYRF 4QPQA 3OS2A 2OTJI 3VODA 2K9LA 1S7EA 1G3SA 1D0YA 4IJAA 2LBFB 2R4GA 3O6BB 5DEQA 1H89C 1V4RA 4II2A 4J00A 1G2HA 4M3BA 2KJCA 3F8BA 4AIDA 2H09A 4F55A 3RPUD 5J1YA 1R71A 1PVEA 4XORA 4CA0A 3HOSA 1VQ5I 3TL4X 1SVMA 5KAFC 3CCEI 3EYYA 3A03A 3PQKA 1XMKA 2RKHA 1HDPA 4BE0A 3BZKA 1T6SA 4JBAA 1LEAA 3OV8A 5ICEA 2HYFA 3QP6A 4GO1A 1UELB 3WGIA 1TC3C 3O3KA 3IP4B 3I53A 4KDPA 2FF4A 5IT9K 1T2KA 2FD5A 3L09A 3JSPA 1TW2A 2JTVA 3FWEA 4BEHB 1D5VA 5J8CA 2MBFA 4GRIA 2GIZA 3RI4A 1K83J 5LGUA 2FQ4A 3DU6A 3M7GA 2IEKA 5KAIC 1U6GA 5J8FA 1IAWA 2E60A 2CU7A 2ZXJA 1ZAOA 2R7OA 2MC4A 5K5RA 3C7JA 2DK8A 3J80Z 3CCQI 3ZMVA 2M9HA 4PDKA 1QBJA 1T0FA 2OUMA 1X1BA 1X1AA 1BR1A 1B72B 2TDXA 1HW1A 4OIPF 4O5VA 3ZRGA 3TP0A 3A1YA 1S7OA 3I5UA 2HXIA 4YEJA 3ABMH 3DV8A 2LMDA 2G9WA 4ENMA 4IHXA 1X4OA 2A5YB 5ED4A 1BI2A 5HODA 3ZMSA 3TBIA 1ZLJA 4DGWB 4AIJA 1XTAA 1WSUA 2HPIA 5ILVA 3DPTA 4XRSG 2DMQA 3EETA 2ME6A 1EA3A 2EZHA 3MWMA 1FOKA 3HZJA 3CCLI 4B47A 4ZYHA 4IPAA 1Y8QB 3GCMA 1J2XA 2VLAA 2PEXA 2WY8Q 3BR2A 1UJ8A 5F27A 1D3YA 1R7JA 3UKGA 1FMVA 3IUOA 3O8HA 5CLSA 4HLXA 3OYAA 1YRNA 2DU9A 2MGQA 1NK3P 4XIDA 2E19A 1BI0A 2R0QC 2CGPA 5FJ8J 3BP8A 2NRAC 1POGA 1MZBA 4EJOA 2W7NA 1O3TA 2E2HJ 3CMEI 4ZDLA 4M6XA 4XLCA 5DM7F 4CH7A 3J81K 2RQPA 1QHGA 3Q5FA 3BTLA 3Q9SA 3HRSA 3IWFA 2E1OA 5HS8A 4FASD 1TNSA 3K0LA 4WXCA 3QOEA 1YOVB 1NG7A 1W4MA 4XMYA 4EJVA 3MZ8A 1VQNI 4HNUA 2HDWA 3DTKA 4MFDA 2XROA 1FOXA 1UHWA 2WY7Q 5D6EA 2IS2A 3WE2A 4CHUA 5F1JA 1TL8A 4S04A 1WQ2A 1SFKA 1RUOA 1H9GA 3FIWA 4H0EA 3GTGJ 2V7FA 5KHDA 1JTXA 5D4RA 3IAM2 3K4MA 2EINH 1XMAA 4OIRF 1K4SA 4U0WA 3JRIA 2FBHA 3QPSA 4A12A 2E7XA 3T8TA 3LAPA 2GIVA 5JLXA 3AG2H 2EIJH 2Z5UA 2A68F 4XICA 3GFLA 2Y69H 2ZNYA 2FA5A 1XB4A 3K1MA 3OYFA 4NHJA 1KQ8A 2H8WA 2RAEA 4XN3A 2HQRA 2VI6A 1YRNB 3S2WA 4CYDA 2NOGA 1I1SA 1ETXA 4ZC3A 5TJJA 3CMYA 1MH4A 2O3FA 5GTHC 1WJFA 3FM5A 2XHKA 5F08A 4HX4A 3OYJA 4B3AA 2CSOA 3OMYA 2EPFA 4CCOA 1WJDA 1LB2A 2JSCA 5ILUA 1OCPA 2VOOA 1IO2A 1ODDA 1OQYA 1FIAA 1B1BA 2I8DA 2KQRA 1OCCH 3Q0VA 2IGMA 4AU7A 2XGCA 2OCEA 3TDUC 3ZGKA 2HKOA 4G7HF 3OOPA 1X1PA 1NG6A 3DLAA 5LGNA 1BJZA 1UB9A 2R7SA 2ELKA 2EZIA 2VBXA 3V7RA 3DEWA 3L7WA 2MSYA 2YX4A 3OSFA 4U0VA 4MLOA 1XC5A 2L01A 1K7AA 3VYRB 5HNFA 4IOAF 2HOAA 4E7ZA 2XSDC 1JE8A 3CJTB 3K10A 2XRLA 3BROA 2X1DA 1VQ7I 2XVCA 3TO6A 3CCJI 1B9MA 2VKHA 4L9TA 3CCVI 1AWCA 1HA8A 2F4MB 1FIPA 3FMRA 4EM2A 4Y13A 2ID6A 4LLNA 4IO9F 4UUVA 1PDNC 2NVQJ 4N4OB 3F8CA 4HYEA 2BBYA 5CKTA 4FCYA 3GLLA 1MIJA 1BN5A 3I4MJ 3AG3H 2CWEA 2IS1A 2OC6A 3OL3A 2XPVA 1U78A 3LL7A 2W4SA 3G1OA 1B8IA 3W3CA 4DYCA 2CJJA 2BW3A 1IZ1A 1LJ9A 2DOAA 2J5PA 1MJAA 2XIGA 3V42A 5EF6A 1SMTA 4KICA 3GTJJ 2STWA 1MKMA 4O3MA 4YIRX 4IF4A 3FMSA 4KNYA 1F43A 3WG7H 4G9YA 2A5WA 2E2IJ 2FUG2 3S2HJ 1TQIA 2R93J 4JK1X 1VQ6I 2GBYA 5HLTA 3GF2A 1R23A 2F5DA 1B59A 2R7WA 1ETKA 4I2OA 4L5IA 3JAMK 3Q9VA 2CV1A 2XF5A 1DDNA 3GVAA 4HSRA 3RZOJ 3PFIA 2COMA 3OYHA 3I4NJ 4LK0F 1BC7C 1O3QA 2B0LA 3MN2A 4GCVA 3VFZA 3JR9A 3FKIJ 3B6CA 4MTEA 5ICGA 1HOMA 1HSTA 1UCRA 2LFBA 4ENKA 1FWZA 1PYVA 2F5CA 2L54A 1SFOJ 3FXKA 2DT5A 1QZYA 2EJRA 5CVUA 4S0HB 1QPIA 1Y1VJ 2FMLA 2QKLB 4YFXF 2D1HA 2K7LA 3DQVC 4MEYF 4BJTA 4BXUA 5GPAA 5AONA 3OWTA 1ETOA 1EH8A 3QPTA 3R6SA 1XDSA 2CQXA 2DMNA 5IY5H 3J81Z 2ZJPF 1W0TA 2F6CA 4HW0A 2H6CA 3OYNA 2P8TA 3KP5A 1B8IB 1RRJA 2R7UA 2KMUA 2M4KA 1LPQA 2BW3B 1WFXA 3L9FA 1SANA 3TO7A 2V1XA 3P7NA 1S72I 4HX8A 1J9IA 1BBYA 3OYEA 4QTRA 2XUBA 3MVPA 4UV9A 3K1PA 3PQJA 3K70D 2H1LA 1MDMB 2DA7A 4D9JA 1XSDA 2YU9J 4PGHA 4NC6A 1ZLKA 2HVRA 2HOEA 5H2FC 1X1DA 1T33A 3JRFA 1JT0A 1WH7A 2CW7A 2M8EA 2TCTA 4YIIA 2LOOA 2HTSA 5CVVA 4UNOA 2O9LA 4RS8A 3PIPF 2Q0OA 2ME0A 4BE2A 2ZNZA 1DP7P 3HSRA 3PFYA 2K86A 4EM1A 4BY1J 1MMDA 3SEZA 2X6WA 2FOWA 3KP3A 5JHFA 1LDDA 2P5VA 1J7KA 1IV6A 2WA0A 4HBLA 4A3IJ 3ABTA 1YX3A 3RCOA 2R5ZA 2BXZA 2UUZA 3M9AA 3SYTA 3JSOA 1R58A 1ZARA 1GT0C 4C2UA 4QLCU 3B6AA 2KFDA 1K4TA 3CO6C 4HQEA 4F93B 2IBDA 2XPUA 4WXDA 1RETA 4ENJA 1ULYA 3S2DJ 3WHBA 4KJZA 3HTSB 1F1ZA 1MNDA 3IWZA 2NVTJ 2DI3A 2DMTA 1J09A 2IPQX 2VT2A 1MMSA 3H5RA 3K4NA 3MMYB 3G1LA 2LVSA 5M5XJ 5J1UA 2RV8A 1JKOC 1JUSA 4LFUA 5FKOA 1HC8A 1V55H 1S3JA 4H4KC 3G3ZA 4Z2YA 5LHGA 4BXFA 3F6VA 2LY9A 4IHWA 1UG2A 3F23A 1OR7C 3VEPA 4ZZDA 5FKKA 1ZRDA 4RB0A 3E1SA 5HDNA 2JWTA 5BMZA 2D1VA 2K3FA 1LDKB 3P5JA 3F72A 4HF0A 4A6DA 1FT9A 3AL0C 2EB7A 4UB6C 1LKXA 2K3PA 5GAEJ 1R49A 3RPUA 4XBFA 2VC1A 2R7TA 3DEUA 2YUSA 1XS9A 1HBXG 3QWLA 3CCYA 2GXAA 2XKOA 4IKFA 1VQKI 2VN2A 4QSHA 5K5OA 1DU6A 2K4BA 3CUOA 1F4KA 2L2OA 2VL8A 3FXLA 2ZO4A 3HYIA 3BCBA 1KQ9A 1D1CA 1OPCA 1WKMA 3BLYA 4BQAA 3E6CC 1BW5A 4LD5A 4M3EA 5LHHA 3IL2A 3RZDJ 3I4PA 2PLYA 2UXNA 5F04A 2GA2A 3DBHB 1T08B 2K9NA 3TOBA 3C2GA 1ORKA 3VOEA 1GVJA 3F21A 3LFKA 5FB2A 3KCCA 3BTIA 2AQFA 2Y9ZA 3KP2A 3OL4A 3ZN1A 2B9SA 1IG7A 1O7FA 2VKDA 2YS9A 4A0ZA 3DEEA 2YU3A 2ZBKA 5LRSA 3M8FA 3FDYA 1IGNA 2VC0A 2E5NA 5F1RA 3NEUA 1YS6A 2UV1A 2CUJA 1GVDA 1YJWI 4F92B 1SD5A 2JZYA 4RAZA 2GZWA 5EEAA 2Z9OA 4IHVA 4J19A 5L3GA 4D0PA 2EFPA 2HVQA 1MMNA 4L5JA 3JAMZ 4WXHA 1WGXA 3M1EA 2VKVA 4M72A 4ESBA 3L2QA 