1X3ZB

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
GSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide: N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1x3zB01
2F4OB 2QSFX 1TP4A 2QSGX 3ESWB 1QZEA 1PVEA 2F4MB 2QSHX 4YIRX 1OQYA 1X3WB 1X3ZB
chains in the Genus database with same CATH superfamily
2ZO4A 4XSZF 2EZKA 3O8GA 1H9GA 5J1YA 1QGPA 1NH3A 4C3IJ 3HXLA 3HRSA 4BEHB 3WGHA 3I55I 4XK4A 2ZSHB 1P92A 2M9HA 3CCUI 1B1BA 2UXNA 3HPGA 4ZDOA 1WRJA 4GO1A 3GUDA 3DPUA 3G1MA 5L3BA 5ERIA 2LVSA 2L7FP 2VBXA 2LY1A 3FHZA 1NTCA 3F3XA 5GAHJ 1YIJI 4I98B 1WJAA 3S2DJ 4RAFA 2WAQA 3W6VA 1YRNA 2WAFA 1USTA 3JCUC 2CW7A 1SFKA 3EUAA 1NHAA 3M7GA 5CQEA 2FOKA 3ZR8X 4E70A 4GXOA 4RS8A 3FMSA 5L3FA 3ONQA 4HAMA 4JYKA 3BG9A 5E1XA 3UR3C 4RLFA 3FWEA 1OLTA 1T95A 3R61A 1H88C 1ETQA 3BG7A 3OYJA 1XD7A 4J00A 1K83J 4LD5A 2IVMA 2OV7A 4HV5A 2FF4A 4HSTA 2DTZA 1BIAA 4XLAA 5CJ9A 2EIJH 3P9CA 1P9QC 1HC8A 2PG4A 3MMYB 2ELJA 4UV9A 2NVUB 3GTPJ 2EFNA 3ZMVA 3HIFA 3RZDJ 2CV0A 3BP8A 3LSIA 4PJJA 1LVKA 1X3UA 2R5YA 3JRDA 2A05A 3F8FA 4OIQF 4GYIA 4M9XA 2ADUA 3KZIC 4YRVA 4BXXJ 2GOXB 4N4NB 3TDUC 3WODF 5F1JA 3DEUA 3H0GJ 1P4XA 4KNYA 2H27A 1B72A 2GAUA 3KYCB 2QENA 2DW4A 3CMMA 2X1EA 3DFGA 2IP2A 1XPXA 2XAUA 2XGDA 4A3LJ 4I01A 5E3MA 3K4BA 2HYFA 3QOPA 5E3OA 1V55H 2WBMA 4ZYDA 3HOSA 4K2EA 1N25A 3K4KA 2KIUA 4N0BA 1R71A 3JRHA 2IA1A 1YJ9I 2JA8J 1O3QA 5GTIC 1BN5A 4BUPA 3E1SA 2GZWA 4S04A 3RPUA 2KZVA 3H3UA 5F0CA 4BY1J 2ISZA 1OQYA 1AU7A 2RV8A 2D2WA 3K69A 1H8AC 1EA3A 3ULQB 2LG4A 1S8NA 1WI3A 1BC8C 4UY8I 3GZ5A 2Y48A 3VYUB 4A3KJ 5HVQC 3LFUA 4EJOA 1Y1VJ 2QQ9A 4NDLA 3P7NA 1TWAJ 5HNFA 2E2IJ 4NQWB 3WTXC 2CSOA 1VQ8I 2PFBA 1SMTA 4HX8A 1IZ1A 1XDUA 1WPKA 2WB1A 1G59A 2EFWA 4G7HF 2VJ4A 1OR7C 4RB3C 1XGNA 2BBYA 4WWCA 1U2WA 2JPBA 1UHMA 3HOWJ 2CO5A 3FM5A 4LMYA 3HSEA 4HF2A 4PFPA 4IRGA 1ZYRF 2XGEA 4Y4RA 3V7SA 2D5VA 2V9PA 3H9QA 3WHCA 2JT1A 4G6DA 4I76A 4E7ZA 1MDMA 1TWCJ 3JSPA 1KU3A 2LD5A 4KN4X 1BOAA 1SFOJ 1R4NB 1NK2P 2EILH 4WCGA 4W97A 3HC7A 4GYGA 3V4GA 3W2VA 4IHSA 5H2FC 1SFEA 3X2QH 1MSEC 2GXGA 3CMEI 2FQ3A 3ECOA 4BE2A 1XMAA 2JA5J 1OKRA 3OYIA 4LJZF 4Y7NJ 3AAFA 1RR8C 1U9OA 2H6CA 2K4BA 3TMOA 2FNPA 5LEKA 1GDTA 2DYRH 2E71A 2CV2A 2HPMA 4NC8A 2K4JA 1TT0A 2IA2A 4HZFA 2Q2EB 4V19K 4CZCA 2ZB9A 3E5UA 4F52A 4CH7A 1LE8A 2FMLA 3QRFF 3GTOJ 1KQ9A 4CO8A 4B3AA 5B3SH 1B8IB 5DCFA 1EH8A 5D6FA 2CYYA 4XLCA 4IHWA 3TEDA 2R7XA 2J5PA 2CV1A 5M5XJ 2KZGA 4R8HA 4RAGA 5JVGF 1TWGJ 3I4NJ 2H6BA 3GFMA 1Z91A 2XPUA 2VE9A 3K4CA 4Y15A 4EGZA 3BTIA 4FE7A 4XONA 1U3EM 5GPAA 4DW6A 3OL4A 4HX7A 3OYMA 4XQFA 5ICEA 1ZG1A 4MTEA 1SC7A 4KUMA 3L09A 2DPUA 4I02A 5D6EA 5E20A 3VWBA 2NNYA 3CJNA 4AC0A 3J80K 3JAMZ 2HZTA 2ZC2A 1MJAA 1IJWC 1HDDC 1FEXA 1FLIA 2BHYA 1YQAA 3F0CA 2LBFB 3LSKA 4FE4A 4DJAA 1GVJA 2EA4A 2K3FA 3ASNH 2QSGX 5AIPA 1ZH5A 4ABZA 3S2WA 1S6LA 4PZJA 5EF6A 2OD5A 4N9HA 3M3YJ 2AHQA 2E5ZA 1ZKGA 3HRMA 4G7OF 5EZGA 5C4JJ 2W7NA 2JA2A 1ZHFA 2P7CB 5LGUA 2FBHA 3IP4B 1J7KA 2DQLA 2H1LA 4XLEA 4L9TA 1T33A 4LOCA 3DQVC 5F6FA 2Z5UA 4ESFA 2RQQA 4PGGA 4DYCA 2X4HA 4ZTJA 4A3IJ 4C2MJ 1R1TA 1XGSA 2HXIA 1R6RA 3Q5FA 4EMSA 4IL6C 3HOYJ 4IQ4A 3E6BA 3BJ6A 2OZ6A 5GTHC 2E7WA 4BQQA 2DO7A 1IN4A 1WJ5A 3CC4I 1BI0A 1VQKI 1BI1A 3HBLA 4B3XA 3H3ZA 1SD7A 4OOIA 4KIGA 2H09A 4F3QA 3HSRA 3WE3A 1IV8A 3D5LA 3T0YA 4N9IA 1B6AA 3SEQA 3H3VK 2L01A 3EUKL 2XUBA 4FCYA 4ZYAA 3WHBA 3IV5A 2DPDA 1H9TA 2QEXI 1TQMA 1ACIA 1IW7F 2WA0A 2Z16A 2X48A 4LITA 4BS9A 1O57A 5J8FA 1OPCA 5IT3A 4LIVA 1U5TB 2MD0A 1QVTA 4XIDA 4HX4A 3J7AY 4CCLA 1FOYA 2BHZA 3HGGA 3OYEA 1FWZA 3NQOA 3D5RC 4V2FA 4BHBA 1HSJA 2WWYA 4EATA 1MMGA 1MMDA 2X0LA 2XF6A 4HSRA 2UWMA 3GTGJ 1IUFA 2K86A 3EUHC 1GVDA 2F6CA 2UZKA 4UXNA 3A02A 3CUQA 2KJCA 2ZNZA 1YIOA 3D0SA 3H9GA 3TQNA 3CDIA 5DV5A 2E2HJ 4OIRF 4QIWN 4NC6A 1Q1HA 3OS1A 2MFZA 3DBRB 2STWA 4OINF 3QU6A 1HOMA 9ANTA 4NQWA 2B7EA 5IP9J 1PUFA 2XRLA 3JTGA 4NC7A 3RPUD 3V7CA 1IGNA 1OCRH 5LHHA 1S5LC 2MW8A 3GEZA 4EJVA 5J40A 2XRNA 2KDZA 2OA4A 2PBIA 3BTCA 4HNUA 1DPUA 1X2MA 2XAFA 3L2UA 3E5QA 2MYSA 3QOEA 4IHXA 1YJWI 1OMIA 1CGPA 4WK8F 4O3MA 2DU9A 5GADJ 1ZRFA 3FKIJ 3IUOA 3Q0WA 5CYVA 5J8CA 3HTSB 1JUMA 3IC7A 1Y8RB 3W6JB 2E36A 3OYAA 1KZHA 5IYCJ 4QLCU 4BQOA 5K1YA 3QYBA 3J81K 3WTZA 3GLLA 1U9NA 1JKRC 3CESA 5DD4A 3BPVA 2K3PA 1R00A 2ACJA 5D8KB 1WCMJ 1IXCA 1D0YA 4UUSB 5TRDA 4XRSG 3F8NA 2DA2A 2QM3A 4HRIA 4CGZA 2QSFX 1ODDA 2DAOA 1JTYA 2DODA 2DOFA 2ZMEC 3DWLE 2V7FA 3ZQQA 4IOAF 1HSTA 1ETOA 3C18A 3BCBA 2YR2A 3MN2A 2V6CA 2XHKA 3NWSA 2VOPA 2VPLA 3CTAA 5J4YA 5M5WJ 2EZIA 3BY6A 5FD6A 4L5EA 2L4AA 2VQLA 5EGOA 4F91B 4M6XA 3BTLA 4A3CJ 5JLXA 4P9FA 2KFDA 2ME0A 4BHPA 4KYWA 3VDXA 4PDKA 4BE0A 1YRNB 1X19A 1I50J 2L4MA 3OYFA 2XB0X 4HF0A 3VEPA 1K7AA 3ZQGA 3AG3H 5E8IA 2LKSA 2EV0A 2Q2EA 5JI6A 2VC1A 2VIXA 2KRCA 2E34A 1CF7B 1P4WA 1MIJA 3M4OJ 1YS6A 3RYRA 1WI9A 1LVAA 4A12A 2IAIA 4AD9A 2VB6A 4A3DJ 4CUGA 3WU0A 2QQBA 4II2A 1Z21A 3CP8A 4II3A 2UXXA 4EVIA 5E3LA 1VQ4I 1DGWY 2L7KA 3BJOA 2XSDC 3VODA 1S29A 5JHFA 1FP1D 4HQEA 2KP6A 1D3YA 3PIOF 4RMNA 2K9LA 2VASA 4HLYA 1RI7A 2HS5A 4BH9A 1ZG5A 3LSHA 2XC7A 2YU3A 2IGNA 4PJMA 2R5YB 4DBRA 2HPIA 2OCEA 3QP5A 1XG1A 2KHMA 2JPCA 1APLC 2ZJPF 2HDCA 2GBYA 1V5FA 3LSGA 4LB6B 2NVQJ 3F21A 2E5NA 5KHDA 5K5OA 2M87A 1B72B 2HVRA 2NVTJ 2EZLA 2FEZA 4MGRA 3T5XA 2V1XA 3GZNB 1BM9A 2VKEA 3LQQA 1IG7A 3CC7I 2WAQN 2MH9A 1G3TA 1RKTA 4JP0A 5FO5A 1OCZH 2ECBA 3GFLA 3KZYA 4MIMA 2ESHA 1TT5B 2DQRA 3F8CA 3S3NA 4FX0A 1SFUA 2HWVA 2Q0OA 4L0YB 1IRGA 3LSRA 1ETVA 2JUCA 4E7IA 2JN6A 1T0FA 1S72I 5BNGA 3JRAA 2YX4A 4KITB 1UZCA 3N97A 2LLKA 2ZJRF 5CKTA 4ENKA 2I5UA 3L7WA 3G6EI 3HPHA 3LSTA 4XRMA 1X2NA 1TP4A 1GUUA 2V1DA 3FK6A 1RR7A 4F93B 3RIRA 3R60A 3S8PA 4IF4A 1X4PA 1YW8A 3BZCA 4BYYA 3DBLB 2R93J 1QNTA 3H36A 2DMNA 4IHTA 3SYTA 5ICGA 2A07F 1BBYA 3S1NJ 3IWZA 2QBYA 4D0PA 2DI3A 1YTYA 1FC3A 2DA1A 3GTQJ 3WU2C 3GXOA 3S93A 3C2GA 3WE2A 2K9SA 4JQFA 2RAEA 3BQZA 5DD8A 4CYDA 1ZLKA 3SEZA 3QPLA 1DU0A 3SXYA 3OYNA 1JUPA 3MAJA 1FZPB 2JRMA 3C2HA 4IPAA 3GVAA 4A3MJ 1IO2A 2XVCA 1FTTA 1KU2A 2XIGA 5H20A 2W24A 2R7WA 3M9AA 2CQ7A 4XKCA 3ABLH 1O3RA 4BQAA 3U21A 1U5TA 1B59A 2Y75A 2X6YA 5JR3A 1IN5A 5K5QA 2PJPA 4D7NA 1T56A 2O03A 3RKQA 3QODA 1LDDA 