1X40A

Solution structure of the sam domain of human arap2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
GSSGSSGMSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRILKQLQIILSKMQDIPIYASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SAM domain of human ARAP2
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords ARAP2
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1x40A00
2QB0B 2LPEA 2QB1A 1F0MA 1Z1VA 5J8YC 2B6GA 2KG5A 1SXEA 2EANA 2L5YA 1SXDA 2KMDA 1UCVA 5KNIA 2ES6A 1B4FA 2DL0A 2Y9TA 2DKXA 2D3DA 4MHVA 3TADA 4PZOA 3H8MA 5JTIA 2E8MA 1SV0C 2QARA 3SENA 2KSOA 1WWVA 4NL9C 3BS5B 1DXSA 3TADC 2ESEA 2JV3A 2Y9UA 3SEIA 1KW4A 2E8NA 2DKZA 1LKYA 3BS5A 1WWUA 4NL9A 1B0XA 2KIVA 1SV0A 5JU5A 2KSOB 1PK3A 1X66A 3IDWA 1X9XA 2EAOA 3BQ7A 5F3XB 1V85A 3KKAA 5JRTA 2EAMA 2F3NA 2F8KA 1RG6A 1V38A 4NJ8A 1OXJA 1JI7A 5L1MA 1SV4A 4RQNA 1X40A 2K60A 2QARB 1OW5A 2E8OA 1LKYB 2YTUA 5J8YA 3K1RB 2EAPA 2FE9A 1PK1A 3TACB 2K4PA 4PZNA 1COKA 2KE7A 4RQMA 3HILA 2F44A 4IS7A 2LMRA 3BS7A 2QKQA 2D8CA 1SGGA 3KKAC 2QB0A 1UQVA 2E8PA 2GLEA 1PK1B
chains in the Genus database with same CATH superfamily
4B9TA 5AI4A 4QJFB 2F1JA 2QB1A 4I2JA 4UB6U 3N97B 1J2MA 1QQ7A 5ALIA 2H3IA 5L9XA 4QWBA 2HHQA 2JZBB 5DKWA 5KG5A 2YN4A 4KLIA 1Z4OA 5DB6A 1IV8A 4USAA 3TFRA 2DKXA 3KHLA 1RZTA 2W9CB 1QLNA 9ICJA 5AM3A 2QARA 3AMZA 2KSOA 4KN4A 3H0LB 2WFAA 3C5FA 3TADC 3H8SA 3UXPA 2BCQA 3NASA 3PY8A 3KZXA 2G5HB 2BPFA 1ZQJA 2Q4TA 2PMZF 2HDOA 1WWUA 8ICXA 2DGZA 2E1EA 4ICAA 3OJUA 2Y1JA 1TE2A 5AKEA 2LI6A 1X9XA 4DSIA 4KLDA 5KFPA 5F3XB 3BQ2A 2VA2A 2HW3A 4EENA 4PGXA 1Q3VA 1L5UA 1NK9A 2HVIA 3KHGA 4BUGA 4BJQA 3MR3A 4UAUA 5KTQA 1OW5A 5KFRA 4NLZA 1AQ6A 1KEJA 4PH5A 1ZJNA 4ECVA 2KE7A 1YZ6A 3DV9A 5AKJA 4ECTA 2D8CA 1NK8A 2PMZC 2F1IA 5CRXA 3IRUA 9ICWA 3BQ1A 7ICOA 4YMMA 2HBLA 4FZNA 4C8NA 5KFKA 4DS4A 5ALFA 3AL0B 1XU4A 3R9KA 2XGQA 2VIXA 3N28A 4ACOA 4NV0A 4ZH4A 3RRHA 3PW2A 1SIJA 2RQ5A 5CWRA 3AM9A 1CEZA 4DCCA 1Z4NA 8ICIA 4PGYA 4NWIA 3WK9A 3UXNA 4Y2PA 3PO4A 4RQ6A 1XSNA 5KFOA 2WF8A 1ZRNA 3B9JA 7ICIA 1DK2A 4JWNA 1UHUA 3A0BU 3HPOA 4ELTA 4KLUA 3SAFA 1KW4A 4P0QB 5IILA 1SL2A 5K4LA 4NXZA 4DO9A 3LWMA 5GTHU 4RQ7A 2F1HA 1MC8A 4UB5A 5J2FA 1X6JA 5JU5A 3QXGA 3RAQA 3PMNA 3JPPA 3Q8QB 2EAOA 9ICQA 3WKEA 3FAHA 1ZQMA 2R8JA 2BCUA 1HIWA 1UA0A 4RQ3A 2BPCA 3F2BA 7ICVA 5AM5A 3CP8A 3RJFA 3Q8LA 2ZJAA 3NS1A 4C4SA 1SKRA 4J9RA 2CRXA 1ZQUA 4DFDA 2K4EA 1O03A 3MDAA 1XO0A 4J9NA 7ICHA 8ICJA 4P4MA 2KTQA 2FE9A 5BOMA 3GV5B 1CRXA 4B6JA 1NKCA 3AU6A 1FIQA 3PW0A 3PW7A 4OJOA 3BS7A 2Y0SC 3M8RA 3UMBA 4OJPA 5KG1A 2LYHA 2R8HA 4A8EA 4NLCA 2HHXA 1S9FA 2UVVA 5J0PA 4PPXA 2PFNA 2FPKA 5IIKA 2G5IB 3G6VA 5AKHA 2RDIA 1ZXIA 3C2MA 2IHMA 5KG0A 4IRDA 5CHGA 2JEIA 1NJZA 4F5OA 4QZCA 1FO4A 3C28A 1SL1A 2RLTA 4CF4A 4QZEA 5AKGA 3EUB2 5KAFU 7ICLA 1HUZA 4EEYA 4GC6A 4YR0A 3QU7A 1ZOLA 2WB1C 1D9FA 3BDPA 2ZUDA 4UAVA 3J81j 3CYMA 2K8BB 2FLNA 3D2QA 5KFXA 3MR5A 2MUTB 2ZIVB 1FFUA 4KLJA 2RDJA 1PK3A 9ICIA 4BWMA 3D6JA 2HHWA 4DSEA 3WK6A 3ETRA 4NLBA 8ICMA 1ZQOA 2BDUA 3PSFA 1YT3A 2FI1A 2Z7JA 2H5XA 1WUDA 2K8CB 3QZ7A 4B9UA 2JEGA 2ZUBA 4C8LA 5HHHA 3TARA 5AKLA 1L6NA 1D9DA 1TVAA 3S6JA 4ECUA 1URJA 3C5GA 4LJXA 4RQMA 3FYHA 1VJ5A 3M9NB 5DG8A 2VA8A 1ZRMA 2XO7A 2IHNA 1S8OA 2G08A 3EPIA 3RB0A 3PO5A 4I29A 4RQ8A 1JX4A 4B9VA 4DQSA 4RZRA 3M8SA 1F0MA 3M6KA 2W3RA 1BNOA 1CI4A 4OO1J 1N62A 1C20A 3QUTA 5AIBA 3SV3A 1UCVA 2VKQA 5ALYA 3ISCA 3ZI4A 1ZQBA 4IQVA 3UMGA 4K4HA 3M7DA 4CF5A 4NY8A 5IIJA 5C0YA 4QW8A 3ZDBA 2G0AA 4AP9A 2AHOB 2K4HA 2H3FA 2XVTA 4Y2QA 2XY6A 3AUOA 9ICGA 5J2DA 4NL9A 3MGIA 2HOFA 2FMPA 3SAHA 3UQ0A 5KFFA 4Y2YA 1QSLA 3EZ5A 1RXVA 1RM6C 1PZNA 4KX3A 3FC4A 3Q8RB 5AKXA 5A0LA 5CJ7A 1ZYQA 1ZQXA 2Y0SF 2EAMA 1TK8A 1RG6A 2XC9A 2RRDA 3C2LA 5BPCA 3N7SC 8ICFA 2W8KA 2W9BB 3AQEA 4ED6A 4F5RA 5HMMA 5KFTA 4EYIB 9ICOA 1L3UA 3IN5A 2Y1IA 3QX7A 4P0PA 3K75D 5ALXA 2YTUA 3UPQA 3LK9A 5ALSA 2R18A 2V4QA 2WF6A 1MN8A 4EZ9A 8ICNA 2Q0ZX 7ICSA 1MA7A 8ICUA 4QZFA 3H4DA 2KZ3A 3PZPA 1L8OA 5EWFA 2J6UA 5AHXA 4ZOHC 5KG2A 1NK6A 4I2AA 2EZXA 4YFKA 4XUSA 2FLPA 2HCFA 4OCZA 4F4YA 4KMOB 2OEHA 9ICSA 3RJIA 5HNKA 