3RKYA 4BKXA 1T95A 2DT6A 4NB5A 3JRDA 2LREA 3CTAA 4HQMA 4MFEA 3HUGB 4HNVA 3WODF 5CVIA 1FSEA 1N75A 4I6ZA 1VTNC 6PAXA 5HLGA 4F91B 2EV0A 1A04A 4CGZA 1FY7A 2WTEA 2QKMB 4LIUA 3WU0A 1C0WA 4B3XA 3N4MA 1W7PD 3FKJA 4PK4A 1JKRC 4X0GA 3E97A 1BR2A 1T38A 2JRTA 3ELKA 1QVTA 1TWFJ 2XB0X 3SZPA 3GUDA 3J7YJ 3ZPLA 3LSPA 1NTCA 4Y33A 2WAQA 3OYIA 3H3VK 2MABA 1P92A 2V26A 5J40A 3IRRA 3KETA 3SQNA 1N77A 2A07F 1K6YA 1TWGJ 3KLOA 2CQKA 3UR3C 3ZMUA 1OCOH 3BOQA 1QZZA 5HS7A 2LH9A 1A6IA 1S5LC 2MD5A 5C4JJ 4NC8A 3SEQA 2KPMA 1MD0A 3V8KA 1H88C 4ON0A 5J4VA 4C3HJ 2DA3A 1FJLA 1JHFA 1VQOI 1IRXA 2LKSA 1R1VA 4RGRA 3OYMA 2X48A 5EEHA 4O6JA 5B5EC 3F0CA 4P9UA 1ZRCA 4RAGA 1V5GA 3GTKJ 4HF1A 3BR1A 4LOCA 2A6EF 3M07A 3MZHA 3H5NA 4WF2A 3BR6A 2X51A 1FLIA 3G71I 3CUQC 2DXIA 1TT5B 1WJBA 3QP5A 3AKZA 2K9SA 2XSJC 1RR7A 4D7NA 2Q2EA 1ZR2A 3DBLB 1U9NA 3EUHA 3BJAA 4KT5C 1QQIA 1ETYA 3FISA 2NVYJ 5AIPA 4AYBN 1XG1A 2D45A 1IUYA 5D5UB 2KDZA 3OYGA 3GZ6A 4XK4A 2FJ1A 5D8KB 1I3AA 1SFXA 3HHHA 3IH4A 4HF2A 2OQGA 3QYBA 1T8IA 2PJPA 2DMPA 4PSWA 2OA4A 3RJPA 1Z7LA 3ZP5A 5K7FA 3K2AA 3V8LA 2LSOA 2MH2A 5CVJA 5DDGA 5IPAA 3H5AA 2CQNA 4G6TB 4FX4A 1F5TA 3E5QA 4UUTA 4XQFA 2H8RA 2XRNA 4CICA 1EF4A 3GZ5A 1HW5A 1I6HJ 2FNAA 1MSEC 4M3DA 1B6AA 3ABUA 2R7XA 2Y0SA 2P5KA 2V79A 1M1EB 1IDYA 4FE7A 2YR2A 1O7LA 4EEFG 1FBSA 5LLQA 1LEBA 3WTTC 2ZJRF 3HJEA 2K4JA 1FP1D 3NAUA 2JRMA 3FHNA 3NQOA 1J59A 3JRHA 2V1UA 4RM3A 1MH3A 2Y48A 3FBNB 5E1ZB 2P7CB 1MJBA 2FXAA 2LKXA 2M1BA 1KYZA 3KYCB 2VQCA 5DM6F 5FLVA 3DTIA 4XRFA 3KFWX 3HKZN 4V2GA 3QRFF 3S14J 1R4NB 2CFOA 1USSA 3RKXA 2E36A 3TW6A 1MW7A 1WJCA 1K78A 3JRGA 3COAC 3L2RA 2AHQA 3S1MJ 2M7AA 2QUFA 3BJOA 1XMXA 2Q2EB 2PMZN 1XPXA 2XKPA 5BNGA 4P9FA 1MBEA 2DQRA 3S3MA 4YIFA 5IP9J 5TRDA 2BE5F 3EYIA 2XPWA 9ANTA 3L1PA 4BQOA 4BQNA 5DCMB 4LG3A 3W2VA 5FO5A 4N4NB 2HQNA 3KP7A 4LIVA 3MKWB 3JTHA 1IRZA 3R60A 3R61A 3TEDA 1YW8A 3H9GA 3MEXA 1KYWA 4D5CA 5HVQC 3CCUI 1KU9A 2L5QA 1BIAA 4PJMA 3VYUB 2DPUA 3CDIA 1FYKA 3GYHX 5BOXA 4XOPA 4IHYA 2ISYA 1APLC 1LNWA 5CJ9A 2DW4A 1T98A 4E7HA 3PO3J 4ZZLA 1H8AC 2HU9A 1DU0A 5FD5A 2VE9A 2HOSA 4YRVA 4A3FJ 5DYMA 1QA6A 3K4CA 4AD9A 2LC2A 3KLNA 2LK2A 4E7SA 1XGNA 2L9RA 2OU2A 2WV1A 4HZFA 2QM3A 2DA2A 1OYYA 3SDGA 2V9KA 3VYTB 3CJNA 2EFWA 4FX0A 2IRFG 2QSHX 3NARA 3GLXA 2V9PA 3K9TA 2L7MP 3E0JB 5EG0B 1EH6A 1BI3A 1OYIA 3E5XA 4MIMA 5L3DA 4A69C 3Q0WA 4ETSA 3HGGA 2BXYA 2P81A 5AIQA 2HPMA 3CLQA 3WTUC 4M6YA 2O6GE 2BY3A 3VWBA 4I0BA 5F64A 1K78B 3CF5F 4HSTA 1EKEA 1MMGA 1IXSB 2JPBA 3E6MA 3C1DA 1O3SA 1X3UA 3OIQA 5LHIA 1YYVA 4HOBA 1PUEE 2JQ7A 1I6XA 1J5YA 3HXLA 1MSFC 5E79C 5E3LA 3CDHA 2JA7J 2MD0A 2K9QA 2PFBA 2CFXA 1L3LA 1V3FA 3EUHC 4R79A 3CD6I 4I98B 2HXOA 5JR3A 3FK6A 3GEZA 1CGPA 4EGZA 2DPDA 2ZJQF 1OMIA 2KIUA 3P9CA 1W0UA 3TMOA 2XV4S 3VDXA 2JA5J 2A6HF 4IL6C 1KA8A 2GLOA 4BNCA 2VBYA 4ITVA 2V6CA 4NBQA 4NQWB 3WGGA 4HDUA 3TGNA 3QU3A 2JA6J 1B4AA 2MLGA 2DTRA 4G7ZF 1KU7A 3KPHA 2OCCH 2X6XA 1OFCX 2LLKA 3HG9A 3VYSB 4K2EA 1VF9A 2KISA 2O7OA 2W25A 3A2KA 4IXAA 1E3PA 5B1BH 4CUGA 2KRHA 2XAGA 3ULQB 1WI3A 1AU7A 4BGDA 5F6FA 3BZCA 2C6YA 2I5UA 2L9NA 2OV7A 1IXRC 1ZN2A 4RB1A 5E17F 5D5WB 1OCRH 3I55I 5FGMA 5DD8A 2NS0A 3L2UA 4OU0A 1HSJA 5GAGJ 1K6OA 2HDDA 3V7CA 5CQEA 4CCJA 2F4IA 1P2FA 4ZTJA 1IW7F 3GFJA 2DFHA 3W6KB 2MLKA 3AAFA 1BI1A 3F3XA 3FF5A 2HVSA 4AYBA 2LKPA 3ZQGA 2P4WA 4G7OF 3MCZA 3PJRA 1DQUA 1ZGJA 2V1DA 3NRVA 1X1CA 5KCMA 1W5TA 2O8XA 4A5NA 2LG4A 3PIOF 3CC7I 4BE1A 4OIOF 4Y3OA 2Y30A 3KE2A 2ZB9A 2PQ8A 3PNTA 3G73A 4PJJA 2CO5A 4CZCA 2IGNA 2IA0A 2HNHA 3DLLF 1FBUA 4HNTA 4DIQA 3KYDB 1IN8A 3GTOJ 1V54H 3N05A 3WG9A 4JYKA 1BJAA 5CYVA 3ERED 3DKYA 1RR8C 1T0FC 4LB5A 2LR8A 2L9VA 5C44J 3U1KA 5IYDJ 2LNBA 1FZPB 3FM3A 4PJNA 3U2RA 3M8EA 4P96A 3D5SC 1IN7A 3N97A 2X6YA 2M4GA 2K85A 4HDVA 1D0XA 2EBIA 1AHDP 2F4OB 2WAEA 2KJBA 4CZZA 3IKVA 3MQ0A 5IT9Z 1IRGA 3IH2A 3K6GA 5D5XB 1QHHD 5FLXK 1ON2A 2EZLA 2NNYA 1MBGA 4N9IA 2OQRA 5F0HA 1A36A 4DZPA 2DFEA 4D7MA 1XCVA 3PSFA 4CYCA 2V4JC 3PNVA 4ESJA 5C4XJ 4PZJA 3ZQIA 3HOTA 1D5YA 2CUZA 2DMUA 3QU6A 1VQ9I 1RC9A 4I76A 3I56I 3BT9A 1ACIA 1WI9A 1DGRM 4AC0A 2PJRA 2ZKZA 4WX9A 1ZG5A 2H6BA 1MDMA 2VB6A 2Z99A 5JFRA 2K02A 2KT0A 2K27A 4MNUA 2HZTA 2L0KA 3O8GA 5LRRA 1G6NA 1WH5A 4DJAA 1A5JA 5J47A 2G7HA 1UHSA 3KZIC 4IVNA 2X0LA 3HBLA 1TQMA 2DAOA 1TNTA 2R7DA 4QWQA 3EUAA 2P7VB 2BYVE 4IOCF 3RQ4A 4CCNA 1R1TA 2XGEA 5M5WJ 1YW7A 2QCOA 3K1NA 2QQAA 2HYGD 2GOXB 4P1WA 2GWRA 4XKCA 3B73A 5HDKA 4A2UA 4IRHA 4E7LA 4KIGA 2JUGA 2A6TA 4ABZA 1RIOH 1H0MA 1TW3A 5LGTA 3CZ6A 3TDZC 4ZTFA 4JX4A 3WU1B 4RGXA 3H0DA 2DOEA 3W2WA 4IQ4A 2BHZA 1YS7A 4HX7A 4ZYEA 5FROA 1E2XA 3CP2A 3DF8A 3K70C 3IAS2 5FRMA 1MMAA 3I59B 1ZTRA 2ZMEA 1SAUA 3E7LA 3WTWC 2QGUA 3T8RA 4G12A 4GYIA 2ZXIA 1W7PA 1LFBA 1MBKA 4Q5SF 3M8JA 4YFNF 4A5MA 3V7SA 3HM5A 4C9YA 2DA5A 4CYCB 2E2JJ 4F52A 1U8BA 4IHSA 5DTDA 3TKYA 2X6OA 2E5ZA 1HCRA 4BHBA 1K79A 4UHTA 2ZFWA 2KHMA 5M3MJ 2Y2ZA 3HDDA 3ZQLA 1E0EA 4ZH4F 1U5TB 1YTYA 1Z7UA 2BHYA 4AM3A 4HA8A 2JK3A 2PJRB 2RDPA 3F9KA 3T1BA 3HOVJ 1Y1WJ 3KZZA 1YHQI 4PJ0C 2PI0A 4D5FA 3Q3SA 5LD2C 3SJMA 3PO2J 3DCFA 1REPC 2R7QA 4M3FA 1PP8F 4UB8C 5H20A 1FTTA 2RC4A 2WB1N 2EV5A 1DP3A 4ZDPA 1SFUA 1LDJA 2UWMA 2RREA 4ANJA 3QPLA 3D0SA 1SD7A 1Y56A 4U0YA 2Q8KA 4EJUA 2AXLA 1MGTA 2OPTA 3E5UA 2CV0A 3WTVC 1Z9CA 2VIXA 1YX5A 4YG2F 4BDYA 1FSHA 3PUBA 1I5ZA 5JVTA 2XB5A 2KLOA 1ZREA 3R0JA 1SAXA 4C2TA 3OR2C 4R8HA 1G3WA 2QYOA 1CF7A 2FEZA 2IAIA 1S9HA 2HTJA 2OD5A 3FZVA 3L00A 4XOTA 1BR4A 2FX0A 3ESWB 2QQ8A 2VXZA 3T5XA 4E7JA 2EILH 5E20A 2ZMEB 4OAYA 1AKHB 1W7PB 3HTUA 3WTXC 3RIRA 3WE3A 2GOMA 3A02A 4AVZA 2OJED 5B1AH 1X2NA 4N9HA 3HPGA 5ICFA 1JJ6C 4Y4RA 2FBIA 2Y31A 2FBKA 4IQJA 3CP8A 2DYRH 4M74A 2ICWG 3D5RC 4EVIA 4A3BJ 1ZH5A 5JLWA 2JPCA 4OMZA 2E1CA 2FE3A 2MFZA 2HS5A 1VFCA 1FYMA 1S29A