4J01A 2BE5F 3EQLF 1Z3YA 1ZR2A 1MDMB 1X1AA 4Q48A 2DK5A 5J1RA 2VXZA 5DYMA 1B4AA 4E7KA 1K6YA 3DXJF 3BR6A 1OISA 3J81Z 2ZXJA 2WTEA 4G12A 2BGCA 3WGIA 3LNQA 4NUBA 5IT9Z 3U2RA 2JSPA 4YG2F 1JKPC 1YLFA 5D5UB 3CLQA 2OTLI 4LB5A 3LSJA 1VFCA 3BCAA 3IRQA 2M0CA 2NYXA 2OF7A 1D0XA 1YITI 3HKZA 3PSIA 1XSXA 2KIQA 1ZAOA 4EM1A 2VKHA 2DA7A 4EM2A 3K1MA 2DA5A 2F4IA 2LF8A 2WB1N 4ZYEA 3A1YA 4M3BA 1FIPA 4A3JJ 3N4MA 1Z1DA 1LE8B 4BBRJ 2COBA 2VJJA 4HYEA 2EFPA 4U88A 2G0EA 3FMRA 5D5VB 1MNEA 3HDDA 2F5CA 2WY7Q 2K5CA 4S0HB 2M7AA 4UUSA 1A6IA 3ZCOA 2ZKZA 1XS9A 1YS7A 1T08B 2JRTA 2OBPA 4AIHA 4R79A 1RKWA 3SZPA 3V8KA 3JRCA 1FOKA 3KP2A 3MEXA 4PK4A 2PN6A 1T98A 1BL0A 3OR2C 2K9NA 2IS6A 4Z2YA 2M34A 3CJTB 2H1KA 5HDNA 3JRBA 3MQ0A 4AIDA 4RLQA 4UUVA 2OJED 3EETA 2M4KA 5FD5A 1I6XA 4PJLA 2Y0SN 3SQNA 2I8DA 2VL8A 4A5MA 4E7HA 3U9GA 4ETSA 3L2CA 1G4DA 1CF7A 2MABA 2HOAA 4ESJA 3L2RA 4IO9F 3AFHA 5E8GA 1SD4A 2CFXA 2Z2SB 3O8HA 3BR0A 3FMQA 2HYJA 4MLOA 2GXAA 1Y6IA 4I0BA 1TWHJ 3E5XA 1XC5A 1JT0A 2KPMA 4GCVA 1WJDA 3BR3A 5CPRB 3JAMK 2LKXA 2ZSIB 3WTSC 4CCNA 3ZPLA 3W2AA 2A61A 1XSDA 4GGGA 1UHSA 3M07A 3OWTA 1H89C 1IRFA 1IXSB 4B48A 1I39A 2L7MP 2XF7A 3FXUA 5FKKA 4EM0B 3FKJA 3GTLJ 3HHHA 3HHGA 2JA7J 4AM3A 3I58A 2E1CA 4CICA 3OYGA 1HLVA 1D8JA 1BR1A 1F1ZA 1VQPI 4A93J 1T38A 2XV4S 5F08A 4XKWA 5FKMA 3HEFA 1RUNA 2VBYA 2XKPA 2GLOA 2QUFA 2M3AA 5FKLA 1LB2A 2B0LA 2DMPA 2LF7A 5F0FA 5LLQA 1QO0D 2FSWA 2ZJQF 4EEFG 1USSA 4KT6A 2QLZA 1FY7A 2VJIA 5FRNA 3LA3A 2VOOA 1EH7A 3WTWC 1OCOH 3K70D 4RB2C 5BQTA 3CUQB 1G3WA 3BWGA 3FXOA 4AYBA 3ABUA 3F23A 4BL0B 1Y8QB 2XDVA 3DP7A 3VSKA 4CCJA 5LGTA 2M2EA 4UVBA 4PSWA 1QBJA 3MCZA 1FYKA 3LFKA 4ENNA 1FJLA 2P6SA 3AG4H 2PMZN 1PUFB 1UHWA 1W36C 3HUGB 3AL0B 2BVLA 5EYRA 4U7BA 2F5EA 2X85A 2G7HA 2CQKA 2OUMA 2K85A 3F6OA 4HA8A 1J0RA 4RB0A 3KZZA 3HG9A 1X1CA 2KRHA 4F92B 4QPOA 2VPRA 3ZMSA 1ZRCA 4X0GA 4GFBA 3CJRB 3S1MJ 1JI8A 4CDGA 2XAHA 4KN7X 2ESNA 3K1PA 3D5SC 5E18F 1K78A 1E0EA 4A0YA 1E3HA 4G94A 2COMA 1M1EB 3A01A 3ECHA 2BVMA 2ETHA 4A6DA 2R7VA 1BR2A 1HW1A 2FJ1A 2K9QA 2F2EA 4MEYF 2QQAA 1O3SA 1ZR4A 4EQQA 3WTTC 3OYHA 4RGXA 4LG3A 4C9YA 1U0JA 3GBGA 3KEOA 4KICA 4NBQA 2DFHA 3BDDA 4CA0A 2HU9A 2DK8A 1IUYA 3TW7A 2DA3A 2F5VA 4XOTA 2Y0MA 3T8RA 1UB9A 2MC3A 2IS1A 3QWLA 5HS9A 2HQRA 3BR2A 3BG3A 4Z6YA 3H0DA 5EGOB 1WJBA 1JT6A 4HW0A 2P8TA 4M3EA 4HF1A 5DEQA 2KISA 2XGCA 1SAXA 2DMQA 4QTRA 2NVYJ 1W4MA 1V4RA 4UUTA 1MBEA 4IQJA 3TGNA 3COAC 2MA3A 3C1DA 3RZOJ 1D8KA 2DT6A 2R7QA 3TP3A 4OMYA 1FIAA 3M1CA 4MTDA 4L5IA 5C3EJ 2E7XA 3WU1B 4JOMA 2D1HA 4XL9A 3I0TA 4U0YA 2EH3A 3W6KB 2V4JC 2YX7A 3K1NA 1OCTC 2DBBA 4M3DA 2Y31A 1D5YA 5FFZA 2WC2A 3ERED 1HKSA 1MH3A 2VBWA 4JBAA 4M9ZA 4HNVA 2R7UA 2HKOA 1DGRM 1FMWA 3KE2A 5LHIA 3I54A 2R7RA 4PGHA 1AA7A 1FMVA 2FNAA 2V9VA 1X4OA 4FQGA 1PP7U 4M71A 5EG0B 2BEOA 4JX5A 2QSHX 2MD5A 5BPDA 2ID6A 3DEWA 4XMYA 4N4OB 1Y0NA 2RVCA 1D1CA 5KCMA 1PDNC 3MKZA 1E17A 3HTUA 3KCCA 5L3EA 4G7ZF 4XN0A 4PJNA 3CF2A 4XLHA 4DYQA 4DOZA 2EWNA 1RC9A 1SD5A 5LRRA 2KL4A 1YW7A 3OOPA 1DUXC 3CCYA 4GRIA 1WVRA 2L54A 5BPIA 2EZHA 5HLIA 4ZDPA 3O2PE 1AOYA 1V5EA 3ESWB 3I3LA 4UV8A 5JHUA 1ZQ3P 1W7PA 3I9V2 3GCMA 2DA4A 1EV7A 5DUKA 1BIBA 1TTYA 2PEXA 3FXLA 2TCTA 4C2UA 1O7FA 1WKMA 1FBQA 4O6JA 2XASA 3TBIA 3V8LA 1BA5A 1ZTRA 4E7SA 1WJCA 4CHUA 1F5TA 2VT2A 1W0TA 5HLGA 3KPHA 1OYIA 3LSPA 3FIWA 1Y1WJ 1Y56A 2G9WA 3ERMA 3PUBA 4RM2A 1MBJA 2HKXA 2IA0A 2QBYB 5LGNA 4JK1X 2DN0A 2KDOA 5FRMA 3SFIA 2LREA 1BI3A 4EV0A 3DKXA 4A3GJ 2O7OA 5J1UA 3Q9SA 5DDGA 2DCEA 3CD6I 2EK5A 1X1PA 1UCRA 1P7IA 2V79A 1T0FC 3ZMTA 4B47A 4MNUA 5L3GA 3S16J 3I59B 2BYVE 2RKHA 3I53A 5CVIA 3L2WA 1EJ9A 3PIPF 5ED4A 2NOJB 2TDXA 1PYVA 3E6CC 1HBXG 1QZEA 2JWTA 3CCSI 2HNHA 2X6OA 3FK7A 4M72A 3GO5A 1WH7A 3RQIA 1J2XA 3K10A 3REOA 3ZN1A 3JR9A 3PM1A 2LTPA 3KP4A 1UG2A 4XKBA 4QWQA 1HXDA 2NRAC 1JGSA 3HOUJ 1D0ZA 1MD0A 2EA2A 2CWEA 2MG4A 3QAHA 1I1SA 5ILUA 3HYIA 5K7ZA 2R7DA 3K7AJ 3C7JA 2XF5A 1Z7UA 1UFMA 1JJ6C 5HDKA 2VXDA 4EGYA 2ID3A 1IC8A 1SVOA 3QPHA 1R58A 4RBOA 3QQAA 3K4NA 4PFOA 2XGXA 1U5TC 1MZBA 2VKVA 1YYVA 3HUGA 4AVPA 1OR7A 2YPRA 1Z6TA 1NG6A 5LHGA 3GTJJ 1R23A 5DCMA 1VQNI 4ENMA 2GXBA 3OS0A 4DNCA 3WTYC 3HOXJ 2HXOA 3KP5A 5H6QA 4DIQA 2NNNA 1LPQA 2A5WA 2ZJ2A 3GYHX 3OSFA 1FSEA 2ZNYA 4KIFA 2DFIA 3OSGA 1FPQA 2IGMA 4KMFA 5J47A 5F27A 2NVXJ 1XMKA 5IT9K 5HLHA 3DBHB 2GOMA 3ZQCA 3JREA 1X1DA 1R7JA 5HS8A 2MH2A 1Z67A 1IXRC 3Q3SA 2A69F 1Z9CA 1JHFA 4LG0B 1W5CC 4B4CA 3KP7A 4B1RA 4CSWA 3EDPA 5C44J 3B6CA 3ELKA 4PUSA 3CC2I 1DP3A 3DTIA 4RAZA 1DQUA 1ZN2A 2CQNA 3J7YJ 3S3OA 3GLXA 4KA4A 4ASNA 1IRZA 1P2FA 1JXSA 2KJBA 4UB8C 5FLXZ 3QPSA 5FB2A 2AQFA 5HODA 4UVAA 4KJZA 2RNJA 5FKNA 5JVTA 3LAPA 1EH6A 1TNSA 2RREA 5GAGJ 5M3FJ 4LK0F 4C30A 5IPAA 1ENHA 2VQCA 5IOYA 3A0HC 3CCLI 2M7BA 3ABMH 3MD2A 2JMWA 4FX4A 2CQXA 1JE8A 1JTXA 3FXMA 5GPCA 2WY8Q 1FOXA 3FZVA 3S14J 3HOTA 5CVRA 2O5RA 3H9JA 4ZZDA 3CMYA 2AXLA 4BU2A 1ZLJA 3GTKJ 4DGWB 4Q5SF 4IHYA 5D5XB 3QYEA 4LLLA 2DFFA 4YFKF 1R49A 4JX4A 5FKOA 4AWXB 1F4KA 2M45A 3ZMZA 4LLNA 1QPIA 2P5VA 3CO7C 3FHNA 2QKMB 5EG0A 1E2XA 2L9NA 1R9TJ 3FBNB 3VYTB 3S3MA 1QU3A 3BROA 1QQIA 5DM7F 4IRIA 1ZGJA 2YUSA 4IXAA 1U6GA 3AG1H 3ZQ7A 4OAZA 1K4TA 1N77A 3IL2A 3PQJA 4BJ5C 1LJ9A 3SDGA 4C3JJ 1TW3A 1XSVA 2L0KA 3LAJA 4G9YA 1JJ8C 3E97A 5CVUA 1MBFA 2HTSA 4MFDA 2DXIA 3LWFA 1TQIA 3K9TA 1VQMI 3U1DA 3VYSB 3ZMUA 2VJ5A 3SJMA 3KLNA 4WXDA 3HL2A 2HFHA 2M30A 2QZ8A 6PAXA 2FXAA 1XGMA 4KFCA 5EDNA 3IWFA 2W4SA 1BJZA 3RQ4A 2VODA 3R4KA 1G8XA 1VI0A 3OL3A 1P7JA 1MGTA 1UELB 3HM5A 4A2UA 1LEBA 2ZFWA 5A2QZ 3KLOA 1YI2I 3T8TA 1MNDA 4I09A 1MMAA 3HSFA 3G1LA 2OU2A 2JSCA 5LEJA 1RRJA 2E1MB 3BR5A 1FX7A 1I1GA 2V1NA 3P5JA 2FBKA 4ANJA 2P4WA 3CJQB 4EJTA 2ISYA 1W7PD 4IHVA 2BW3A 1AWCA 3DPLC 4XOPA 4RM3A 3J7ZI 2L9SA 1GT0C 2L9VA 1YW9A 3BG5A 1DP7P 1MW7A 1SMYF 3LMMA 3ZOBA 3I5UA 4BGDA 1Y39A 1P4AA 1GXPA 5E79C 1AHDP 4W1UA 4HBLA 4LIUA 1Z3XA 5KAIC 4WF2A 1G2HA 1W0UA 3I59A 4X1EA 1LNWA 1SAUA 3QP6A 4BJTA 2R7TA 3TOBA 4BBSJ 2JQ7A 2JUGA 3HGYA 4D9JA 3DLLF 5C4XJ 1P6RA 1OCCH 2L3DA 2OPTA 3OYCA 1K78B 1IDZA 3I56I 1T8IA 1IN8A 3EUHA 3SZGA 4CCMA 3L9FA 1S9HA 1ZGAA 2GA1A 2HGCA 4NB5A 4U0WA 4ESBA 3A01B 1T6SA 1HKTA 5CLSA 3QU3A 3DTKA 2MLGA 2VQHA 3EPZA 