5KNIA 5KT5A 2Y9TA 2FLLA 4GIBA 1YZ7A 2R8IA 4UBBA 2ZXIA 2W8LA 2B21A 2KVSA 3PX6A 3NGDA 1S5LU 2BR0A 1PVQA 2H3VA 8ICSA 5J0UA 1WWVA 2C22A 1DXSA 1MQ3A 1IG6A 2ZIWB 2W9AA 3T5LA 5J0YA 2YMLA 5KT3A 4O3NA 3RFAA 3AEVA 5AKKA 1J97A 2K8AA 1P7DA 5AI0A 1OUQA 4KX5A 4PHEA 3BJYA 2MSNA 5AKZA 4F72A 3PX0A 3ALRA 1V38A 4DS5A 4YMNA 4IC9A 4Z6DA 5J2JA 2QLTA 1RQNA 5D46A 1ZQDA 3VC8A 4YN4A 4RQNA 3SAGA 3KFUF 2RHFA 1NZPA 4I2CA 2K4IA 1KTQA 1NOMA 5AK5A 5CB1A 5ALUA 2FMQA 3QU9A 3TI0A 2ZIUA 1BPBA 3CNHA 3TAPA 4EBEA 3PV8A 4Q8FA 1N5WA 3PX4A 1XSPA 4I2EA 2PI4A 4C8OA 1HEKA 2HI0A 3F2DA 3RJHA 1NI3A 1Z00B 5KFIA 1COOA 4DQQA 1SZHA 1A76A 2W54A 5CR0A 8ICPA 3T5HA 4ED2A 1PVPA 4CE6A 1MSWD 3H8JA 5AK4A 5KG3A 1ZJMA 2IOFK 4KLMA 2HHSA 3K4GA 4ECQA 4NLNA 2GOLA 4Y2RA 3M6ZA 3BZCA 2OCEA 4F5NA 5AKYA 4Q45A 4M9JA 8ICWA 8ICQA 5EE3A 5CA7A 1ECWA 2E8MA 4QIWF 5DBBA 8ICVA 1T7PA 1U4BA 5E79U 4UQGA 3WU2U 1AROP 2OH2A 3LVWA 8ICZA 4IQUA 7ICKA 5KFGA 5BOLA 4JK1A 5AM4A 2V9WA 2MRLA 2IMWP 2JHDA 4KLFA 9ICHA 5GTIU 3IDWA 2ALZA 4QZ8A 3SI8A 3PNCA 9ICEA 4KLHA 3LVVA 3BZKA 1TAUA 1ZETA 4F91B 3B0XA 5AM2A 1JMSA 4KMUA 3Q8SB 3WKBA 4YR3A 4FO6A 4RQ2A 2N1RA 2MU2A 2HVHA 4XA5A 2E3TA 4DF8A 3NVYA 5ALJA 2K4PA 1HJPA 1S0VA 3RRGA 4KLGA 5J2KA 1KN5A 1XNSA 3T5JA 3V72A 1UT8A 2DPJA 2J6SA 4OD0A 4NM1A 5KFJA 4P0PB 2B6GA 4EYHB 4DEZA 3PVXA 4UATA 8ICBA 4F50A 2P66A 4UB4A 4NLKA 2EZZA 4GFJA 2ZTDA 5EE0A 3THVA 4PZOA 2W3SA 5KG7A 3H8MA 4ECYA 3D2NA 4IQWA 3A0HU 2OYYA 2ZIVA 3LYSA 3H40A 3BQTA 2KHVA 5HMLA 4KITB 5TISU 1RXWA 3WK4A 1KRPA 5DGBA 4YVZA 3E58A 5ALMA 2AJQA 4DSLA 3GIJA 2CXYA 2ZTCA 4DL4A 2IOHA 1UT5A 3PW5A 1BVSA 2LYAA 3GIIA 4QZBA 2EH9A 2MA1A 4YXJA 2AGPA 2C2RA 4ED1A 4QWDA 4JMUA 4J9MA 2VJ4A 3C1YA 2BQ3A 5EOZA 1KFSA 2FPLA 2BQRA 3JPSA 3SV4A 2HHUA 4M9HA 1JALA 3K1RB 1RQLA 4FZLA 4M9GA 4O3RA 2KKPA 4C8MA 5J2EA 1KDHA 7ICFA 2KN7A 9ICFA 2FPMA 2QKQA 4Y2XA 4YD1A 2KVCA 3QEAZ 4M6WA 1L7NA 4QWEA 3QU2A 4J9KA 3PW4A 2QB0B 5H2FU 1ZQFA 1ZQIA 9ICNA 2NO4A 5J8YC 3RJGA 4KLOA 4M2YA 2LHTA 2W9BA 1ZQHA 1S0OA 2YB1A 4UB2A 1TAQA 4F4XA 9ICBA 5F9LA 1DGSA 2JMGA 1B4FA 4M04A 2KJ5A 3HP6A 2GO7A 3QUQA 4LVSA 1C7YA 2PKEA 5KFLA 1SL0A 2GWSA 9ICRA 5DBCA 4DL2A 4PGQA 9ICAA 5J0QA 5J0SA 5KG6A 1QQ5A 5EWEA 4I2GA 4WJ3B 4EBCA 4I2BA 2JV3A 4QIWC 2ASJA 3SEIA 5IIIA 2WAQF 5HR6A 3RB4A 5KFUA 1LKYA 2KEYA 4ELUA 4P4PA 3LWLA 2UVUA 3IHQB 1JUDA 5TZVA 3OPXA 4B9MA 4MFAA 4EBDA 3KD3A 3V7JA 3RBDA 4GLXA 5DG7A 1LB2B 4C7ZA 7ICQA 2NRWA 3KOOA 3QNMA 3SZ2A 1V85A 2KICA 2ZJ8A 3DEEA 3PR4A 2EDUA 3QE9Y 5KL1B 4C4TA 3C21A 1TV9A 2KZZA 1U48A 4B9LA 4XQ8A 4YQWA 2KFNA 5J0OA 5EE1A 3NVWA 2WF5A 1N48A 1K1SA 1JN3A 1ZQEA 2LM1A 4F5QA 2BKEA 2LMRA 4HAIA 3JPRA 4UB3A 2W9CA 1UQVA 4JUZA 4NLGA 4C80A 1JROA 4YG2A 1N61A 3WKDA 4M0AA 1H38A 5KFAA 1NK4A 4J9QA 4IRCA 1VLBA 1XS9D 3V6JA 5D4BA 3AQFA 4JV2A 2BCSA 4ED3A 4UBCA 2ZIWA 1N63A 4UB1A 1L3TA 4DOAA 3V6HA 1D8YA 4CNQA 3FM9A 4I2FA 2W7PA 2W11A 2KIWA 3G6YA 1BNPA 1U45A 2P35A 2AH5A 3SENA 1KBUA 8ICGA 2JEFA 5AIAA 2ESEA 3QU5A 1DGJA 4M9LA 3GDXA 3BS5A 3NUQA 1F44A 5KFNA 2A3VA 2KIVA 5KL8B 4QZAA 1ZQPA 1QTMA 4DLGA 3B0YA 2F3NA 2O6KA 3U26A 4QZ9A 4AYBC 1OXJA 1NJWA 2ZIUB 1ED1A 1BPXA 5ALNA 5CP2A 4QZGA 7ICTA 1KFTA 1NK7A 3M9MB 1RYUA 3RF9A 3N7RC 3ZDDA 1ZQSA 1Z00A 1TK5A 4PZNA 3QZ8A 2A1AA 2FMSA 4I2IA 5DB9A 1N60A 5KT4A 3KHHA 3HW8A 4M47A 3HILA 2HMXA 2C28A 2JXJA 1QSSA 1ZD4A 2NRTA 3E0FA 5KT7A 4J9SA 5AM0A 1KFDA 1KL9A 3I76A 3D2SA 5ALPA 3KBBA 1XC9A 3LDAA 2M0NA 3MFHA 3SMVA 1Q46A 1QCKA 2KJ8A 3C2KA 4R63A 4EX7A 5DQIA 2XI9A 3Q8PB 4EEKA 3ETLA 5ALHA 1V97A 5J0XA 3OHAA 2DL0A 2W55A 3I28A 5J2GA 4MHVA 1TK0A 1L7MA 2ATLA 1PUZA 5DDYA 3HKZF 5ALZA 2ISPA 5J2CA 1LV5A 2PI5A 1UA1A 4TQSA 2BGWA 5DQGA 4OJ6A 4Z6CA 2WHEA 3ZD8A 3EW9A 5KFSA 4DL6A 2JR5A 2J6TA 4IR9A 4HYKA 4KLLA 1V9PA 4Y2TA 5AI9A 4MEXA 3C23A 2ISOA 3QYPA 4DOBA 3OSNA 5DBAA 3AU2A 3H7IA 4I2DA 5G5GA 4RQ1A 1SV4A 4J9OA 4O5CA 1HUOA 1LKYB 4KN7A 5HR7A 5AKIA 5AICA 1COKA 2XY7A 2I1QA 4O3MA 4Q44A 3WK8A 3HRDD 8ICEA 4DQIA 4F2SA 4ECWA 2HHTA 5KT6A 2R8KA 5CEHA 5JUMA 4G9BA 4KLEA 1ZQ1C 1ZQGA 1LVHA 3QEBZ 1B22A 2F8LA 3N7PD 4P4OA 3OHBA 3EYZA 4IR1A 9ICCA 2BCRA 2ZJ5A 1S0NA 4LZGA 2MAXA 