chains in the Genus database with same CATH topology
2QSGX 1TP4A 1OQYA 3ESWB 2QSHX 1X3WB 2F4MB 4YIRX 2F4OB 1QZEA 1PVEA 1X3ZB 2QSFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSG X;  1TP4 A;  1OQY A;  3ESW B;  2QSH X;  1X3W B;  2F4M B;  4YIR X;  2F4O B;  1QZE A;  1PVE A;  1X3Z B;  2QSF X; 
#chains in the Genus database with same CATH topology
 1I1G A;  2A3S A;  1R1U A;  2V6E A;  2KL4 A;  1PUF A;  3RKW A;  3HUG A;  2IA1 A;  4ZJZ A;  3VSL A;  1Z0X A;  3S15 J;  4UVA A;  5F0F A;  2R5Y B;  3G6E I;  1EH7 A;  2VBW A;  2IXS A;  2LRD A;  2OAZ A;  2DJN A;  4G94 A;  3ZR8 X;  2DA6 A;  1YLF A;  1JXS A;  4N0B A;  2LF7 A;  4A3J J;  1WWX A;  1XCB A;  4RM2 A;  5EZG A;  4GDF A;  2ESH A;  1FC3 A;  2XC7 A;  1LQ1 A;  2I10 A;  3DPU A;  1ZRF A;  2KIF A;  3W6V A;  2FQ3 A;  1Q1H A;  5K7Z A;  1W36 D;  5FLX Z;  3WHC A;  2Y75 A;  3F8N A;  4XSX F;  3RSN A;  4L9N A;  4KYW A;  3IHU A;  3BG3 A;  1CF7 B;  1D1B A;  2R7F A;  4XL9 A;  2EIM H;  1L0O C;  4XLF A;  1WZ2 A;  1JUP A;  4IZZ A;  1E17 A;  2AXT C;  1YJN I;  4M6V A;  1DPR A;  3IKT A;  5EYR A;  4DQ2 A;  2VQH A;  3RKQ A;  2UZK A;  2XGX A;  3HRM A;  4MQV A;  4L9J A;  3R4K A;  5E1W A;  2L4A A;  4BHC A;  1GXP A;  4KUM A;  1GLN A;  1TZL A;  2D5V A;  3DP7 A;  2GXB A;  1MBH A;  1FP2 A;  1P4A A;  1S7A A;  2CH0 A;  1U2W A;  3CMA I;  4QPO A;  3QYE A;  3LSI A;  1I27 A;  5IT3 A;  2VPL A;  1RZ4 A;  2BVL A;  3OYL A;  2IS6 A;  3K4K A;  5EZH A;  2BGC A;  5E18 F;  4JOM A;  3ZQC A;  3I64 A;  3K4L A;  3FXJ A;  2Z33 A;  3ASN H;  3FHZ A;  2F5F A;  2M30 A;  3ERM A;  2UXX A;  4XLP F;  3F6O A;  2JSP A;  2Z2S B;  3F8M A;  1PUF B;  2DO7 A;  3MKL A;  3HOY J;  3JRA A;  2XGD A;  5J1R A;  3CO7 C;  1CQT A;  1JGS A;  3HOX J;  3QAH A;  5BS6 A;  2F5V A;  3H9Q A;  4LJZ F;  1FMW A;  2CMP A;  3BJ6 A;  1K61 A;  1SFE A;  2E1M B;  1YO5 C;  3AG4 H;  4BHP A;  5DUK A;  1BC8 C;  2VPR A;  5EJC A;  2MG4 A;  4DBQ A;  3GXO A;  3DKX A;  2CS3 A;  4XNF A;  2R7V A;  5HLH A;  1VQ8 I;  4C3I J;  1F9N A;  1GUU A;  1BOA A;  2EIK H;  3ZQF A;  1P9Q C;  4EMS A;  4CCK A;  3ASO H;  5LBQ A;  4KIS A;  2DN0 A;  3BR5 A;  3H9J A;  4CCM A;  4KIT B;  3LAJ A;  4J01 A;  1B9N A;  4BQQ A;  5L3F A;  1IJW C;  2KIM A;  4C30 A;  1OYW A;  3CC2 I;  1UST A;  5FKM A;  4Q47 A;  4DNC A;  3KX2 A;  1RPW A;  3PNY A;  4FIS A;  3VB2 A;  1TWA J;  2Y0M A;  4MO7 A;  3D1N I;  3OYK A;  3LOC A;  4W97 A;  4E4H A;  1YQA A;  2DLL A;  3CDL A;  4CDG A;  2E35 A;  1UFM A;  1SMY F;  3MKY B;  3HSE A;  1X58 A;  3PL8 A;  4M9Z A;  4MGR A;  1YJ9 I;  5HLI A;  3I54 A;  4BS9 A;  2DDA A;  1X19 A;  2LTP A;  2DFF A;  1WJ5 A;  1T39 A;  3CMM A;  1Q1V A;  1LVA A;  4BAC A;  3WTZ A;  2Z3Y A;  4ENN A;  1ZGA A;  3K7A J;  3ML6 A;  2AO9 A;  5LEK A;  1J75 A;  1P4X A;  4P5O A;  2VJI A;  2DK5 A;  5JI6 A;  4CO8 A;  4M9X A;  1BM9 A;  4HV6 A;  3IH3 A;  5D8L B;  1NH3 A;  2IP2 A;  2HI3 A;  2EWN A;  3GME A;  1IN6 A;  2X1E A;  5DCM A;  1RI7 A;  3HL2 A;  4PSX A;  2YPR A;  3NWT A;  2GA1 A;  3OYB A;  2L7K A;  1SD6 A;  3OOU A;  2NAZ A;  5FLM J;  4XLE A;  3HRU A;  3E6B A;  3KEY A;  4NC7 A;  3X2Q H;  3TW7 A;  1Y8R B;  4IRI A;  1VI0 A;  2GQQ A;  4U87 A;  2F48 A;  5HDG A;  3C2H A;  2ELH A;  3BWG A;  1N78 A;  4A0Y A;  1KON A;  3AFH A;  2A61 A;  4AIK A;  2XAQ A;  1FBQ A;  2DBB A;  1GV2 A;  2KIQ A;  4E7K A;  2W85 A;  4M3G A;  4RDU A;  3GWZ A;  3HHG A;  1RKW A;  5L3E A;  3PUF A;  4M9S A;  3L2C A;  1TLH B;  2HGC A;  1QU3 A;  3V8J A;  2IA2 A;  5DUI A;  4LG0 B;  3LSK A;  4L0Z B;  1YW9 A;  4OOI A;  5JHU A;  5EG0 A;  2BEO A;  3V4G A;  3LNQ A;  2M7B A;  2IGK A;  4B1R A;  4M73 A;  2VJ4 A;  3QPH A;  1JTY A;  2NNN A;  4KN4 X;  4Q4Z F;  1HKQ A;  4LIT A;  1IC8 A;  2FRH A;  2QSF X;  5FKL A;  4RB2 C;  4PCQ A;  2P5L C;  2W57 A;  3SFI A;  3BDD A;  2WAF A;  3E3V A;  1FNN A;  2W84 A;  3R0A A;  2ECC A;  4MHG A;  1JKQ C;  3Q0U A;  3H35 A;  3HSF A;  5GPC A;  2BOL A;  4PFP A;  3LA3 A;  4I01 A;  2VAS A;  1XDU A;  1VQ4 I;  1V5E A;  3HPH A;  3ISP A;  1IXC A;  5M3F J;  1RUN A;  2O61 A;  2VJJ A;  1DPU A;  2RNJ A;  3S32 A;  2ADU A;  2P6T A;  3F8F A;  1JJ8 C;  1ZK8 A;  4HLY A;  2L4M A;  1Z21 A;  2IGO A;  1U3E M;  4KFC A;  1GDT A;  4UXN A;  4C3J J;  1Z77 A;  3JRB A;  2TRT A;  3A0H C;  3B02 A;  1ZG1 A;  1BIB A;  1Y0U A;  2A69 F;  4FE4 