1X40A

Solution structure of the sam domain of human arap2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
GSSGSSGMSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRILKQLQIILSKMQDIPIYASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SAM domain of human ARAP2
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords ARAP2
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1x40A00
2EAOA 4NL9A 1SV4A 2K4PA 1PK3A 1B0XA 1JI7A 2E8MA 2Y9TA 2ESEA 5JTIA 2K60A 1PK1A 2D3DA 5L1MA 3BS7A 1COKA 1UCVA 4RQMA 3SENA 2KSOB 2YTUA 2LPEA 4NL9C 2EANA 5JU5A 2QB0B 2Y9UA 2D8CA 3TACB 2QARB 5J8YC 1UQVA 2GLEA 1WWVA 5F3XB 3TADA 1SXEA 2E8PA 4RQNA 3IDWA 1PK1B 1V85A 1X9XA 1F0MA 4PZNA 2QKQA 2EAPA 2F3NA 1OXJA 1SV0C 3SEIA 2KIVA 2DKZA 2E8NA 1DXSA 1WWUA 1KW4A 2QARA 3K1RB 2F44A 1X66A 2EAMA 2ES6A 3BS5A 1LKYB 2DL0A 5KNIA 2KG5A 1RG6A 3HILA 2FE9A 2B6GA 4PZOA 3H8MA 2LMRA 4NJ8A 1SXDA 2L5YA 4MHVA 2DKXA 1OW5A 1SV0A 2KMDA 3KKAA 2F8KA 1B4FA 4IS7A 2QB0A 2QB1A 3KKAC 1LKYA 1SGGA 3BS5B 2JV3A 5JRTA 1V38A 2E8OA 3TADC 1Z1VA 2KE7A 5J8YA 2KSOA 1X40A 3BQ7A
chains in the Genus database with same CATH superfamily
4YMOA 3KD3A 3QEBZ 3M9MB 3EUB2 1K1SA 3SD7A 1SV4A 3K1ZA 4E0DA 2C2RA 2ALZA 1T8EA 1JN3A 3JPPA 4QW8A 5GTHU 5AIBA 2E5SA 3BS7A 4B9UA 4PHPA 3MFHA 3ZDDA 5KL1B 5IILA 2HI0A 3V6HA 1TAUA 5AKEA 3RJGA 4OJLA 3I1YA 5J0RA 5F3XB 3TADA 1UT5A 3WKAA 3FYHA 4CF4A 1MQ3A 3ZD9A 2W9AA 5E79U 1L6NA 2ZXHA 5AKHA 1D9DA 4BX9C 5AK5A 4QZ9A 1N60A 7ICMA 4YCXA 3PVXA 2GOLA 2HDOA 1S5LU 2Y1JA 1RYRA 5J2AA 5ALMA 5CP2A 5JUMA 2KVCA 3LYSA 1F44A 4RQ3A 8ICFA 4KLEA 5KG1A 1FO4A 2AJQA 5KNIA 3MR2A 1ZQEA 3WKCA 4C8NA 2JRZA 3LK9A 4B9NA 2WAQC 4IRKA 4PPXA 2XGQA 4M9JA 3FC4A 2HBLA 5KFSA 5L1LA 3TAPA 1S9FA 2M9NA 3M6ZA 3KHRA 2ZTDA 4M04A 2H5XA 1KRPA 4M47A 4F4ZA 2FI1A 4IS7A 2IOFK 3UMCA 3UMBA 5IIIA 4USAA 1KN5A 2KE7A 4KLUA 1RM6C 2AQ0A 2Q0ZX 1T4GA 3PSFA 1N62A 2W11A 2EAOA 3PR5B 3TFRA 1XS9D 1ZQXA 5AM1A 4DCCA 2GH1A 1NNLA 1QTMA 5AKKA 1PK1A 5J2BA 4UB4A 5AM4A 3GIKA 2WHEA 3L3FX 3RH6A 4PHEA 4UB1A 4I28A 4Y2XA 5DKWA 4CF5A 1ZQBA 2BZFA 2ZIUA 3AQFA 2QB0B 5AM3A 4KMUA 1ZD2P 2JH1A 4RQ4A 5J8YC 3OTQA 4UB6U 2OM6A 1N5XA 1DOQA 1DGSA 1L7MA 3E0FA 2EZZA 1ZQ1C 1QSYA 1NK6A 2W8LA 4MEXA 2EAPA 2KZMA 2ASJA 4KLTA 2BQUA 3F2BA 1SV0C 2AGPA 4KLGA 5BOMA 9ICHA 3AU6A 5J0XA 1DXSA 5J0WA 5TISU 5KFIA 2W04A 2ES6A 3EPIA 5J0QA 1J97A 3HPOA 4ED8A 3JPSA 1ZQHA 2V9WA 3HILA 4I2BA 4XRHA 3PSPA 3AMZA 4UB5A 4IQWA 1QCKA 3RJIA 4OD0A 1OW5A 9ICMA 2IHMA 2C2EA 1NK7A 1NJZA 4FS1A 3M9OB 5DB8A 4QZEA 4O3NA 3C1ZA 1X42A 4B9MA 4Z6FA 4TUQA 9ICBA 3BS5B 1ZD4A 4F4YA 1S0NA 1SL2A 4DO9A 2W7OA 2BCVA 5ALKA 4J9QA 9ICTA 2XICA 5J0TA 4QWCA 1F5SA 4DLEA 4PL2A 2J6SA 2E1FA 1U45A 3HW8A 5J2HA 3RJFA 1ZQGA 4I2CA 3IV6A 1JI7A 4QZFA 2Y9TA 3CRXA 3RRGA 5KFPA 5KT6A 2C2DA 5DGAA 2K8AA 4QZGA 4C7ZA 3SV3A 2LPEA 5B66U 8ICEA 3TQ1A 3RBEA 3N7PD 1ZQZA 1ZQUA 3QUQA 4LZGA 3WK6A 3T5HA 7ICSA 1HJPA 4QIWC 4ECXA 4RQ6A 1JXEA 1Z4OA 3G6YA 1Z4NA 4M9GA 4EBEA 