2W04A 3WK5A 2XCAA 2NRVA 4DLEA 3UXOA 1RYSA 1JRPA 5DGAA 1S0MA 2WTFA 1S10A 4C8KA 5KFZA 4RNMA 1A0PA 1N2XA 4QZHA 3JPOA 5JTIA 1F5SA 1KLNA 2VJ5A 5L1LA 2ZXHA 5J2IA 5G5HA 1PVRA 5AM1A 4DFKA 1Q3UA 3L4PA 9ICPA 2HBJA 2Y9UA 5KFDA 4ECXA 3IP4B 2DKZA 3MGHA 5KAIU 4M9NA 4M6WB 1X6IA 5KFCA 3TAQA 1NZBA 4J9PA 2W03A 4G3IA 3C29A 1JIHA 7ICNA 4F93B 4Z6FA 2GH1A 4PL1A 3HKZC 1ZQZA 3ZDAA 5J2BA 3BQ7A 1ZD3A 1IIPA 3ISDA 2HHVA 4KTQA 1Z1BA 1L7OA 5L1MA 4CRXA 3KHRA 2KP7A 7ICGA 2KHQA 4BX9C 4BXOA 2K60A 5B66U 3MABA 5B5EU 3Q8MA 4EX6A 2UVRA 2VANA 4FBTA 2ODGA 2LKYA 4C7YA 2E1FA 4GXJA 2EAPA 3GILA 3I1YA 5EE9A 7ICMA 4ELVA 1WCNA 4UB8U 4U7CA 2YMPA 5AI8A 1ZQRA 9ICMA 2E5SA 5FP0A 4C0ZA 4GXKA 2NV3A 3HJEA 5AK6A 3GQCA 2ZG6A 1PK1B 4R8UA 1SWWA 3IG8A 1N5XA 3ONNA 2KG5A 2NRXA 4PHDA 4GC7A 5J29A 2VA3A 4FE3A 4P2HA 2ZIXA 5ALLA 3TQ1A 4PL2A 2F2AB 5J0WA 3SQIA 1WG8A 4O3QA 4UW9A 2KNJA 4YD2A 2JZBA 4R66A 1T3QA 2PFPA 3PSIA 4US8A 3IM1A 1L7PA 4DFPA 3ORYA 1S97A 9ICTA 2YMQA 2JRZA 5HP4A 1SV0C 5ALDA 3WKAA 2HOIA 3TANA 4NL9C 1SB3C 2H3QA 3NVZA 2I5HA 4GXIA 2E8NA 2EZYA 1ZQAA 4KLSA 1SV0A 1NK5A 5DLGA 1IM4A 3DDHA 3GZFA 2DBYA 2PFOA 3KKAA 3RH4A 1X9SA 3NVVA 3RTVA 2WB1F 3HX0A 2YY6A 4RUAA 2DFLA 4UASA 4YXMA 4DFJA 4DSKA 1ZQLA 2NRZA 2B0CA 1Z19A 4BXOB 2P6RA 4PJ0U 3V7LA 4O3PA 4TQRA 2PXIA 4Q43A 2RP5A 1D8BA 4JV1A 2KZMA 1U47A 3KTQA 3H4BA 1NKBA 1L8LA 3H0MB 4ECSA 3CW2C 3PSTA 4IS7A 4QNLA 1S77D 1ZQQA 4C4RA 1QQ6A 2JGAA 4F3OA 1SGGA 3KKAC 1CUKA 2QB0A 1U49A 3CRXA 3UQ2A 4RUCA 3EWAA 4O5EA 1FEZA 3RH6A 4PHPA 5ALTA 1ZD2P 3E2EA 5L1JA 4MFFA 4UAWA 4FS2A 5T14A 5AK3A 4B9NA 3GU3A 5ALGA 4B9SA 4RT3A 3GFKB 2C2EA 1MQ2A 2KMDA 4IQTA 3V6KA 8ICYA 2ES6A 1KSPA 1NJXA 5KFBA 2A19A 4ED0A 3WK7A 2LBOA 3VCBA 2KJ9A 4RQ5A 2MUTA 1SWVA 2A1JB 3T5KA 2G07A 2DPIA 4UAZA 1N56A 2BDPA 1SKWA 5KFVA 1T4GA 5DG9A 9ICUA 4F71A 3HWTA 4UARA 2CPRA 2KSOB 1JXEA 3IG5A 8ICHA 2KD1A 1RYRA 4DSJA 3RB6A 4Y2VA 3N4MB 4XRHA 3RJKA 4TURA 1Z3EB 1TAMA 4ED8A 1JI7A 3ISBA 4DOCA 3TKAA 2AQ0A 1EXNA 2KK0A 3RJEA 3K1ZA 1S76D 2YB4A 4ECZA 5KT2A 4TUPA 3G6XA 2YX8A 4F8RA 1DK3A 2E8OA 5J2HA 1BPYA 3ZD9A 2IOFA 4Y2UA 5J0TA 9ICLA 1Q8KA 4MF2A 3MDCA 4K4IA 2HSZA 1X42A 2AQ4A 2ZTEA 4PHAA 1TKDA 3MR2A 4I2HA 3KZIU 4AYBF 3QU4A 2OHFA 2I6XA 3QUCA 5EWGA 1M6YA 2W7OA 3RR7A 1ZQVA 2KFZA 2KOBA 3HT3A 4EELA 3RAXA 5KFHA 3MC1A 8ICAA 1O08A 3M1YA 4F92B 4DWIA 1RDFA 1BPEA 2F77X 4F4ZA 1JXLA 4FZMA 1BPZA 4EZ6A 4Q8EA 2NYVA 9ICXA 5D49A 3MFIA 3SYZA 4IL6U 3WKCA 3F2CA 5DDMA 4RPYA 4Z6EA 4QW9A 8ICKA 4O3SA 1XSLA 3UM9A 1ZQCA 1XO1A 2OWOA 3NRZA 8ICCA 2XGPA 3BS5B 4BDPA 1QSYA 4OJ5A 1DRGA 1WYGA 5IIMA 4FS1A 4RT2A 2FDRA 3UMCA 5L1IA 4US9A 2ZIXB 8ICRA 2EQYA 4QZIA 5DQHA 1X66A 3F5AA 2OM6A 2FJ6A 1DOQA 4RNOA 2YMMA 3OGUA 1ZQTA 9ICKA 2DWQA 4CF3A 4U6PA 5ALWA 2I9GA 3NRWA 3PSPA 1A6SA 3BQ0A 4F4KA 1VDVA 1KQQA 4RQ4A 4R65A 2IA6A 5KG4A 2F76X 5F9NA 4J03A 1Y88A 2QARB 2ASLA 4MF8A 2NO5A 7ICUA 2YQEA 4ECRA 5HHIA 1WCLA 1NNLA 4DF4A 4QWCA 2JH7A 5ALVA 1ZQYA 1KKXA 3MGVA 4RPZA 4KLQA 2IBKA 1SKSA 1D8LA 5KFYA 4P0QA 2JEJA 3T3FA 5IIOA 4JB3A 1XWLA 2BQUA 2LPEA 4O9MA 3H8WA 2HOQA 3GIKA 1IXRA 3T79A 1SXEA 1SZPA 2L5YA 2LYBA 4MEYA 3F53A 4CCHA 4DL5A 1GO3F 4RQ0A 4JV0A 5ALQA 2D3DA 3GV7B 1RPLA 3TADA 5KFMA 4FFDA 3M9OB 4E0DA 4DL3A 4QZDA 4YP3A 1L3VA 2ASDA 3RB3A 2C2DA 5C5JA 3FDSA 3O0FA 4FBUA 4R8UB 2HBKA 2CN1A 1ZQKA 3AN1A 4Y2JA 3Q8KA 4K4GA 3OSPA 4O0IA 1U9LA 1X2IA 1NJYA 8ICTA 4CDGA 4BWJA 4UAYA 1B43A 2A1JA 4DSFA 4CGZA 2XCPA 1X40A 5DB8A 2R8GA 1T8EA 3V7KA 3NTUA 1T3NA 3ZDEA 1BPDA 3RH5A 5J8YA 1X9WA 2V4RA 5J2AA 1PK1A 3EPGA 2KV2A 1J2NA 3JPNA 2G06A 7ICRA 2K89A 4YMOA 2WAQC 2F44A 2DUYA 1UPHA 4DFMA 4X5VA 7ICEA 2WF7A 3ED5A 5DLFA 1ZD5A 4YR2A 4TUQA 1K1QA 2E8PA 5KFWA 4J9LA 2DQNB 4I27A 2AU0A 1X9MA 2BZFA 3TFSA 1Z1VA 2W9MA 4JWMA 2D6FC 4TUSA 4I28A 2DF4B 9ICVA 1K5OA 2EANA 2M9NA 5ALKA 3C1ZA 4F2RA 3RBEA 4KLTA 1SXDA 1L3SA 3RR8A 2LM4A 2XIDA 5DB7A 2HBMA 5ALRA 1ZQWA 3QUBA 1FFVA 3GV8B 8ICLA 5KFQA 5ALEA 3IV6A 3H0RB 4O5KA 8ICOA 3L5KA 5AI6A 4IRKA 1BGXT 4YCXA 2H3ZA 3GIMA 4BGDA 1QH9A 4ED7A 3ZDCA 2JH1A 4DL7A 2BCVA 3SD7A 2XICA 3OTQA 1B0XA 3F5EA 3ICXA 3MR6A 5J0RA 2W43A 3JPTA 4R64A 4F4WA 2PFQA 2UVWA 5JRTA 4RPXA 2F8KA 3PMLA 4NJ8A 4RNNA 2ZUCA 3MBYA 5IINA 5L1KA 4DQRA 4LZDA 3JPQA 4DQPA 4Y2SA 2G09A 5ALOA 4F5PA 4QWAA 3RJJA 2AGQA 3PR5B 2AGOA 1NKEA 4O3OA 2WF9A 7ICJA 5KFEA 4OJLA 1T94A 4NM2A 4MFCA 7ICPA 2P6UA 3TACB 2AXTU 2OXOA 2XY5A 2KKVA 3OJSA 2BHNA 3SR6A 3L3FX 5AI5A 2BPGA 1A77A 1NK0A 2GLEA 1ZQNA 1TFRA 4RU9A
