1X40A

Solution structure of the sam domain of human arap2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
b'GSSGSSGMSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRILKQLQIILSKMQDIPIYASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARAP2
publication title Solution structure of the SAM domain of human ARAP2
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1x40A00
4MHVA 2QB1A 5J8YA 1Z1VA 2E8MA 2K4PA 5KNIA 1SXDA 3BQ7A 5J8YC 1RG6A 1KW4A 3TADA 5JTIA 3BS5B 1PK1B 2Y9UA 2QARA 2QB0A 2D8CA 2EANA 3TADC 2F8KA 3H8MA 2E8PA 1COKA 1F0MA 1V38A 5JRTA 2LPEA 5F3XB 3SEIA 1OW5A 4RQNA 1B0XA 2ESEA 5JU5A 2KG5A 1SV4A 2QARB 2QB0B 2LMRA 1PK3A 2KSOA 2FE9A 2KIVA 1UQVA 2JV3A 3SENA 1X66A 2K60A 3K1RB 1V85A 1LKYA 2QKQA 2B6GA 1WWUA 4NJ8A 4PZNA 1X9XA 2KE7A 1B4FA 2F44A 1JI7A 1SGGA 1LKYB 3BS5A 1PK1A 1UCVA 1WWVA 2E8OA 2DKXA 2EAPA 4PZOA 2KMDA 1OXJA 3KKAA 2E8NA 4IS7A 2GLEA 2Y9TA 2DL0A 2F3NA 4RQMA 2KSOB 3HILA 3KKAC 4NL9A 5L1MA 3TACB 2DKZA 3BS7A 2YTUA 4NL9C 1SV0A 2ES6A 1DXSA 2EAOA 2D3DA 2L5YA 2EAMA 1X40A 3IDWA 1SXEA 1SV0C
chains in the Genus database with same CATH superfamily
3GIMA 1NK7A 3MFIA 4RQ8A 3ALRA 2EZYA 2G07A 1UA1A 2KZZA 3QU5A 3M6ZA 1X2IA 1SIJA 2DF4B 2GWSA 2W55A 7ICGA 3NASA 1K5OA 2LM1A 3QZ7A 2HHQA 5AM0A 4IQWA 2G06A 3TADC 3M9NB 4Z6DA 2YY6A 4I2EA 4YD2A 5ALRA 4DFDA 2XCPA 1ZJNA 1T8EA 1NJZA 2BCSA 4F4XA 1D9DA 4K4GA 5AK4A 4F2RA 1DRGA 4K4IA 3GQCA 4KITB 3RB4A 4CF5A 2FMSA 5J2CA 4J9MA 5KFSA 4YXMA 4CF3A 5ALPA 2E1FA 5AICA 4UB5A 5KFJA 4PGXA 3UXPA 3NVVA 1JRPA 4RU9A 4UB3A 4MEXA 4F5OA 4C8MA 5HNKA 2AHOB 5ALTA 4R66A 2KVSA 2RHFA 2C22A 2F44A 2ISPA 3OTQA 5F9NA 4C7YA 1KKXA 4BDPA 2Q4TA 4J9NA 1O03A 1UCVA 2W8LA 2HHUA 4P0QA 4ELVA 1DK2A 2NRTA 2P6UA 1QSLA 2HHWA 4OJOA 3WKAA 3I76A 2C2DA 2KJ9A 4ELUA 1JALA 4YMOA 4C4SA 4EEYA 1QTMA 2HSZA 1ZQOA 2HOIA 3AU2A 5DB7A 1BPYA 4NL9C 3JPSA 3N7RC 2A1JA 3F53A 1QQ6A 3N97B 4P4MA 1BVSA 4DFJA 1NJYA 2FI1A 7ICRA 3Q8PB 2FMQA 3NS1A 1BPEA 5AK5A 3KD3A 5J8YA 2E8MA 4O3MA 5CRXA 2KZMA 4RQ2A 3MR6A 4KN4A 4KX3A 2KJ5A 4LVSA 3QUCA 3ZI4A 1QCKA 4BUGA 1ZQYA 7ICNA 4ED2A 2IOHA 4R65A 3RH4A 1HJPA 4PHDA 4O3PA 2NRWA 2XGQA 4DL4A 2IBKA 4ECZA 1K1SA 2D6FC 2FE9A 1B43A 3D6JA 2A1JB 1M6YA 1X66A 1NK9A 4C8LA 4J9RA 4QZGA 2J6TA 5ALFA 2PMZF 5AM1A 5J0OA 1S0MA 3HPOA 3R9KA 1SZHA 3RH5A 4O3SA 1HUZA 2M9NA 3RRGA 5EE3A 4C7ZA 4FO6A 2BPGA 5AI9A 1ZD5A 8ICBA 1B4FA 3EPGA 4FBUA 4O5CA 3C2MA 2ODGA 4YXJA 4R63A 4ZOHC 1MC8A 3N7PD 4LZGA 1RXWA 5BPCA 1JX4A 1JROA 4KLOA 2A3VA 9ICPA 3KFUF 2A19A 3KKAA 4XA5A 4YQWA 4EZ9A 3S6JA 2WB1C 3WK4A 2DPIA 1NKCA 4U7CA 3PW5A 4IQVA 7ICTA 4OJLA 2P66A 9ICLA 5AKZA 1U4BA 3QZ8A 1SKRA 3L5KA 4PL1A 5KAFU 2BCVA 3TARA 3E0FA 1ZQEA 3AN1A 4KLHA 2AXTU 2P35A 3RAXA 1WYGA 4UASA 3LWLA 7ICOA 3KZXA 4I2AA 4FS1A 3C21A 2W43A 3A0BU 2C2EA 4F4WA 5EWEA 4I2IA 5KTQA 4LJXA 4RUAA 5F3XB 2RLTA 4ECTA 4Q43A 4RNMA 3UXOA 1X9WA 3V6HA 3B0XA 3QUQA 4JV2A 3UMCA 3PMLA 1XU4A 5C0YA 5HP4A 4NLBA 3KZIU 1PVPA 1L5UA 5L1LA 4KMUA 2XCAA 1V85A 3TQ1A 2PI5A 4RNNA 3HP6A 4DCCA 5ALLA 2NO5A 5KFAA 2KHVA 2K89A 4CF4A 1U49A 5AKIA 2K4HA 2ASLA 4ED6A 4AYBF 2W9AA 3H4DA 1SZPA 2WFAA 3SV4A 3GIJA 5EE9A 5KFNA 1DK3A 2BCUA 3BJYA 2JGAA 1V9PA 2F8LA 1J2MA 3PSFA 3PX6A 9ICHA 4PZOA 9ICSA 4KMOB 2G5HB 1OXJA 4YFKA 1UHUA 2GLEA 9ICUA 4TUPA 5AK3A 3PO4A 2YTUA 4F5QA 4IR9A 1IIPA 4O5EA 5CA7A 3GDXA 3J81j 2R8JA 1X42A 2ZXIA 1FO4A 2FPKA 1L8OA 2Y0SF 4GC7A 2UVUA 3NVYA 4RQ0A 1XC9A 2BZFA 4ACOA 9ICVA 4DOAA 2HHSA 3QEBZ 4HAIA 2CN1A 1Q46A 3PSTA 1N60A 4F91B 4NM1A 5ALDA 4MEYA 4Y2JA 5J2EA 2R8GA 4BXOA 1LVHA 1A6SA 1N56A 3KHHA 7ICKA 3PW7A 1B0XA 2ESEA 3ISCA 9ICOA 3WK9A 5DB6A 2DPJA 4CGZA 3D2SA 2NRXA 1K1QA 4DWIA 1ZD4A 1ZQRA 3TANA 1UT8A 4I28A 5ALYA 1J97A 8ICLA 4J9QA 5AI6A 1X9XA 1KFTA 2ALZA 5KFMA 2P6RA 3SZ2A 3ZDCA 4QZFA 3RJEA 1JI7A 4BXOB 3I1YA 8ICPA 5EWGA 4UB8U 3ICXA 4UB1A 4M04A 2C28A 5KFXA 3WK6A 2E8NA 2EH9A 4USAA 5CEHA 2I9GA 3UQ0A 1JIHA 2ISOA 4AP9A 2HBKA 2GO7A 4PGYA 1ZQKA 1GO3F 5ALGA 3BZCA 4F5NA 2OCEA 4GXJA 3Q8LA 8ICJA 2BPFA 8ICCA 1ZQQA 2L5YA 1SWVA 1X40A 5DBBA 5AKGA 2G0AA 2V4QA 1Z1VA 5KG2A 9ICBA 2JRZA 3EW9A 2XVTA 1LB2B 5J0TA 