A;  1R5G A;  4BY7 J;  4NQW A;  4XLN F;  2KP6 A;  4RBO A;  1LE8 A;  1IRF A;  1AA7 A;  3LMM A;  4WK8 F;  4OWR B;  4ZDO A;  3CJQ B;  1XGO A;  3CJR B;  2CYY A;  3HEF A;  2CQQ A;  5FFZ A;  2CV2 A;  2WV0 A;  2ZCW A;  3JRC A;  4ZYD A;  3LSH A;  2ZSH B;  2EZK A;  3HIF A;  4LGW A;  2OTL I;  3OYD A;  3BC8 A;  1MNM C;  4V19 K;  1KZH A;  1I3Q J;  2ZC2 A;  2M87 A;  3FX3 A;  2W48 A;  3FXQ A;  1BA5 A;  3OS1 A;  4RLQ A;  5CQG A;  4X6A J;  4I0A A;  2XAF A;  2HKX A;  2JJ7 A;  3HC7 A;  1ON1 A;  2QWW A;  1X3Z B;  4L5E A;  2VOD A;  2H94 A;  3T0Y A;  1LVK A;  2Q1Z B;  5ILS A;  1DGW Y;  2ECB A;  2MW8 A;  4Z6Y A;  5M5Y J;  1X3W B;  1XSV A;  1GXQ A;  4XKW A;  4U88 A;  1W5S A;  2ELJ A;  3TO9 A;  4JX6 A;  2VUM J;  1Z91 A;  5K1Y A;  2VT3 A;  1D1A A;  5A2Q K;  1P7I A;  1R00 A;  4F3Q A;  3TP3 A;  4CSW A;  3GX4 X;  1G3Y A;  1R5H A;  1XSX A;  5KNL A;  2VQL A;  4B43 A;  1KU3 A;  1JGG A;  4E6K G;  2HWV A;  3F22 A;  2O0Y A;  1ZGW A;  3GZN B;  2D2W A;  1FEX A;  2V9V A;  4I09 A;  3CCS I;  5BPI A;  3CLO A;  4XLA A;  2LD5 A;  4XLH A;  2QF7 A;  3EPZ A;  2XAJ A;  1WJE A;  1T56 A;  4RGS A;  2FSW A;  3ZXS A;  4EQQ A;  4UUS A;  1V5F A;  5BQT A;  3DTE A;  4ASN A;  3DPL C;  2CW8 A;  1VQL I;  4HEA 2;  1LE8 B;  3DXJ F;  4BJ5 C;  1WRJ A;  3I9V 2;  2AQE A;  2RQQ A;  3IC7 A;  3PM1 A;  1NK2 P;  4DOZ A;  4XKB A;  1ZG3 A;  1J0R A;  3QOP A;  3NWS A;  1OLT A;  1UAA A;  4S05 A;  3A01 A;  2BV6 A;  2QZ8 A;  3OIP A;  2W00 A;  4PGG A;  1IN5 A;  4DW6 A;  4P55 A;  2B7E A;  4AUX A;  4L0Y B;  4B48 A;  1W5C C;  2G7U A;  2OZ6 A;  2X1C A;  2JVH A;  4FT8 A;  5HNH A;  1FOW A;  2COB A;  3W6J B;  3GBG A;  1XD7 A;  5GAD J;  3GFI A;  3I3L A;  4BH9 A;  3MFK A;  2B63 J;  3P9I A;  1QPM A;  1OIS A;  3DKW A;  1MJ9 A;  4IHT A;  5E3O A;  1PJR A;  1BOB A;  4RAY A;  1ZQ3 P;  1U8R A;  3FXU A;  4MQ9 F;  1LFP A;  2NS7 A;  5FKN A;  1Z05 A;  5DS9 A;  3S1N J;  5D4S A;  4GXO A;  2IS4 A;  4KMF A;  2J5O A;  4MTD A;  1UZC A;  2O03 A;  2RGV A;  4RMN A;  1WPK A;  1H9T A;  1DUX C;  4BYY A;  4HAM A;  4XSZ F;  2FOK A;  1Y6I A;  4AIH A;  2FU4 A;  3AG1 H;  3LWF A;  5E8I A;  3IRQ A;  3A4C A;  1FOY A;  4WWC A;  1OCZ H;  4R1H A;  3MZY A;  3MAJ A;  1QZE A;  2W24 A;  4PFO A;  4U7D A;  3RYR A;  1HQC A;  2JT1 A;  4EJW A;  5IP6 A;  4UUS B;  1KU2 A;  4JX5 A;  3HOW J;  5B66 C;  2Z1D A;  1XGM A;  1P6R A;  3LFU A;  1IV8 A;  2BZT A;  5DV5 A;  2HYJ A;  1STZ A;  3WTS C;  2P0W A;  1ZEL A;  2WBM A;  1SVL A;  3BPV A;  2MH9 A;  2QBY A;  4I7H A;  4HG2 A;  4EAT A;  3TOA A;  2GM4 A;  2O5R A;  1ETW A;  3S8P A;  3ZMD A;  2IVM A;  4DYQ A;  2CQ7 A;  3A01 B;  2R92 J;  4LLL A;  2OBP A;  3SHF A;  1RNL A;  1SVO A;  2X4H A;  4UY8 I;  3S16 J;  3ABK H;  4II3 A;  2MA3 A;  2W82 A;  3BR3 A;  3BQY A;  3HKZ A;  2JVG A;  1GV5 A;  3I59 A;  2QEX I;  4F7Z A;  4KMU X;  4A93 J;  4IRG A;  2IT0 A;  2XF7 A;  2OZU A;  1JUM A;  5E8G A;  4NUB A;  1O4X A;  4XR6 A;  1HW2 A;  3S1Q J;  2M0M A;  4XKV A;  3ZCO A;  1VND A;  5ICC A;  2QA4 I;  2F2E A;  2PMZ A;  2HOT A;  1TWH J;  3MD2 A;  2BVM A;  3ZQH A;  4A3M J;  3P9K A;  2N8G A;  2XAH A;  3DWL E;  4ZYG A;  4KT6 A;  1U5T A;  4FHT A;  2CUE A;  1HLV A;  2VKE A;  2E34 A;  3HRT A;  4KIB A;  3JCU C;  4A3L J;  2LF8 A;  1P4W A;  2JUC A;  2F5E A;  4LK1 F;  3RYP A;  2HQA A;  2VQG A;  2O8K A;  3HOZ J;  4JP0 A;  2KDO A;  3BTJ A;  2NVU B;  4WCG A;  1SC7 A;  5IOY A;  3KEQ A;  3D5L A;  2WAD A;  1OR7 A;  4OIN F;  2KZV A;  5LFA A;  2NXN B;  3QOD A;  3WGH A;  4W1U A;  3VPR A;  4XRS A;  3FMQ A;  1HKT A;  3ECH A;  2LYC A;  2PBI A;  3GTP J;  1A35 A;  4NDL A;  3IV5 A;  5JVG F;  4RB3 C;  3OS0 A;  5DCF A;  2DDB A;  5KK1 A;  2QBY B;  2YX7 A;  2DA4 A;  2L9S A;  2Z16 A;  3REO A;  2DFI A;  3ECO A;  2CW0 F;  4Y7N J;  5KVR A;  4OAZ A;  1Y39 A;  5EDN A;  1F36 A;  4PUS A;  4B44 A;  1HKS A;  2E71 A;  1D8J A;  4AVP A;  2ACJ A;  1KQ0 A;  2JA2 A;  3ZN0 A;  4A3G J;  2MYS A;  3RPQ A;  4U7B A;  4G8X A;  3S3O A;  3M1C A;  2DT7 B;  4I99 C;  3DU5 A;  2QQ9 A;  4NNJ A;  3GTL J;  4G6Q A;  4E70 A;  4LLG F;  5A2Q Z;  1AKH A;  3G4S I;  3O2P E;  1TTY A;  4FET A;  4BL0 B;  1YG2 A;  2EA4 A;  5J4Y A;  2KKO A;  4HPQ A;  4BDZ A;  3J7A O;  2LDU A;  5B3S H;  4L18 B;  3OYC A;  1OJL A;  5LEJ A;  1Z6T A;  2JMW A;  2WAQ N;  5GP9 A;  3SDB A;  3ZQ7 A;  1S6L A;  3LSM A;  1TT0 A;  2K5C A;  1QGP A;  3QYF A;  3E6D A;  5D6F A;  4A3D J;  2M0C A;  4OMY A;  2PMU A;  3K69 A;  2QSG X;  2OF7 A;  4RGU A;  2CG4 A;  4GYG A;  2Y9Y A;  3U1D A;  2EK5 A;  5C3E J;  5HS9 A;  2HQ5 A;  1R4M B;  1ZKG A;  4M71 A;  1O3R A;  1WJA A;  3WU2 C;  2R5Y A;  1EV7 A;  4DYR A;  3L2W A;  2A05 A;  2NYX A;  4BBS J;  1D8K A;  3H0G J;  3BPX A;  1ETV A;  5L3C A;  3LQQ A;  2G0E A;  1P7J A;  4IEJ A;  1I50 J;  3LSJ A;  3AL0 B;  2PG4 A;  1JT6 A;  4I02 A;  2CRG A;  5FRN A;  3ONQ A;  1YI2 I;  1MNE A;  2WWY A;  1EJ9 A;  5H6R A;  4CCL A;  1R5I D;  4A6E A;  1ITY A;  1TWC J;  3SZT A;  2QEN A;  4RA2 A;  2BY1 A;  5EGO A;  3BTC A;  2ISZ A;  5ERI