chains in the Genus database with same CATH topology
2QB0B 2LPEA 2QB1A 1F0MA 1Z1VA 5J8YC 2B6GA 2KG5A 1SXEA 2EANA 2L5YA 1SXDA 2KMDA 1UCVA 5KNIA 2ES6A 1B4FA 2DL0A 2Y9TA 2DKXA 2D3DA 4MHVA 3TADA 4PZOA 3H8MA 5JTIA 2E8MA 1SV0C 2QARA 3SENA 2KSOA 1WWVA 4NL9C 3BS5B 1DXSA 3TADC 2ESEA 2JV3A 2Y9UA 3SEIA 1KW4A 2E8NA 2DKZA 1LKYA 3BS5A 1WWUA 4NL9A 1B0XA 2KIVA 1SV0A 5JU5A 2KSOB 1PK3A 1X66A 3IDWA 1X9XA 2EAOA 3BQ7A 5F3XB 1V85A 3KKAA 5JRTA 2EAMA 2F3NA 2F8KA 1RG6A 1V38A 4NJ8A 1OXJA 1JI7A 5L1MA 1SV4A 4RQNA 1X40A 2K60A 2QARB 1OW5A 2E8OA 1LKYB 2YTUA 5J8YA 3K1RB 2EAPA 2FE9A 1PK1A 3TACB 2K4PA 4PZNA 1COKA 2KE7A 4RQMA 3HILA 2F44A 4IS7A 2LMRA 3BS7A 2QKQA 2D8CA 1SGGA 3KKAC 2QB0A 1UQVA 2E8PA 2GLEA 1PK1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 B;  2LPE A;  2QB1 A;  1F0M A;  1Z1V A;  5J8Y C;  2B6G A;  2KG5 A;  1SXE A;  2EAN A;  2L5Y A;  1SXD A;  2KMD A;  1UCV A;  5KNI A;  2ES6 A;  1B4F A;  2DL0 A;  2Y9T A;  2DKX A;  2D3D A;  4MHV A;  3TAD A;  4PZO A;  3H8M A;  5JTI A;  2E8M A;  1SV0 C;  2QAR A;  3SEN A;  2KSO A;  1WWV A;  4NL9 C;  3BS5 B;  1DXS A;  3TAD C;  2ESE A;  2JV3 A;  2Y9U A;  3SEI A;  1KW4 A;  2E8N A;  2DKZ A;  1LKY A;  3BS5 A;  1WWU A;  4NL9 A;  1B0X A;  2KIV A;  1SV0 A;  5JU5 A;  2KSO B;  1PK3 A;  1X66 A;  3IDW A;  1X9X A;  2EAO A;  3BQ7 A;  5F3X B;  1V85 A;  3KKA A;  5JRT A;  2EAM A;  2F3N A;  2F8K A;  1RG6 A;  1V38 A;  4NJ8 A;  1OXJ A;  1JI7 A;  5L1M A;  1SV4 A;  4RQN A;  1X40 A;  2K60 A;  2QAR B;  1OW5 A;  2E8O A;  1LKY B;  2YTU A;  5J8Y A;  3K1R B;  2EAP A;  2FE9 A;  1PK1 A;  3TAC B;  2K4P A;  4PZN A;  1COK A;  2KE7 A;  4RQM A;  3HIL A;  2F44 A;  4IS7 A;  2LMR A;  3BS7 A;  2QKQ A;  2D8C A;  1SGG A;  3KKA C;  2QB0 A;  1UQV A;  2E8P A;  2GLE A;  1PK1 B; 
#chains in the Genus database with same CATH topology
 4B9T A;  5AI4 A;  4QJF B;  2F1J A;  2QB1 A;  4I2J A;  4UB6 U;  3N97 B;  1J2M A;  1QQ7 A;  5ALI A;  2H3I A;  5L9X A;  4QWB A;  2HHQ A;  2JZB B;  5DKW A;  5KG5 A;  2YN4 A;  4KLI A;  1Z4O A;  5DB6 A;  1IV8 A;  4USA A;  3TFR A;  2DKX A;  3KHL A;  1RZT A;  2W9C B;  1QLN A;  9ICJ A;  5AM3 A;  2QAR A;  3AMZ A;  2KSO A;  4KN4 A;  3H0L B;  2WFA A;  3C5F A;  3TAD C;  3H8S A;  3UXP A;  2BCQ A;  3NAS A;  3PY8 A;  3KZX A;  2G5H B;  2BPF A;  1ZQJ A;  2Q4T A;  2PMZ F;  2HDO A;  1WWU A;  8ICX A;  2DGZ A;  2E1E A;  4ICA A;  3OJU A;  2Y1J A;  1TE2 A;  5AKE A;  2LI6 A;  1X9X A;  4DSI A;  4KLD A;  5KFP A;  5F3X B;  3BQ2 A;  2VA2 A;  2HW3 A;  4EEN A;  4PGX A;  1Q3V A;  1L5U A;  1NK9 A;  2HVI A;  3KHG A;  4BUG A;  4BJQ A;  3MR3 A;  4UAU A;  5KTQ A;  1OW5 A;  5KFR A;  4NLZ A;  1AQ6 A;  1KEJ A;  4PH5 A;  1ZJN A;  4ECV A;  2KE7 A;  1YZ6 A;  3DV9 A;  5AKJ A;  4ECT A;  2D8C A;  1NK8 A;  2PMZ C;  2F1I A;  5CRX A;  3IRU A;  9ICW A;  3BQ1 A;  7ICO A;  4YMM A;  2HBL A;  4FZN A;  4C8N A;  5KFK A;  4DS4 A;  5ALF A;  3AL0 B;  1XU4 A;  3R9K A;  2XGQ A;  2VIX A;  3N28 A;  4ACO A;  4NV0 A;  4ZH4 A;  3RRH A;  3PW2 A;  1SIJ A;  2RQ5 A;  5CWR A;  3AM9 A;  1CEZ A;  4DCC A;  1Z4N A;  8ICI A;  4PGY A;  4NWI A;  3WK9 A;  3UXN A;  4Y2P A;  3PO4 A;  4RQ6 A;  1XSN A;  5KFO A;  2WF8 A;  1ZRN A;  3B9J A;  7ICI A;  1DK2 A;  4JWN A;  1UHU A;  3A0B U;  3HPO A;  4ELT A;  4KLU A;  3SAF A;  1KW4 A;  4P0Q B;  5IIL A;  1SL2 A;  5K4L A;  4NXZ A;  4DO9 A;  3LWM A;  5GTH U;  4RQ7 A;  2F1H A;  1MC8 A;  4UB5 A;  5J2F A;  1X6J A;  5JU5 A;  3QXG A;  3RAQ A;  3PMN A;  3JPP A;  3Q8Q B;  2EAO A;  9ICQ A;  3WKE A;  3FAH A;  1ZQM A;  2R8J A;  2BCU A;  1HIW A;  1UA0 A;  4RQ3 A;  2BPC A;  3F2B A;  7ICV A;  5AM5 A;  3CP8 A;  3RJF A;  3Q8L A;  2ZJA A;  3NS1 A;  4C4S A;  1SKR A;  4J9R A;  2CRX A;  1ZQU A;  4DFD A;  2K4E A;  1O03 A;  3MDA A;  1XO0 A;  