1V85A 3QU4A 5GTIU 3SMVA 5EOZA 4Q43A 3ZDAA 4R63A 2FLPA 9ICXA 2QKQA 1OXJA 3MGVA 2OEHA 1UA1A 3NVZA 3NTUA 2HHWA 3BZCA 5G5GA 5KT7A 4RQ1A 4EENA 4QZAA 5J0YA 5ALOA 7ICKA 1L3VA 2JEFA 5CJ7A 2ATLA 1YZ6A 4ECUA 4F5QA 4Z6DA 4KMOB 1XSLA 3HT3A 1DRGA 3N7SC 8ICKA 2LMRA 5AIAA 5AI6A 5ALTA 3OJUA 5B5EU 2XY7A 2HCFA 2DKXA 3PW2A 4UB8U 4PJ0U 2O6KA 4Y2UA 9ICUA 5F9LA 1IG6A 4UW9A 4RZRA 4DL5A 2KKPA 3KKAC 4KX5A 1L5UA 2KFZA 1LKYA 1NOMA 4BXOA 2E8OA 4GXJA 4IQUA 1L7OA 1PUZA 3SI8A 5IIMA 4ECWA 2FMPA 3ZDCA 4BJQA 5J2CA 2RRDA 4ED1A 2IA6A 2W8KA 4O3SA 4DL4A 1B0XA 1SWWA 2LM1A 4ECQA 1CEZA 4I2AA 5AHXA 1N61A 4O3PA 4Y2PA 3TI0A 4DSKA 3F2DA 4O3OA 4F5NA 4RQ5A 4I27A 4F2SA 5DG7A 3OJSA 2H3VA 5DDMA 4K4IA 7ICHA 1RQLA 1ZOLA 5JU5A 2W9MA 5IIJA 8ICAA 2RP5A 1ZQQA 4DQSA 4NV0A 7ICQA 3BQ1A 4F5RA 4JK1A 4BUGA 4O3QA 3AM9A 4G3IA 2KICA 1XO1A 2P6RA 1KQQA 4QWDA 4FZMA 8ICJA 4MFAA 3IG8A 3PW7A 1WCLA 3QUCA 2VIXA 5ALYA 4Q8FA 4O3MA 4CF3A 3D6JA 4UASA 2K4IA 5KFLA 1L7PA 2QARA 4FBUA 4MFFA 2F44A 1ZQCA 4BXOB 2BHNA 4RU9A 2KZZA 2DL0A 4DFMA 5AI4A 3E2EA 4YXMA 4RNNA 5KFBA 4YN4A 5J2KA 5ALVA 1COOA 2HHUA 1VDVA 4ECYA 4CDGA 4EZ6A 2KMDA 3TANA 2ZTEA 3KKAA 2W9CA 1NJYA 4O9MA 5KG5A 1XWLA 1SZHA 1U48A 1QH9A 3WK4A 4J9RA 2QB1A 3MFIA 5AKZA 4QZCA 4DSJA 4MF2A 4O5EA 4OJPA 4U7CA 3BJYA 4UAZA 1Z1VA 5KT5A 2BR0A 2YY6A 4QW9A 3ED5A 2Y0SF 4I2JA 5AKJA 5KFXA 1N5WA 3E58A 8ICLA 5KG7A 3UXOA 1Z00A 2HOQA 1RDFA 1Z1BA 2NRWA 1D9FA 3K4GA 3M7DA 8ICZA 3KZXA 1BPZA 4NL9C 1U9LA 2H3QA 3EYZA 4BWJA 2WF6A 3PR4A 1NZBA 9ICVA 5DQIA 4CNQA 4NLCA 3N4MB 3ISBA 2KV2A 5DBBA 3KHLA 2R8JA 4ZOHC 1B43A 5J29A 2DPJA 3CNHA 1F0MA 2KJ5A 4NXZA 1QSSA 1ECWA 2OCEA 4RT2A 1ZQAA 2YMLA 4EBCA 3HKZC 3KHHA 1SWVA 3GIMA 2WTFA 4C4TA 2B0CA 3QYPA 3BS5A 3H0RB 2KG5A 9ICIA 1RG6A 4R8UB 3Q8PB 5AI8A 4QWBA 5KFAA 9ICKA 5KFNA 3GIJA 1URJA 4UB2A 5KFZA 1BNPA 2QB0A 2IMWP 4PGYA 1HUOA 3ISCA 5KTQA 2HVIA 5C5JA 1FIQA 2MA1A 4GXKA 2PXIA 3QZ8A 3GDXA 3GZFA 5ALJA 4DQQA 3M6KA 1DK3A 2WF5A 3H0LB 5KFDA 1NKBA 3SAHA 1BNOA 3NASA 3UXPA 5ALGA 7ICVA 2E8MA 4KLLA 3NVWA 3M9NB 3RAXA 3IG5A 3UM9A 1N63A 4EX7A 1A6SA 2DQNB 3THVA 4YVZA 2YQEA 5DLGA 1NKEA 3QU7A 4RQ2A 1ZQOA 4TUSA 2JEJA 4F50A 1X6IA 3KBBA 3DDHA 1TK5A 1A77A 2PMZC 1PK1B 4KLQA 3MR3A 2ZIXB 1TAMA 2JH7A 4EYIB 1ZQFA 4R66A 4B9LA 5HHIA 2BPCA 5F9NA 4I2HA 2HOFA 3JPRA 3T79A 3PMNA 5AKYA 5FP0A 2AGOA 3AEVA 4IQTA 4DFPA 4YMNA 3GQCA 4B9SA 1ZRNA 3Q8RB 4P0QB 4DOAA 3AN1A 2RHFA 4F2RA 3Q8QB 4YD1A 4UAWA 3AQEA 1S97A 5KAFU 3PV8A 2HHSA 4M9NA 4M9HA 1BVSA 4DQPA 4NM1A 4MHVA 3VC8A 4ICAA 3PSIA 1X9SA 5J2FA 3C5FA 2XGPA 2DBYA 3SAGA 4FE3A 4JV2A 1ZQYA 4IC9A 1BGXT 2JV3A 5ALZA 8ICTA 3ONNA 5AKGA 9ICEA 5KFJA 4LVSA 4CGZA 3PNCA 2GO7A 1KFTA 1HUZA 4C8MA 2LM4A 5KT4A 3NRWA 1MSWD 4IRDA 3CYMA 2KKVA 4RUCA 1NZPA 2JXJA 7ICJA 3ZD8A 3M8SA 3EW9A 4R64A 5AM0A 1AQ6A 2XI9A 7ICIA 2JHDA 3MABA 1DGJA 1ZD3A 2OHFA 2YN4A 2JEGA 2D8CA 5IINA 1L3TA 2NRXA 1ZQSA 5AICA 2GLEA 5BOLA 4UBCA 1Y88A 5KAIU 1C7YA 3T5KA 3PZPA 5CA7A 1BPYA 3D2SA 4NLNA 4C0ZA 4F5PA 4RNOA 