A;  4RAF A;  5CVR A;  1O57 A;  3JW4 A;  1UG0 A;  2HFH A;  2BY0 A;  4X1E A;  2RVC A;  2VE8 A;  4RLF A;  4B8X A;  3S1R J;  1JKP C;  1ERD A;  2ZFU A;  2FNP A;  4DBR A;  4A3C J;  1OKR A;  2XDV A;  1HF0 A;  4DZJ A;  2JA8 J;  2DYS H;  3PSI A;  4BUP A;  4EJT A;  4L9V A;  4FTH A;  2AS5 F;  2P6S A;  3JTG A;  2GAU A;  4BU2 A;  3ZOB A;  1ZR4 A;  1X2M A;  3OIO A;  1RES A;  2EV6 A;  3S3N A;  1LFU P;  1NHA A;  3S93 A;  3C2B A;  4EM0 B;  2NS8 A;  5CPR B;  4CXF A;  1QO0 D;  3W2A A;  2H27 A;  3GTQ J;  5E3M A;  2ID3 A;  2DTZ A;  5FD6 A;  2KRC A;  3UNG C;  1U0J A;  2Y0S N;  3KP4 A;  1W36 C;  4KIF A;  1U5T C;  3SFZ A;  4B4C A;  2PX9 A;  3C3W A;  3LA7 A;  3GFM A;  1Z67 A;  3QQA A;  3C18 A;  2W1O A;  5IOZ A;  2IJL A;  1ENH A;  1ETQ A;  5K5Q A;  3CUQ A;  1G59 A;  3GO5 A;  2K9M A;  2K40 A;  4V2F A;  5HOO A;  1PP7 U;  4UVC A;  3A0B C;  4XON A;  5IP7 J;  5GTI C;  1R22 A;  2NVX J;  4XM3 A;  2L3D A;  2M8G X;  3H36 A;  2VOP A;  2HEO A;  2L7F P;  2QVO A;  2VBZ A;  3GW2 A;  4HRI A;  3U21 A;  3LSG A;  2XF6 A;  5J3L A;  5TIS C;  3M3Y J;  1VQM I;  3OY9 A;  4Q48 A;  1Y0N A;  1IDZ A;  1XN7 A;  3KIO A;  2FMY A;  4BAY A;  3BR0 A;  2EH3 A;  4LMY A;  5FFX A;  1FX7 A;  5EGO B;  5EEG A;  2DA1 A;  4C2M J;  4EGY A;  3KP6 A;  1OCT C;  2DJI A;  2M45 A;  1S8N A;  5DD4 A;  3I71 A;  4G6D A;  1QNT A;  3BQZ A;  3FXO A;  4HV5 A;  1A31 A;  2STT A;  1N25 A;  3GTM J;  4ESF A;  2LP0 A;  1ONV A;  2QQB A;  2R5Z B;  5L3B A;  1Z1D A;  2ESN A;  3S17 J;  2XAS A;  3J80 K;  2ZME C;  3RTR A;  2R7Z J;  2VJ5 A;  1R36 A;  2HR3 A;  1X4P A;  2DOD A;  4OIQ F;  3KYL A;  1UMQ A;  1MBJ A;  1W1W E;  3RQI A;  1VQP I;  1UHM A;  1IUF A;  3LA2 A;  2MC3 A;  1R9T J;  3BY6 A;  1R6R A;  3CCR I;  4Y17 A;  2M34 A;  3HGY A;  4KN7 X;  2JN6 A;  4A0X A;  2NOJ B;  3EUK L;  2L7Z A;  3K4J A;  3KEO A;  1YIO A;  3I58 A;  4UV8 A;  2CUF A;  3RDI A;  2LY2 A;  3BCA A;  1D0Z A;  2R3S A;  1LUJ B;  1QRY A;  2EQR A;  3CUQ B;  3WTY C;  1G4D A;  4IX7 A;  3H3U A;  5F0C A;  1ZHF A;  2M5W A;  2E7W A;  1Z6R A;  2ZXH A;  2KZG A;  1KGS A;  3JRE A;  1A6Q A;  1TQP A;  1E3O C;  2IW5 A;  4YFK F;  4QIW N;  1FYL A;  1JHH A;  3LQR A;  4XN0 A;  4LB6 B;  1TP4 A;  1VZ0 A;  2PN6 A;  3SZG A;  1YIT I;  4ZYA A;  3ZQQ A;  1G3T A;  3BG7 A;  3BG5 A;  1GHC A;  2L02 A;  3FBI B;  3ZMT A;  3TQN A;  3CES A;  1BW6 A;  3CCM I;  2DOF A;  2YSR A;  4BJ6 C;  3I0T A;  3LST A;  3L2V A;  1BL0 A;  1G8X A;  4AWX B;  1XX5 A;  1U9O A;  1WHU A;  3G2B A;  3FXM A;  2RN7 A;  3M4O J;  2X85 A;  3FXR A;  3HB9 A;  4PJL A;  2ETH A;  3H92 A;  3ABL H;  4LG0 A;  1HDD C;  3SXY A;  4TV7 A;  4A3K J;  2DCE A;  3BG6 A;  4UVB A;  2WC2 A;  3LSR A;  2H1K A;  3CQZ J;  3BZ6 A;  1HXD A;  1E3H A;  4Y52 J;  2LBF A;  5IYB J;  2R7R A;  4EV0 A;  2KRF A;  2EFO A;  2V1N A;  1Z3X A;  2WB1 A;  3DFG A;  3U9G A;  1TBX A;  4GGG A;  5TGT A;  3G1M A;  4XRM A;  2VON A;  3ZMZ A;  1SD4 A;  3MKZ A;  3K2Z A;  1SEU A;  1FPQ A;  3H1C A;  3KZY A;  4BBR J;  2M3A A;  4A3E J;  2HDC A;  2EFN A;  2HZD A;  3VSK A;  4Y15 A;  5K7H A;  3EQL F;  2X9D A;  3J7A Y;  1RKT A;  3CF2 A;  4MEX F;  1IF1 A;  1FTZ A;  2BY2 A;  4BEH A;  1YE9 A;  1QVU A;  3OR1 C;  2E1M C;  4BXX J;  4YEL A;  5GAH J;  1I39 A;  5D5V B;  5E1X A;  2RNG A;  1YIJ I;  2EA2 A;  2DQL A;  2M2E A;  5J6X A;  1MBF A;  2PMH A;  3J7Z I;  3OSG A;  1YFH A;  1XGS A;  3HOU J;  3H3Z A;  2GXG A;  4GFB A;  3ROU A;  1JI8 A;  4JQF A;  5BPD A;  2XAU A;  5H6Q A;  1Z3Y A;  2ZXW H;  1WCM J;  2LY1 A;  5E3N A;  1B72 A;  5IYC J;  1WVR A;  2ZJ2 A;  2EFQ A;  3K4B A;  4B09 A;  1IN4 A;  2E1N A;  4D1Q A;  4KA4 A;  4FQG A;  1AOY A;  3CC4 I;  3DBR B;  4E7I A;  3FK7 A;  2QLZ A;  2VXD A;  2ZSI B;  3EDP A;  3BG9 A;  1ZYR F;  4QPQ A;  3OS2 A;  2OTJ I;  3VOD A;  2K9L A;  1S7E A;  1G3S A;  1D0Y A;  4IJA A;  2LBF B;  2R4G A;  3O6B B;  5DEQ A;  1H89 C;  1V4R A;  4II2 A;  4J00 A;  1G2H A;  4M3B A;  2KJC A;  3F8B A;  4AID A;  2H09 A;  4F55 A;  3RPU D;  5J1Y A;  1R71 A;  1PVE A;  4XOR A;  4CA0 A;  3HOS A;  1VQ5 I;  3TL4 X;  1SVM A;  5KAF C;  3CCE I;  3EYY A;  3A03 A;  3PQK A;  1XMK A;  2RKH A;  1HDP A;  4BE0 A;  3BZK A;  1T6S A;  4JBA A;  1LEA A;  3OV8 A;  5ICE A;  2HYF A;  3QP6 A;  4GO1 A;  1UEL B;  3WGI A;  1TC3 C;  3O3K A;  3IP4 B;  3I53 A;  4KDP A;  2FF4 A;  5IT9 K;  1T2K A;  2FD5 A;  3L09 A;  3JSP A;  1TW2 A;  2JTV A;  3FWE A;  4BEH B;  1D5V A;  5J8C A;  2MBF A;  4GRI A;  2GIZ A;  3RI4 A;  1K83 J;  5LGU A;  2FQ4 A;  3DU6 A;  3M7G A;  2IEK A;  5KAI C;  1U6G A;  5J8F A;  1IAW A;  2E60 A;  2CU7 A;  2ZXJ A;  1ZAO A;  2R7O A;  2MC4 A;  5K5R A;  3C7J A;  2DK8 A;  3J80 Z;  3CCQ I;  3ZMV A;  2M9H A;  4PDK A;  1QBJ A;  1T0F A;  2OUM A;  1X1B A;  1X1A A;  1BR1 A;  1B72 B;  2TDX A;  1HW1 A;  4OIP F;  4O5V A;  3ZRG A;  3TP0 A;  3A1Y A;  1S7O A;  3I5U A;  2HXI A;  4YEJ A;  3ABM H;  3DV8 A;  2LMD A;  2G9W A;  4ENM A;  4IHX A;  1X4O A;  2A5Y B;  5ED4 A;  1BI2 A;  5HOD A;  3ZMS A;  3TBI A;  1ZLJ A;  4DGW B;  4AIJ A;  