4J9N A;  7ICH A;  8ICJ A;  4P4M A;  2KTQ A;  2FE9 A;  5BOM A;  3GV5 B;  1CRX A;  4B6J A;  1NKC A;  3AU6 A;  1FIQ A;  3PW0 A;  3PW7 A;  4OJO A;  3BS7 A;  2Y0S C;  3M8R A;  3UMB A;  4OJP A;  5KG1 A;  2LYH A;  2R8H A;  4A8E A;  4NLC A;  2HHX A;  1S9F A;  2UVV A;  5J0P A;  4PPX A;  2PFN A;  2FPK A;  5IIK A;  2G5I B;  3G6V A;  5AKH A;  2RDI A;  1ZXI A;  3C2M A;  2IHM A;  5KG0 A;  4IRD A;  5CHG A;  2JEI A;  1NJZ A;  4F5O A;  4QZC A;  1FO4 A;  3C28 A;  1SL1 A;  2RLT A;  4CF4 A;  4QZE A;  5AKG A;  3EUB 2;  5KAF U;  7ICL A;  1HUZ A;  4EEY A;  4GC6 A;  4YR0 A;  3QU7 A;  1ZOL A;  2WB1 C;  1D9F A;  3BDP A;  2ZUD A;  4UAV A;  3J81 j;  3CYM A;  2K8B B;  2FLN A;  3D2Q A;  5KFX A;  3MR5 A;  2MUT B;  2ZIV B;  1FFU A;  4KLJ A;  2RDJ A;  1PK3 A;  9ICI A;  4BWM A;  3D6J A;  2HHW A;  4DSE A;  3WK6 A;  3ETR A;  4NLB A;  8ICM A;  1ZQO A;  2BDU A;  3PSF A;  1YT3 A;  2FI1 A;  2Z7J A;  2H5X A;  1WUD A;  2K8C B;  3QZ7 A;  4B9U A;  2JEG A;  2ZUB A;  4C8L A;  5HHH A;  3TAR A;  5AKL A;  1L6N A;  1D9D A;  1TVA A;  3S6J A;  4ECU A;  1URJ A;  3C5G A;  4LJX A;  4RQM A;  3FYH A;  1VJ5 A;  3M9N B;  5DG8 A;  2VA8 A;  1ZRM A;  2XO7 A;  2IHN A;  1S8O A;  2G08 A;  3EPI A;  3RB0 A;  3PO5 A;  4I29 A;  4RQ8 A;  1JX4 A;  4B9V A;  4DQS A;  4RZR A;  3M8S A;  1F0M A;  3M6K A;  2W3R A;  1BNO A;  1CI4 A;  4OO1 J;  1N62 A;  1C20 A;  3QUT A;  5AIB A;  3SV3 A;  1UCV A;  2VKQ A;  5ALY A;  3ISC A;  3ZI4 A;  1ZQB A;  4IQV A;  3UMG A;  4K4H A;  3M7D A;  4CF5 A;  4NY8 A;  5IIJ A;  5C0Y A;  4QW8 A;  3ZDB A;  2G0A A;  4AP9 A;  2AHO B;  2K4H A;  2H3F A;  2XVT A;  4Y2Q A;  2XY6 A;  3AUO A;  9ICG A;  5J2D A;  4NL9 A;  3MGI A;  2HOF A;  2FMP A;  3SAH A;  3UQ0 A;  5KFF A;  4Y2Y A;  1QSL A;  3EZ5 A;  1RXV A;  1RM6 C;  1PZN A;  4KX3 A;  3FC4 A;  3Q8R B;  5AKX A;  5A0L A;  5CJ7 A;  1ZYQ A;  1ZQX A;  2Y0S F;  2EAM A;  1TK8 A;  1RG6 A;  2XC9 A;  2RRD A;  3C2L A;  5BPC A;  3N7S C;  8ICF A;  2W8K A;  2W9B B;  3AQE A;  4ED6 A;  4F5R A;  5HMM A;  5KFT A;  4EYI B;  9ICO A;  1L3U A;  3IN5 A;  2Y1I A;  3QX7 A;  4P0P A;  3K75 D;  5ALX A;  2YTU A;  3UPQ A;  3LK9 A;  5ALS A;  2R18 A;  2V4Q A;  2WF6 A;  1MN8 A;  4EZ9 A;  8ICN A;  2Q0Z X;  7ICS A;  1MA7 A;  8ICU A;  4QZF A;  3H4D A;  2KZ3 A;  3PZP A;  1L8O A;  5EWF A;  2J6U A;  5AHX A;  4ZOH C;  5KG2 A;  1NK6 A;  4I2A A;  2EZX A;  4YFK A;  4XUS A;  2FLP A;  2HCF A;  4OCZ A;  4F4Y A;  4KMO B;  2OEH A;  9ICS A;  3RJI A;  5HNK A;  5KNI A;  5KT5 A;  2Y9T A;  2FLL A;  4GIB A;  1YZ7 A;  2R8I A;  4UBB A;  2ZXI A;  2W8L A;  2B21 A;  2KVS A;  3PX6 A;  3NGD A;  1S5L U;  2BR0 A;  1PVQ A;  2H3V A;  8ICS A;  5J0U A;  1WWV A;  2C22 A;  1DXS A;  1MQ3 A;  1IG6 A;  2ZIW B;  2W9A A;  3T5L A;  5J0Y A;  2YML A;  5KT3 A;  4O3N A;  3RFA A;  3AEV A;  5AKK A;  1J97 A;  2K8A A;  1P7D A;  5AI0 A;  1OUQ A;  4KX5 A;  4PHE A;  3BJY A;  2MSN A;  5AKZ A;  4F72 A;  3PX0 A;  3ALR A;  1V38 A;  4DS5 A;  4YMN A;  4IC9 A;  4Z6D A;  5J2J A;  2QLT A;  1RQN A;  5D46 A;  1ZQD A;  3VC8 A;  4YN4 A;  4RQN A;  3SAG A;  3KFU F;  2RHF A;  1NZP A;  4I2C A;  2K4I A;  1KTQ A;  1NOM A;  5AK5 A;  5CB1 A;  5ALU A;  2FMQ A;  3QU9 A;  3TI0 A;  2ZIU A;  1BPB A;  3CNH A;  3TAP A;  4EBE A;  3PV8 A;  4Q8F A;  1N5W A;  3PX4 A;  1XSP A;  4I2E A;  2PI4 A;  4C8O A;  1HEK A;  2HI0 A;  3F2D A;  3RJH A;  1NI3 A;  1Z00 B;  5KFI A;  1COO A;  4DQQ A;  1SZH A;  1A76 A;  2W54 A;  5CR0 A;  8ICP A;  3T5H A;  4ED2 A;  1PVP A;  4CE6 A;  1MSW D;  3H8J A;  5AK4 A;  5KG3 A;  1ZJM A;  2IOF K;  4KLM A;  2HHS A;  3K4G A;  4ECQ A;  4NLN A;  2GOL A;  4Y2R A;  3M6Z A;  3BZC A;  2OCE A;  4F5N A;  5AKY A;  4Q45 A;  4M9J A;  8ICW A;  8ICQ A;  5EE3 A;  5CA7 A;  1ECW A;  2E8M A;  4QIW F;  5DBB A;  8ICV A;  1T7P A;  1U4B A;  5E79 U;  4UQG A;  3WU2 U;  1ARO P;  2OH2 A;  3LVW A;  8ICZ A;  4IQU A;  7ICK A;  5KFG A;  5BOL A;  4JK1 A;  5AM4 A;  2V9W A;  2MRL A;  2IMW P;  2JHD A;  4KLF A;  9ICH A;  5GTI U;  3IDW A;  2ALZ A;  4QZ8 A;  3SI8 A;  3PNC A;  9ICE A;  4KLH A;  3LVV A;  3BZK A;  1TAU A;  1ZET A;  