4RQ6A 2W9CA 4NLCA 2K4EA 1NK6A 4PH5A 4IRKA 1ZQIA 4IQTA 1SKSA 1QSYA 4IC9A 5KFHA 1NKEA 2BHNA 4DL6A 4TUQA 5ALNA 4C4RA 2JEIA 1A0PA 4QZIA 4NY8A 4KLUA 3TAPA 2KSOA 4GLXA 4GFJA 1URJA 1N63A 4JUZA 3KHGA 2I1QA 2K60A 5DQGA 2RDIA 3KOOA 4DFKA 2KICA 2MUTA 1MSWD 5JUMA 4QJFB 3AQEA 4I2CA 4HYKA 4B9SA 3PNCA 1WWUA 1Z4NA 3FM9A 3NGDA 4DFMA 5BOLA 2AH5A 4NJ8A 2W9CB 5J2FA 2W9BB 3HRDD 3RB3A 3OJUA 9ICJA 2PFNA 1H38A 2JZBA 1B22A 4ED7A 4KLLA 5L9XA 4KLDA 2ATLA 3GFKB 3PZPA 1ZYQA 2XO7A 2PFPA 3B9JA 4EENA 3RJIA 1S0VA 2DL0A 3BQ2A 2KSOB 4O3OA 4DEZA 2R8HA 9ICMA 3ZDAA 1L3UA 3N28A 2DKZA 4O3RA 4QIWF 7ICEA 3LVWA 5J0QA 3H7IA 2KIWA 3M8RA 2FJ6A 5HR6A 2WHEA 2B21A 3RTVA 2ZTDA 2K4PA 1XWLA 3K1ZA 5J2BA 2RRDA 3Q8KA 1SXDA 4QZAA 2C2RA 3HKZF 1S0OA 3IM1A 2PFOA 1ZQZA 1L7MA 1KBUA 1RQNA 5IIMA 2EANA 1NK0A 4BWJA 2EZXA 1JXEA 5AK6A 5J0WA 1F0MA 4M9GA 3WKCA 3SEIA 4OCZA 4PHAA 1QLNA 4MFCA 1ZQFA 2UVVA 2LYHA 4A8EA 2BDPA 3LWMA 3RFAA 3RB6A 2VANA 4Y2TA 3JPRA 4DL3A 4UBCA 4RPXA 4RNOA 2HVIA 2QKQA 3QXGA 5DQIA 1ZQBA 2LM4A 4KTQA 4F8RA 3MDAA 1HIWA 4QZ9A 3IP4B 2YMMA 1L7PA 2YB1A 4KLJA 3UQ2A 4Z6FA 3JPOA 4CDGA 5AM5A 3QX7A 1ZRNA 2LYAA 2AGQA 5J2GA 3SMVA 3T5JA 3ZD9A 1L3SA 4F5RA 2YB4A 3HT3A 2RQ5A 2Y9TA 4Y2UA 3HILA 3DV9A 4UAVA 4Y2YA 2XY5A 1BPBA 1QH9A 5K4LA 1AQ6A 5D4BA 3HWTA 1L6NA 3KHLA 1SV0A 8ICRA 4QZ8A 5KT4A 2EZZA 3ZD8A 3WKEA 1HEKA 3AEVA 9ICFA 5B66U 4RQ4A 4YMNA 2K8CB 2XGPA 3JPNA 4DQIA 4PPXA 5KNIA 1N5XA 4UAWA 2HCFA 2KV2A 1RG6A 1NI3A 3QU2A 3TADA 1S8OA 1C20A 4Y2PA 4IQUA 2D8CA 5AKYA 3OSNA 3PW2A 3O0FA 4PL2A 3H8WA 1ZQSA 3V7LA 4QWDA 4F92B 2KG5A 5ALXA 3T5HA 1JUDA 5J0PA 2LMRA 2IMWP 4XQ8A 1C7YA 2ZIXB 3EUB2 3C28A 5IIJA 4US9A 1KTQA 8ICQA 4YN4A 2KTQA 1ZQUA 2VJ5A 4Y2QA 8ICMA 2FLNA 3WKDA 4BGDA 1ZOLA 4BWMA 3AMZA 3G6VA 1NJXA 5ALIA 2JEFA 4UAUA 1L7OA 1UPHA 2PI4A 1V97A 4FZLA 3FAHA 3BQ1A 1X6JA 4JK1A 4KLQA 3MC1A 3RAQA 5ALHA 5J2JA 3MR5A 4ECXA 2ZJ5A 5L1MA 4NL9A 3TACB 3BS7A 2XY6A 4KLTA 2NRVA 4FZMA 4MF2A 1SKWA 1RYRA 1KN5A 2D3DA 2JHDA 4MF8A 1SXEA 2Y1IA 2NV3A 4MHVA 4DQPA 4UBBA 2WTFA 5HHIA 2HMXA 2OXOA 2K4IA 4E0DA 1TFRA 3RH6A 1TAMA 4F50A 9ICTA 2LHTA 3QU7A 3M6KA 3RR7A 4J03A 1WG8A 3FYHA 4UAYA 3PVXA 7ICUA 3ZDEA 4EYHB 5DLGA 2AU0A 1S0NA 4GXIA 3OHAA 4J9OA 1D9FA 1TK8A 4KLEA 3BQTA 1KEJA 4M47A 1O08A 4F5PA 2KVCA 2VA3A 3NUQA 5KG7A 4PHPA 5F9LA 2B6GA 1ZQNA 4QW8A 2PKEA 1QQ5A 4EEKA 3CW2C 3F5AA 2GH1A 2VA2A 9ICEA 1KL9A 2AGOA 4EX6A 1ZQVA 5KG6A 3GV7B 5DKWA 1NJWA 1PK1A 1FFVA 5L1KA 2ZUCA 2MA1A 4TQSA 2EAPA 1MQ2A 5AM3A 3AQFA 4J9SA 4DLEA 1T7PA 9ICQA 4FZNA 2BCRA 1XNSA 3SAFA 4RQ5A 3DDHA 3L4PA 1Q3UA 2H3QA 1T3QA 3UPQA 1KFDA 2FPMA 3V72A 2ZIVA 4EBDA 1KQQA 3SAHA 1ZQWA 3UXNA 2F76X 5KFWA 3D2QA 3SI8A 4NLZA 1CI4A 4Y2XA 3MABA 4JV1A 2PFQA 2WAQF 5AKEA 2H3FA 3CRXA 2HBLA 2RP5A 4F4YA 4ECRA 1PK1B 4C4TA 3PR5B 4DSIA 3D2NA 4EBCA 5KFIA 2KD1A 3T79A 1XSPA 4F4ZA 2ZIWB 4QZHA 1ZQPA 5JRTA 3BZKA 3OPXA 3H0LB 3GU3A 4NLKA 3TKAA 2ZTEA 8ICNA 1X9MA 1YZ7A 1IXRA 4ECSA 3B0YA 2F1JA 5DDMA 1IV8A 5KFFA 1DGSA 1PK3A 2G5IB 2KIVA 2ZIVB 3SENA 2H3VA 3F2CA 8ICWA 5J2KA 1NZPA 3V7JA 2HDOA 3QU4A 2ASDA 5KG0A 2ZIUA 3C1ZA 4OJ5A 2BQRA 1VLBA 2OH2A 1ED1A 3IG5A 2ZG6A 5E79U 4ECQA 3ETRA 1KDHA 2KE7A 1PVRA 5D46A 1S76D 5B5EU 3NTUA 2E3TA 3RBEA 7ICVA 5KFEA 5DG7A 1NK8A 1U9LA 4B9MA 2PXIA 2W3RA 3K75D 1Z19A 5HR7A 3H40A 5T14A 5KFKA 5TISU 2KMDA 1RQLA 4UB4A 4QWEA 4KX5A 3GILA 4IS7A 5G5GA 4NWIA 3H4BA 4DF8A 3SR6A 4P0PB 4Q45A 3G6XA 1WCLA 4AYBC 3ISBA 2JR5A 2NYVA 3QEAZ 2EQYA 1L3VA 4UARA 2AGPA 2EAOA 3PY8A 1TAUA 3NRWA 2ZIUB 4ICAA 4O3NA 3IDWA 2QB1A 1NOMA 1XO1A 3SAGA 3V6JA 1IM4A 1BPDA 5KFCA 2NO4A 2W7PA 2XICA 4IRDA 4FBTA 4NV0A 3Q8QB 4I27A 2ZUBA 5DG8A 4F4KA 5KL1B 5EE1A 4O9MA 1KRPA 2ZTCA 2BGWA 5AKKA 5A0LA 2KK0A 3CYMA 4K4HA 5J2IA 3C23A 1P7DA 2Y0SC 4I29A 4KLIA 4I2FA 2QB0B 2UVWA 4DL2A 4G9BA 3SQIA 3NVZA 3V6KA 2W9BA 3RRHA 4TUSA 2ASJA 2DWQA 4P2HA 2W03A 4B6JA 2IA6A 2R8IA 2OHFA 4QWAA 4YR0A 4Y2VA 5AI0A 1ZQHA 4UB6U 5J0RA 2J6SA 4J9PA 5ALSA 1SGGA 3Q8RB 4DO9A 2YX8A 1MN8A 3OHBA 2HVHA 3IRUA 2OM6A 7ICIA 3PR4A 1L7NA 3MGHA 4EZ6A 4OO1J 7ICSA 4RQMA 5AKXA 9ICNA 4PHEA 4B9VA 4US8A 1ZXIA 1A77A 3PSPA 2OEHA 4QZCA 4I2BA 3EWAA 1WUDA 