1XTA A;  1WSU A;  2HPI A;  5ILV A;  3DPT A;  4XRS G;  2DMQ A;  3EET A;  2ME6 A;  1EA3 A;  2EZH A;  3MWM A;  1FOK A;  3HZJ A;  3CCL I;  4B47 A;  4ZYH A;  4IPA A;  1Y8Q B;  3GCM A;  1J2X A;  2VLA A;  2PEX A;  2WY8 Q;  3BR2 A;  1UJ8 A;  5F27 A;  1D3Y A;  1R7J A;  3UKG A;  1FMV A;  3IUO A;  3O8H A;  5CLS A;  4HLX A;  3OYA A;  1YRN A;  2DU9 A;  2MGQ A;  1NK3 P;  4XID A;  2E19 A;  1BI0 A;  2R0Q C;  2CGP A;  5FJ8 J;  3BP8 A;  2NRA C;  1POG A;  1MZB A;  4EJO A;  2W7N A;  1O3T A;  2E2H J;  3CME I;  4ZDL A;  4M6X A;  4XLC A;  5DM7 F;  4CH7 A;  3J81 K;  2RQP A;  1QHG A;  3Q5F A;  3BTL A;  3Q9S A;  3HRS A;  3IWF A;  2E1O A;  5HS8 A;  4FAS D;  1TNS A;  3K0L A;  4WXC A;  3QOE A;  1YOV B;  1NG7 A;  1W4M A;  4XMY A;  4EJV A;  3MZ8 A;  1VQN I;  4HNU A;  2HDW A;  3DTK A;  4MFD A;  2XRO A;  1FOX A;  1UHW A;  2WY7 Q;  5D6E A;  2IS2 A;  3WE2 A;  4CHU A;  5F1J A;  1TL8 A;  4S04 A;  1WQ2 A;  1SFK A;  1RUO A;  1H9G A;  3FIW A;  4H0E A;  3GTG J;  2V7F A;  5KHD A;  1JTX A;  5D4R A;  3IAM 2;  3K4M A;  2EIN H;  1XMA A;  4OIR F;  1K4S A;  4U0W A;  3JRI A;  2FBH A;  3QPS A;  4A12 A;  2E7X A;  3T8T A;  3LAP A;  2GIV A;  5JLX A;  3AG2 H;  2EIJ H;  2Z5U A;  2A68 F;  4XIC A;  3GFL A;  2Y69 H;  2ZNY A;  2FA5 A;  1XB4 A;  3K1M A;  3OYF A;  4NHJ A;  1KQ8 A;  2H8W A;  2RAE A;  4XN3 A;  2HQR A;  2VI6 A;  1YRN B;  3S2W A;  4CYD A;  2NOG A;  1I1S A;  1ETX A;  4ZC3 A;  5TJJ A;  3CMY A;  1MH4 A;  2O3F A;  5GTH C;  1WJF A;  3FM5 A;  2XHK A;  5F08 A;  4HX4 A;  3OYJ A;  4B3A A;  2CSO A;  3OMY A;  2EPF A;  4CCO A;  1WJD A;  1LB2 A;  2JSC A;  5ILU A;  1OCP A;  2VOO A;  1IO2 A;  1ODD A;  1OQY A;  1FIA A;  1B1B A;  2I8D A;  2KQR A;  1OCC H;  3Q0V A;  2IGM A;  4AU7 A;  2XGC A;  2OCE A;  3TDU C;  3ZGK A;  2HKO A;  4G7H F;  3OOP A;  1X1P A;  1NG6 A;  3DLA A;  5LGN A;  1BJZ A;  1UB9 A;  2R7S A;  2ELK A;  2EZI A;  2VBX A;  3V7R A;  3DEW A;  3L7W A;  2MSY A;  2YX4 A;  3OSF A;  4U0V A;  4MLO A;  1XC5 A;  2L01 A;  1K7A A;  3VYR B;  5HNF A;  4IOA F;  2HOA A;  4E7Z A;  2XSD C;  1JE8 A;  3CJT B;  3K10 A;  2XRL A;  3BRO A;  2X1D A;  1VQ7 I;  2XVC A;  3TO6 A;  3CCJ I;  1B9M A;  2VKH A;  4L9T A;  3CCV I;  1AWC A;  1HA8 A;  2F4M B;  1FIP A;  3FMR A;  4EM2 A;  4Y13 A;  2ID6 A;  4LLN A;  4IO9 F;  4UUV A;  1PDN C;  2NVQ J;  4N4O B;  3F8C A;  4HYE A;  2BBY A;  5CKT A;  4FCY A;  3GLL A;  1MIJ A;  1BN5 A;  3I4M J;  3AG3 H;  2CWE A;  2IS1 A;  2OC6 A;  3OL3 A;  2XPV A;  1U78 A;  3LL7 A;  2W4S A;  3G1O A;  1B8I A;  3W3C A;  4DYC A;  2CJJ A;  2BW3 A;  1IZ1 A;  1LJ9 A;  2DOA A;  2J5P A;  1MJA A;  2XIG A;  3V42 A;  5EF6 A;  1SMT A;  4KIC A;  3GTJ J;  2STW A;  1MKM A;  4O3M A;  4YIR X;  4IF4 A;  3FMS A;  4KNY A;  1F43 A;  3WG7 H;  4G9Y A;  2A5W A;  2E2I J;  2FUG 2;  3S2H J;  1TQI A;  2R93 J;  4JK1 X;  1VQ6 I;  2GBY A;  5HLT A;  3GF2 A;  1R23 A;  2F5D A;  1B59 A;  2R7W A;  1ETK A;  4I2O A;  4L5I A;  3JAM K;  3Q9V A;  2CV1 A;  2XF5 A;  1DDN A;  3GVA A;  4HSR A;  3RZO J;  3PFI A;  2COM A;  3OYH A;  3I4N J;  4LK0 F;  1BC7 C;  1O3Q A;  2B0L A;  3MN2 A;  4GCV A;  3VFZ A;  3JR9 A;  3FKI J;  3B6C A;  4MTE A;  5ICG A;  1HOM A;  1HST A;  1UCR A;  2LFB A;  4ENK A;  1FWZ A;  1PYV A;  2F5C A;  2L54 A;  1SFO J;  3FXK A;  2DT5 A;  1QZY A;  2EJR A;  5CVU A;  4S0H B;  1QPI A;  1Y1V J;  2FML A;  2QKL B;  4YFX F;  2D1H A;  2K7L A;  3DQV C;  4MEY F;  4BJT A;  4BXU A;  5GPA A;  5AON A;  3OWT A;  1ETO A;  1EH8 A;  3QPT A;  3R6S A;  1XDS A;  2CQX A;  2DMN A;  5IY5 H;  3J81 Z;  2ZJP F;  1W0T A;  2F6C A;  4HW0 A;  2H6C A;  3OYN A;  2P8T A;  3KP5 A;  1B8I B;  1RRJ A;  2R7U A;  2KMU A;  2M4K A;  1LPQ A;  2BW3 B;  1WFX A;  3L9F A;  1SAN A;  3TO7 A;  2V1X A;  3P7N A;  1S72 I;  4HX8 A;  1J9I A;  1BBY A;  3OYE A;  4QTR A;  2XUB A;  3MVP A;  4UV9 A;  3K1P A;  3PQJ A;  3K70 D;  2H1L A;  1MDM B;  2DA7 A;  4D9J A;  1XSD A;  2YU9 J;  4PGH A;  4NC6 A;  1ZLK A;  2HVR A;  2HOE A;  5H2F C;  1X1D A;  1T33 A;  3JRF A;  1JT0 A;  1WH7 A;  2CW7 A;  2M8E A;  2TCT A;  4YII A;  2LOO A;  2HTS A;  5CVV A;  4UNO A;  2O9L A;  4RS8 A;  3PIP F;  2Q0O A;  2ME0 A;  4BE2 A;  2ZNZ A;  1DP7 P;  3HSR A;  3PFY A;  2K86 A;  4EM1 A;  4BY1 J;  1MMD A;  3SEZ A;  2X6W A;  2FOW A;  3KP3 A;  5JHF A;  1LDD A;  2P5V A;  1J7K A;  1IV6 A;  2WA0 A;  4HBL A;  4A3I J;  3ABT A;  1YX3 A;  3RCO A;  2R5Z A;  2BXZ A;  2UUZ A;  3M9A A;  3SYT A;  3JSO A;  1R58 A;  1ZAR A;  1GT0 C;  4C2U A;  4QLC U;  3B6A A;  2KFD A;  1K4T A;  3CO6 C;  4HQE A;  4F93 B;  2IBD A;  2XPU A;  4WXD A;  1RET A;  4ENJ A;  1ULY A;  3S2D J;  3WHB A;  4KJZ A;  3HTS B;  1F1Z A;  1MND A;  3IWZ A;  2NVT J;  2DI3 A;  2DMT A;  1J09 A;  2IPQ X;  2VT2 A;  1MMS A;  3H5R A;  3K4N A;  3MMY B;  3G1L A;  2LVS A;  5M5X J;  5J1U A;  2RV8 A;  1JKO C;  1JUS A;  4LFU A;  5FKO A;  1HC8 A;  1V55 H;  1S3J A;  4H4K C;  3G3Z A;  4Z2Y A;  5LHG A;  4BXF A;  3F6V A;  2LY9 A;  4IHW A;  1UG2 A;  3F23 A;  1OR7 C;  3VEP A;  4ZZD A;  5FKK A;  