2R92J 3KP3A 1WHUA 1B9NA 4L18B 3VSLA 2O8XA 4RA2A 1BW6A 1IN6A 1OYYA 2BY0A 3KEQA 3TL4X 3WTVC 2AQEA 2G7UA 5DUIA 2R3SA 3OR1C 4IOCF 3DPTA 4J19A 2DLLA 1GXQA 2ELKA 2A6TA 1B9MA 4AYBN 5EEHA 5D8LB 1RIOH 4CCOA 2HI3A 1F9NA 1MMNA 2K7LA 2RGVA 2QGUA 3NAUA 3OY9A 1BJAA 1LFBA 1ULYA 1R5HA 4XM3A 4OAYA 2ZCWA 4L9NA 5EJCA 3LSMA 1PJRA 3GW2A 4HG2A 4AU7A 4C3HJ 1S7OA 1WFXA 2STTA 1GLNA 3RDIA 2FX0A 3ASOH 4ZJZA 1S7EA 2GIVA 2CQQA 4P96A 1HF0A 4YIRX 1KONA 3IKTA 3UKGA 2AO9A 1MKMA 1WH5A 4V2GA 3S15J 4X6AJ 2ZBKA 4M3GA 1QA6A 3O3KA 2HVSA 3CLOA 1YHQI 4XSXF 4FT8A 2N8GA 3VFZA 4Y52J 4LG0A 3LA7A 2BY3A 3SFZA 1UG0A 2V26A 2P0WA 3M8JA 1SEUA 2DDAA 2L7ZA 3KYDB 2Y9YA 2F48A 2UV1A 2QYOA 5FROA 4M74A 3R6SA 4MHGA 2VBZA 3MKWB 4UNOA 2BV6A 5E1ZB 1YG2A 2VI6A 4P9UA 2XROA 4R1HA 5K5RA 2W82A 1XDSA 5J6XA 3CUOA 3CP2A 3CCVI 2V6EA 1MBHA 3CCRI 1FTZA 2OCCH 5BOXA 2DJNA 4AIJA 2F5DA 3ABKH 4IJAA 1KYWA 3TDZC 2W1OA 1FNNA 2IBDA 1KU9A 2Q1ZB 2RQPA 1W7PB 4FTHA 4DZJA 4A6EA 2FOWA 2D1VA 1A5JA 3I64A 2K02A 3E6MA 2MBFA 4RGRA 2EBIA 3K4MA 1PVEA 2JZYA 3H1CA 1O3TA 1O7LA 1YJNI 3E3VA 4ZZLA 4XORA 1QZZA 4MO7A 2BXZA 1YO5C 3K2AA 5DM6F 5ICCA 1W5SA 2EQRA 2W85A 3V7RA 4LLGF 2EV5A 2A68F 3DEEA 3G3ZA 1X3WB 3N05A 2CRGA 2LSOA 1J75A 2PQ8A 1R5ID 2RNGA 4PJ0C 2HVQA 4M3FA 4HNTA 4ZYHA 1S3JA 1N75A 1FBUA 3PO3J 4AUXA 3MVPA 3F72A 4NNJA 5CVVA 5H6RA 2FU4A 2M4GA 2RC4A 3BZKA 3MFKA 4A3EJ 4LFUA 1I6HJ 3BG6A 3NEUA 4Y3OA 4P55A 1K79A 5CVJA 3OYLA 1MJBA 3TP0A 3KIOA 3F22A 2OAZA 1O4XA 4IZZA 3OS2A 3KX2A 2W00A 2X1CA 2MLKA 5DTDA 4YFXF 2EJRA 4RGSA 2O3FA 1L0OC 3FXQA 3BZ6A 2M8EA 4OWRB 3RYPA 1J59A 2PX9A 2ZXIA 2ZXHA 1JUSA 5L3DA 3DF8A 1TC3C 2X9DA 1N78A 1V3FA 2IS2A 1OJLA 2GIZA 5IYBJ 3EYYA 2BOLA 2BXYA 3I4PA 4E6KG 2LOOA 2E19A 3K6GA 2L9RA 2JK3A 5IP7J 1EF4A 2R5ZA 1WSUA 3O6BB 1G3YA 4BDZA 1ZGWA 2M5WA 1HA8A 1V54H 2LP0A 3MZ8A 4XLNF 2IS4A 2PI0A 4FASD 1MSFC 4BHCA 1VF9A 3OIOA 1FYMA 3CF5F 2OTJI 3C2BA 5B1AH 3L00A 5JFRA 4WXHA 1QHHD 5DCMB 1R22A 2X6XA 1POGA 2EFOA 2YS9A 1VTNC 4E7LA 3I4MJ 3WGGA 5FJ8J 3NARA 4B43A 2HOTA 1A04A 1HW5A 1KQ0A 2DDBA 2ZXWH 3OIPA 1ZREA 3CUQC 2V1UA 2P5KA 2IGKA 3SDBA 3FBIB 4H4KC 5LFAA 2IT0A 1ETXA 2LKPA 1MH4A 1AKHA 3HZJA 3ZMDA 4ITVA 4S05A 4GDFA 3J7AO 2IPQX 1A36A 3LA2A 1UJ8A 1KQ8A 2KIMA 1IV6A 5TJJA 4XICA 1E3OC 3TOAA 2PJRB 3AL0C 3IKVA 3PNYA 1Z6RA 2EV6A 5TISC 3PFIA 4UHTA 2I10A 3RCOA 1GV2A 4MQVA 3IAS2 3PSFA 3PUFA 5LRSA 2VE8A 4HEA2 1QPMA 3JRGA 5KVRA 1HW2A 3ISPA 5TGTA 4FISA 1G6NA 3ZRGA 3WG7H 2LDUA 4A69C 1XTAA 2KKOA 2EPFA 2PMUA 2W57A 3H5RA 1ERDA 4DQ2A 2LNBA 2DOAA 4M6YA 2HEOA 2IRFG 2KQRA 4I6ZA 3KYLA 5F04A 4BKXA 3GMEA 3IHUA 1VQ7I 3IH2A 4DBQA 4MEXF 3IH4A 2FUG2 3ML6A 4PCQA 2CFOA 2O9LA 2AXTC 1FYLA 2QCOA 4QSHA 1FBSA 1QRYA 3CQZJ 5B5EC 2Z33A 1ITYA 3DV8A 2Y0SA 1S7AA 1XGOA 2W25A 2GA2A 2CUJA 2WAEA 2KLOA 3I71A 3EYIA 1BC7C 4YIFA 1NK3P 1D1BA 1MJ9A 4HDVA 3BTJA 4BDYA 2CUZA 1XCVA 3CDLA 3HJEA 3IAM2 3NWTA 1QVUA 2A6HF 2A5YB 3M8EA 4U87A 5FLXK 1R1UA 3G2BA 2A3SA 3VPRA 2OQRA 1ETYA 5HS7A 4M9SA 2L5QA 3CCEI 2CG4A 2XAQA 1Z05A 4P5OA 2ZFUA 1VNDA 3PNVA 2KT0A 1JKQC 1K6OA 1BR4A 1Y0UA 4OMZA 4YIIA 3IRRA 5EEGA 1A35A 2LY2A 2KIFA 3JSOA 2HZDA 2H8RA 4ENJA 2DA6A 1I5ZA 2UUZA 3BPXA 1FSHA 5BS6A 4WX9A 3P9IA 1IDYA 3F6VA 3S1RJ 1EKEA 4XRFA 2IJLA 4HQMA 4B8XA 4E7JA 4L5JA 3G1OA 4YEJA 4BEHA 2P7VB 1F36A 3ROUA 3BC8A 1IN7A 4D7MA 1IAWA 2TRTA 2XPVA 3E0JB 2M1BA 1R36A 1TW2A 3ZQLA 2CJJA 4YFNF 5HDGA 2QWWA 4CCKA 1QHGA 4HOBA 1SFXA 2L02A 4M73A 5ICFA 1Z0XA 3R0AA 1BW5A 1RNLA 1TBXA 2R7FA 3LQRA 2XPWA 3A2KA 2V9KA 2FQ4A 3S2HJ 3E7LA 3FXJA 4IRHA 5GAEJ 3DKWA 3HOVJ 2CW8A 2B9SA 3S17J 5L3CA 4I0AA 5KK1A 2LH9A 2PLYA 5D4RA 3GX4X 2PMHA 5J4VA 2NAZA 1ETWA 2DMUA 5AIQA 3K70C 3TKYA 1VQ5I 4UB6C 2C6YA 5HOOA 2VQGA 4XN3A 2F4OB 3A03A 1HCRA 5B1BH 4KMUX 4OIPF 2Y9ZA 2LR8A 2M8GX 5E17F 4XRSA 1FP2A 4DYRA 3H5AA 4KDPA 2BW3B 1X58A 3Q0VA 1ZK8A 2CUEA 2LY9A 4U0VA 3DCFA 4CYCB 3L1PA 1I27A 2LK2A 1C0WA 1J5YA 3RPQA 2WV0A 2JA6J 3U1KA 2X6WA 2KMUA 2O6GE 2PMZA 4Q4ZF 5M3MJ 2Z9OA 2QF7A 3DU5A 1RUOA 3GF2A 3OV8A 5A2QK 3V42A 4KIBA 2LMDA 1YFHA 2QKLB 4D5CA 2VT3A 1STZA 3JTHA 3PJRA 3JRFA 1W5TA 1Z7LA 1LFPA 1KGSA 4L9JA 3M1EA 4BAYA 2Z99A 4F7ZA 3W2WA 3R0JA 4XKVA 2EFQA 2OC6A 5D4SA 3LOCA 2RN7A 4CZZA 1T2KA 3B6AA 2HTJA 3FDYA 3PNTA 4BNCA 3ZQHA 1RESA 1LDKB 4OIOF 2VUMJ 3GTMJ 3W3CA 1FOWA 3CCMI 5CQGA 3WG9A 5F0HA 3RKWA 3JW4A 4L0ZB 3F8MA 2Y69H 4JX6A 3VOEA 3BQYA 4A5NA 4XLPF 5E1WA 1IRXA 2QQ8A 3F9KA 3FXRA 4RAYA 4E4HA 4I2OA 2IXSA 1HQCA 4MQ9F 1R5GA 1LFUP 1KU7A 4UVCA 3L2QA 3GFIA 5E3NA 1GV5A 1TLHB 1D5VA 1UMQA 2FMYA 1LUJB 2H8WA 2HR3A 1V5GA 4FETA 5HLTA 3MWMA 1ZRDA 2GM4A 1TZLA 1Z77A 2DOEA 2NOGA 2CU7A 4IX7A 3MZYA 4IKFA 2A6EF 1WWXA 2EB7A 2O0YA 3FM3A 3ZN0A 2P5LC 1SD6A 2E60A 2M0MA 5KAFC 5IY5H 2P81A 4C2TA 1VZ0A 5BMZA 4KT5C 2NS8A 2X51A 1X1BA 2ZMEB 2J5OA 4D5FA 2R7ZJ 3VB2A 4ZTFA 1MBKA 1TQPA 2YSRA 4WXCA 1ON2A 1MMSA 2PJRA 1LKXA 4EJUA 2CW0F 1HKQA 1ZARA 3GZ6A 1MNMC 2W84A 1SVMA 5K7HA 2R7OA 2CMPA 4BXUA 1KYZA 1PUEE 2WADA 1VQ9I 4A3FJ 2EIKH 1F43A 1FT9A 1MBGA 3MKLA 4XBFA 3L2VA 5FGMA 4HDUA 1RETA 4ON0A 3QYFA 2YU9J 2ECCA 4BY7J 4H0EA 3AG2H 3E6DA 3BOQA 2JTVA 2NS7A 1SVLA 2OZUA 4MFEA 2HQAA 3OYDA 3RSNA 3MZHA 5GP9A 2JVGA 3CO6C 4LK1F 1SANA 5AONA 5LBQA 3HB9A 3ABTA 4O5VA 4HPQA 1E3PA 2OQGA 5EEAA 5D5WB 3D1NI 2VN2A 2XKOA 2XSJC 3NRVA 4ZYGA 1JGGA 3HKZN 1OFCX 4XNFA 3RTRA 3PQKA 5ILVA 1YX3A 3BR1A 2F5FA 3P9KA 1ONVA 3ZGKA 1XX5A 3KETA 4QPQA 3RKYA 3G4SI 3K4JA 1K4SA 2CGPA 3K4LA 4IVNA 2DTRA 2GWRA 3H92A 1NG7A 1U8RA 4TV7A 2LFBA 2VKDA 1REPC 4Y13A 3DLAA 1KA8A 1ON1A 2X1DA 1VQOI 2JVHA 3OYBA 2K40A 1U78A 2B63J 3CMAI 1TWFJ 2FD5A 3B73A 2CUFA 3PFYA 2JJ7A 3DTEA 4ZH4F 2O61A 3KP6A 2ICWG 1WZ2A 1B8IA 1A31A 3ZQIA 3J80Z 3K0LA 2DFEA 2E1NA 2XB5A 3S32A 1W1WE 2BY2A 5ILSA 4RGUA 4XLFA 1WQ2A 1ZG3A 3CZ6A 3LL7A 4FHTA 2E1OA 1YOVB 5F64A 4B09A 2P6TA 3JRIA 3KEYA 1U8BA 3V8JA 1XB4A 4B44A 2E2JJ 5EZHA 3S1QJ 1J9IA 4AVZA 2HQNA 2ME6A 3DKYA 2E35A 4A0ZA 3M8FA 3OMYA 2NXNB 1YX5A 2HQ5A 1R4MB 1RZ4A 2EIMH 3Q9VA 2BZTA 2FE3A 2FA5A 2W48A 1VQLI 3ZQFA 4BJ6C 4LGWA 2Q8KA 3RI4A 1D1AA 2CH0A 2IW5A 3HRUA 1JKOC 3B02A 4Y33A 2DMTA 2R5ZB 1JHHA 2LBFA 2XAGA 5IP6A 2LYCA 1I3QJ 1ZELA 3A4CA 3FF5A 4HLXA 2AS5F 1LEAA 3A0BC 4BQNA 1XMXA 2HOEA 