2ES6A 3GV8B 4O5KA 8ICUA 1Y88A 3H8SA 2BQUA 4JWNA 1U48A 4QZDA 3TFRA 3V7KA 1JN3A 3UM9A 4CRXA 4B9NA 4RZRA 2XY7A 4RQ7A 5KG3A 4JMUA 4PGQA 1ZQMA 5JTIA 3IHQB 3M1YA 3RJFA 2VJ4A 5KFTA 4UB2A 4YG2A 3MR2A 2ZJ8A 5C5JA 5CHGA 1IG6A 4ZH4A 2MRLA 2F2AB 2AQ0A 3H8JA 5ALUA 4RQNA 4I2GA 2KKPA 1SV4A 5KT3A 4ECYA 2QARB 4U6PA 4DS5A 4ELTA 8ICKA 3M9MB 3UMBA 4NM2A 2F1HA 2FLLA 2KHQA 2V4RA 4ECVA 1X9SA 4Q44A 3MBYA 5DB8A 4YP3A 7ICHA 3AUOA 8ICTA 1Z1BA 3ZDDA 3UMGA 2XIDA 4DSJA 1FFUA 1SL2A 3IG8A 4ED0A 7ICQA 5CP2A 1ZRMA 2EDUA 1HUOA 4DOCA 4CNQA 4QW9A 5IINA 5KFLA 1LKYB 1Z4OA 1N48A 9ICCA 8ICFA 3BS5A 2LBOA 2A1AA 4G3IA 5KT7A 2KJ8A 4RT3A 3FC4A 2YN4A 1QQ7A 3DEEA 5FP0A 3ORYA 2FPLA 3GZFA 2YQEA 2ZJAA 5J0SA 3LK9A 7ICLA 2Z7JA 4KN7A 3RJKA 5L1JA 3GIKA 1Q8KA 4ED1A 4EYIB 1UT5A 4RT2A 3JPQA 3AM9A 2WF7A 1PZNA 5J8YC 4M9NA 2LYBA 3BS5B 3KBBA 8ICSA 2VKQA 2Y9UA 7ICMA 2FDRA 1RYUA 3Q8MA 1SL1A 1ZJMA 2ZIXA 2HOQA 4Z6CA 2DQNB 3QUBA 1TVAA 1U45A 5HMLA 2E8PA 4QIWC 5J2DA 1NNLA 4RQ1A 1OW5A 4O3QA 3ISDA 1NKBA 3QUTA 1TK5A 5JU5A 1NZBA 3PX4A 3JPPA 5J0UA 5L1IA 5IIIA 2JV3A 2W9MA 4IR1A 4QWCA 1ZQ1C 1VDVA 4YD1A 3HKZC 4YR2A 1Q3VA 5DG9A 9ICRA 3QU9A 2WB1F 4F93B 3VCBA 3WK7A 3RR8A 3MR3A 5KAIU 4DQRA 9ICAA 1XO0A 3QYPA 2WF6A 1ZQAA 4XRHA 5KFRA 4ED3A 2W3SA 5KT2A 5ALJA 4KLFA 1OUQA 5GTHU 4DFPA 4BX9C 4JB3A 1XSLA 4YVZA 5D49A 3KKAC 4DQQA 2UVRA 3C5FA 4UW9A 2Y1JA 4P0QB 1F5SA 3MFHA 4GXKA 3C2KA 2M0NA 3RJHA 5KFOA 4KLMA 2JH1A 1TKDA 5KFQA 1U47A 1TV9A 5HMMA 3MGIA 2HHXA 4TURA 3C29A 4P4PA 8ICGA 3BQ7A 4R8UA 3T5KA 4B9LA 1T94A 5KFDA 4J9LA 1UA0A 2HW3A 3MGVA 4ECWA 4NLNA 1ZQTA 3A0HU 3F2BA 5ALZA 4DSKA 2F8KA 3H8MA 3I28A 5AI4A 2BPCA 3OSPA 1QSSA 5AM2A 5ALQA 5GTIU 3N4MB 2CPRA 4GC6A 5KFBA 5DQHA 2E1EA 2CRXA 4EBEA 2J6UA 1S97A 4UQGA 2RDJA 2JEJA 4C80A 4RPZA 5DLFA 4X5VA 4M9HA 2OYYA 2F77X 3M7DA 2QLTA 5EE0A 5KFZA 3T5LA 4R8UB 3CP8A 4KLSA 4NXZA 5AHXA 2W8KA 3LYSA 4FS2A 2KP7A 3BQ0A 4EX7A 4F72A 4RQ3A 1TK0A 4M9LA 2XC9A 3C5GA 1RYSA 3ETLA 2KFZA 2E8OA 4Z6EA 3RJJA 1Z00A 1RZTA 1JMSA 1T3NA 4M2YA 2HI0A 4RPYA 5ALOA 3TAQA 4DL7A 3U26A 2O6KA 4UAZA 4CCHA 9ICXA 5KT6A 1BPZA 5AM4A 1NK5A 3GV5B 7ICPA 2R18A 1ZQLA 4DS4A 1ZQXA 2KEYA 3HJEA 2FMPA 4PJ0U 5AKHA 3WK8A 5AI8A 1BNPA 2ZIWA 1XS9D 3PSIA 4KLGA 4QZEA 1KSPA 2PMZC 2W54A 2WF5A 2HBMA 8ICZA 1MA7A 5CJ7A 4OD0A 2N1RA 1ECWA 1LV5A 8ICYA 1A76A 1DGJA 2I5HA 5KFYA 3IN5A 4Q8FA 4M6WA 1Z3EB 2BDUA 2H3ZA 1Z00B 2AQ4A 3RB0A 2YMQA 5H2FU 1PUZA 1V38A 7ICFA 2KOBA 1D8BA 4Q8EA 4DLGA 2YMPA 4FE3A 3PO5A 3SYZA 8ICEA 1TAQA 2IOFA 1D8LA 2W11A 1D8YA 2IOFK 5HHHA 5ALKA 1FIQA 4C8OA 3QNMA 3LDAA 5KT5A 3SV3A 3KTQA 4QZBA 1L3TA 2HHVA 4JV0A 3OJSA 3VC8A 1RDFA 5DBAA 4M9JA 3PX0A 2LKYA 8ICHA 4RUCA 2BR0A 2GOLA 4M6WB 3EZ5A 3SD7A 4P0PA 3PW4A 2ZXHA 5BOMA 3WK5A 1S9FA 4C8KA 4WJ3B 2AJQA 3THVA 1WWVA 4O0IA 1L8LA 9ICIA 4F71A 1AROP 1RPLA 5DBCA 5KG4A 2G08A 2KN7A 1FEZA 2ZUDA 1ZETA 4B9TA 9ICGA 2BQ3A 3FDSA 3EYZA 3C2LA 1SWWA 4I2HA 1NK4A 2JEGA 2FLPA 4UATA 3AL0B 4DSLA 4DL5A 4M0AA 3N7SC 4XUSA 5J0YA 2DBYA 1X6IA 5J2AA 3K4GA 4ED8A 2KFNA 1DXSA 3G6YA 5CWRA 2EAMA 3ONNA 3QE9Y 3EPIA 4YMMA 4DSFA 2JXJA 4QNLA 2DUYA 3NRZA 2K8AA 2CXYA 2JMGA 2QB0A 2IHMA 4MFAA 2MU2A 1N5WA 2MSNA 1COKA 1BPXA 1N2XA 5KFUA 2KNJA 2LPEA 3RBDA 1RM6C 1F44A 4BJQA 4DF4A 2XI9A 5AKJA 5DDYA 4MFFA 1ZD2P 1N62A 2NRZA 3H0RB 5ALWA 2WAQC 5DGAA 1PVQA 4I2JA 4JWMA 2YMLA 5ALEA 9ICKA 4GIBA 4I2DA 1COOA 4Y2RA 5KFVA 2I6XA 3IV6A 5DGBA 1ZQDA 3WU2U 4OJ6A 3PW0A 3RF9A 5CR0A 2K8BB 3TI0A 1SL0A 3F5EA 2B0CA 2G09A 4CE6A 4J9KA 8ICIA 3C1YA 2JH7A 2DKXA 4FFDA 4P4OA 1T4GA 2MAXA 5AIAA 1KFSA 2HOFA 3RJGA 1SB3C 1BGXT 4OJPA 8ICOA 3E2EA 3E58A 1MQ3A 1KLNA 9ICWA 3TFSA 2IHNA 1WCNA 1YT3A 3NVWA 4LZDA 2F3NA 4Y2SA 1ZQJA 5DB9A 2BKEA 2H5XA 2KKVA 3M9OB 5ALMA 2VA8A 1CEZA 5G5HA 5AIBA 3KHRA 3MDCA 3OGUA 3GIIA 4R64A 1N61A 3HX0A 4DQSA 2R8KA 4DOBA 2WF9A 5J2HA 1VJ5A 5IILA 4TQRA 1KW4A 4IL6U 5KL8B 1EXNA 1ZD3A 2QARA 2DGZA 2F1IA 3CNHA 2Q0ZX 5AI5A 4C8NA 2WF8A 1S5LU 2W7OA 3PV8A 4NLGA 4EELA 4YCXA 1ZQGA 2W04A 5IIOA 2DFLA 2VIXA 1XSNA 1UQVA 4F3OA 3WKBA 4IRCA 5EOZA 5AKLA 3JPTA 5J29A 3K1RB 4DSEA 1LKYA 1CUKA 8ICAA 2KZ3A 5KFPA 2E5SA 1DOQA 3HW8A 2LI6A 4QWBA 1BNOA 1TE2A 2H3IA 4PZNA 3ED5A 3H0MB 4B9UA 2MUTB 3BDPA 1S77D 1RXVA 2BCQA 1ZQCA 5J0XA 5KFGA 2HBJA 2HHTA 8ICXA 4C0ZA 5ALVA 4ECUA 8ICVA 4F2SA 5EWFA 3ZDBA 5CB1A 5KG5A 1JXLA 2JZBB 1YZ6A 2V9WA 4YR3A 3F2DA 5IIKA 3T3FA 5TZVA 5KG1A 1J2NA 1S10A 7ICJA 3LVVA 3AU6A 2OWOA 1CRXA 3L3FX 3PMNA 3M8SA 3Q8SB 1SV0C