1ZRD A;  4RB0 A;  3E1S A;  5HDN A;  2JWT A;  5BMZ A;  2D1V A;  2K3F A;  1LDK B;  3P5J A;  3F72 A;  4HF0 A;  4A6D A;  1FT9 A;  3AL0 C;  2EB7 A;  4UB6 C;  1LKX A;  2K3P A;  5GAE J;  1R49 A;  3RPU A;  4XBF A;  2VC1 A;  2R7T A;  3DEU A;  2YUS A;  1XS9 A;  1HBX G;  3QWL A;  3CCY A;  2GXA A;  2XKO A;  4IKF A;  1VQK I;  2VN2 A;  4QSH A;  5K5O A;  1DU6 A;  2K4B A;  3CUO A;  1F4K A;  2L2O A;  2VL8 A;  3FXL A;  2ZO4 A;  3HYI A;  3BCB A;  1KQ9 A;  1D1C A;  1OPC A;  1WKM A;  3BLY A;  4BQA A;  3E6C C;  1BW5 A;  4LD5 A;  4M3E A;  5LHH A;  3IL2 A;  3RZD J;  3I4P A;  2PLY A;  2UXN A;  5F04 A;  2GA2 A;  3DBH B;  1T08 B;  2K9N A;  3TOB A;  3C2G A;  1ORK A;  3VOE A;  1GVJ A;  3F21 A;  3LFK A;  5FB2 A;  3KCC A;  3BTI A;  2AQF A;  2Y9Z A;  3KP2 A;  3OL4 A;  3ZN1 A;  2B9S A;  1IG7 A;  1O7F A;  2VKD A;  2YS9 A;  4A0Z A;  3DEE A;  2YU3 A;  2ZBK A;  5LRS A;  3M8F A;  3FDY A;  1IGN A;  2VC0 A;  2E5N A;  5F1R A;  3NEU A;  1YS6 A;  2UV1 A;  2CUJ A;  1GVD A;  1YJW I;  4F92 B;  1SD5 A;  2JZY A;  4RAZ A;  2GZW A;  5EEA A;  2Z9O A;  4IHV A;  4J19 A;  5L3G A;  4D0P A;  2EFP A;  2HVQ A;  1MMN A;  4L5J A;  3JAM Z;  4WXH A;  1WGX A;  3M1E A;  2VKV A;  4M72 A;  4ESB A;  3L2Q A;  3RKY A;  4BKX A;  1T95 A;  2DT6 A;  4NB5 A;  3JRD A;  2LRE A;  3CTA A;  4HQM A;  4MFE A;  3HUG B;  4HNV A;  3WOD F;  5CVI A;  1FSE A;  1N75 A;  4I6Z A;  1VTN C;  6PAX A;  5HLG A;  4F91 B;  2EV0 A;  1A04 A;  4CGZ A;  1FY7 A;  2WTE A;  2QKM B;  4LIU A;  3WU0 A;  1C0W A;  4B3X A;  3N4M A;  1W7P D;  3FKJ A;  4PK4 A;  1JKR C;  4X0G A;  3E97 A;  1BR2 A;  1T38 A;  2JRT A;  3ELK A;  1QVT A;  1TWF J;  2XB0 X;  3SZP A;  3GUD A;  3J7Y J;  3ZPL A;  3LSP A;  1NTC A;  4Y33 A;  2WAQ A;  3OYI A;  3H3V K;  2MAB A;  1P92 A;  2V26 A;  5J40 A;  3IRR A;  3KET A;  3SQN A;  1N77 A;  2A07 F;  1K6Y A;  1TWG J;  3KLO A;  2CQK A;  3UR3 C;  3ZMU A;  1OCO H;  3BOQ A;  1QZZ A;  5HS7 A;  2LH9 A;  1A6I A;  1S5L C;  2MD5 A;  5C4J J;  4NC8 A;  3SEQ A;  2KPM A;  1MD0 A;  3V8K A;  1H88 C;  4ON0 A;  5J4V A;  4C3H J;  2DA3 A;  1FJL A;  1JHF A;  1VQO I;  1IRX A;  2LKS A;  1R1V A;  4RGR A;  3OYM A;  2X48 A;  5EEH A;  4O6J A;  5B5E C;  3F0C A;  4P9U A;  1ZRC A;  4RAG A;  1V5G A;  3GTK J;  4HF1 A;  3BR1 A;  4LOC A;  2A6E F;  3M07 A;  3MZH A;  3H5N A;  4WF2 A;  3BR6 A;  2X51 A;  1FLI A;  3G71 I;  3CUQ C;  2DXI A;  1TT5 B;  1WJB A;  3QP5 A;  3AKZ A;  2K9S A;  2XSJ C;  1RR7 A;  4D7N A;  2Q2E A;  1ZR2 A;  3DBL B;  1U9N A;  3EUH A;  3BJA A;  4KT5 C;  1QQI A;  1ETY A;  3FIS A;  2NVY J;  5AIP A;  4AYB N;  1XG1 A;  2D45 A;  1IUY A;  5D5U B;  2KDZ A;  3OYG A;  3GZ6 A;  4XK4 A;  2FJ1 A;  5D8K B;  1I3A A;  1SFX A;  3HHH A;  3IH4 A;  4HF2 A;  2OQG A;  3QYB A;  1T8I A;  2PJP A;  2DMP A;  4PSW A;  2OA4 A;  3RJP A;  1Z7L A;  3ZP5 A;  5K7F A;  3K2A A;  3V8L A;  2LSO A;  2MH2 A;  5CVJ A;  5DDG A;  5IPA A;  3H5A A;  2CQN A;  4G6T B;  4FX4 A;  1F5T A;  3E5Q A;  4UUT A;  4XQF A;  2H8R A;  2XRN A;  4CIC A;  1EF4 A;  3GZ5 A;  1HW5 A;  1I6H J;  2FNA A;  1MSE C;  4M3D A;  1B6A A;  3ABU A;  2R7X A;  2Y0S A;  2P5K A;  2V79 A;  1M1E B;  1IDY A;  4FE7 A;  2YR2 A;  1O7L A;  4EEF G;  1FBS A;  5LLQ A;  1LEB A;  3WTT C;  2ZJR F;  3HJE A;  2K4J A;  1FP1 D;  3NAU A;  2JRM A;  3FHN A;  3NQO A;  1J59 A;  3JRH A;  2V1U A;  4RM3 A;  1MH3 A;  2Y48 A;  3FBN B;  5E1Z B;  2P7C B;  1MJB A;  2FXA A;  2LKX A;  2M1B A;  1KYZ A;  3KYC B;  2VQC A;  5DM6 F;  5FLV A;  3DTI A;  4XRF A;  3KFW X;  3HKZ N;  4V2G A;  3QRF F;  3S14 J;  1R4N B;  2CFO A;  1USS A;  3RKX A;  2E36 A;  3TW6 A;  1MW7 A;  1WJC A;  1K78 A;  3JRG A;  3COA C;  3L2R A;  2AHQ A;  3S1M J;  2M7A A;  2QUF A;  3BJO A;  1XMX A;  2Q2E B;  2PMZ N;  1XPX A;  2XKP A;  5BNG A;  4P9F A;  1MBE A;  2DQR A;  3S3M A;  4YIF A;  5IP9 J;  5TRD A;  2BE5 F;  3EYI A;  2XPW A;  9ANT A;  3L1P A;  4BQO A;  4BQN A;  5DCM B;  4LG3 A;  3W2V A;  5FO5 A;  4N4N B;  2HQN A;  3KP7 A;  4LIV A;  3MKW B;  3JTH A;  1IRZ A;  3R60 A;  3R61 A;  3TED A;  1YW8 A;  3H9G A;  3MEX A;  1KYW A;  4D5C A;  5HVQ C;  3CCU I;  1KU9 A;  2L5Q A;  1BIA A;  4PJM A;  3VYU B;  2DPU A;  3CDI A;  1FYK A;  3GYH X;  5BOX A;  4XOP A;  4IHY A;  2ISY A;  1APL C;  1LNW A;  5CJ9 A;  2DW4 A;  1T98 A;  4E7H A;  3PO3 J;  4ZZL A;  1H8A C;  2HU9 A;  1DU0 A;  5FD5 A;  2VE9 A;  2HOS A;  4YRV A;  4A3F J;  5DYM A;  1QA6 A;  3K4C A;  4AD9 A;  2LC2 A;  3KLN A;  2LK2 A;  4E7S A;  1XGN A;  2L9R A;  2OU2 A;  2WV1 A;  4HZF A;  2QM3 A;  2DA2 A;  1OYY A;  3SDG A;  2V9K A;  3VYT B;  3CJN A;  2EFW A;  4FX0 A;  2IRF G;  2QSH X;  3NAR A;  3GLX A;  2V9P A;  3K9T A;  2L7M P;  3E0J B;  5EG0 B;  1EH6 A;  1BI3 A;  1OYI A;  3E5X A;  4MIM A;  5L3D A;  4A69 C;  3Q0W A;  4ETS A;  3HGG A;  2BXY A;  2P81 A;  5AIQ A;  2HPM A;  3CLQ A;  3WTU C;  4M6Y A;  2O6G E;  2BY3 A;  3VWB A;  4I0B A;  5F64 A;  1K78 B;  3CF5 F;  4HST A;  1EKE A;  1MMG A;  1IXS B;  2JPB A;  3E6M A;  3C1D A;  1O3S A;  1X3U A;  3OIQ A;  5LHI A;  1YYV