4QJFB 2JZBA 9ICOA 2QLTA 9ICWA 4G9BA 2BKEA 1LVHA 1QQ7A 2ZIWA 5ALUA 3MC1A 2DWQA 2MU2A 2BCUA 1ZRMA 5KFWA 4UATA 1S10A 4C4RA 1IXRA 1JXLA 4IQVA 2KZ3A 4Z6CA 1TK0A 2G09A 5DBCA 2OXOA 3NRZA 1KDHA 3RFAA 4C8LA 1NJXA 1U49A 5DB7A 5J2EA 3H8MA 3RR8A 2ZIVB 3LWLA 3H8JA 2E1EA 1SL0A 1ZYQA 2KOBA 3SR6A 3Q8SB 2EQYA 4NM2A 2VJ4A 5CEHA 1IM4A 2LHTA 3RH4A 3Q8MA 2XVTA 1WUDA 2VA8A 4PH5A 1Z19A 9ICGA 2VJ5A 3H7IA 2WAQF 2F1HA 8ICBA 4I2GA 2W3RA 4A8EA 4NL9A 4YR2A 4RQ7A 2ZTCA 4OCZA 1JALA 1IV8A 4QIWF 5JTIA 5ALQA 1XU4A 2G5IB 4LJXA 5AI5A 4RQMA 4NLBA 5D46A 2FLLA 1SZPA 2XIDA 1M6YA 2JMGA 1EXNA 4Y2SA 1JROA 1PVRA 4QWAA 2WF7A 5DBAA 2AXTU 2QARB 5IIOA 1VJ5A 3QUTA 2HBJA 1XSPA 1Q8KA 3M8RA 4MF8A 3IDWA 5J0UA 5AKLA 2HHTA 1QQ6A 3V7LA 4DSLA 4GLXA 4FZLA 2HSZA 4J9NA 7ICTA 2E3TA 2LYBA 3RR7A 2C22A 4GC6A 1QSLA 3DV9A 1LKYB 2IBKA 4FS2A 1Q3VA 5BPCA 4QZ8A 4RQ0A 2YMQA 4R65A 3WKBA 2IOHA 1RXWA 1RZTA 5KFHA 3PO5A 3DEEA 2UVWA 3JPNA 2KJ8A 4ED7A 1ZQRA 3SYZA 3TADC 4IR9A 1T7PA 2K8CB 3CP8A 2XC9A 2W54A 4JWNA 4WJ3B 4DQIA 7ICEA 2I9GA 5ALNA 1BPBA 2G06A 1BPDA 2JZBB 3L5KA 4DS4A 2NRVA 5KFCA 3OGUA 2G5HB 7ICRA 1ZXIA 2K89A 1MN8A 2N1RA 5KFTA 4ELUA 1DK2A 2MUTB 1NK9A 4XA5A 7ICOA 2I1QA 5ALFA 5KT2A 2A19A 1X9MA 3VCBA 4EX6A 1WYGA 5K4LA 3ALRA 2C28A 4PHDA 3RB3A 4EELA 2YB4A 1Z3EB 2NO5A 7ICUA 1UQVA 1WWVA 5KFKA 9ICSA 2R18A 5KG2A 3BDPA 1UHUA 4DL6A 4O0IA 2W03A 4O5CA 2YX8A 1ZD5A 4Y2JA 1D8LA 4TURA 1P7DA 2KP7A 4M9LA 5HR6A 1ZQJA 1KSPA 3ICXA 2ZIVA 2BDUA 4FZNA 3T5LA 3WKEA 1K5OA 2FMQA 1U47A 3WU2U 2E8NA 4Q8EA 2UVUA 8ICVA 2ZUDA 2ISPA 4K4GA 4F4XA 4F91B 5J0PA 5DQHA 9ICQA 1ZQLA 1S0MA 4OO1J 4U6PA 3RH5A 3LDAA 4OJ5A 4PZOA 2VA3A 4UB3A 2BCSA 1SXDA 3C21A 3H4DA 4DL2A 3RJKA 4ED3A 2KD1A 2DUYA 1TAQA 1D8BA 9ICPA 4J9MA 4J9KA 3SQIA 5KFRA 3HX0A 5KFFA 5T14A 3OHAA 4EBDA 2ZUBA 5ALRA 2MAXA 5ALSA 4I2IA 1L8LA 1S0OA 3FDSA 2KIWA 1CUKA 1SB3C 5HMLA 2HW3A 3IP4B 2G0AA 1PK3A 5ALPA 1NI3A 4TQSA 1LB2B 2KVSA 1Q46A 4Q45A 5AI9A 2HBMA 4DL7A 3OSPA 1TFRA 3PX0A 4QZBA 3F2CA 3GV8B 4DOBA 1J2MA 5EWEA 3GV7B 2WB1C 3BQ0A 2KTQA 2A1AA 3EWAA 1TKDA 4KITB 5AM5A 3ISDA 1LV5A 4PGQA 5ALIA 4I2EA 2XCAA 5HHHA 2FPMA 2FLNA 3T5JA 2IHNA 2E8PA 3RAQA 1KTQA 5KFVA 4Q44A 3BQTA 4C80A 3QU9A 4XQ8A 3MBYA 1PZNA 4DOCA 2BGWA 2Q4TA 3RB4A 4F93B 5KFUA 2PFNA 1S0VA 3HJEA 3AL0B 1ZQKA 3UQ2A 2UVRA 2HHQA 5ALXA 1NJWA 4J9PA 1S76D 3Q8LA 4J03A 8ICIA 3B0YA 3UPQA 4ECRA 9ICFA 2ZG6A 3WK7A 3NGDA 3FAHA 3HKZF 3PO4A 2CPRA 4RUAA 2WFAA 3WK9A 3B0XA 1SKSA 2MRLA 5EE3A 8ICPA 2L5YA 1AROP 4O3RA 4MFCA 4RPZA 4QZIA 1RQNA 4KLOA 1YT3A 4IR1A 3TARA 4JUZA 4KTQA 2PI4A 5KT3A 4FO6A 3PW5A 3JPQA 5J8YA 9ICJA 1X40A 1ZETA 3OSNA 4QWEA 2ZIUB 3PW0A 3PX6A 1N48A 2A1JB 1GO3F 9ICRA 3N97B 3MGIA 3B9JA 3WKDA 4ECZA 4UBBA 2YTUA 4C4SA 4J9SA 3JPTA 2G07A 3R9KA 4NLGA 4YG2A 4DLGA 3H4BA 1XC9A 3IM1A 2BPFA 2HBKA 1H38A 5HMMA 4DFJA 1WCNA 3N7RC 3AU2A 1V9PA 4US9A 1J2NA 3L4PA 2XY5A 3PSTA 4F5OA 1QLNA 2UVVA 8ICSA 3V7KA 2M0NA 2I5HA 2EAMA 4KLDA 4NWIA 3C2MA 1NK4A 3QU2A 2RQ5A 2FE9A 7ICNA 4M6WA 1TK8A 