4F91 B;  3B0X A;  5AM2 A;  1JMS A;  4KMU A;  3Q8S B;  3WKB A;  4YR3 A;  4FO6 A;  4RQ2 A;  2N1R A;  2MU2 A;  2HVH A;  4XA5 A;  2E3T A;  4DF8 A;  3NVY A;  5ALJ A;  2K4P A;  1HJP A;  1S0V A;  3RRG A;  4KLG A;  5J2K A;  1KN5 A;  1XNS A;  3T5J A;  3V72 A;  1UT8 A;  2DPJ A;  2J6S A;  4OD0 A;  4NM1 A;  5KFJ A;  4P0P B;  2B6G A;  4EYH B;  4DEZ A;  3PVX A;  4UAT A;  8ICB A;  4F50 A;  2P66 A;  4UB4 A;  4NLK A;  2EZZ A;  4GFJ A;  2ZTD A;  5EE0 A;  3THV A;  4PZO A;  2W3S A;  5KG7 A;  3H8M A;  4ECY A;  3D2N A;  4IQW A;  3A0H U;  2OYY A;  2ZIV A;  3LYS A;  3H40 A;  3BQT A;  2KHV A;  5HML A;  4KIT B;  5TIS U;  1RXW A;  3WK4 A;  1KRP A;  5DGB A;  4YVZ A;  3E58 A;  5ALM A;  2AJQ A;  4DSL A;  3GIJ A;  2CXY A;  2ZTC A;  4DL4 A;  2IOH A;  1UT5 A;  3PW5 A;  1BVS A;  2LYA A;  3GII A;  4QZB A;  2EH9 A;  2MA1 A;  4YXJ A;  2AGP A;  2C2R A;  4ED1 A;  4QWD A;  4JMU A;  4J9M A;  2VJ4 A;  3C1Y A;  2BQ3 A;  5EOZ A;  1KFS A;  2FPL A;  2BQR A;  3JPS A;  3SV4 A;  2HHU A;  4M9H A;  1JAL A;  3K1R B;  1RQL A;  4FZL A;  4M9G A;  4O3R A;  2KKP A;  4C8M A;  5J2E A;  1KDH A;  7ICF A;  2KN7 A;  9ICF A;  2FPM A;  2QKQ A;  4Y2X A;  4YD1 A;  2KVC A;  3QEA Z;  4M6W A;  1L7N A;  4QWE A;  3QU2 A;  4J9K A;  3PW4 A;  2QB0 B;  5H2F U;  1ZQF A;  1ZQI A;  9ICN A;  2NO4 A;  5J8Y C;  3RJG A;  4KLO A;  4M2Y A;  2LHT A;  2W9B A;  1ZQH A;  1S0O A;  2YB1 A;  4UB2 A;  1TAQ A;  4F4X A;  9ICB A;  5F9L A;  1DGS A;  2JMG A;  1B4F A;  4M04 A;  2KJ5 A;  3HP6 A;  2GO7 A;  3QUQ A;  4LVS A;  1C7Y A;  2PKE A;  5KFL A;  1SL0 A;  2GWS A;  9ICR A;  5DBC A;  4DL2 A;  4PGQ A;  9ICA A;  5J0Q A;  5J0S A;  5KG6 A;  1QQ5 A;  5EWE A;  4I2G A;  4WJ3 B;  4EBC A;  4I2B A;  2JV3 A;  4QIW C;  2ASJ A;  3SEI A;  5III A;  2WAQ F;  5HR6 A;  3RB4 A;  5KFU A;  1LKY A;  2KEY A;  4ELU A;  4P4P A;  3LWL A;  2UVU A;  3IHQ B;  1JUD A;  5TZV A;  3OPX A;  4B9M A;  4MFA A;  4EBD A;  3KD3 A;  3V7J A;  3RBD A;  4GLX A;  5DG7 A;  1LB2 B;  4C7Z A;  7ICQ A;  2NRW A;  3KOO A;  3QNM A;  3SZ2 A;  1V85 A;  2KIC A;  2ZJ8 A;  3DEE A;  3PR4 A;  2EDU A;  3QE9 Y;  5KL1 B;  4C4T A;  3C21 A;  1TV9 A;  2KZZ A;  1U48 A;  4B9L A;  4XQ8 A;  4YQW A;  2KFN A;  5J0O A;  5EE1 A;  3NVW A;  2WF5 A;  1N48 A;  1K1S A;  1JN3 A;  1ZQE A;  2LM1 A;  4F5Q A;  2BKE A;  2LMR A;  4HAI A;  3JPR A;  4UB3 A;  2W9C A;  1UQV A;  4JUZ A;  4NLG A;  4C80 A;  1JRO A;  4YG2 A;  1N61 A;  3WKD A;  4M0A A;  1H38 A;  5KFA A;  1NK4 A;  4J9Q A;  4IRC A;  1VLB A;  1XS9 D;  3V6J A;  5D4B A;  3AQF A;  4JV2 A;  2BCS A;  4ED3 A;  4UBC A;  2ZIW A;  1N63 A;  4UB1 A;  1L3T A;  4DOA A;  3V6H A;  1D8Y A;  4CNQ A;  3FM9 A;  4I2F A;  2W7P A;  2W11 A;  2KIW A;  3G6Y A;  1BNP A;  1U45 A;  2P35 A;  2AH5 A;  3SEN A;  1KBU A;  8ICG A;  2JEF A;  5AIA A;  2ESE A;  3QU5 A;  1DGJ A;  4M9L A;  3GDX A;  3BS5 A;  3NUQ A;  1F44 A;  5KFN A;  2A3V A;  2KIV A;  5KL8 B;  4QZA A;  1ZQP A;  1QTM A;  4DLG A;  3B0Y A;  2F3N A;  2O6K A;  3U26 A;  4QZ9 A;  4AYB C;  1OXJ A;  1NJW A;  2ZIU B;  1ED1 A;  1BPX A;  5ALN A;  5CP2 A;  4QZG A;  7ICT A;  1KFT A;  1NK7 A;  3M9M B;  1RYU A;  3RF9 A;  3N7R C;  3ZDD A;  1ZQS A;  1Z00 A;  1TK5 A;  4PZN A;  3QZ8 A;  2A1A A;  2FMS A;  4I2I A;  5DB9 A;  1N60 A;  5KT4 A;  3KHH A;  3HW8 A;  4M47 A;  3HIL A;  2HMX A;  2C28 A;  2JXJ A;  1QSS A;  1ZD4 A;  2NRT A;  3E0F A;  5KT7 A;  4J9S A;  5AM0 A;  1KFD A;  1KL9 A;  3I76 A;  3D2S A;  5ALP A;  3KBB A;  1XC9 A;  3LDA A;  2M0N A;  3MFH A;  3SMV A;  1Q46 A;  1QCK A;  2KJ8 A;  3C2K A;  4R63 A;  4EX7 A;  5DQI A;  2XI9 A;  3Q8P B;  4EEK A;  3ETL A;  5ALH A;  1V97 A;  5J0X A;  3OHA A;  2DL0 A;  2W55 A;  3I28 A;  5J2G A;  4MHV A;  1TK0 A;  1L7M A;  2ATL A;  1PUZ A;  5DDY A;  3HKZ F;  5ALZ A;  2ISP A;  5J2C A;  1LV5 A;  2PI5 A;  1UA1 A;  4TQS A;  2BGW A;  5DQG A;  4OJ6 A;  4Z6C A;  2WHE A;  3ZD8 A;  3EW9 A;  5KFS A;  4DL6 A;  2JR5 A;  2J6T A;  4IR9 A;  4HYK A;  4KLL A;  1V9P A;  4Y2T A;  5AI9 A;  4MEX A;  3C23 A;  2ISO A;  3QYP A;  4DOB A;  3OSN A;  5DBA A;  3AU2 A;  3H7I A;  4I2D A;  5G5G