A;  4HOB A;  1PUE E;  2JQ7 A;  1I6X A;  1J5Y A;  3HXL A;  1MSF C;  5E79 C;  5E3L A;  3CDH A;  2JA7 J;  2MD0 A;  2K9Q A;  2PFB A;  2CFX A;  1L3L A;  1V3F A;  3EUH C;  4R79 A;  3CD6 I;  4I98 B;  2HXO A;  5JR3 A;  3FK6 A;  3GEZ A;  1CGP A;  4EGZ A;  2DPD A;  2ZJQ F;  1OMI A;  2KIU A;  3P9C A;  1W0U A;  3TMO A;  2XV4 S;  3VDX A;  2JA5 J;  2A6H F;  4IL6 C;  1KA8 A;  2GLO A;  4BNC A;  2VBY A;  4ITV A;  2V6C A;  4NBQ A;  4NQW B;  3WGG A;  4HDU A;  3TGN A;  3QU3 A;  2JA6 J;  1B4A A;  2MLG A;  2DTR A;  4G7Z F;  1KU7 A;  3KPH A;  2OCC H;  2X6X A;  1OFC X;  2LLK A;  3HG9 A;  3VYS B;  4K2E A;  1VF9 A;  2KIS A;  2O7O A;  2W25 A;  3A2K A;  4IXA A;  1E3P A;  5B1B H;  4CUG A;  2KRH A;  2XAG A;  3ULQ B;  1WI3 A;  1AU7 A;  4BGD A;  5F6F A;  3BZC A;  2C6Y A;  2I5U A;  2L9N A;  2OV7 A;  1IXR C;  1ZN2 A;  4RB1 A;  5E17 F;  5D5W B;  1OCR H;  3I55 I;  5FGM A;  5DD8 A;  2NS0 A;  3L2U A;  4OU0 A;  1HSJ A;  5GAG J;  1K6O A;  2HDD A;  3V7C A;  5CQE A;  4CCJ A;  2F4I A;  1P2F A;  4ZTJ A;  1IW7 F;  3GFJ A;  2DFH A;  3W6K B;  2MLK A;  3AAF A;  1BI1 A;  3F3X A;  3FF5 A;  2HVS A;  4AYB A;  2LKP A;  3ZQG A;  2P4W A;  4G7O F;  3MCZ A;  3PJR A;  1DQU A;  1ZGJ A;  2V1D A;  3NRV A;  1X1C A;  5KCM A;  1W5T A;  2O8X A;  4A5N A;  2LG4 A;  3PIO F;  3CC7 I;  4BE1 A;  4OIO F;  4Y3O A;  2Y30 A;  3KE2 A;  2ZB9 A;  2PQ8 A;  3PNT A;  3G73 A;  4PJJ A;  2CO5 A;  4CZC A;  2IGN A;  2IA0 A;  2HNH A;  3DLL F;  1FBU A;  4HNT A;  4DIQ A;  3KYD B;  1IN8 A;  3GTO J;  1V54 H;  3N05 A;  3WG9 A;  4JYK A;  1BJA A;  5CYV A;  3ERE D;  3DKY A;  1RR8 C;  1T0F C;  4LB5 A;  2LR8 A;  2L9V A;  5C44 J;  3U1K A;  5IYD J;  2LNB A;  1FZP B;  3FM3 A;  4PJN A;  3U2R A;  3M8E A;  4P96 A;  3D5S C;  1IN7 A;  3N97 A;  2X6Y A;  2M4G A;  2K85 A;  4HDV A;  1D0X A;  2EBI A;  1AHD P;  2F4O B;  2WAE A;  2KJB A;  4CZZ A;  3IKV A;  3MQ0 A;  5IT9 Z;  1IRG A;  3IH2 A;  3K6G A;  5D5X B;  1QHH D;  5FLX K;  1ON2 A;  2EZL A;  2NNY A;  1MBG A;  4N9I A;  2OQR A;  5F0H A;  1A36 A;  4DZP A;  2DFE A;  4D7M A;  1XCV A;  3PSF A;  4CYC A;  2V4J C;  3PNV A;  4ESJ A;  5C4X J;  4PZJ A;  3ZQI A;  3HOT A;  1D5Y A;  2CUZ A;  2DMU A;  3QU6 A;  1VQ9 I;  1RC9 A;  4I76 A;  3I56 I;  3BT9 A;  1ACI A;  1WI9 A;  1DGR M;  4AC0 A;  2PJR A;  2ZKZ A;  4WX9 A;  1ZG5 A;  2H6B A;  1MDM A;  2VB6 A;  2Z99 A;  5JFR A;  2K02 A;  2KT0 A;  2K27 A;  4MNU A;  2HZT A;  2L0K A;  3O8G A;  5LRR A;  1G6N A;  1WH5 A;  4DJA A;  1A5J A;  5J47 A;  2G7H A;  1UHS A;  3KZI C;  4IVN A;  2X0L A;  3HBL A;  1TQM A;  2DAO A;  1TNT A;  2R7D A;  4QWQ A;  3EUA A;  2P7V B;  2BYV E;  4IOC F;  3RQ4 A;  4CCN A;  1R1T A;  2XGE A;  5M5W J;  1YW7 A;  2QCO A;  3K1N A;  2QQA A;  2HYG D;  2GOX B;  4P1W A;  2GWR A;  4XKC A;  3B73 A;  5HDK A;  4A2U A;  4IRH A;  4E7L A;  4KIG A;  2JUG A;  2A6T A;  4ABZ A;  1RIO H;  1H0M A;  1TW3 A;  5LGT A;  3CZ6 A;  3TDZ C;  4ZTF A;  4JX4 A;  3WU1 B;  4RGX A;  3H0D A;  2DOE A;  3W2W A;  4IQ4 A;  2BHZ A;  1YS7 A;  4HX7 A;  4ZYE A;  5FRO A;  1E2X A;  3CP2 A;  3DF8 A;  3K70 C;  3IAS 2;  5FRM A;  1MMA A;  3I59 B;  1ZTR A;  2ZME A;  1SAU A;  3E7L A;  3WTW C;  2QGU A;  3T8R A;  4G12 A;  4GYI A;  2ZXI A;  1W7P A;  1LFB A;  1MBK A;  4Q5S F;  3M8J A;  4YFN F;  4A5M A;  3V7S A;  3HM5 A;  4C9Y A;  2DA5 A;  4CYC B;  2E2J J;  4F52 A;  1U8B A;  4IHS A;  5DTD A;  3TKY A;  2X6O A;  2E5Z A;  1HCR A;  4BHB A;  1K79 A;  4UHT A;  2ZFW A;  2KHM A;  5M3M J;  2Y2Z A;  3HDD A;  3ZQL A;  1E0E A;  4ZH4 F;  1U5T B;  1YTY A;  1Z7U A;  2BHY A;  4AM3 A;  4HA8 A;  2JK3 A;  2PJR B;  2RDP A;  3F9K A;  3T1B A;  3HOV J;  1Y1W J;  3KZZ A;  1YHQ I;  4PJ0 C;  2PI0 A;  4D5F A;  3Q3S A;  5LD2 C;  3SJM A;  3PO2 J;  3DCF A;  1REP C;  2R7Q A;  4M3F A;  1PP8 F;  4UB8 C;  5H20 A;  1FTT A;  2RC4 A;  2WB1 N;  2EV5 A;  1DP3 A;  4ZDP A;  1SFU A;  1LDJ A;  2UWM A;  2RRE A;  4ANJ A;  3QPL A;  3D0S A;  1SD7 A;  1Y56 A;  4U0Y A;  2Q8K A;  4EJU A;  2AXL A;  1MGT A;  2OPT A;  3E5U A;  2CV0 A;  3WTV C;  1Z9C A;  2VIX A;  1YX5 A;  4YG2 F;  4BDY A;  1FSH A;  3PUB A;  1I5Z A;  5JVT A;  2XB5 A;  2KLO A;  1ZRE A;  3R0J A;  1SAX A;  4C2T A;  3OR2 C;  4R8H A;  1G3W A;  2QYO A;  1CF7 A;  2FEZ A;  2IAI A;  1S9H A;  2HTJ A;  2OD5 A;  3FZV A;  3L00 A;  4XOT A;  1BR4 A;  2FX0 A;  3ESW B;  2QQ8 A;  2VXZ A;  3T5X A;  4E7J A;  2EIL H;  5E20 A;  2ZME B;  4OAY A;  1AKH B;  1W7P B;  3HTU A;  3WTX C;  3RIR A;  3WE3 A;  2GOM A;  3A02 A;  4AVZ A;  2OJE D;  5B1A H;  1X2N A;  4N9H A;  3HPG A;  5ICF A;  1JJ6 C;  4Y4R A;  2FBI A;  2Y31 A;  2FBK A;  4IQJ A;  3CP8 A;  2DYR H;  4M74 A;  2ICW G;  3D5R C;  4EVI A;  4A3B J;  1ZH5 A;  5JLW A;  2JPC A;  4OMZ A;  2E1C A;  2FE3 A;  2MFZ A;  2HS5 A;  1VFC A;  1FYM A;  1S29 A; 
#chains in the Genus database with same CATH homology
 2QSG X;  1TP4 A;  1OQY A;  3ESW B;  2QSH X;  1X3W B;  2F4M B;  4YIR X;  2F4O B;  1QZE A;  1PVE A;  1X3Z B;  2QSF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...