2ZUCA 1IIPA 1KL9A 2KN7A 5IIKA 8ICUA 2K4EA 5EE1A 4NLZA 4BWMA 1O03A 2NRTA 4JWMA 3FM9A 2CXYA 4JV0A 3C2KA 5ALEA 1KKXA 2YMMA 2HHVA 8ICQA 3H40A 9ICAA 3BQ7A 4DWIA 2R8IA 8ICHA 2HOIA 2HMXA 3IHQB 1L7NA 2R8GA 2G08A 4RPXA 5L1JA 3Q8KA 3F53A 2K60A 3MDCA 2D6FC 4F92B 4M2YA 5CHGA 4NLKA 2FJ6A 1UCVA 1COKA 3SENA 2KEYA 3ETLA 4KLJA 2DGZA 2F8LA 1ZQTA 1ZQMA 2VA2A 1NKCA 5ALHA 4IRCA 3RJEA 4XUSA 2PFOA 3KZIU 4Y2YA 3BQ2A 2Y9UA 2ASLA 4RT3A 5KFQA 3RB0A 3G6VA 4I2FA 1X9WA 1ZJMA 4ACOA 1TE2A 4KLIA 4FFDA 2RDJA 4EYHB 8ICCA 4ECVA 1X9XA 4PGXA 4J9LA 9ICNA 4PZNA 2A3VA 2W9CB 1NK0A 4MEYA 1SKRA 3NS1A 2XCPA 2KIVA 5KFMA 4F8RA 2NO4A 3QUBA 4B9VA 3D2QA 3C1YA 3ETRA 2KNJA 2R8KA 3ZDEA 5HR7A 2EH9A 4DSFA 2GWSA 3C23A 4NJ8A 1JRPA 2NRZA 4GIBA 1ZQDA 2FDRA 5J2DA 4DFDA 1NK5A 4DL3A 2DF4B 3ZI4A 2RLTA 3RBDA 2NYVA 5G5HA 1SGGA 3V7JA 5JRTA 2F1IA 4QNLA 2LYHA 2YMPA 3A0BU 5HP4A 2Y0SC 2W43A 2OWOA 1KLNA 2J6TA 2OYYA 3C28A 3KTQA 8ICRA 1JUDA 2H3IA 1YZ7A 4QZDA 8ICWA 5D49A 4GFJA 2W55A 2PKEA 3RJJA 2ZJ5A 2XY6A 2NV3A 2AU0A 2F1JA 2KHQA 2BCRA 1SKWA 2EANA 3U26A 3V72A 2V4RA 1JMSA 5ALLA 4YFKA 2W3SA 1A0PA 3QZ7A 4F72A 5EWGA 1A76A 5DQGA 2FPKA 3ZDBA 1JIHA 4JV1A 4HAIA 4DF8A 2KHVA 4YXJA 4CE6A 3J81j 2F3NA 4LZDA 5EE9A 3QEAZ 5KFEA 1MA7A 4NY8A 4BGDA 5AK4A 2DKZA 4UAVA 3WK8A 4DFKA 5AKIA 5KG6A 5L1KA 2R8HA 3PX4A 1L3SA 1WWUA 3TKAA 2Z7JA 3GIIA 1UPHA 4YR0A 4KLMA 4DS5A 3I76A 4C8OA 7ICGA 2EZYA 4X5VA 1QQ5A 1S8OA 2XO7A 2B6GA 4I2DA 1PVQA 2PFQA 4OJ6A 5L1IA 3BZKA 3RTVA 3T3FA 2KK0A 1WG8A 4P0PA 5KFOA 4ED6A 3NUQA 1TVAA 9ICCA 3I28A 2DPIA 1B4FA 3HRDD 5DG8A 2V4QA 5DDYA 4K4HA 2A1JA 1ZQWA 4DEZA 4IL6U 1ED1A 4P0QA 3QNMA 4YQWA 1RPLA 3F5AA 4GXIA 4OJOA 4DQRA 5J0SA 1C20A 5HNKA 3NVYA 1UT8A 5KL8B 1KEJA 1HEKA 2I6XA 1SIJA 1HIWA 1RXVA 4DSEA 8ICOA 3QX7A 5DLFA 3MDAA 2ZIXA 4RNMA 2D3DA 5L1MA 4B9TA 2H3FA 4TUPA 2PMZF 3MR6A 1ZQNA 1PVPA 1T94A 2JEIA 4US8A 3OHBA 3S6JA 1FFUA 4UAUA 3QXGA 3NVVA 4Z6EA 2ISOA 4PHAA 2DFLA 4P0PB 2P35A 3F5EA 3K75D 5J2IA 4ELVA 5CRXA 4UARA 3M1YA 4YR3A 3SEIA 1CRXA 3KHGA 5ALWA 1TV9A 4EEKA 2K8BB 5DGBA 5KG4A 5J0OA 5EE0A 2K4HA 1X66A 5KG0A 1V97A 2HVHA 3PMLA 3OPXA 8ICNA 1VLBA 3PW4A 3SAFA 4QZHA 1ZQIA 2F2AB 1FFVA 2F76X 3QE9Y 1SV0A 3KFUF 4R8UA 4KLSA 4ED0A 3RJHA 3RF9A 5CWRA 1N2XA 2EDUA 5AK6A 3JPOA 4I29A 5KFGA 3KOOA 1ZJNA 4F71A 3IN5A 1CI4A 2PI5A 2AQ4A 4AP9A 4KX3A 2KJ9A 2WB1F 4J9OA 3PY8A 4DF4A 2K4PA 7ICFA 2LI6A 2BDPA 1KFSA 3GFKB 3C2LA 2ESEA 2BPGA 4KN7A 2VANA 1T3NA 2AHOB 3HWTA 4C8KA 3ORYA 5AM2A 4CRXA 1S77D 2P6UA 2LBOA 5DB6A 7ICLA 3LVVA 1XNSA 4UQGA 5J2JA 7ICPA 4TQRA 2ZJ8A 4HYKA 5C0YA 1MQ2A 4GC7A 5AK3A 5H2FU 4P4OA 3C5GA 1SXEA 3IRUA 4RQNA 3N28A 4ELTA 1ZQPA 3WK5A 2EZXA 1UA0A 1Z00B 1Q3UA 4F3OA 4ECSA 1O08A 4M0AA 1JX4A 2RDIA 3V6KA 5DG9A 3MR5A 4O5KA 1KBUA 1KW4A 5AKXA 3K1RB 1BPXA 1ZQVA 5AI0A 2WF9A 1FEZA 4AYBF 2CRXA 2VKQA 2MSNA 3AUOA 3SZ2A 4PL1A 4P4PA 4F4KA 9ICLA 5A0LA 3GV5B 3A0HU 2ASDA 4ZH4A 2JR5A 2F77X 2WF8A 4Y2QA 2MUTA 4KLHA 2P66A 3H8SA 2F8KA 5TZVA 2H3ZA 2YB1A 2AH5A 3C29A 