chains in the Genus database with same CATH topology
4MHVA 2QB1A 5J8YA 1Z1VA 2E8MA 2K4PA 5KNIA 1SXDA 3BQ7A 5J8YC 1RG6A 1KW4A 3TADA 5JTIA 3BS5B 1PK1B 2Y9UA 2QARA 2QB0A 2D8CA 2EANA 3TADC 2F8KA 3H8MA 2E8PA 1COKA 1F0MA 1V38A 5JRTA 2LPEA 5F3XB 3SEIA 1OW5A 4RQNA 1B0XA 2ESEA 5JU5A 2KG5A 1SV4A 2QARB 2QB0B 2LMRA 1PK3A 2KSOA 2FE9A 2KIVA 1UQVA 2JV3A 3SENA 1X66A 2K60A 3K1RB 1V85A 1LKYA 2QKQA 2B6GA 1WWUA 4NJ8A 4PZNA 1X9XA 2KE7A 1B4FA 2F44A 1JI7A 1SGGA 1LKYB 3BS5A 1PK1A 1UCVA 1WWVA 2E8OA 2DKXA 2EAPA 4PZOA 2KMDA 1OXJA 3KKAA 2E8NA 4IS7A 2GLEA 2Y9TA 2DL0A 2F3NA 4RQMA 2KSOB 3HILA 3KKAC 4NL9A 5L1MA 3TACB 2DKZA 3BS7A 2YTUA 4NL9C 1SV0A 2ES6A 1DXSA 2EAOA 2D3DA 2L5YA 2EAMA 1X40A 3IDWA 1SXEA 1SV0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHV A;  2QB1 A;  5J8Y A;  1Z1V A;  2E8M A;  2K4P A;  5KNI A;  1SXD A;  3BQ7 A;  5J8Y C;  1RG6 A;  1KW4 A;  3TAD A;  5JTI A;  3BS5 B;  1PK1 B;  2Y9U A;  2QAR A;  2QB0 A;  2D8C A;  2EAN A;  3TAD C;  2F8K A;  3H8M A;  2E8P A;  1COK A;  1F0M A;  1V38 A;  5JRT A;  2LPE A;  5F3X B;  3SEI A;  1OW5 A;  4RQN A;  1B0X A;  2ESE A;  5JU5 A;  2KG5 A;  1SV4 A;  2QAR B;  2QB0 B;  2LMR A;  1PK3 A;  2KSO A;  2FE9 A;  2KIV A;  1UQV A;  2JV3 A;  3SEN A;  1X66 A;  2K60 A;  3K1R B;  1V85 A;  1LKY A;  2QKQ A;  2B6G A;  1WWU A;  4NJ8 A;  4PZN A;  1X9X A;  2KE7 A;  1B4F A;  2F44 A;  1JI7 A;  1SGG A;  1LKY B;  3BS5 A;  1PK1 A;  1UCV A;  1WWV A;  2E8O A;  2DKX A;  2EAP A;  4PZO A;  2KMD A;  1OXJ A;  3KKA A;  2E8N A;  4IS7 A;  2GLE A;  2Y9T A;  2DL0 A;  2F3N A;  4RQM A;  2KSO B;  3HIL A;  3KKA C;  4NL9 A;  5L1M A;  3TAC B;  2DKZ A;  3BS7 A;  2YTU A;  4NL9 C;  1SV0 A;  2ES6 A;  1DXS A;  2EAO A;  2D3D A;  2L5Y A;  2EAM A;  1X40 A;  3IDW A;  1SXE A;  1SV0 C; 
#chains in the Genus database with same CATH topology
 3GIM A;  1NK7 A;  3MFI A;  4RQ8 A;  3ALR A;  2EZY A;  2G07 A;  1UA1 A;  2KZZ A;  3QU5 A;  3M6Z A;  1X2I A;  1SIJ A;  2DF4 B;  2GWS A;  2W55 A;  7ICG A;  3NAS A;  1K5O A;  2LM1 A;  3QZ7 A;  2HHQ A;  5AM0 A;  4IQW A;  2G06 A;  3TAD C;  3M9N B;  4Z6D A;  2YY6 A;  4I2E A;  4YD2 A;  5ALR A;  4DFD A;  2XCP A;  1ZJN A;  1T8E A;  1NJZ A;  2BCS A;  4F4X A;  1D9D A;  4K4G A;  5AK4 A;  4F2R A;  1DRG A;  4K4I A;  3GQC A;  4KIT B;  3RB4 A;  4CF5 A;  2FMS A;  5J2C A;  4J9M A;  5KFS A;  4YXM A;  4CF3 A;  5ALP A;  2E1F A;  5AIC A;  4UB5 A;  5KFJ A;  4PGX A;  3UXP A;  3NVV A;  1JRP A;  4RU9 A;  4UB3 A;  4MEX A;  4F5O A;  4C8M A;  5HNK A;  2AHO B;  5ALT A;  4R66 A;  2KVS A;  2RHF A;  2C22 A;  2F44 A;  2ISP A;  3OTQ A;  5F9N A;  4C7Y A;  1KKX A;  4BDP A;  2Q4T A;  4J9N A;  1O03 A;  1UCV A;  2W8L A;  2HHU A;  4P0Q A;  4ELV A;  1DK2 A;  2NRT A;  2P6U A;  1QSL A;  2HHW A;  4OJO A;  3WKA A;  3I76 A;  2C2D A;  2KJ9 A;  4ELU A;  1JAL A;  4YMO A;  4C4S A;  4EEY A;  1QTM A;  2HSZ A;  1ZQO A;  2HOI A;  3AU2 A;  5DB7 A;  1BPY A;  4NL9 C;  3JPS A;  3N7R C;  2A1J A;  3F53 A;  1QQ6 A;  3N97 B;  4P4M A;  1BVS A;  4DFJ A;  1NJY A;  2FI1 A;  7ICR A;  3Q8P B;  2FMQ A;  3NS1 A;  1BPE A;  5AK5 A;  3KD3 A;  5J8Y A;  2E8M A;  4O3M A;  5CRX A;  2KZM A;  4RQ2 A;  3MR6 A;  4KN4 A;  4KX3 A;  2KJ5 A;  4LVS A;  3QUC A;  3ZI4 A;  1QCK A;  4BUG A;  1ZQY A;  7ICN A;  4ED2 A;  2IOH A;  4R65 A;  3RH4 A;  1HJP A;  4PHD A;  4O3P A;  2NRW A;  2XGQ A;  4DL4 A;  2IBK A;  4ECZ A;  1K1S A;  2D6F C;  2FE9 A;  1B43 A;  3D6J A;  2A1J B;  1M6Y A;  1X66 A;  1NK9 A;  4C8L A;  4J9R A;  4QZG A;  2J6T A;  5ALF A;  2PMZ F;  5AM1 A;  5J0O A;  1S0M A;  3HPO A;  3R9K A;  1SZH A;  3RH5 A;  4O3S A;  1HUZ A;  2M9N A;  3RRG A;  5EE3 A;  4C7Z A;  4FO6 A;  2BPG A;  5AI9 A;  1ZD5 A;  8ICB A;  1B4F A;  3EPG A;  4FBU A;  4O5C A;  3C2M A;  2ODG A;  4YXJ A;  4R63 