5J3LA 4NHJA 5FLVA 3BJAA 1LDJA 1VQ6I 1HDPA 3TW6A 2LC2A 1G3SA 4CYCA 4Q47A 2MGQA 4ZDLA 1WGXA 2XAJA 1X3ZB 2KRFA 3TO6A 4OU0A 1GHCA 4IEJA 3RKXA 5FLMJ 4G6QA 1TL8A 2HOSA 1BI2A 3GWZA 5B66C 1ORKA 3SZTA 5JLWA 2DYSH 3HRTA 2DT7B 2Y2ZA 3AKZA 3T1BA 4XR6A 4I99C 5IOZA 2BY1A 5KNLA 3G71I 1AKHB 4F55A 1BOBA 3CCQI 3SHFA 2E1MC 2DJIA 1A6QA 4BACA 2L2OA 2EINH 1XN7A 2R4GA 4I7HA 2MSYA 1DPRA 2VLAA 2HDDA 3BLYA 3FISA 4RDUA 2HDWA 3MKYB 4AIKA 5M5YJ 2LRDA 4RB1A 2Z1DA 3QPTA 1WJFA 1T39A 1WJEA 2F4MB 1Q1VA 4PSXA 5LD2C 4G6TB 4L9VA 3TO9A 5IYDJ 2HYGD 1L3LA 3G73A 1QZYA 3PO2J 5F1RA 2MC4A 3FXKA 1J09A 3CDHA 4ZC3A 1XCBA 4M6VA 2GQQA 3KFWX 1IF1A 4A3BJ 5K7FA 4EJWA 1YE9A 3HOZJ 3BT9A 4KISA 3DU6A 5DS9A 2CS3A 2K9MA 3PL8A 3VYRB 4DZPA 2QA4I 2VONA 2QVOA 4D1QA 3FX3A 1I3AA 4Y17A 2ELHA 3GFJA 2RDPA 4BE1A 2FBIA 1TNTA 2D45A 2Y30A 2DT5A 1ETKA 2NS0A 3H35A 3F8BA 3IH3A 1W36D 3RJPA 4CXFA 1OCPA 4A0XA 2R7SA 2H94A 2FRHA 4HV6A 3ZXSA 3WTUC 3UNGC 5FFXA 1DDNA 2ZMEA 3TO7A 2Z3YA 1LQ1A 3H5NA 1H0MA 4U7DA 1CQTA 1OYWA 4G8XA 3CCJI 2O8KA 1RPWA 2IEKA 3Q0UA 2WV1A 1PP8F 4P1WA 3ZP5A 2R0QC 2K27A 5HNHA 3K2ZA 1R1VA 4YELA 4BXFA 2IGOA 3OOUA 2VC0A 1K61A 1DU6A 3OIQA 3C3WA 1UAAA 3OYKA
chains in the Genus database with same CATH topology
2F4OB 2QSFX 1TP4A 2QSGX 3ESWB 1QZEA 1PVEA 2F4MB 2QSHX 4YIRX 1OQYA 1X3WB 1X3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4O B;  2QSF X;  1TP4 A;  2QSG X;  3ESW B;  1QZE A;  1PVE A;  2F4M B;  2QSH X;  4YIR X;  1OQY A;  1X3W B;  1X3Z B; 
#chains in the Genus database with same CATH topology
 2ZO4 A;  4XSZ F;  2EZK A;  3O8G A;  1H9G A;  5J1Y A;  1QGP A;  1NH3 A;  4C3I J;  3HXL A;  3HRS A;  4BEH B;  3WGH A;  3I55 I;  4XK4 A;  2ZSH B;  1P92 A;  2M9H A;  3CCU I;  1B1B A;  2UXN A;  3HPG A;  4ZDO A;  1WRJ A;  4GO1 A;  3GUD A;  3DPU A;  3G1M A;  5L3B A;  5ERI A;  2LVS A;  2L7F P;  2VBX A;  2LY1 A;  3FHZ A;  1NTC A;  3F3X A;  5GAH J;  1YIJ I;  4I98 B;  1WJA A;  3S2D J;  4RAF A;  2WAQ A;  3W6V A;  1YRN A;  2WAF A;  1UST A;  3JCU C;  2CW7 A;  1SFK A;  3EUA A;  1NHA A;  3M7G A;  5CQE A;  2FOK A;  3ZR8 X;  4E70 A;  4GXO A;  4RS8 A;  3FMS A;  5L3F A;  3ONQ A;  4HAM A;  4JYK A;  3BG9 A;  5E1X A;  3UR3 C;  4RLF A;  3FWE A;  1OLT A;  1T95 A;  3R61 A;  1H88 C;  1ETQ A;  3BG7 A;  3OYJ A;  1XD7 A;  4J00 A;  1K83 J;  4LD5 A;  2IVM A;  2OV7 A;  4HV5 A;  2FF4 A;  4HST A;  2DTZ A;  1BIA A;  4XLA A;  5CJ9 A;  2EIJ H;  3P9C A;  1P9Q C;  1HC8 A;  2PG4 A;  3MMY B;  2ELJ A;  4UV9 A;  2NVU B;  3GTP J;  2EFN A;  3ZMV A;  3HIF A;  3RZD J;  2CV0 A;  3BP8 A;  3LSI A;  4PJJ A;  1LVK A;  1X3U A;  2R5Y A;  3JRD A;  2A05 A;  3F8F A;  4OIQ F;  4GYI A;  4M9X A;  2ADU A;  3KZI C;  4YRV A;  4BXX J;  2GOX B;  4N4N B;  3TDU C;  3WOD F;  5F1J A;  3DEU A;  3H0G J;  1P4X A;  4KNY A;  2H27 A;  1B72 A;  2GAU A;  3KYC B;  2QEN A;  2DW4 A;  3CMM A;  2X1E A;  3DFG A;  2IP2 A;  1XPX A;  2XAU A;  2XGD A;  4A3L J;  4I01 A;  5E3M A;  3K4B A;  2HYF A;  3QOP A;  5E3O A;  1V55 H;  2WBM A;  4ZYD A;  3HOS A;  4K2E A;  1N25 A;  3K4K A;  2KIU A;  4N0B A;  1R71 A;  3JRH A;  2IA1 A;  1YJ9 I;  2JA8 J;  1O3Q A;  5GTI C;  1BN5 A;  4BUP A;  3E1S A;  2GZW A;  4S04 A;  3RPU A;  2KZV A;  3H3U A;  5F0C A;  4BY1 J;  2ISZ A;  1OQY A;  1AU7 A;  2RV8 A;  2D2W A;  3K69 A;  1H8A C;  1EA3 A;  3ULQ B;  2LG4 A;  1S8N A;  1WI3 A;  1BC8 C;  4UY8 I;  3GZ5 A;  2Y48 A;  3VYU B;  4A3K J;  5HVQ C;  3LFU A;  4EJO A;  1Y1V J;  2QQ9 A;  4NDL A;  3P7N A;  1TWA J;  5HNF A;  2E2I J;  4NQW B;  3WTX C;  2CSO A;  1VQ8 I;  2PFB A;  1SMT A;  4HX8 A;  1IZ1 A;  1XDU A;  1WPK A;  2WB1 A;  1G59 A;  2EFW A;  4G7H F;  2VJ4 A;  1OR7 C;  4RB3 C;  1XGN A;  2BBY A;  4WWC A;  1U2W A;  2JPB A;  1UHM A;  3HOW J;  2CO5 A;  3FM5 A;  4LMY A;  3HSE A;  4HF2 A;  4PFP A;  4IRG A;  1ZYR F;  2XGE A;  4Y4R A;  3V7S A;  2D5V A;  2V9P A;  3H9Q A;  3WHC A;  2JT1 A;  4G6D A;  4I76 A;  4E7Z A;  1MDM A;  1TWC J;  3JSP A;  1KU3 A;  2LD5 A;  4KN4 X;  1BOA A;  1SFO J;  1R4N B;  1NK2 P;  2EIL H;  4WCG A;  4W97 A;  3HC7 A;  4GYG A;  3V4G A;  3W2V A;  4IHS A;  5H2F C;  1SFE A;  3X2Q H;  1MSE C;  2GXG A;  3CME I;  2FQ3 A;  3ECO A;  4BE2 A;  1XMA A;  2JA5 J;  1OKR A;  3OYI A;  4LJZ F;  4Y7N J;  3AAF A;  1RR8 C;  1U9O A;  2H6C A;  2K4B A;  3TMO A;  2FNP A;  5LEK A;  1GDT A;  2DYR H;  2E71 A;  2CV2 A;  2HPM A;  4NC8 A;  2K4J A;  1TT0 A;  2IA2 A;  4HZF A;  2Q2E B;  4V19 K;  4CZC A;  2ZB9 A;  3E5U A;  4F52 A;  4CH7 A;  1LE8 A;  2FML A;  3QRF F;  3GTO J;  1KQ9 A;  4CO8 A;  4B3A A;  5B3S H;  1B8I B;  5DCF A;  1EH8 A;  5D6F A;  2CYY A;  4XLC A;  4IHW A;  3TED A;  2R7X A;  2J5P A;  2CV1 A;  5M5X J;  2KZG A;  4R8H A;  4RAG A;  5JVG F;  1TWG J;  3I4N J;  2H6B A;  3GFM A;  1Z91 A;  2XPU A;  2VE9 A;  3K4C A;  4Y15 A;  4EGZ A;  3BTI A;  4FE7 A;  4XON A;  1U3E M;  5GPA A;  4DW6 A;  3OL4 A;  4HX7 A;  3OYM A;  4XQF A;  5ICE A;  1ZG1 A;  4MTE A;  1SC7 A;  4KUM A;  3L09 A;  2DPU A;  4I02 A;  5D6E A;  5E20 A;  3VWB A;  2NNY A;  3CJN A;  4AC0 A;  3J80 K;  3JAM Z;  2HZT A;  2ZC2 A;  1MJA A;  1IJW C;  1HDD C;  1FEX A;  1FLI A;  2BHY A;  1YQA A;  3F0C A;  2LBF B;  3LSK A;  4FE4 A;  4DJA A;  1GVJ A;  2EA4 A;  2K3F A;  3ASN H;  2QSG X;  5AIP A;  1ZH5 A;  4ABZ A;  3S2W A;  1S6L A;  4PZJ A;  5EF6 A;  2OD5 A;  4N9H A;  3M3Y J;  2AHQ A;  2E5Z A;  1ZKG A;  3HRM A;  4G7O F;  5EZG A;  5C4J J;  2W7N A;  2JA2 A;  1ZHF A;  2P7C B;  5LGU A;  2FBH A;  3IP4 B;  1J7K A;  2DQL A;  2H1L A;  4XLE A;  4L9T A;  1T33 A;  4LOC A;  3DQV C;  5F6F A;  2Z5U A;  4ESF A;  2RQQ A;  4PGG A;  4DYC A;  2X4H A;  4ZTJ A;  4A3I J;  4C2M J;  1R1T A;  1XGS A;  2HXI A;  1R6R A;  3Q5F A;  4EMS A;  4IL6 C;  3HOY J;  4IQ4 A;  3E6B A;  3BJ6 A;  2OZ6 A;  5GTH C;  2E7W A;  4BQQ A;  2DO7 A;  1IN4 A;  1WJ5 A;  3CC4 I;  1BI0 A;  1VQK I;  1BI1 A;  3HBL A;  4B3X A;  3H3Z A;  1SD7 A;  4OOI A;  4KIG A;  2H09 A;  4F3Q A;  3HSR A;  3WE3 A;  1IV8 A;  3D5L A;  3T0Y A;  4N9I A;  1B6A A;  3SEQ A;  3H3V K;  2L01 A;  3EUK L;  2XUB A;  4FCY A;  4ZYA A;  3WHB A;  3IV5 A;  2DPD A;  1H9T A;  2QEX I;  1TQM A;  1ACI