2AGQA 4RQ8A 2OH2A 1V38A 5D4BA 4YD2A 2ODGA 4JB3A 1U4BA 2KSOA 3UXNA 2B21A 1SL1A 3MGHA 2BQ3A 1L3UA 4CCHA 1BPEA 3TAQA 1D8YA 8ICYA 5L9XA 3UQ0A 3HP6A 4EEYA 3EPGA 2FPLA 1K1QA 1RYSA 4YMMA 4DSIA 2KSOB 2IOFA 4Y2VA 3O0FA 3EZ5A 1KFDA 2J6UA 1B22A 1XSNA 2CN1A 3TACB 4UAYA 4JMUA 1RYUA 3G6XA 1XO0A 1OUQA 2LYAA 5J2GA 3H0MB 4ECTA 2W9BA 4M6WB 4P2HA 1X6JA 3GU3A 2W7PA 5ALDA 4B6JA 3QU5A 5KFYA 4BDPA 2W9BB 3RB6A 4Y2TA 2Y1IA 3H8WA 1T3QA 3V6JA 4EZ9A 4KLFA 3GILA 3D2NA 1X2IA 1MC8A 2BCQA 2KFNA 8ICGA 5CB1A 2BQRA 2LKYA 4F4WA 4P4MA 4FBTA 4ED2A 8ICMA 2JGAA 3RRHA 2ZJAA 5KG3A 4YP3A 4C7YA 3UMGA 3LVWA 5EWFA 4Y2RA 3SV4A 1L8OA 1NK8A 2FMSA 2HHXA 3CW2C 3LWMA 2ZXIA 4KN4A 8ICXA 2ZIWB 4RPYA 3TFSA 1N56A 5DB9A 5CR0A 2PFPA 4AYBC
chains in the Genus database with same CATH topology
2EAOA 4NL9A 1SV4A 2K4PA 1PK3A 1B0XA 1JI7A 2E8MA 2Y9TA 2ESEA 5JTIA 2K60A 1PK1A 2D3DA 5L1MA 3BS7A 1COKA 1UCVA 4RQMA 3SENA 2KSOB 2YTUA 2LPEA 4NL9C 2EANA 5JU5A 2QB0B 2Y9UA 2D8CA 3TACB 2QARB 5J8YC 1UQVA 2GLEA 1WWVA 5F3XB 3TADA 1SXEA 2E8PA 4RQNA 3IDWA 1PK1B 1V85A 1X9XA 1F0MA 4PZNA 2QKQA 2EAPA 2F3NA 1OXJA 1SV0C 3SEIA 2KIVA 2DKZA 2E8NA 1DXSA 1WWUA 1KW4A 2QARA 3K1RB 2F44A 1X66A 2EAMA 2ES6A 3BS5A 1LKYB 2DL0A 5KNIA 2KG5A 1RG6A 3HILA 2FE9A 2B6GA 4PZOA 3H8MA 2LMRA 4NJ8A 1SXDA 2L5YA 4MHVA 2DKXA 1OW5A 1SV0A 2KMDA 3KKAA 2F8KA 1B4FA 4IS7A 2QB0A 2QB1A 3KKAC 1LKYA 1SGGA 3BS5B 2JV3A 5JRTA 1V38A 2E8OA 3TADC 1Z1VA 2KE7A 5J8YA 2KSOA 1X40A 3BQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAO A;  4NL9 A;  1SV4 A;  2K4P A;  1PK3 A;  1B0X A;  1JI7 A;  2E8M A;  2Y9T A;  2ESE A;  5JTI A;  2K60 A;  1PK1 A;  2D3D A;  5L1M A;  3BS7 A;  1COK A;  1UCV A;  4RQM A;  3SEN A;  2KSO B;  2YTU A;  2LPE A;  4NL9 C;  2EAN A;  5JU5 A;  2QB0 B;  2Y9U A;  2D8C A;  3TAC B;  2QAR B;  5J8Y C;  1UQV A;  2GLE A;  1WWV A;  5F3X B;  3TAD A;  1SXE A;  2E8P A;  4RQN A;  3IDW A;  1PK1 B;  1V85 A;  1X9X A;  1F0M A;  4PZN A;  2QKQ A;  2EAP A;  2F3N A;  1OXJ A;  1SV0 C;  3SEI A;  2KIV A;  2DKZ A;  2E8N A;  1DXS A;  1WWU A;  1KW4 A;  2QAR A;  3K1R B;  2F44 A;  1X66 A;  2EAM A;  2ES6 A;  3BS5 A;  1LKY B;  2DL0 A;  5KNI A;  2KG5 A;  1RG6 A;  3HIL A;  2FE9 A;  2B6G A;  4PZO A;  3H8M A;  2LMR A;  4NJ8 A;  1SXD A;  2L5Y A;  4MHV A;  2DKX A;  1OW5 A;  1SV0 A;  2KMD A;  3KKA A;  2F8K A;  1B4F A;  4IS7 A;  2QB0 A;  2QB1 A;  3KKA C;  1LKY A;  1SGG A;  3BS5 B;  2JV3 A;  5JRT A;  1V38 A;  2E8O A;  3TAD C;  1Z1V A;  2KE7 A;  5J8Y A;  2KSO A;  1X40 A;  3BQ7 A; 
#chains in the Genus database with same CATH topology