A;  4ZOH C;  1MC8 A;  3N7P D;  4LZG A;  1RXW A;  5BPC A;  1JX4 A;  1JRO A;  4KLO A;  2A3V A;  9ICP A;  3KFU F;  2A19 A;  3KKA A;  4XA5 A;  4YQW A;  4EZ9 A;  3S6J A;  2WB1 C;  3WK4 A;  2DPI A;  1NKC A;  4U7C A;  3PW5 A;  4IQV A;  7ICT A;  4OJL A;  2P66 A;  9ICL A;  5AKZ A;  1U4B A;  3QZ8 A;  1SKR A;  3L5K A;  4PL1 A;  5KAF U;  2BCV A;  3TAR A;  3E0F A;  1ZQE A;  3AN1 A;  4KLH A;  2AXT U;  2P35 A;  3RAX A;  1WYG A;  4UAS A;  3LWL A;  7ICO A;  3KZX A;  4I2A A;  4FS1 A;  3C21 A;  2W43 A;  3A0B U;  2C2E A;  4F4W A;  5EWE A;  4I2I A;  5KTQ A;  4LJX A;  4RUA A;  5F3X B;  2RLT A;  4ECT A;  4Q43 A;  4RNM A;  3UXO A;  1X9W A;  3V6H A;  3B0X A;  3QUQ A;  4JV2 A;  3UMC A;  3PML A;  1XU4 A;  5C0Y A;  5HP4 A;  4NLB A;  3KZI U;  1PVP A;  1L5U A;  5L1L A;  4KMU A;  2XCA A;  1V85 A;  3TQ1 A;  2PI5 A;  4RNN A;  3HP6 A;  4DCC A;  5ALL A;  2NO5 A;  5KFA A;  2KHV A;  2K89 A;  4CF4 A;  1U49 A;  5AKI A;  2K4H A;  2ASL A;  4ED6 A;  4AYB F;  2W9A A;  3H4D A;  1SZP A;  2WFA A;  3SV4 A;  3GIJ A;  5EE9 A;  5KFN A;  1DK3 A;  2BCU A;  3BJY A;  2JGA A;  1V9P A;  2F8L A;  1J2M A;  3PSF A;  3PX6 A;  9ICH A;  4PZO A;  9ICS A;  4KMO B;  2G5H B;  1OXJ A;  4YFK A;  1UHU A;  2GLE A;  9ICU A;  4TUP A;  5AK3 A;  3PO4 A;  2YTU A;  4F5Q A;  4IR9 A;  1IIP A;  4O5E A;  5CA7 A;  3GDX A;  3J81 j;  2R8J A;  1X42 A;  2ZXI A;  1FO4 A;  2FPK A;  1L8O A;  2Y0S F;  4GC7 A;  2UVU A;  3NVY A;  4RQ0 A;  1XC9 A;  2BZF A;  4ACO A;  9ICV A;  4DOA A;  2HHS A;  3QEB Z;  4HAI A;  2CN1 A;  1Q46 A;  3PST A;  1N60 A;  4F91 B;  4NM1 A;  5ALD A;  4MEY A;  4Y2J A;  5J2E A;  2R8G A;  4BXO A;  1LVH A;  1A6S A;  1N56 A;  3KHH A;  7ICK A;  3PW7 A;  1B0X A;  2ESE A;  3ISC A;  9ICO A;  3WK9 A;  5DB6 A;  2DPJ A;  4CGZ A;  3D2S A;  2NRX A;  1K1Q A;  4DWI A;  1ZD4 A;  1ZQR A;  3TAN A;  1UT8 A;  4I28 A;  5ALY A;  1J97 A;  8ICL A;  4J9Q A;  5AI6 A;  1X9X A;  1KFT A;  2ALZ A;  5KFM A;  2P6R A;  3SZ2 A;  3ZDC A;  4QZF A;  3RJE A;  1JI7 A;  4BXO B;  3I1Y A;  8ICP A;  5EWG A;  4UB8 U;  3ICX A;  4UB1 A;  4M04 A;  2C28 A;  5KFX A;  3WK6 A;  2E8N A;  2EH9 A;  4USA A;  5CEH A;  2I9G A;  3UQ0 A;  1JIH A;  2ISO A;  4AP9 A;  2HBK A;  2GO7 A;  4PGY A;  1ZQK A;  1GO3 F;  5ALG A;  3BZC A;  4F5N A;  2OCE A;  4GXJ A;  3Q8L A;  8ICJ A;  2BPF A;  8ICC A;  1ZQQ A;  2L5Y A;  1SWV A;  1X40 A;  5DBB A;  5AKG A;  2G0A A;  2V4Q A;  1Z1V A;  5KG2 A;  9ICB A;  2JRZ A;  3EW9 A;  2XVT A;  1LB2 B;  5J0T A;  4RQ6 A;  2W9C A;  4NLC A;  2K4E A;  1NK6 A;  4PH5 A;  4IRK A;  1ZQI A;  4IQT A;  1SKS A;  1QSY A;  4IC9 A;  5KFH A;  1NKE A;  2BHN A;  4DL6 A;  4TUQ A;  5ALN A;  4C4R A;  2JEI A;  1A0P A;  4QZI A;  4NY8 A;  4KLU A;  3TAP A;  2KSO A;  4GLX A;  4GFJ A;  1URJ A;  1N63 A;  4JUZ A;  3KHG A;  2I1Q A;  2K60 A;  5DQG A;  2RDI A;  3KOO A;  4DFK A;  2KIC A;  2MUT A;  1MSW D;  5JUM A;  4QJF B;  3AQE A;  4I2C A;  4HYK A;  4B9S A;  3PNC A;  1WWU A;  1Z4N A;  3FM9 A;  3NGD A;  4DFM A;  5BOL A;  2AH5 A;  4NJ8 A;  2W9C B;  5J2F A;  2W9B B;  3HRD D;  3RB3 A;  3OJU A;  9ICJ A;  2PFN A;  1H38 A;  2JZB A;  1B22 A;  4ED7 A;  4KLL A;  5L9X A;  4KLD A;  2ATL A;  3GFK B;  3PZP A;  1ZYQ A;  2XO7 A;  2PFP A;  3B9J A;  4EEN A;  3RJI A;  1S0V A;  2DL0 A;  3BQ2 A;  2KSO B;  4O3O A;  4DEZ A;  2R8H A;  9ICM A;  3ZDA A;  1L3U A;  3N28 A;  2DKZ A;  4O3R A;  4QIW F;  7ICE A;  3LVW A;  5J0Q A;  3H7I A;  2KIW A;  3M8R A;  2FJ6 A;  5HR6 A;  2WHE A;  2B21 A;  3RTV A;  2ZTD A;  2K4P A;  1XWL A;  3K1Z A;  5J2B A;  2RRD A;  3Q8K A;  1SXD A;  4QZA A;  2C2R A;  3HKZ F;  1S0O A;  3IM1 A;  2PFO A;  1ZQZ A;  1L7M A;  1KBU A;  1RQN A;  5IIM A;  2EAN A;  1NK0 A;  4BWJ A;  2EZX A;  1JXE A;  5AK6 A;  5J0W A;  1F0M A;  4M9G A;  3WKC A;  3SEI A;  4OCZ A;  4PHA A;  1QLN A;  4MFC A;  1ZQF A;  2UVV A;  2LYH A;  4A8E A;  2BDP A;  3LWM A;  3RFA A;  3RB6 A;  2VAN A;  4Y2T A;  3JPR A;  4DL3 A;  4UBC A;  4RPX A;  4RNO A;  2HVI A;  2QKQ A;  3QXG A;  5DQI A;  1ZQB A;  2LM4 A;  4KTQ A;  4F8R A;  3MDA A;  1HIW A;  4QZ9 A;  3IP4 B;  2YMM A;  