A;  1IW7 F;  2WA0 A;  2Z16 A;  2X48 A;  4LIT A;  4BS9 A;  1O57 A;  5J8F A;  1OPC A;  5IT3 A;  4LIV A;  1U5T B;  2MD0 A;  1QVT A;  4XID A;  4HX4 A;  3J7A Y;  4CCL A;  1FOY A;  2BHZ A;  3HGG A;  3OYE A;  1FWZ A;  3NQO A;  3D5R C;  4V2F A;  4BHB A;  1HSJ A;  2WWY A;  4EAT A;  1MMG A;  1MMD A;  2X0L A;  2XF6 A;  4HSR A;  2UWM A;  3GTG J;  1IUF A;  2K86 A;  3EUH C;  1GVD A;  2F6C A;  2UZK A;  4UXN A;  3A02 A;  3CUQ A;  2KJC A;  2ZNZ A;  1YIO A;  3D0S A;  3H9G A;  3TQN A;  3CDI A;  5DV5 A;  2E2H J;  4OIR F;  4QIW N;  4NC6 A;  1Q1H A;  3OS1 A;  2MFZ A;  3DBR B;  2STW A;  4OIN F;  3QU6 A;  1HOM A;  9ANT A;  4NQW A;  2B7E A;  5IP9 J;  1PUF A;  2XRL A;  3JTG A;  4NC7 A;  3RPU D;  3V7C A;  1IGN A;  1OCR H;  5LHH A;  1S5L C;  2MW8 A;  3GEZ A;  4EJV A;  5J40 A;  2XRN A;  2KDZ A;  2OA4 A;  2PBI A;  3BTC A;  4HNU A;  1DPU A;  1X2M A;  2XAF A;  3L2U A;  3E5Q A;  2MYS A;  3QOE A;  4IHX A;  1YJW I;  1OMI A;  1CGP A;  4WK8 F;  4O3M A;  2DU9 A;  5GAD J;  1ZRF A;  3FKI J;  3IUO A;  3Q0W A;  5CYV A;  5J8C A;  3HTS B;  1JUM A;  3IC7 A;  1Y8R B;  3W6J B;  2E36 A;  3OYA A;  1KZH A;  5IYC J;  4QLC U;  4BQO A;  5K1Y A;  3QYB A;  3J81 K;  3WTZ A;  3GLL A;  1U9N A;  1JKR C;  3CES A;  5DD4 A;  3BPV A;  2K3P A;  1R00 A;  2ACJ A;  5D8K B;  1WCM J;  1IXC A;  1D0Y A;  4UUS B;  5TRD A;  4XRS G;  3F8N A;  2DA2 A;  2QM3 A;  4HRI A;  4CGZ A;  2QSF X;  1ODD A;  2DAO A;  1JTY A;  2DOD A;  2DOF A;  2ZME C;  3DWL E;  2V7F A;  3ZQQ A;  4IOA F;  1HST A;  1ETO A;  3C18 A;  3BCB A;  2YR2 A;  3MN2 A;  2V6C A;  2XHK A;  3NWS A;  2VOP A;  2VPL A;  3CTA A;  5J4Y A;  5M5W J;  2EZI A;  3BY6 A;  5FD6 A;  4L5E A;  2L4A A;  2VQL A;  5EGO A;  4F91 B;  4M6X A;  3BTL A;  4A3C J;  5JLX A;  4P9F A;  2KFD A;  2ME0 A;  4BHP A;  4KYW A;  3VDX A;  4PDK A;  4BE0 A;  1YRN B;  1X19 A;  1I50 J;  2L4M A;  3OYF A;  2XB0 X;  4HF0 A;  3VEP A;  1K7A A;  3ZQG A;  3AG3 H;  5E8I A;  2LKS A;  2EV0 A;  2Q2E A;  5JI6 A;  2VC1 A;  2VIX A;  2KRC A;  2E34 A;  1CF7 B;  1P4W A;  1MIJ A;  3M4O J;  1YS6 A;  3RYR A;  1WI9 A;  1LVA A;  4A12 A;  2IAI A;  4AD9 A;  2VB6 A;  4A3D J;  4CUG A;  3WU0 A;  2QQB A;  4II2 A;  1Z21 A;  3CP8 A;  4II3 A;  2UXX A;  4EVI A;  5E3L A;  1VQ4 I;  1DGW Y;  2L7K A;  3BJO A;  2XSD C;  3VOD A;  1S29 A;  5JHF A;  1FP1 D;  4HQE A;  2KP6 A;  1D3Y A;  3PIO F;  4RMN A;  2K9L A;  2VAS A;  4HLY A;  1RI7 A;  2HS5 A;  4BH9 A;  1ZG5 A;  3LSH A;  2XC7 A;  2YU3 A;  2IGN A;  4PJM A;  2R5Y B;  4DBR A;  2HPI A;  2OCE A;  3QP5 A;  1XG1 A;  2KHM A;  2JPC A;  1APL C;  2ZJP F;  2HDC A;  2GBY A;  1V5F A;  3LSG A;  4LB6 B;  2NVQ J;  3F21 A;  2E5N A;  5KHD A;  5K5O A;  2M87 A;  1B72 B;  2HVR A;  2NVT J;  2EZL A;  2FEZ A;  4MGR A;  3T5X A;  2V1X A;  3GZN B;  1BM9 A;  2VKE A;  3LQQ A;  1IG7 A;  3CC7 I;  2WAQ N;  2MH9 A;  1G3T A;  1RKT A;  4JP0 A;  5FO5 A;  1OCZ H;  2ECB A;  3GFL A;  3KZY A;  4MIM A;  2ESH A;  1TT5 B;  2DQR A;  3F8C A;  3S3N A;  4FX0 A;  1SFU A;  2HWV A;  2Q0O A;  4L0Y B;  1IRG A;  3LSR A;  1ETV A;  2JUC A;  4E7I A;  2JN6 A;  1T0F A;  1S72 I;  5BNG A;  3JRA A;  2YX4 A;  4KIT B;  1UZC A;  3N97 A;  2LLK A;  2ZJR F;  5CKT A;  4ENK A;  2I5U A;  3L7W A;  3G6E I;  3HPH A;  3LST A;  4XRM A;  1X2N A;  1TP4 A;  1GUU A;  2V1D A;  3FK6 A;  1RR7 A;  4F93 B;  3RIR A;  3R60 A;  3S8P A;  4IF4 A;  1X4P A;  1YW8 A;  3BZC A;  4BYY A;  3DBL B;  2R93 J;  1QNT A;  3H36 A;  2DMN A;  4IHT A;  3SYT A;  5ICG A;  2A07 F;  1BBY A;  3S1N J;  3IWZ A;  2QBY A;  4D0P A;  2DI3 A;  1YTY A;  1FC3 A;  2DA1 A;  3GTQ J;  3WU2 C;  3GXO A;  3S93 A;  3C2G A;  3WE2 A;  2K9S A;  4JQF A;  2RAE A;  3BQZ A;  5DD8 A;  4CYD A;  1ZLK A;  3SEZ A;  3QPL A;  1DU0 A;  3SXY A;  3OYN A;  1JUP A;  3MAJ A;  1FZP B;  2JRM A;  3C2H A;  4IPA A;  3GVA A;  4A3M J;  1IO2 A;  2XVC A;  1FTT A;  1KU2 A;  2XIG A;  5H20 A;  2W24 A;  2R7W A;  3M9A A;  2CQ7 A;  4XKC A;  3ABL H;  1O3R A;  4BQA A;  3U21 A;  1U5T A;  1B59 A;  2Y75 A;  2X6Y A;  5JR3 A;  1IN5 A;  5K5Q A;  2PJP A;  4D7N A;  1T56 A;  2O03 A;  3RKQ A;  3QOD A;  1LDD A;  4J01 A;  2BE5 F;  3EQL F;  1Z3Y A;  1ZR2 A;  1MDM B;  1X1A A;  4Q48 A;  2DK5 A;  5J1R A;  2VXZ A;  5DYM A;  1B4A A;  4E7K A;  1K6Y A;  3DXJ F;  3BR6 A;  1OIS A;  3J81 Z;  2ZXJ A;  2WTE A;  4G12 A;  2BGC A;  3WGI A;  3LNQ A;  4NUB A;  5IT9 Z;  3U2R A;  2JSP A;  4YG2 F;  1JKP C;  1YLF A;  5D5U B;  3CLQ A;  2OTL I;  4LB5 A;  3LSJ A;  1VFC A;  3BCA A;  3IRQ A;  2M0C A;  2NYX A;  2OF7 A;  1D0X A;  1YIT I;  3HKZ A;  3PSI A;  1XSX A;  2KIQ A;  1ZAO A;  4EM1 A;  2VKH A;  2DA7 A;  4EM2 A;  3K1M A;  2DA5 A;  2F4I A;  2LF8 A;  2WB1 N;  4ZYE A;  3A1Y A;  4M3B A;  1FIP A;  4A3J J;  3N4M A;  1Z1D A;  1LE8 B;  4BBR J;  2COB A;  2VJJ A;  4HYE A;  2EFP A;  4U88 A;  2G0E A;  3FMR A;  5D5V B;  1MNE A;  3HDD A;  2F5C A;  2WY7 Q;  2K5C A;  4S0H B;  2M7A A;  4UUS A;  1A6I A;  3ZCO A;  2ZKZ A;  1XS9 A;  1YS7 A;  1T08 B;  2JRT A;  2OBP A;  4AIH A;  4R79 A;  1RKW A;  3SZP A;  3V8K A;  3JRC A;  1FOK A;  3KP2 A;  3MEX A;  4PK4 A;  2PN6 A;  1T98 A;  1BL0 A;  3OR2 C;  2K9N A;  2IS6 A;  4Z2Y A;  2M34 A;  3CJT B;  2H1K A;  5HDN A;  3JRB A;  3MQ0 A;  4AID A;  4RLQ A;  4UUV A;  2OJE D;  3EET A;  2M4K A;  5FD5 A;  1I6X A;  4PJL A;  2Y0S N;  3SQN A;  2I8D A;  2VL8 A;  4A5M A;  4E7H A;  3U9G A;  4ETS A;  3L2C A;  1G4D A;  1CF7 A;  2MAB A;  2HOA A;  4ESJ A;  3L2R A;  4IO9 F;  3AFH A;  5E8G A;  1SD4 A;  2CFX A;  2Z2S B;  3O8H A;  3BR0 A;  3FMQ A;  2HYJ A;  4MLO A;  2GXA A;  1Y6I A;  4I0B A;  1TWH J;  3E5X A;  1XC5 A;  1JT0 A;  2KPM A;  4GCV A;  1WJD A;  3BR3 A;  5CPR B;  3JAM K;  2LKX A;  2ZSI B;  3WTS C;  4CCN A;  3ZPL A;  3W2A A;  2A61 A;  1XSD A;  4GGG A;  1UHS A;  3M07 A;  3OWT A;  1H89 C;  1IRF A;  1IXS B;  4B48 A;  1I39 A;  2L7M P;  2XF7 A;  3FXU A;  5FKK A;  4EM0 B;  3FKJ A;  3GTL J;  3HHH A;  3HHG A;  2JA7 J;  4AM3 A;  3I58 A;  2E1C A;  4CIC A;  3OYG A;  1HLV A;  1D8J A;  1BR1 A;  1F1Z A;  1VQP I;  4A93 J;  1T38 A;  2XV4 S;  5F08 A;  4XKW A;  5FKM A;  3HEF A;  1RUN A;  2VBY A;  2XKP A;  2GLO A;  2QUF A;  2M3A A;  5FKL A;  1LB2 A;  2B0L A;  2DMP A;  2LF7 A;  5F0F A;  5LLQ A;  1QO0 D;  2FSW A;  2ZJQ F;  4EEF G;  1USS A;  4KT6 A;  2QLZ A;  1FY7 A;  2VJI A;  5FRN A;  3LA3 A;  2VOO A;  1EH7 A;  3WTW C;  1OCO H;  3K70 D;  4RB2 C;  5BQT A;  3CUQ B;  1G3W A;  3BWG A;  3FXO A;  4AYB A;  3ABU A;  3F23 A;  4BL0 B;  1Y8Q B;  2XDV A;  3DP7 A;  3VSK A;  4CCJ A;  5LGT A;  2M2E A;  4UVB A;  4PSW A;  1QBJ A;  3MCZ A;  1FYK A;  3LFK A;  4ENN A;  1FJL A;  2P6S A;  3AG4 H;  2PMZ N;  1PUF B;  1UHW A;  1W36 C;  3HUG B;  3AL0 B;  2BVL A;  5EYR A;  4U7B A;  2F5E A;  2X85 A;  2G7H A;  2CQK A;  2OUM A;  2K85 A;  3F6O A;  4HA8 A;  1J0R A;  4RB0 A;  3KZZ A;  3HG9 A;  1X1C A;  2KRH A;  4F92 B;  4QPO A;  2VPR A;  3ZMS A;  1ZRC A;  4X0G A;  4GFB A;  3CJR B;  3S1M J;  1JI8 A;  4CDG A;  2XAH A;  4KN7 X;  2ESN A;  3K1P A;  3D5S C;  5E18 F;  1K78 A;  1E0E A;  4A0Y A;  1E3H A;  4G94 A;  2COM A;  1M1E B;  3A01 A;  3ECH A;  2BVM A;  2ETH A;  4A6D A;  2R7V A;  1BR2 A;  1HW1 A;  2FJ1 A;  2K9Q A;  2F2E A;  4MEY F;  2QQA A;  1O3S A;  1ZR4 A;  4EQQ A;  3WTT C;  3OYH A;  4RGX A;  4LG3 A;  4C9Y A;  1U0J A;  3GBG A;  3KEO A;  4KIC A;  4NBQ A;  2DFH A;  3BDD A;  4CA0 A;  2HU9 A;  2DK8 A;  1IUY A;  3TW7 A;  2DA3 A;  2F5V A;  4XOT A;  2Y0M A;  3T8R A;  1UB9 A;  2MC3 A;  2IS1 A;  3QWL A;  5HS9 A;  2HQR A;  3BR2 A;  3BG3 A;  4Z6Y A;  3H0D A;  5EGO B;  1WJB A;  1JT6 A;  4HW0 A;  2P8T A;  4M3E A;  4HF1 A;  5DEQ A;  2KIS A;  2XGC A;  1SAX A;  2DMQ A;  4QTR A;  2NVY J;  1W4M A;  1V4R A;  4UUT A;  1MBE A;  4IQJ A;  3TGN A;  3COA C;  2MA3 A;  3C1D A;  3RZO J;  1D8K A;  2DT6 A;  2R7Q A;  3TP3 A;  4OMY A;  1FIA A;  3M1C A;  4MTD A;  4L5I A;  5C3E J;  2E7X A;  3WU1 B;  4JOM A;  2D1H A;  4XL9 A;  3I0T A;  4U0Y A;  2EH3 A;  3W6K B;  2V4J C;  2YX7 A;  3K1N A;  1OCT C;  2DBB A;  4M3D A;  2Y31 A;  1D5Y A;  5FFZ A;  2WC2 A;  3ERE D;  1HKS A;  1MH3 A;  2VBW A;  4JBA A;  4M9Z A;  4HNV A;  2R7U A;  2HKO A;  1DGR M;  1FMW A;  3KE2 A;  5LHI A;  3I54 A;  2R7R A;  4PGH A;  1AA7 A;  1FMV A;  2FNA A;  2V9V A;  1X4O A;  4FQG A;  1PP7 U;  4M71 A;  5EG0 B;  2BEO A;  4JX5 A;  2QSH X;  2MD5 A;  5BPD A;  2ID6 A;  3DEW A;  4XMY A;  4N4O B;  1Y0N A;  2RVC A;  1D1C A;  5KCM A;  1PDN C;  3MKZ A;  1E17 A;  3HTU A;  3KCC A;  5L3E A;  4G7Z F;  4XN0 A;  4PJN A;  3CF2 A;  4XLH A;  4DYQ A;  4DOZ A;  2EWN A;  1RC9 A;  1SD5 A;  5LRR A;  2KL4 A;  1YW7 A;  3OOP A;  1DUX C;  3CCY A;  4GRI A;  1WVR A;  2L54 A;  5BPI A;  2EZH A;  5HLI A;  4ZDP A;  3O2P E;  1AOY A;  1V5E A;  3ESW B;  3I3L A;  4UV8 A;  5JHU A;  1ZQ3 P;  1W7P A;  3I9V 2;  3GCM A;  2DA4 A;  1EV7 A;  5DUK A;  1BIB A;  1TTY A;  2PEX A;  3FXL A;  2TCT A;  4C2U A;  1O7F A;  1WKM A;  1FBQ A;  4O6J A;  2XAS A;  3TBI A;  3V8L A;  1BA5 A;  1ZTR A;  4E7S A;  1WJC A;  4CHU A;  1F5T A;  2VT2 A;  1W0T A;  5HLG A;  3KPH A;  1OYI A;  3LSP A;  3FIW A;  1Y1W J;  1Y56 A;  2G9W A;  3ERM A;  3PUB A;  4RM2 A;  1MBJ A;  2HKX A;  2IA0 A;  2QBY B;  5LGN A;  4JK1 X;  2DN0 A;  2KDO A;  5FRM A;  3SFI A;  2LRE A;  1BI3 A;  4EV0 A;  3DKX A;  4A3G J;  2O7O A;  5J1U A;  3Q9S A;  5DDG A;  2DCE A;  3CD6 I;  2EK5 A;  1X1P A;  1UCR A;  1P7I A;  2V79 A;  1T0F C;  3ZMT A;  4B47 A;  4MNU A;  5L3G A;  3S16 J;  3I59 B;  2BYV E;  2RKH A;  3I53 A;  5CVI A;  3L2W A;  1EJ9 A;  3PIP F;  5ED4 A;  2NOJ B;  2TDX A;  1PYV A;  3E6C C;  1HBX G;  1QZE A;  2JWT A;  3CCS I;  2HNH A;  2X6O A;  3FK7 A;  4M72 A;  3GO5 A;  1WH7 A;  3RQI A;  1J2X A;  3K10 A;  3REO A;  3ZN1 A;  3JR9 A;  3PM1 A;  2LTP A;  3KP4 A;  1UG2 A;  4XKB A;  4QWQ A;  1HXD A;  2NRA C;  1JGS A;  3HOU J;  1D0Z A;  1MD0 A;  2EA2 A;  2CWE A;  2MG4 A;  3QAH A;  1I1S A;  5ILU A;  3HYI A;  5K7Z A;  2R7D A;  3K7A J;  3C7J A;  2XF5 A;  1Z7U A;  1UFM A;  1JJ6 C;  5HDK A;  2VXD A;  4EGY A;  2ID3 A;  1IC8 A;  1SVO A;  3QPH A;  1R58 A;  4RBO A;  3QQA A;  3K4N A;  4PFO A;  2XGX A;  1U5T C;  1MZB A;  2VKV A;  1YYV A;  3HUG A;  4AVP A;  1OR7 A;  2YPR A;  1Z6T A;  1NG6 A;  5LHG A;  3GTJ J;  1R23 A;  5DCM A;  1VQN I;  4ENM A;  2GXB A;  3OS0 A;  4DNC A;  3WTY C;  3HOX J;  2HXO A;  3KP5 A;  5H6Q A;  4DIQ A;  2NNN A;  1LPQ A;  2A5W A;  2ZJ2 A;  3GYH X;  3OSF A;  1FSE A;  2ZNY A;  4KIF A;  2DFI A;  3OSG A;  1FPQ A;  2IGM A;  4KMF A;  5J47 A;  5F27 A;  2NVX J;  1XMK A;  5IT9 K;  5HLH A;  3DBH B;  2GOM A;  3ZQC A;  3JRE A;  1X1D A;  1R7J A;  5HS8 A;  2MH2 A;  1Z67 A;  1IXR C;  3Q3S A;  2A69 F;  1Z9C A;  1JHF A;  4LG0 B;  1W5C C;  4B4C A;  3KP7 A;  4B1R A;  4CSW A;  3EDP A;  5C44 J;  3B6C A;  3ELK A;  4PUS A;  3CC2 I;  1DP3 A;  3DTI A;  4RAZ A;  1DQU A;  1ZN2 A;  2CQN A;  3J7Y J;  3S3O A;  3GLX A;  4KA4 A;  4ASN A;  1IRZ A;  1P2F A;  1JXS A;  2KJB A;  4UB8 C;  5FLX Z;  3QPS A;  5FB2 A;  2AQF A;  5HOD A;  4UVA A;  4KJZ A;  2RNJ A;  5FKN A;  5JVT A;  3LAP A;  1EH6 A;  1TNS A;  2RRE A;  5GAG J;  5M3F J;  4LK0 F;  4C30 A;  5IPA A;  1ENH A;  2VQC A;  5IOY A;  3A0H C;  3CCL I;  2M7B A;  3ABM H;  3MD2 A;  2JMW A;  4FX4 A;  2CQX A;  1JE8 A;  1JTX A;  3FXM A;  5GPC A;  2WY8 Q;  1FOX A;  3FZV A;  3S14 J;  3HOT A;  5CVR A;  2O5R A;  3H9J A;  4ZZD A;  3CMY A;  2AXL A;  4BU2 A;  1ZLJ A;  3GTK J;  4DGW B;  4Q5S F;  4IHY A;  5D5X B;  3QYE A;  4LLL A;  2DFF A;  4YFK F;  1R49 A;  4JX4 A;  5FKO A;  4AWX B;  1F4K A;  2M45 A;  3ZMZ A;  4LLN A;  1QPI A;  2P5V A;  3CO7 C;  3FHN A;  2QKM B;  5EG0 A;  1E2X A;  2L9N A;  1R9T J;  3FBN B;  3VYT B;  3S3M A;  1QU3 A;  3BRO A;  1QQI A;  5DM7 F;  4IRI A;  1ZGJ A;  2YUS A;  4IXA A;  1U6G A;  3AG1 H;  3ZQ7 A;  4OAZ A;  1K4T A;  1N77 A;  3IL2 A;  3PQJ A;  4BJ5 C;  1LJ9 A;  3SDG A;  4C3J J;  1TW3 A;  1XSV A;  2L0K A;  3LAJ A;  4G9Y A;  1JJ8 C;  3E97 A;  5CVU A;  1MBF A;  2HTS A;  4MFD A;  2DXI A;  3LWF A;  1TQI A;  3K9T A;  1VQM I;  3U1D A;  3VYS B;  3ZMU A;  2VJ5 A;  3SJM A;  3KLN A;  4WXD A;  3HL2 A;  2HFH A;  2M30 A;  2QZ8 A;  6PAX A;  2FXA A;  1XGM A;  4KFC A;  5EDN A;  3IWF A;  2W4S A;  1BJZ A;  3RQ4 A;  2VOD A;  3R4K A;  1G8X A;  1VI0 A;  3OL3 A;  