A;  4RQ1 A;  1SV4 A;  4J9O A;  4O5C A;  1HUO A;  1LKY B;  4KN7 A;  5HR7 A;  5AKI A;  5AIC A;  1COK A;  2XY7 A;  2I1Q A;  4O3M A;  4Q44 A;  3WK8 A;  3HRD D;  8ICE A;  4DQI A;  4F2S A;  4ECW A;  2HHT A;  5KT6 A;  2R8K A;  5CEH A;  5JUM A;  4G9B A;  4KLE A;  1ZQ1 C;  1ZQG A;  1LVH A;  3QEB Z;  1B22 A;  2F8L A;  3N7P D;  4P4O A;  3OHB A;  3EYZ A;  4IR1 A;  9ICC A;  2BCR A;  2ZJ5 A;  1S0N A;  4LZG A;  2MAX A;  2W04 A;  3WK5 A;  2XCA A;  2NRV A;  4DLE A;  3UXO A;  1RYS A;  1JRP A;  5DGA A;  1S0M A;  2WTF A;  1S10 A;  4C8K A;  5KFZ A;  4RNM A;  1A0P A;  1N2X A;  4QZH A;  3JPO A;  5JTI A;  1F5S A;  1KLN A;  2VJ5 A;  5L1L A;  2ZXH A;  5J2I A;  5G5H A;  1PVR A;  5AM1 A;  4DFK A;  1Q3U A;  3L4P A;  9ICP A;  2HBJ A;  2Y9U A;  5KFD A;  4ECX A;  3IP4 B;  2DKZ A;  3MGH A;  5KAI U;  4M9N A;  4M6W B;  1X6I A;  5KFC A;  3TAQ A;  1NZB A;  4J9P A;  2W03 A;  4G3I A;  3C29 A;  1JIH A;  7ICN A;  4F93 B;  4Z6F A;  2GH1 A;  4PL1 A;  3HKZ C;  1ZQZ A;  3ZDA A;  5J2B A;  3BQ7 A;  1ZD3 A;  1IIP A;  3ISD A;  2HHV A;  4KTQ A;  1Z1B A;  1L7O A;  5L1M A;  4CRX A;  3KHR A;  2KP7 A;  7ICG A;  2KHQ A;  4BX9 C;  4BXO A;  2K60 A;  5B66 U;  3MAB A;  5B5E U;  3Q8M A;  4EX6 A;  2UVR A;  2VAN A;  4FBT A;  2ODG A;  2LKY A;  4C7Y A;  2E1F A;  4GXJ A;  2EAP A;  3GIL A;  3I1Y A;  5EE9 A;  7ICM A;  4ELV A;  1WCN A;  4UB8 U;  4U7C A;  2YMP A;  5AI8 A;  1ZQR A;  9ICM A;  2E5S A;  5FP0 A;  4C0Z A;  4GXK A;  2NV3 A;  3HJE A;  5AK6 A;  3GQC A;  2ZG6 A;  1PK1 B;  4R8U A;  1SWW A;  3IG8 A;  1N5X A;  3ONN A;  2KG5 A;  2NRX A;  4PHD A;  4GC7 A;  5J29 A;  2VA3 A;  4FE3 A;  4P2H A;  2ZIX A;  5ALL A;  3TQ1 A;  4PL2 A;  2F2A B;  5J0W A;  3SQI A;  1WG8 A;  4O3Q A;  4UW9 A;  2KNJ A;  4YD2 A;  2JZB A;  4R66 A;  1T3Q A;  2PFP A;  3PSI A;  4US8 A;  3IM1 A;  1L7P A;  4DFP A;  3ORY A;  1S97 A;  9ICT A;  2YMQ A;  2JRZ A;  5HP4 A;  1SV0 C;  5ALD A;  3WKA A;  2HOI A;  3TAN A;  4NL9 C;  1SB3 C;  2H3Q A;  3NVZ A;  2I5H A;  4GXI A;  2E8N A;  2EZY A;  1ZQA A;  4KLS A;  1SV0 A;  1NK5 A;  5DLG A;  1IM4 A;  3DDH A;  3GZF A;  2DBY A;  2PFO A;  3KKA A;  3RH4 A;  1X9S A;  3NVV A;  3RTV A;  2WB1 F;  3HX0 A;  2YY6 A;  4RUA A;  2DFL A;  4UAS A;  4YXM A;  4DFJ A;  4DSK A;  1ZQL A;  2NRZ A;  2B0C A;  1Z19 A;  4BXO B;  2P6R A;  4PJ0 U;  3V7L A;  4O3P A;  4TQR A;  2PXI A;  4Q43 A;  2RP5 A;  1D8B A;  4JV1 A;  2KZM A;  1U47 A;  3KTQ A;  3H4B A;  1NKB A;  1L8L A;  3H0M B;  4ECS A;  3CW2 C;  3PST A;  4IS7 A;  4QNL A;  1S77 D;  1ZQQ A;  4C4R A;  1QQ6 A;  2JGA A;  4F3O A;  1SGG A;  3KKA C;  1CUK A;  2QB0 A;  1U49 A;  3CRX A;  3UQ2 A;  4RUC A;  3EWA A;  4O5E A;  1FEZ A;  3RH6 A;  4PHP A;  5ALT A;  1ZD2 P;  3E2E A;  5L1J A;  4MFF A;  4UAW A;  4FS2 A;  5T14 A;  5AK3 A;  4B9N A;  3GU3 A;  5ALG A;  4B9S A;  4RT3 A;  3GFK B;  2C2E A;  1MQ2 A;  2KMD A;  4IQT A;  3V6K A;  8ICY A;  2ES6 A;  1KSP A;  1NJX A;  5KFB A;  2A19 A;  4ED0 A;  3WK7 A;  2LBO A;  3VCB A;  2KJ9 A;  4RQ5 A;  2MUT A;  1SWV A;  2A1J B;  3T5K A;  2G07 A;  2DPI A;  4UAZ A;  1N56 A;  2BDP A;  1SKW A;  5KFV A;  1T4G A;  5DG9 A;  9ICU A;  4F71 A;  3HWT A;  4UAR A;  2CPR A;  2KSO B;  1JXE A;  3IG5 A;  8ICH A;  2KD1 A;  1RYR A;  4DSJ A;  3RB6 A;  4Y2V A;  3N4M B;  4XRH A;  3RJK A;  4TUR A;  1Z3E B;  1TAM A;  4ED8 A;  1JI7 A;  3ISB A;  4DOC A;  3TKA A;  2AQ0 A;  1EXN A;  2KK0 A;  3RJE A;  3K1Z A;  1S76 D;  2YB4 A;  4ECZ A;  5KT2 A;  4TUP A;  3G6X A;  2YX8 A;  4F8R A;  1DK3 A;  2E8O A;  5J2H A;  1BPY A;  3ZD9 A;  2IOF A;  4Y2U A;  5J0T A;  9ICL A;  1Q8K A;  4MF2 A;  3MDC A;  4K4I A;  2HSZ A;  1X42 A;  2AQ4 A;  2ZTE A;  4PHA A;  1TKD A;  3MR2 A;  4I2H A;  3KZI U;  4AYB F;  3QU4 A;  2OHF A;  2I6X A;  3QUC A;  5EWG A;  1M6Y A;  2W7O A;  3RR7 A;  1ZQV A;  2KFZ A;  2KOB A;  3HT3 A;  4EEL A;  3RAX A;  5KFH A;  3MC1 A;  8ICA A;  1O08 A;  3M1Y A;  4F92 B;  4DWI A;  1RDF A;  1BPE A;  2F77 X;  4F4Z A;  1JXL A;  4FZM A;  1BPZ A;  4EZ6 A;  4Q8E A;  2NYV A;  9ICX A;  5D49 A;  3MFI A;  3SYZ A;  4IL6 U;  3WKC A;  3F2C A;  5DDM A;  