1L7P A;  2YB1 A;  4KLJ A;  3UQ2 A;  4Z6F A;  3JPO A;  4CDG A;  5AM5 A;  3QX7 A;  1ZRN A;  2LYA A;  2AGQ A;  5J2G A;  3SMV A;  3T5J A;  3ZD9 A;  1L3S A;  4F5R A;  2YB4 A;  3HT3 A;  2RQ5 A;  2Y9T A;  4Y2U A;  3HIL A;  3DV9 A;  4UAV A;  4Y2Y A;  2XY5 A;  1BPB A;  1QH9 A;  5K4L A;  1AQ6 A;  5D4B A;  3HWT A;  1L6N A;  3KHL A;  1SV0 A;  8ICR A;  4QZ8 A;  5KT4 A;  2EZZ A;  3ZD8 A;  3WKE A;  1HEK A;  3AEV A;  9ICF A;  5B66 U;  4RQ4 A;  4YMN A;  2K8C B;  2XGP A;  3JPN A;  4DQI A;  4PPX A;  5KNI A;  1N5X A;  4UAW A;  2HCF A;  2KV2 A;  1RG6 A;  1NI3 A;  3QU2 A;  3TAD A;  1S8O A;  1C20 A;  4Y2P A;  4IQU A;  2D8C A;  5AKY A;  3OSN A;  3PW2 A;  3O0F A;  4PL2 A;  3H8W A;  1ZQS A;  3V7L A;  4QWD A;  4F92 B;  2KG5 A;  5ALX A;  3T5H A;  1JUD A;  5J0P A;  2LMR A;  2IMW P;  4XQ8 A;  1C7Y A;  2ZIX B;  3EUB 2;  3C28 A;  5IIJ A;  4US9 A;  1KTQ A;  8ICQ A;  4YN4 A;  2KTQ A;  1ZQU A;  2VJ5 A;  4Y2Q A;  8ICM A;  2FLN A;  3WKD A;  4BGD A;  1ZOL A;  4BWM A;  3AMZ A;  3G6V A;  1NJX A;  5ALI A;  2JEF A;  4UAU A;  1L7O A;  1UPH A;  2PI4 A;  1V97 A;  4FZL A;  3FAH A;  3BQ1 A;  1X6J A;  4JK1 A;  4KLQ A;  3MC1 A;  3RAQ A;  5ALH A;  5J2J A;  3MR5 A;  4ECX A;  2ZJ5 A;  5L1M A;  4NL9 A;  3TAC B;  3BS7 A;  2XY6 A;  4KLT A;  2NRV A;  4FZM A;  4MF2 A;  1SKW A;  1RYR A;  1KN5 A;  2D3D A;  2JHD A;  4MF8 A;  1SXE A;  2Y1I A;  2NV3 A;  4MHV A;  4DQP A;  4UBB A;  2WTF A;  5HHI A;  2HMX A;  2OXO A;  2K4I A;  4E0D A;  1TFR A;  3RH6 A;  1TAM A;  4F50 A;  9ICT A;  2LHT A;  3QU7 A;  3M6K A;  3RR7 A;  4J03 A;  1WG8 A;  3FYH A;  4UAY A;  3PVX A;  7ICU A;  3ZDE A;  4EYH B;  5DLG A;  2AU0 A;  1S0N A;  4GXI A;  3OHA A;  4J9O A;  1D9F A;  1TK8 A;  4KLE A;  3BQT A;  1KEJ A;  4M47 A;  1O08 A;  4F5P A;  2KVC A;  2VA3 A;  3NUQ A;  5KG7 A;  4PHP A;  5F9L A;  2B6G A;  1ZQN A;  4QW8 A;  2PKE A;  1QQ5 A;  4EEK A;  3CW2 C;  3F5A A;  2GH1 A;  2VA2 A;  9ICE A;  1KL9 A;  2AGO A;  4EX6 A;  1ZQV A;  5KG6 A;  3GV7 B;  5DKW A;  1NJW A;  1PK1 A;  1FFV A;  5L1K A;  2ZUC A;  2MA1 A;  4TQS A;  2EAP A;  1MQ2 A;  5AM3 A;  3AQF A;  4J9S A;  4DLE A;  1T7P A;  9ICQ A;  4FZN A;  2BCR A;  1XNS A;  3SAF A;  4RQ5 A;  3DDH A;  3L4P A;  1Q3U A;  2H3Q A;  1T3Q A;  3UPQ A;  1KFD A;  2FPM A;  3V72 A;  2ZIV A;  4EBD A;  1KQQ A;  3SAH A;  1ZQW A;  3UXN A;  2F76 X;  5KFW A;  3D2Q A;  3SI8 A;  4NLZ A;  1CI4 A;  4Y2X A;  3MAB A;  4JV1 A;  2PFQ A;  2WAQ F;  5AKE A;  2H3F A;  3CRX A;  2HBL A;  2RP5 A;  4F4Y A;  4ECR A;  1PK1 B;  4C4T A;  3PR5 B;  4DSI A;  3D2N A;  4EBC A;  5KFI A;  2KD1 A;  3T79 A;  1XSP A;  4F4Z A;  2ZIW B;  4QZH A;  1ZQP A;  5JRT A;  3BZK A;  3OPX A;  3H0L B;  3GU3 A;  4NLK A;  3TKA A;  2ZTE A;  8ICN A;  1X9M A;  1YZ7 A;  1IXR A;  4ECS A;  3B0Y A;  2F1J A;  5DDM A;  1IV8 A;  5KFF A;  1DGS A;  1PK3 A;  2G5I B;  2KIV A;  2ZIV B;  3SEN A;  2H3V A;  3F2C A;  8ICW A;  5J2K A;  1NZP A;  3V7J A;  2HDO A;  3QU4 A;  2ASD A;  5KG0 A;  2ZIU A;  3C1Z A;  4OJ5 A;  2BQR A;  1VLB A;  2OH2 A;  1ED1 A;  3IG5 A;  2ZG6 A;  5E79 U;  4ECQ A;  3ETR A;  1KDH A;  2KE7 A;  1PVR A;  5D46 A;  1S76 D;  5B5E U;  3NTU A;  2E3T A;  3RBE A;  7ICV A;  5KFE A;  5DG7 A;  1NK8 A;  1U9L A;  4B9M A;  2PXI A;  2W3R A;  3K75 D;  1Z19 A;  5HR7 A;  3H40 A;  5T14 A;  5KFK A;  5TIS U;  2KMD A;  1RQL A;  4UB4 A;  4QWE A;  4KX5 A;  3GIL A;  4IS7 A;  5G5G A;  4NWI A;  3H4B A;  4DF8 A;  3SR6 A;  4P0P B;  4Q45 A;  3G6X A;  1WCL A;  4AYB C;  3ISB A;  2JR5 A;  2NYV A;  3QEA Z;  2EQY A;  1L3V A;  4UAR A;  2AGP A;  2EAO A;  3PY8 A;  1TAU A;  3NRW A;  2ZIU B;  4ICA A;  4O3N A;  3IDW A;  2QB1 A;  1NOM A;  1XO1 A;  3SAG A;  3V6J A;  1IM4 A;  1BPD A;  5KFC A;  2NO4 A;  2W7P A;  2XIC A;  4IRD A;  4FBT A;  4NV0 A;  3Q8Q B;  4I27 A;  2ZUB A;  5DG8 A;  4F4K A;  5KL1 B;  5EE1 A;  4O9M A;  1KRP A;  2ZTC A;  2BGW A;  5AKK A;  5A0L A;  2KK0 A;  3CYM A;  4K4H A;  5J2I A;  3C23 A;  1P7D A;  2Y0S C;  4I29 A;  4KLI A;  4I2F A;  2QB0 B;  2UVW A;  4DL2 A;  4G9B A;  3SQI A;  3NVZ A;  3V6K A;  2W9B A;  3RRH A;  4TUS A;  2ASJ A;  2DWQ A;  4P2H A;  2W03 A;  4B6J A;  2IA6 A;  2R8I A;  2OHF A;  4QWA A;  4YR0 A;  4Y2V A;  5AI0 A;  1ZQH A;  4UB6 U;  5J0R A;  2J6S A;  4J9P A;  5ALS A;  1SGG A;  3Q8R B;  4DO9 A;  2YX8 A;  1MN8 A;  3OHB A;  2HVH A;  3IRU A;  2OM6 A;  7ICI A;  3PR4 A;  1L7N A;  3MGH A;  4EZ6 A;  4OO1 J;  7ICS A;  4RQM A;  5AKX A;  9ICN A;  4PHE A;  4B9V A;  4US8 A;  1ZXI A;  1A77 A;  3PSP A;  2OEH A;  4QZC A;  4I2B A;  3EWA A;  1WUD A;  2ES6 A;  3GV8 B;  4O5K A;  8ICU A;  1Y88 A;  3H8S A;  2BQU A;  4JWN A;  1U48 A;  4QZD A;  3TFR A;  3V7K A;  1JN3 A;  3UM9 A;  4CRX A;  4B9N A;  4RZR A;  2XY7 A;  4RQ7 A;  5KG3 A;  4JMU A;  4PGQ A;  1ZQM A;  5JTI A;  3IHQ B;  3M1Y A;  3RJF A;  2VJ4 A;  5KFT A;  4UB2 A;  4YG2 A;  3MR2 A;  2ZJ8 A;  5C5J A;  5CHG A;  1IG6 A;  4ZH4 A;  2MRL A;  2F2A B;  2AQ0 A;  3H8J A;  5ALU A;  4RQN A;  4I2G A;  2KKP A;  1SV4 A;  5KT3 A;  4ECY A;  2QAR B;  4U6P A;  4DS5 A;  4ELT A;  8ICK A;  3M9M B;  3UMB A;  4NM2 A;  2F1H A;  2FLL A;  2KHQ A;  2V4R A;  4ECV A;  1X9S A;  4Q44 A;  3MBY A;  5DB8 A;  4YP3 A;  7ICH A;  3AUO A;  8ICT A;  1Z1B A;  3ZDD A;  3UMG A;  2XID A;  4DSJ A;  1FFU A;  1SL2 A;  3IG8 A;  4ED0 A;  7ICQ A;  5CP2 A;  1ZRM A;  2EDU A;  1HUO A;  4DOC A;  4CNQ A;  4QW9 A;  5IIN A;  5KFL A;  1LKY B;  1Z4O A;  1N48 A;  9ICC A;  8ICF A;  3BS5 A;  2LBO A;  2A1A A;  4G3I A;  5KT7 A;  2KJ8 A;  4RT3 A;  3FC4 A;  2YN4 A;  1QQ7 A;  3DEE A;  5FP0 A;  3ORY A;  2FPL A;  3GZF A;  2YQE A;  2ZJA A;  5J0S A;  3LK9 A;  7ICL A;  2Z7J A;  4KN7 A;  3RJK A;  5L1J A;  3GIK A;  1Q8K A;  4ED1 A;  4EYI B;  1UT5 A;  4RT2 A;  3JPQ A;  3AM9 A;  2WF7 A;  1PZN A;  5J8Y C;  4M9N A;  2LYB A;  3BS5 B;  3KBB A;  8ICS A;  2VKQ A;  2Y9U A;  7ICM A;  2FDR A;  1RYU A;  3Q8M A;  1SL1 A;  1ZJM A;  2ZIX A;  2HOQ A;  4Z6C A;  2DQN B;  3QUB A;  1TVA A;  1U45 A;  5HML A;  2E8P A;  4QIW C;  5J2D A;  1NNL A;  4RQ1 A;  1OW5 A;  4O3Q A;  3ISD A;  1NKB A;  3QUT A;  1TK5 A;  5JU5 A;  1NZB A;  3PX4 A;  3JPP A;  5J0U A;  5L1I A;  5III A;  2JV3 A;  2W9M A;  4IR1 A;  4QWC A;  1ZQ1 C;  1VDV A;  4YD1 A;  3HKZ C;  4YR2 A;  1Q3V A;  5DG9 A;  9ICR A;  3QU9 A;  2WB1 F;  4F93 B;  3VCB A;  3WK7 A;  3RR8 A;  3MR3 A;  5KAI U;  4DQR A;  9ICA A;  1XO0 A;  3QYP A;  2WF6 A;  1ZQA A;  4XRH A;  5KFR A;  4ED3 A;  2W3S A;  5KT2 A;  5ALJ A;  4KLF A;  1OUQ A;  5GTH U;  4DFP A;  4BX9 C;  4JB3 A;  1XSL A;  4YVZ A;  5D49 A;  3KKA C;  4DQQ A;  2UVR A;  3C5F A;  4UW9 A;  2Y1J A;  4P0Q B;  1F5S A;  3MFH A;  4GXK A;  3C2K A;  2M0N A;  3RJH A;  5KFO A;  4KLM A;  2JH1 A;  1TKD A;  5KFQ A;  1U47 A;  1TV9 A;  5HMM A;  3MGI A;  2HHX A;  4TUR A;  3C29 A;  4P4P A;  8ICG A;  3BQ7 A;  4R8U A;  3T5K A;  4B9L A;  1T94 A;  5KFD A;  4J9L A;  1UA0 A;  2HW3 A;  3MGV A;  4ECW A;  4NLN A;  1ZQT A;  3A0H U;  3F2B A;  5ALZ A;  4DSK A;  2F8K A;  3H8M A;  3I28 A;  5AI4 A;  2BPC A;  3OSP A;  1QSS A;  5AM2 A;  5ALQ A;  5GTI U;  3N4M B;  2CPR A;  4GC6 A;  5KFB A;  5DQH A;  2E1E A;  2CRX A;  4EBE A;  2J6U A;  1S97 A;  4UQG A;  2RDJ A;  2JEJ A;  4C80 A;  4RPZ A;  5DLF A;  4X5V A;  4M9H A;  2OYY A;  2F77 X;  3M7D A;  2QLT A;  5EE0 A;  5KFZ A;  3T5L A;  4R8U B;  3CP8 A;  4KLS A;  4NXZ A;  5AHX A;  2W8K A;  3LYS A;  4FS2 A;  2KP7 A;  3BQ0 A;  4EX7 A;  4F72 A;  4RQ3 A;  1TK0 A;  4M9L A;  2XC9 A;  3C5G A;  1RYS A;  3ETL A;  2KFZ A;  2E8O A;  4Z6E A;  3RJJ A;  1Z00 A;  1RZT A;  1JMS A;  1T3N A;  4M2Y A;  2HI0 A;  4RPY A;  5ALO A;  3TAQ A;  4DL7 A;  3U26 A;  2O6K A;  4UAZ A;  4CCH A;  9ICX A;  5KT6 A;  1BPZ A;  5AM4 A;  1NK5 A;  3GV5 B;  7ICP A;  2R18 A;  1ZQL A;  4DS4 A;  1ZQX A;  2KEY A;  3HJE A;  2FMP A;  4PJ0 U;  5AKH A;  3WK8 A;  5AI8 A;  1BNP A;  2ZIW A;  1XS9 D;  3PSI A;  4KLG A;  4QZE A;  1KSP A;  2PMZ C;  2W54 A;  2WF5 A;  2HBM A;  8ICZ A;  1MA7 A;  5CJ7 A;  4OD0 A;  2N1R A;  1ECW A;  1LV5 A;  8ICY A;  1A76 A;  1DGJ A;  2I5H A;  5KFY A;  3IN5 A;  4Q8F A;  4M6W A;  1Z3E B;  2BDU A;  2H3Z A;  1Z00 B;  2AQ4 A;  3RB0 A;  2YMQ A;  5H2F U;  1PUZ A;  1V38 A;  7ICF A;  2KOB A;  