1P7J A;  1MGT A;  1UEL B;  3HM5 A;  4A2U A;  1LEB A;  2ZFW A;  5A2Q Z;  3KLO A;  1YI2 I;  3T8T A;  1MND A;  4I09 A;  1MMA A;  3HSF A;  3G1L A;  2OU2 A;  2JSC A;  5LEJ A;  1RRJ A;  2E1M B;  3BR5 A;  1FX7 A;  1I1G A;  2V1N A;  3P5J A;  2FBK A;  4ANJ A;  2P4W A;  3CJQ B;  4EJT A;  2ISY A;  1W7P D;  4IHV A;  2BW3 A;  1AWC A;  3DPL C;  4XOP A;  4RM3 A;  3J7Z I;  2L9S A;  1GT0 C;  2L9V A;  1YW9 A;  3BG5 A;  1DP7 P;  1MW7 A;  1SMY F;  3LMM A;  3ZOB A;  3I5U A;  4BGD A;  1Y39 A;  1P4A A;  1GXP A;  5E79 C;  1AHD P;  4W1U A;  4HBL A;  4LIU A;  1Z3X A;  5KAI C;  4WF2 A;  1G2H A;  1W0U A;  3I59 A;  4X1E A;  1LNW A;  1SAU A;  3QP6 A;  4BJT A;  2R7T A;  3TOB A;  4BBS J;  2JQ7 A;  2JUG A;  3HGY A;  4D9J A;  3DLL F;  5C4X J;  1P6R A;  1OCC H;  2L3D A;  2OPT A;  3OYC A;  1K78 B;  1IDZ A;  3I56 I;  1T8I A;  1IN8 A;  3EUH A;  3SZG A;  4CCM A;  3L9F A;  1S9H A;  1ZGA A;  2GA1 A;  2HGC A;  4NB5 A;  4U0W A;  4ESB A;  3A01 B;  1T6S A;  1HKT A;  5CLS A;  3QU3 A;  3DTK A;  2MLG A;  2VQH A;  3EPZ A;  2R92 J;  3KP3 A;  1WHU A;  1B9N A;  4L18 B;  3VSL A;  2O8X A;  4RA2 A;  1BW6 A;  1IN6 A;  1OYY A;  2BY0 A;  3KEQ A;  3TL4 X;  3WTV C;  2AQE A;  2G7U A;  5DUI A;  2R3S A;  3OR1 C;  4IOC F;  3DPT A;  4J19 A;  2DLL A;  1GXQ A;  2ELK A;  2A6T A;  1B9M A;  4AYB N;  5EEH A;  5D8L B;  1RIO H;  4CCO A;  2HI3 A;  1F9N A;  1MMN A;  2K7L A;  2RGV A;  2QGU A;  3NAU A;  3OY9 A;  1BJA A;  1LFB A;  1ULY A;  1R5H A;  4XM3 A;  4OAY A;  2ZCW A;  4L9N A;  5EJC A;  3LSM A;  1PJR A;  3GW2 A;  4HG2 A;  4AU7 A;  4C3H J;  1S7O A;  1WFX A;  2STT A;  1GLN A;  3RDI A;  2FX0 A;  3ASO H;  4ZJZ A;  1S7E A;  2GIV A;  2CQQ A;  4P96 A;  1HF0 A;  4YIR X;  1KON A;  3IKT A;  3UKG A;  2AO9 A;  1MKM A;  1WH5 A;  4V2G A;  3S15 J;  4X6A J;  2ZBK A;  4M3G A;  1QA6 A;  3O3K A;  2HVS A;  3CLO A;  1YHQ I;  4XSX F;  4FT8 A;  2N8G A;  3VFZ A;  4Y52 J;  4LG0 A;  3LA7 A;  2BY3 A;  3SFZ A;  1UG0 A;  2V26 A;  2P0W A;  3M8J A;  1SEU A;  2DDA A;  2L7Z A;  3KYD B;  2Y9Y A;  2F48 A;  2UV1 A;  2QYO A;  5FRO A;  4M74 A;  3R6S A;  4MHG A;  2VBZ A;  3MKW B;  4UNO A;  2BV6 A;  5E1Z B;  1YG2 A;  2VI6 A;  4P9U A;  2XRO A;  4R1H A;  5K5R A;  2W82 A;  1XDS A;  5J6X A;  3CUO A;  3CP2 A;  3CCV I;  2V6E A;  1MBH A;  3CCR I;  1FTZ A;  2OCC H;  5BOX A;  2DJN A;  4AIJ A;  2F5D A;  3ABK H;  4IJA A;  1KYW A;  3TDZ C;  2W1O A;  1FNN A;  2IBD A;  1KU9 A;  2Q1Z B;  2RQP A;  1W7P B;  4FTH A;  4DZJ A;  4A6E A;  2FOW A;  2D1V A;  1A5J A;  3I64 A;  2K02 A;  3E6M A;  2MBF A;  4RGR A;  2EBI A;  3K4M A;  1PVE A;  2JZY A;  3H1C A;  1O3T A;  1O7L A;  1YJN I;  3E3V A;  4ZZL A;  4XOR A;  1QZZ A;  4MO7 A;  2BXZ A;  1YO5 C;  3K2A A;  5DM6 F;  5ICC A;  1W5S A;  2EQR A;  2W85 A;  3V7R A;  4LLG F;  2EV5 A;  2A68 F;  3DEE A;  3G3Z A;  1X3W B;  3N05 A;  2CRG A;  2LSO A;  1J75 A;  2PQ8 A;  1R5I D;  2RNG A;  4PJ0 C;  2HVQ A;  4M3F A;  4HNT A;  4ZYH A;  1S3J A;  1N75 A;  1FBU A;  3PO3 J;  4AUX A;  3MVP A;  3F72 A;  4NNJ A;  5CVV A;  5H6R A;  2FU4 A;  2M4G A;  2RC4 A;  3BZK A;  3MFK A;  4A3E J;  4LFU A;  1I6H J;  3BG6 A;  3NEU A;  4Y3O A;  4P55 A;  1K79 A;  5CVJ A;  3OYL A;  1MJB A;  3TP0 A;  3KIO A;  3F22 A;  2OAZ A;  1O4X A;  4IZZ A;  3OS2 A;  3KX2 A;  2W00 A;  2X1C A;  2MLK A;  5DTD A;  4YFX F;  2EJR A;  4RGS A;  2O3F A;  1L0O C;  3FXQ A;  3BZ6 A;  2M8E A;  4OWR B;  3RYP A;  1J59 A;  2PX9 A;  2ZXI A;  2ZXH A;  1JUS A;  5L3D A;  3DF8 A;  1TC3 C;  2X9D A;  1N78 A;  1V3F A;  2IS2 A;  1OJL A;  2GIZ A;  5IYB J;  3EYY A;  2BOL A;  2BXY A;  3I4P A;  4E6K G;  2LOO A;  2E19 A;  3K6G A;  2L9R A;  2JK3 A;  5IP7 J;  1EF4 A;  2R5Z A;  1WSU A;  3O6B B;  1G3Y A;  4BDZ A;  1ZGW A;  2M5W A;  1HA8 A;  1V54 H;  2LP0 A;  3MZ8 A;  4XLN F;  2IS4 A;  2PI0 A;  4FAS D;  1MSF C;  4BHC A;  1VF9 A;  3OIO A;  1FYM A;  3CF5 F;  2OTJ I;  3C2B A;  5B1A H;  3L00 A;  5JFR A;  4WXH A;  1QHH D;  5DCM B;  1R22 A;  2X6X A;  1POG A;  2EFO A;  2YS9 A;  1VTN C;  4E7L A;  3I4M J;  3WGG A;  5FJ8 J;  3NAR A;  4B43 A;  2HOT A;  1A04 A;  1HW5 A;  1KQ0 A;  2DDB A;  2ZXW H;  3OIP A;  1ZRE A;  3CUQ C;  2V1U A;  2P5K A;  2IGK A;  3SDB A;  3FBI B;  4H4K C;  5LFA A;  2IT0 A;  1ETX A;  2LKP A;  1MH4 A;  1AKH A;  3HZJ A;  3ZMD A;  4ITV A;  4S05 A;  4GDF A;  3J7A O;  2IPQ X;  1A36 A;  3LA2 A;  1UJ8 A;  1KQ8 A;  2KIM A;  1IV6 A;  5TJJ A;  4XIC A;  1E3O C;  3TOA A;  2PJR B;  3AL0 C;  3IKV A;  3PNY A;  1Z6R A;  2EV6 A;  5TIS C;  3PFI A;  4UHT A;  2I10 A;  3RCO A;  1GV2 A;  4MQV A;  3IAS 2;  3PSF A;  3PUF A;  5LRS A;  2VE8 A;  4HEA 2;  1QPM A;  3JRG A;  5KVR A;  1HW2 A;  3ISP A;  5TGT A;  4FIS A;  1G6N A;  3ZRG A;  3WG7 H;  2LDU A;  4A69 C;  1XTA A;  2KKO A;  2EPF A;  2PMU A;  2W57 A;  3H5R A;  1ERD A;  4DQ2 A;  2LNB A;  2DOA A;  4M6Y A;  2HEO A;  2IRF G;  2KQR A;  4I6Z A;  3KYL A;  5F04 A;  4BKX A;  3GME A;  3IHU A;  1VQ7 I;  3IH2 A;  4DBQ A;  4MEX F;  3IH4 A;  2FUG 2;  3ML6 A;  4PCQ A;  2CFO A;  2O9L A;  2AXT C;  1FYL A;  2QCO A;  4QSH A;  1FBS A;  1QRY A;  3CQZ J;  5B5E C;  2Z33 A;  1ITY A;  3DV8 A;  2Y0S A;  1S7A A;  1XGO A;  2W25 A;  2GA2 A;  2CUJ A;  2WAE A;  2KLO A;  3I71 A;  3EYI A;  1BC7 C;  4YIF A;  1NK3 P;  1D1B A;  1MJ9 A;  4HDV A;  3BTJ A;  4BDY A;  2CUZ A;  1XCV A;  3CDL A;  3HJE A;  3IAM 2;  3NWT A;  1QVU A;  2A6H F;  2A5Y B;  3M8E A;  4U87 A;  5FLX K;  1R1U A;  3G2B A;  2A3S A;  3VPR A;  2OQR A;  1ETY A;  5HS7 A;  4M9S A;  2L5Q A;  3CCE I;  2CG4 A;  2XAQ A;  1Z05 A;  4P5O A;  2ZFU A;  1VND A;  3PNV A;  2KT0 A;  1JKQ C;  1K6O A;  1BR4 A;  1Y0U A;  4OMZ A;  4YII A;  3IRR A;  5EEG A;  1A35 A;  2LY2 A;  2KIF A;  3JSO A;  2HZD A;  2H8R A;  4ENJ A;  2DA6 A;  1I5Z A;  2UUZ A;  3BPX A;  1FSH A;  5BS6 A;  4WX9 A;  3P9I A;  1IDY A;  3F6V A;  3S1R J;  1EKE A;  4XRF A;  2IJL A;  4HQM A;  4B8X A;  4E7J A;  4L5J A;  3G1O A;  4YEJ A;  4BEH A;  2P7V B;  1F36 A;  3ROU A;  3BC8 A;  1IN7 A;  4D7M A;  1IAW A;  2TRT A;  2XPV A;  3E0J B;  2M1B A;  1R36 A;  1TW2 A;  3ZQL A;  2CJJ A;  4YFN F;  5HDG A;  2QWW A;  4CCK A;  1QHG A;  4HOB