 4YMO A;  3KD3 A;  3QEB Z;  3M9M B;  3EUB 2;  1K1S A;  3SD7 A;  1SV4 A;  3K1Z A;  4E0D A;  2C2R A;  2ALZ A;  1T8E A;  1JN3 A;  3JPP A;  4QW8 A;  5GTH U;  5AIB A;  2E5S A;  3BS7 A;  4B9U A;  4PHP A;  3MFH A;  3ZDD A;  5KL1 B;  5IIL A;  2HI0 A;  3V6H A;  1TAU A;  5AKE A;  3RJG A;  4OJL A;  3I1Y A;  5J0R A;  5F3X B;  3TAD A;  1UT5 A;  3WKA A;  3FYH A;  4CF4 A;  1MQ3 A;  3ZD9 A;  2W9A A;  5E79 U;  1L6N A;  2ZXH A;  5AKH A;  1D9D A;  4BX9 C;  5AK5 A;  4QZ9 A;  1N60 A;  7ICM A;  4YCX A;  3PVX A;  2GOL A;  2HDO A;  1S5L U;  2Y1J A;  1RYR A;  5J2A A;  5ALM A;  5CP2 A;  5JUM A;  2KVC A;  3LYS A;  1F44 A;  4RQ3 A;  8ICF A;  4KLE A;  5KG1 A;  1FO4 A;  2AJQ A;  5KNI A;  3MR2 A;  1ZQE A;  3WKC A;  4C8N A;  2JRZ A;  3LK9 A;  4B9N A;  2WAQ C;  4IRK A;  4PPX A;  2XGQ A;  4M9J A;  3FC4 A;  2HBL A;  5KFS A;  5L1L A;  3TAP A;  1S9F A;  2M9N A;  3M6Z A;  3KHR A;  2ZTD A;  4M04 A;  2H5X A;  1KRP A;  4M47 A;  4F4Z A;  2FI1 A;  4IS7 A;  2IOF K;  3UMC A;  3UMB A;  5III A;  4USA A;  1KN5 A;  2KE7 A;  4KLU A;  1RM6 C;  2AQ0 A;  2Q0Z X;  1T4G A;  3PSF A;  1N62 A;  2W11 A;  2EAO A;  3PR5 B;  3TFR A;  1XS9 D;  1ZQX A;  5AM1 A;  4DCC A;  2GH1 A;  1NNL A;  1QTM A;  5AKK A;  1PK1 A;  5J2B A;  4UB4 A;  5AM4 A;  3GIK A;  2WHE A;  3L3F X;  3RH6 A;  4PHE A;  4UB1 A;  4I28 A;  4Y2X A;  5DKW A;  4CF5 A;  1ZQB A;  2BZF A;  2ZIU A;  3AQF A;  2QB0 B;  5AM3 A;  4KMU A;  1ZD2 P;  2JH1 A;  4RQ4 A;  5J8Y C;  3OTQ A;  4UB6 U;  2OM6 A;  1N5X A;  1DOQ A;  1DGS A;  1L7M A;  3E0F A;  2EZZ A;  1ZQ1 C;  1QSY A;  1NK6 A;  2W8L A;  4MEX A;  2EAP A;  2KZM A;  2ASJ A;  4KLT A;  2BQU A;  3F2B A;  1SV0 C;  2AGP A;  4KLG A;  5BOM A;  9ICH A;  3AU6 A;  5J0X A;  1DXS A;  5J0W A;  5TIS U;  5KFI A;  2W04 A;  2ES6 A;  3EPI A;  5J0Q A;  1J97 A;  3HPO A;  4ED8 A;  3JPS A;  1ZQH A;  2V9W A;  3HIL A;  4I2B A;  4XRH A;  3PSP A;  3AMZ A;  4UB5 A;  4IQW A;  1QCK A;  3RJI A;  4OD0 A;  1OW5 A;  9ICM A;  2IHM A;  2C2E A;  1NK7 A;  1NJZ A;  4FS1 A;  3M9O B;  5DB8 A;  4QZE A;  4O3N A;  3C1Z A;  1X42 A;  4B9M A;  4Z6F A;  4TUQ A;  9ICB A;  3BS5 B;  1ZD4 A;  4F4Y A;  1S0N A;  1SL2 A;  4DO9 A;  2W7O A;  2BCV A;  5ALK A;  4J9Q A;  9ICT A;  2XIC A;  5J0T A;  4QWC A;  1F5S A;  4DLE A;  4PL2 A;  2J6S A;  2E1F A;  1U45 A;  3HW8 A;  5J2H A;  3RJF A;  1ZQG A;  4I2C A;  3IV6 A;  1JI7 A;  4QZF A;  2Y9T A;  3CRX A;  3RRG A;  5KFP A;  5KT6 A;  2C2D A;  5DGA A;  2K8A A;  4QZG A;  4C7Z A;  3SV3 A;  2LPE A;  5B66 U;  8ICE A;  3TQ1 A;  3RBE A;  3N7P D;  1ZQZ A;  1ZQU A;  3QUQ A;  4LZG A;  3WK6 A;  3T5H A;  7ICS A;  1HJP A;  4QIW C;  4ECX A;  4RQ6 A;  1JXE A;  1Z4O A;  3G6Y A;  1Z4N A;  4M9G A;  4EBE A;  1V85 A;  3QU4 A;  5GTI U;  3SMV A;  5EOZ A;  4Q43 A;  3ZDA A;  4R63 A;  2FLP A;  9ICX A;  2QKQ A;  1OXJ A;  3MGV A;  2OEH A;  1UA1 A;  3NVZ A;  3NTU A;  2HHW A;  3BZC A;  5G5G A;  5KT7 A;  4RQ1 A;  4EEN A;  4QZA A;  5J0Y A;  5ALO A;  7ICK A;  1L3V A;  2JEF A;  5CJ7 A;  2ATL A;  1YZ6 A;  4ECU A;  4F5Q A;  4Z6D A;  4KMO B;  1XSL A;  3HT3 A;  1DRG A;  3N7S C;  8ICK A;  2LMR A;  5AIA A;  5AI6 A;  5ALT A;  3OJU A;  5B5E U;  2XY7 A;  2HCF A;  2DKX A;  3PW2 A;  4UB8 U;  4PJ0 U;  2O6K A;  4Y2U A;  9ICU A;  5F9L A;  1IG6 A;  4UW9 A;  4RZR A;  4DL5 A;  2KKP A;  3KKA C;  4KX5 A;  1L5U A;  2KFZ A;  1LKY A;  