4RPY A;  4Z6E A;  4QW9 A;  8ICK A;  4O3S A;  1XSL A;  3UM9 A;  1ZQC A;  1XO1 A;  2OWO A;  3NRZ A;  8ICC A;  2XGP A;  3BS5 B;  4BDP A;  1QSY A;  4OJ5 A;  1DRG A;  1WYG A;  5IIM A;  4FS1 A;  4RT2 A;  2FDR A;  3UMC A;  5L1I A;  4US9 A;  2ZIX B;  8ICR A;  2EQY A;  4QZI A;  5DQH A;  1X66 A;  3F5A A;  2OM6 A;  2FJ6 A;  1DOQ A;  4RNO A;  2YMM A;  3OGU A;  1ZQT A;  9ICK A;  2DWQ A;  4CF3 A;  4U6P A;  5ALW A;  2I9G A;  3NRW A;  3PSP A;  1A6S A;  3BQ0 A;  4F4K A;  1VDV A;  1KQQ A;  4RQ4 A;  4R65 A;  2IA6 A;  5KG4 A;  2F76 X;  5F9N A;  4J03 A;  1Y88 A;  2QAR B;  2ASL A;  4MF8 A;  2NO5 A;  7ICU A;  2YQE A;  4ECR A;  5HHI A;  1WCL A;  1NNL A;  4DF4 A;  4QWC A;  2JH7 A;  5ALV A;  1ZQY A;  1KKX A;  3MGV A;  4RPZ A;  4KLQ A;  2IBK A;  1SKS A;  1D8L A;  5KFY A;  4P0Q A;  2JEJ A;  3T3F A;  5IIO A;  4JB3 A;  1XWL A;  2BQU A;  2LPE A;  4O9M A;  3H8W A;  2HOQ A;  3GIK A;  1IXR A;  3T79 A;  1SXE A;  1SZP A;  2L5Y A;  2LYB A;  4MEY A;  3F53 A;  4CCH A;  4DL5 A;  1GO3 F;  4RQ0 A;  4JV0 A;  5ALQ A;  2D3D A;  3GV7 B;  1RPL A;  3TAD A;  5KFM A;  4FFD A;  3M9O B;  4E0D A;  4DL3 A;  4QZD A;  4YP3 A;  1L3V A;  2ASD A;  3RB3 A;  2C2D A;  5C5J A;  3FDS A;  3O0F A;  4FBU A;  4R8U B;  2HBK A;  2CN1 A;  1ZQK A;  3AN1 A;  4Y2J A;  3Q8K A;  4K4G A;  3OSP A;  4O0I A;  1U9L A;  1X2I A;  1NJY A;  8ICT A;  4CDG A;  4BWJ A;  4UAY A;  1B43 A;  2A1J A;  4DSF A;  4CGZ A;  2XCP A;  1X40 A;  5DB8 A;  2R8G A;  1T8E A;  3V7K A;  3NTU A;  1T3N A;  3ZDE A;  1BPD A;  3RH5 A;  5J8Y A;  1X9W A;  2V4R A;  5J2A A;  1PK1 A;  3EPG A;  2KV2 A;  1J2N A;  3JPN A;  2G06 A;  7ICR A;  2K89 A;  4YMO A;  2WAQ C;  2F44 A;  2DUY A;  1UPH A;  4DFM A;  4X5V A;  7ICE A;  2WF7 A;  3ED5 A;  5DLF A;  1ZD5 A;  4YR2 A;  4TUQ A;  1K1Q A;  2E8P A;  5KFW A;  4J9L A;  2DQN B;  4I27 A;  2AU0 A;  1X9M A;  2BZF A;  3TFS A;  1Z1V A;  2W9M A;  4JWM A;  2D6F C;  4TUS A;  4I28 A;  2DF4 B;  9ICV A;  1K5O A;  2EAN A;  2M9N A;  5ALK A;  3C1Z A;  4F2R A;  3RBE A;  4KLT A;  1SXD A;  1L3S A;  3RR8 A;  2LM4 A;  2XID A;  5DB7 A;  2HBM A;  5ALR A;  1ZQW A;  3QUB A;  1FFV A;  3GV8 B;  8ICL A;  5KFQ A;  5ALE A;  3IV6 A;  3H0R B;  4O5K A;  8ICO A;  3L5K A;  5AI6 A;  4IRK A;  1BGX T;  4YCX A;  2H3Z A;  3GIM A;  4BGD A;  1QH9 A;  4ED7 A;  3ZDC A;  2JH1 A;  4DL7 A;  2BCV A;  3SD7 A;  2XIC A;  3OTQ A;  1B0X A;  3F5E A;  3ICX A;  3MR6 A;  5J0R A;  2W43 A;  3JPT A;  4R64 A;  4F4W A;  2PFQ A;  2UVW A;  5JRT A;  4RPX A;  2F8K A;  3PML A;  4NJ8 A;  4RNN A;  2ZUC A;  3MBY A;  5IIN A;  5L1K A;  4DQR A;  4LZD A;  3JPQ A;  4DQP A;  4Y2S A;  2G09 A;  5ALO A;  4F5P A;  4QWA A;  3RJJ A;  2AGQ A;  3PR5 B;  2AGO A;  1NKE A;  4O3O A;  2WF9 A;  7ICJ A;  5KFE A;  4OJL A;  1T94 A;  4NM2 A;  4MFC A;  7ICP A;  2P6U A;  3TAC B;  2AXT U;  2OXO A;  2XY5 A;  2KKV A;  3OJS A;  2BHN A;  3SR6 A;  3L3F X;  5AI5 A;  2BPG A;  1A77 A;  1NK0 A;  2GLE A;  1ZQN A;  1TFR A;  4RU9 A; 
#chains in the Genus database with same CATH homology
 2QB0 B;  2LPE A;  2QB1 A;  1F0M A;  1Z1V A;  5J8Y C;  2B6G A;  2KG5 A;  1SXE A;  2EAN A;  2L5Y A;  1SXD A;  2KMD A;  1UCV A;  5KNI A;  2ES6 A;  1B4F A;  2DL0 A;  2Y9T A;  2DKX A;  2D3D A;  4MHV A;  3TAD A;  4PZO A;  3H8M A;  5JTI A;  2E8M A;  1SV0 C;  2QAR A;  3SEN A;  2KSO A;  1WWV A;  4NL9 C;  3BS5 B;  1DXS A;  3TAD C;  2ESE A;  2JV3 A;  2Y9U A;  3SEI A;  1KW4 A;  2E8N A;  2DKZ A;  1LKY A;  3BS5 A;  1WWU A;  4NL9 A;  1B0X A;  2KIV A;  1SV0 A;  5JU5 A;  2KSO B;  1PK3 A;  1X66 A;  3IDW A;  1X9X A;  2EAO A;  3BQ7 A;  5F3X B;  1V85 A;  3KKA A;  5JRT A;  2EAM A;  2F3N A;  2F8K A;  1RG6 A;  1V38 A;  4NJ8 A;  1OXJ A;  1JI7 A;  5L1M A;  1SV4 A;  4RQN A;  1X40 A;  2K60 A;  2QAR B;  1OW5 A;  2E8O A;  1LKY B;  2YTU A;  5J8Y A;  3K1R B;  2EAP A;  2FE9 A;  1PK1 A;  3TAC B;  2K4P A;  4PZN A;  1COK A;  2KE7 A;  4RQM A;  3HIL A;  2F44 A;  4IS7 A;  2LMR A;  3BS7 A;  2QKQ A;  2D8C A;  1SGG A;  3KKA C;  2QB0 A;  1UQV A;  2E8P A;  2GLE A;  1PK1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...