A;  1SFX A;  2L02 A;  4M73 A;  5ICF A;  1Z0X A;  3R0A A;  1BW5 A;  1RNL A;  1TBX A;  2R7F A;  3LQR A;  2XPW A;  3A2K A;  2V9K A;  2FQ4 A;  3S2H J;  3E7L A;  3FXJ A;  4IRH A;  5GAE J;  3DKW A;  3HOV J;  2CW8 A;  2B9S A;  3S17 J;  5L3C A;  4I0A A;  5KK1 A;  2LH9 A;  2PLY A;  5D4R A;  3GX4 X;  2PMH A;  5J4V A;  2NAZ A;  1ETW A;  2DMU A;  5AIQ A;  3K70 C;  3TKY A;  1VQ5 I;  4UB6 C;  2C6Y A;  5HOO A;  2VQG A;  4XN3 A;  2F4O B;  3A03 A;  1HCR A;  5B1B H;  4KMU X;  4OIP F;  2Y9Z A;  2LR8 A;  2M8G X;  5E17 F;  4XRS A;  1FP2 A;  4DYR A;  3H5A A;  4KDP A;  2BW3 B;  1X58 A;  3Q0V A;  1ZK8 A;  2CUE A;  2LY9 A;  4U0V A;  3DCF A;  4CYC B;  3L1P A;  1I27 A;  2LK2 A;  1C0W A;  1J5Y A;  3RPQ A;  2WV0 A;  2JA6 J;  3U1K A;  2X6W A;  2KMU A;  2O6G E;  2PMZ A;  4Q4Z F;  5M3M J;  2Z9O A;  2QF7 A;  3DU5 A;  1RUO A;  3GF2 A;  3OV8 A;  5A2Q K;  3V42 A;  4KIB A;  2LMD A;  1YFH A;  2QKL B;  4D5C A;  2VT3 A;  1STZ A;  3JTH A;  3PJR A;  3JRF A;  1W5T A;  1Z7L A;  1LFP A;  1KGS A;  4L9J A;  3M1E A;  4BAY A;  2Z99 A;  4F7Z A;  3W2W A;  3R0J A;  4XKV A;  2EFQ A;  2OC6 A;  5D4S A;  3LOC A;  2RN7 A;  4CZZ A;  1T2K A;  3B6A A;  2HTJ A;  3FDY A;  3PNT A;  4BNC A;  3ZQH A;  1RES A;  1LDK B;  4OIO F;  2VUM J;  3GTM J;  3W3C A;  1FOW A;  3CCM I;  5CQG A;  3WG9 A;  5F0H A;  3RKW A;  3JW4 A;  4L0Z B;  3F8M A;  2Y69 H;  4JX6 A;  3VOE A;  3BQY A;  4A5N A;  4XLP F;  5E1W A;  1IRX A;  2QQ8 A;  3F9K A;  3FXR A;  4RAY A;  4E4H A;  4I2O A;  2IXS A;  1HQC A;  4MQ9 F;  1R5G A;  1LFU P;  1KU7 A;  4UVC A;  3L2Q A;  3GFI A;  5E3N A;  1GV5 A;  1TLH B;  1D5V A;  1UMQ A;  2FMY A;  1LUJ B;  2H8W A;  2HR3 A;  1V5G A;  4FET A;  5HLT A;  3MWM A;  1ZRD A;  2GM4 A;  1TZL A;  1Z77 A;  2DOE A;  2NOG A;  2CU7 A;  4IX7 A;  3MZY A;  4IKF A;  2A6E F;  1WWX A;  2EB7 A;  2O0Y A;  3FM3 A;  3ZN0 A;  2P5L C;  1SD6 A;  2E60 A;  2M0M A;  5KAF C;  5IY5 H;  2P81 A;  4C2T A;  1VZ0 A;  5BMZ A;  4KT5 C;  2NS8 A;  2X51 A;  1X1B A;  2ZME B;  2J5O A;  4D5F A;  2R7Z J;  3VB2 A;  4ZTF A;  1MBK A;  1TQP A;  2YSR A;  4WXC A;  1ON2 A;  1MMS A;  2PJR A;  1LKX A;  4EJU A;  2CW0 F;  1HKQ A;  1ZAR A;  3GZ6 A;  1MNM C;  2W84 A;  1SVM A;  5K7H A;  2R7O A;  2CMP A;  4BXU A;  1KYZ A;  1PUE E;  2WAD A;  1VQ9 I;  4A3F J;  2EIK H;  1F43 A;  1FT9 A;  1MBG A;  3MKL A;  4XBF A;  3L2V A;  5FGM A;  4HDU A;  1RET A;  4ON0 A;  3QYF A;  2YU9 J;  2ECC A;  4BY7 J;  4H0E A;  3AG2 H;  3E6D A;  3BOQ A;  2JTV A;  2NS7 A;  1SVL A;  2OZU A;  4MFE A;  2HQA A;  3OYD A;  3RSN A;  3MZH A;  5GP9 A;  2JVG A;  3CO6 C;  4LK1 F;  1SAN A;  5AON A;  5LBQ A;  3HB9 A;  3ABT A;  4O5V A;  4HPQ A;  1E3P A;  2OQG A;  5EEA A;  5D5W B;  3D1N I;  2VN2 A;  2XKO A;  2XSJ C;  3NRV A;  4ZYG A;  1JGG A;  3HKZ N;  1OFC X;  4XNF A;  3RTR A;  3PQK A;  5ILV A;  1YX3 A;  3BR1 A;  2F5F A;  3P9K A;  1ONV A;  3ZGK A;  1XX5 A;  3KET A;  4QPQ A;  3RKY A;  3G4S I;  3K4J A;  1K4S A;  2CGP A;  3K4L A;  4IVN A;  2DTR A;  2GWR A;  3H92 A;  1NG7 A;  1U8R A;  4TV7 A;  2LFB A;  2VKD A;  1REP C;  4Y13 A;  3DLA A;  1KA8 A;  1ON1 A;  2X1D A;  1VQO I;  2JVH A;  3OYB A;  2K40 A;  1U78 A;  2B63 J;  3CMA I;  1TWF J;  2FD5 A;  3B73 A;  2CUF A;  3PFY A;  2JJ7 A;  3DTE A;  4ZH4 F;  2O61 A;  3KP6 A;  2ICW G;  1WZ2 A;  1B8I A;  1A31 A;  3ZQI A;  3J80 Z;  3K0L A;  2DFE A;  2E1N A;  2XB5 A;  3S32 A;  1W1W E;  2BY2 A;  5ILS A;  4RGU A;  4XLF A;  1WQ2 A;  1ZG3 A;  3CZ6 A;  3LL7 A;  4FHT A;  2E1O A;  1YOV B;  5F64 A;  4B09 A;  2P6T A;  3JRI A;  3KEY A;  1U8B A;  3V8J A;  1XB4 A;  4B44 A;  2E2J J;  5EZH A;  3S1Q J;  1J9I A;  4AVZ A;  2HQN A;  2ME6 A;  3DKY A;  2E35 A;  4A0Z A;  3M8F A;  3OMY A;  2NXN B;  1YX5 A;  2HQ5 A;  1R4M B;  1RZ4 A;  2EIM H;  3Q9V A;  2BZT A;  2FE3 A;  2FA5 A;  2W48 A;  1VQL I;  3ZQF A;  4BJ6 C;  4LGW A;  2Q8K A;  3RI4 A;  1D1A A;  2CH0 A;  2IW5 A;  3HRU A;  1JKO C;  3B02 A;  4Y33 A;  2DMT A;  2R5Z B;  1JHH A;  2LBF A;  2XAG A;  5IP6 A;  2LYC A;  1I3Q J;  1ZEL A;  3A4C A;  3FF5 A;  4HLX A;  2AS5 F;  1LEA A;  3A0B C;  4BQN A;  1XMX A;  2HOE A;  5J3L A;  4NHJ A;  5FLV A;  3BJA A;  1LDJ A;  1VQ6 I;  1HDP A;  3TW6 A;  2LC2 A;  1G3S A;  4CYC A;  4Q47 A;  2MGQ A;  4ZDL A;  1WGX A;  2XAJ A;  1X3Z B;  2KRF A;  3TO6 A;  4OU0 A;  1GHC A;  4IEJ A;  3RKX A;  5FLM J;  4G6Q A;  1TL8 A;  2HOS A;  1BI2 A;  3GWZ A;  5B66 C;  1ORK A;  3SZT A;  5JLW A;  2DYS H;  3HRT A;  2DT7 B;  2Y2Z A;  3AKZ A;  3T1B A;  4XR6 A;  4I99 C;  5IOZ A;  2BY1 A;  5KNL A;  3G71 I;  1AKH B;  4F55 A;  1BOB A;  3CCQ I;  3SHF A;  2E1M C;  2DJI A;  1A6Q A;  4BAC A;  2L2O A;  2EIN H;  1XN7 A;  2R4G A;  4I7H A;  2MSY A;  1DPR A;  2VLA A;  2HDD A;  3BLY A;  3FIS A;  4RDU A;  2HDW A;  3MKY B;  4AIK A;  5M5Y J;  2LRD A;  4RB1 A;  2Z1D A;  3QPT A;  1WJF A;  1T39 A;  1WJE A;  2F4M B;  1Q1V A;  4PSX A;  5LD2 C;  4G6T B;  4L9V A;  3TO9 A;  5IYD J;  2HYG D;  1L3L A;  3G73 A;  1QZY A;  3PO2 J;  5F1R A;  2MC4 A;  3FXK A;  1J09 A;  3CDH A;  4ZC3 A;  1XCB A;  4M6V A;  2GQQ A;  3KFW X;  1IF1 A;  4A3B J;  5K7F A;  4EJW A;  1YE9 A;  3HOZ J;  3BT9 A;  4KIS A;  3DU6 A;  5DS9 A;  2CS3 A;  2K9M A;  3PL8 A;  3VYR B;  4DZP A;  2QA4 I;  2VON A;  2QVO A;  4D1Q A;  3FX3 A;  1I3A A;  4Y17 A;  2ELH A;  3GFJ A;  2RDP A;  4BE1 A;  2FBI A;  1TNT A;  2D45 A;  2Y30 A;  2DT5 A;  1ETK A;  2NS0 A;  3H35 A;  3F8B A;  3IH3 A;  1W36 D;  3RJP A;  4CXF A;  1OCP A;  4A0X A;  2R7S A;  2H94 A;  2FRH A;  4HV6 A;  3ZXS A;  3WTU C;  3UNG C;  5FFX A;  1DDN A;  2ZME A;  3TO7 A;  2Z3Y A;  1LQ1 A;  3H5N A;  1H0M A;  4U7D A;  1CQT A;  1OYW A;  4G8X A;  3CCJ I;  2O8K A;  1RPW A;  2IEK A;  3Q0U A;  2WV1 A;  1PP8 F;  4P1W A;  3ZP5 A;  2R0Q C;  2K27 A;  5HNH A;  3K2Z A;  1R1V A;  4YEL A;  4BXF A;  2IGO A;  3OOU A;  2VC0 A;  1K61 A;  1DU6 A;  3OIQ A;  3C3W A;  1UAA A;  3OYK A; 
#chains in the Genus database with same CATH homology
 2F4O B;  2QSF X;  1TP4 A;  2QSG X;  3ESW B;  1QZE A;  1PVE A;  2F4M B;  2QSH X;  4YIR X;  1OQY A;  1X3W B;  1X3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...