1NOM A;  4BXO A;  2E8O A;  4GXJ A;  4IQU A;  1L7O A;  1PUZ A;  3SI8 A;  5IIM A;  4ECW A;  2FMP A;  3ZDC A;  4BJQ A;  5J2C A;  2RRD A;  4ED1 A;  2IA6 A;  2W8K A;  4O3S A;  4DL4 A;  1B0X A;  1SWW A;  2LM1 A;  4ECQ A;  1CEZ A;  4I2A A;  5AHX A;  1N61 A;  4O3P A;  4Y2P A;  3TI0 A;  4DSK A;  3F2D A;  4O3O A;  4F5N A;  4RQ5 A;  4I27 A;  4F2S A;  5DG7 A;  3OJS A;  2H3V A;  5DDM A;  4K4I A;  7ICH A;  1RQL A;  1ZOL A;  5JU5 A;  2W9M A;  5IIJ A;  8ICA A;  2RP5 A;  1ZQQ A;  4DQS A;  4NV0 A;  7ICQ A;  3BQ1 A;  4F5R A;  4JK1 A;  4BUG A;  4O3Q A;  3AM9 A;  4G3I A;  2KIC A;  1XO1 A;  2P6R A;  1KQQ A;  4QWD A;  4FZM A;  8ICJ A;  4MFA A;  3IG8 A;  3PW7 A;  1WCL A;  3QUC A;  2VIX A;  5ALY A;  4Q8F A;  4O3M A;  4CF3 A;  3D6J A;  4UAS A;  2K4I A;  5KFL A;  1L7P A;  2QAR A;  4FBU A;  4MFF A;  2F44 A;  1ZQC A;  4BXO B;  2BHN A;  4RU9 A;  2KZZ A;  2DL0 A;  4DFM A;  5AI4 A;  3E2E A;  4YXM A;  4RNN A;  5KFB A;  4YN4 A;  5J2K A;  5ALV A;  1COO A;  2HHU A;  1VDV A;  4ECY A;  4CDG A;  4EZ6 A;  2KMD A;  3TAN A;  2ZTE A;  3KKA A;  2W9C A;  1NJY A;  4O9M A;  5KG5 A;  1XWL A;  1SZH A;  1U48 A;  1QH9 A;  3WK4 A;  4J9R A;  2QB1 A;  3MFI A;  5AKZ A;  4QZC A;  4DSJ A;  4MF2 A;  4O5E A;  4OJP A;  4U7C A;  3BJY A;  4UAZ A;  1Z1V A;  5KT5 A;  2BR0 A;  2YY6 A;  4QW9 A;  3ED5 A;  2Y0S F;  4I2J A;  5AKJ A;  5KFX A;  1N5W A;  3E58 A;  8ICL A;  5KG7 A;  3UXO A;  1Z00 A;  2HOQ A;  1RDF A;  1Z1B A;  2NRW A;  1D9F A;  3K4G A;  3M7D A;  8ICZ A;  3KZX A;  1BPZ A;  4NL9 C;  1U9L A;  2H3Q A;  3EYZ A;  4BWJ A;  2WF6 A;  3PR4 A;  1NZB A;  9ICV A;  5DQI A;  4CNQ A;  4NLC A;  3N4M B;  3ISB A;  2KV2 A;  5DBB A;  3KHL A;  2R8J A;  4ZOH C;  1B43 A;  5J29 A;  2DPJ A;  3CNH A;  1F0M A;  2KJ5 A;  4NXZ A;  1QSS A;  1ECW A;  2OCE A;  4RT2 A;  1ZQA A;  2YML A;  4EBC A;  3HKZ C;  3KHH A;  1SWV A;  3GIM A;  2WTF A;  4C4T A;  2B0C A;  3QYP A;  3BS5 A;  3H0R B;  2KG5 A;  9ICI A;  1RG6 A;  4R8U B;  3Q8P B;  5AI8 A;  4QWB A;  5KFA A;  9ICK A;  5KFN A;  3GIJ A;  1URJ A;  4UB2 A;  5KFZ A;  1BNP A;  2QB0 A;  2IMW P;  4PGY A;  1HUO A;  3ISC A;  5KTQ A;  2HVI A;  5C5J A;  1FIQ A;  2MA1 A;  4GXK A;  2PXI A;  3QZ8 A;  3GDX A;  3GZF A;  5ALJ A;  4DQQ A;  3M6K A;  1DK3 A;  2WF5 A;  3H0L B;  5KFD A;  1NKB A;  3SAH A;  1BNO A;  3NAS A;  3UXP A;  5ALG A;  7ICV A;  2E8M A;  4KLL A;  3NVW A;  3M9N B;  3RAX A;  3IG5 A;  3UM9 A;  1N63 A;  4EX7 A;  1A6S A;  2DQN B;  3THV A;  4YVZ A;  2YQE A;  5DLG A;  1NKE A;  3QU7 A;  4RQ2 A;  1ZQO A;  4TUS A;  2JEJ A;  4F50 A;  1X6I A;  3KBB A;  3DDH A;  1TK5 A;  1A77 A;  2PMZ C;  1PK1 B;  4KLQ A;  3MR3 A;  2ZIX B;  1TAM A;  2JH7 A;  4EYI B;  1ZQF A;  4R66 A;  4B9L A;  5HHI A;  2BPC A;  5F9N A;  4I2H A;  2HOF A;  3JPR A;  3T79 A;  3PMN A;  5AKY A;  5FP0 A;  2AGO A;  3AEV A;  4IQT A;  4DFP A;  4YMN A;  3GQC A;  4B9S A;  1ZRN A;  3Q8R B;  4P0Q B;  4DOA A;  3AN1 A;  2RHF A;  4F2R A;  3Q8Q B;  