1D8B A;  4Q8E A;  4DLG A;  2YMP A;  4FE3 A;  3PO5 A;  3SYZ A;  8ICE A;  1TAQ A;  2IOF A;  1D8L A;  2W11 A;  1D8Y A;  2IOF K;  5HHH A;  5ALK A;  1FIQ A;  4C8O A;  3QNM A;  3LDA A;  5KT5 A;  3SV3 A;  3KTQ A;  4QZB A;  1L3T A;  2HHV A;  4JV0 A;  3OJS A;  3VC8 A;  1RDF A;  5DBA A;  4M9J A;  3PX0 A;  2LKY A;  8ICH A;  4RUC A;  2BR0 A;  2GOL A;  4M6W B;  3EZ5 A;  3SD7 A;  4P0P A;  3PW4 A;  2ZXH A;  5BOM A;  3WK5 A;  1S9F A;  4C8K A;  4WJ3 B;  2AJQ A;  3THV A;  1WWV A;  4O0I A;  1L8L A;  9ICI A;  4F71 A;  1ARO P;  1RPL A;  5DBC A;  5KG4 A;  2G08 A;  2KN7 A;  1FEZ A;  2ZUD A;  1ZET A;  4B9T A;  9ICG A;  2BQ3 A;  3FDS A;  3EYZ A;  3C2L A;  1SWW A;  4I2H A;  1NK4 A;  2JEG A;  2FLP A;  4UAT A;  3AL0 B;  4DSL A;  4DL5 A;  4M0A A;  3N7S C;  4XUS A;  5J0Y A;  2DBY A;  1X6I A;  5J2A A;  3K4G A;  4ED8 A;  2KFN A;  1DXS A;  3G6Y A;  5CWR A;  2EAM A;  3ONN A;  3QE9 Y;  3EPI A;  4YMM A;  4DSF A;  2JXJ A;  4QNL A;  2DUY A;  3NRZ A;  2K8A A;  2CXY A;  2JMG A;  2QB0 A;  2IHM A;  4MFA A;  2MU2 A;  1N5W A;  2MSN A;  1COK A;  1BPX A;  1N2X A;  5KFU A;  2KNJ A;  2LPE A;  3RBD A;  1RM6 C;  1F44 A;  4BJQ A;  4DF4 A;  2XI9 A;  5AKJ A;  5DDY A;  4MFF A;  1ZD2 P;  1N62 A;  2NRZ A;  3H0R B;  5ALW A;  2WAQ C;  5DGA A;  1PVQ A;  4I2J A;  4JWM A;  2YML A;  5ALE A;  9ICK A;  4GIB A;  4I2D A;  1COO A;  4Y2R A;  5KFV A;  2I6X A;  3IV6 A;  5DGB A;  1ZQD A;  3WU2 U;  4OJ6 A;  3PW0 A;  3RF9 A;  5CR0 A;  2K8B B;  3TI0 A;  1SL0 A;  3F5E A;  2B0C A;  2G09 A;  4CE6 A;  4J9K A;  8ICI A;  3C1Y A;  2JH7 A;  2DKX A;  4FFD A;  4P4O A;  1T4G A;  2MAX A;  5AIA A;  1KFS A;  2HOF A;  3RJG A;  1SB3 C;  1BGX T;  4OJP A;  8ICO A;  3E2E A;  3E58 A;  1MQ3 A;  1KLN A;  9ICW A;  3TFS A;  2IHN A;  1WCN A;  1YT3 A;  3NVW A;  4LZD A;  2F3N A;  4Y2S A;  1ZQJ A;  5DB9 A;  2BKE A;  2H5X A;  2KKV A;  3M9O B;  5ALM A;  2VA8 A;  1CEZ A;  5G5H A;  5AIB A;  3KHR A;  3MDC A;  3OGU A;  3GII A;  4R64 A;  1N61 A;  3HX0 A;  4DQS A;  2R8K A;  4DOB A;  2WF9 A;  5J2H A;  1VJ5 A;  5IIL A;  4TQR A;  1KW4 A;  4IL6 U;  5KL8 B;  1EXN A;  1ZD3 A;  2QAR A;  2DGZ A;  2F1I A;  3CNH A;  2Q0Z X;  5AI5 A;  4C8N A;  2WF8 A;  1S5L U;  2W7O A;  3PV8 A;  4NLG A;  4EEL A;  4YCX A;  1ZQG A;  2W04 A;  5IIO A;  2DFL A;  2VIX A;  1XSN A;  1UQV A;  4F3O A;  3WKB A;  4IRC A;  5EOZ A;  5AKL A;  3JPT A;  5J29 A;  3K1R B;  4DSE A;  1LKY A;  1CUK A;  8ICA A;  2KZ3 A;  5KFP A;  2E5S A;  1DOQ A;  3HW8 A;  2LI6 A;  4QWB A;  1BNO A;  1TE2 A;  2H3I A;  4PZN A;  3ED5 A;  3H0M B;  4B9U A;  2MUT B;  3BDP A;  1S77 D;  1RXV A;  2BCQ A;  1ZQC A;  5J0X A;  5KFG A;  2HBJ A;  2HHT A;  8ICX A;  4C0Z A;  5ALV A;  4ECU A;  8ICV A;  4F2S A;  5EWF A;  3ZDB A;  5CB1 A;  5KG5 A;  1JXL A;  2JZB B;  1YZ6 A;  2V9W A;  4YR3 A;  3F2D A;  5IIK A;  3T3F A;  5TZV A;  5KG1 A;  1J2N A;  1S10 A;  7ICJ A;  3LVV A;  3AU6 A;  2OWO A;  1CRX A;  3L3F X;  3PMN A;  3M8S A;  3Q8S B;  1SV0 C; 
#chains in the Genus database with same CATH homology
 4MHV A;  2QB1 A;  5J8Y A;  1Z1V A;  2E8M A;  2K4P A;  5KNI A;  1SXD A;  3BQ7 A;  5J8Y C;  1RG6 A;  1KW4 A;  3TAD A;  5JTI A;  3BS5 B;  1PK1 B;  2Y9U A;  2QAR A;  2QB0 A;  2D8C A;  2EAN A;  3TAD C;  2F8K A;  3H8M A;  2E8P A;  1COK A;  1F0M A;  1V38 A;  5JRT A;  2LPE A;  5F3X B;  3SEI A;  1OW5 A;  4RQN A;  1B0X A;  2ESE A;  5JU5 A;  2KG5 A;  1SV4 A;  2QAR B;  2QB0 B;  2LMR A;  1PK3 A;  2KSO A;  2FE9 A;  2KIV A;  1UQV A;  2JV3 A;  3SEN A;  1X66 A;  2K60 A;  3K1R B;  1V85 A;  1LKY A;  2QKQ A;  2B6G A;  1WWU A;  4NJ8 A;  4PZN A;  1X9X A;  2KE7 A;  1B4F A;  2F44 A;  1JI7 A;  1SGG A;  1LKY B;  3BS5 A;  1PK1 A;  1UCV A;  1WWV A;  2E8O A;  2DKX A;  2EAP A;  4PZO A;  2KMD A;  1OXJ A;  3KKA A;  2E8N A;  4IS7 A;  2GLE A;  2Y9T A;  2DL0 A;  2F3N A;  4RQM A;  2KSO B;  3HIL A;  3KKA C;  4NL9 A;  5L1M A;  3TAC B;  2DKZ A;  3BS7 A;  2YTU A;  4NL9 C;  1SV0 A;  2ES6 A;  1DXS A;  2EAO A;  2D3D A;  2L5Y A;  2EAM A;  1X40 A;  3IDW A;  1SXE A;  1SV0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...