4YD1 A;  4UAW A;  3AQE A;  1S97 A;  5KAF U;  3PV8 A;  2HHS A;  4M9N A;  4M9H A;  1BVS A;  4DQP A;  4NM1 A;  4MHV A;  3VC8 A;  4ICA A;  3PSI A;  1X9S A;  5J2F A;  3C5F A;  2XGP A;  2DBY A;  3SAG A;  4FE3 A;  4JV2 A;  1ZQY A;  4IC9 A;  1BGX T;  2JV3 A;  5ALZ A;  8ICT A;  3ONN A;  5AKG A;  9ICE A;  5KFJ A;  4LVS A;  4CGZ A;  3PNC A;  2GO7 A;  1KFT A;  1HUZ A;  4C8M A;  2LM4 A;  5KT4 A;  3NRW A;  1MSW D;  4IRD A;  3CYM A;  2KKV A;  4RUC A;  1NZP A;  2JXJ A;  7ICJ A;  3ZD8 A;  3M8S A;  3EW9 A;  4R64 A;  5AM0 A;  1AQ6 A;  2XI9 A;  7ICI A;  2JHD A;  3MAB A;  1DGJ A;  1ZD3 A;  2OHF A;  2YN4 A;  2JEG A;  2D8C A;  5IIN A;  1L3T A;  2NRX A;  1ZQS A;  5AIC A;  2GLE A;  5BOL A;  4UBC A;  1Y88 A;  5KAI U;  1C7Y A;  3T5K A;  3PZP A;  5CA7 A;  1BPY A;  3D2S A;  4NLN A;  4C0Z A;  4F5P A;  4RNO A;  4QJF B;  2JZB A;  9ICO A;  2QLT A;  9ICW A;  4G9B A;  2BKE A;  1LVH A;  1QQ7 A;  2ZIW A;  5ALU A;  3MC1 A;  2DWQ A;  2MU2 A;  2BCU A;  1ZRM A;  5KFW A;  4UAT A;  1S10 A;  4C4R A;  1IXR A;  1JXL A;  4IQV A;  2KZ3 A;  4Z6C A;  1TK0 A;  2G09 A;  5DBC A;  2OXO A;  3NRZ A;  1KDH A;  3RFA A;  4C8L A;  1NJX A;  1U49 A;  5DB7 A;  5J2E A;  3H8M A;  3RR8 A;  2ZIV B;  3LWL A;  3H8J A;  2E1E A;  1SL0 A;  1ZYQ A;  2KOB A;  3SR6 A;  3Q8S B;  2EQY A;  4NM2 A;  2VJ4 A;  5CEH A;  1IM4 A;  2LHT A;  3RH4 A;  3Q8M A;  2XVT A;  1WUD A;  2VA8 A;  4PH5 A;  1Z19 A;  9ICG A;  2VJ5 A;  3H7I A;  2WAQ F;  2F1H A;  8ICB A;  4I2G A;  2W3R A;  4A8E A;  4NL9 A;  4YR2 A;  4RQ7 A;  2ZTC A;  4OCZ A;  1JAL A;  1IV8 A;  4QIW F;  5JTI A;  5ALQ A;  1XU4 A;  2G5I B;  4LJX A;  5AI5 A;  4RQM A;  4NLB A;  5D46 A;  2FLL A;  1SZP A;  2XID A;  1M6Y A;  2JMG A;  1EXN A;  4Y2S A;  1JRO A;  1PVR A;  4QWA A;  2WF7 A;  5DBA A;  2AXT U;  2QAR B;  5IIO A;  1VJ5 A;  3QUT A;  2HBJ A;  1XSP A;  1Q8K A;  3M8R A;  4MF8 A;  3IDW A;  5J0U A;  5AKL A;  2HHT A;  1QQ6 A;  3V7L A;  4DSL A;  4GLX A;  4FZL A;  2HSZ A;  4J9N A;  7ICT A;  2E3T A;  2LYB A;  3RR7 A;  2C22 A;  4GC6 A;  1QSL A;  3DV9 A;  1LKY B;  2IBK A;  4FS2 A;  1Q3V A;  5BPC A;  4QZ8 A;  4RQ0 A;  2YMQ A;  4R65 A;  3WKB A;  2IOH A;  1RXW A;  1RZT A;  5KFH A;  3PO5 A;  3DEE A;  2UVW A;  3JPN A;  2KJ8 A;  4ED7 A;  1ZQR A;  3SYZ A;  3TAD C;  4IR9 A;  1T7P A;  2K8C B;  3CP8 A;  2XC9 A;  2W54 A;  4JWN A;  4WJ3 B;  4DQI A;  7ICE A;  2I9G A;  5ALN A;  1BPB A;  2G06 A;  1BPD A;  2JZB B;  3L5K A;  4DS4 A;  2NRV A;  5KFC A;  3OGU A;  2G5H B;  7ICR A;  1ZXI A;  2K89 A;  1MN8 A;  2N1R A;  5KFT A;  4ELU A;  1DK2 A;  2MUT B;  1NK9 A;  4XA5 A;  7ICO A;  2I1Q A;  5ALF A;  5KT2 A;  2A19 A;  1X9M A;  3VCB A;  4EX6 A;  1WYG A;  5K4L A;  3ALR A;  2C28 A;  4PHD A;  3RB3 A;  4EEL A;  2YB4 A;  1Z3E B;  2NO5 A;  7ICU A;  1UQV A;  1WWV A;  5KFK A;  9ICS A;  2R18 A;  5KG2 A;  3BDP A;  1UHU A;  4DL6 A;  4O0I A;  2W03 A;  4O5C A;  2YX8 A;  1ZD5 A;  4Y2J A;  1D8L A;  4TUR A;  1P7D A;  2KP7 A;  4M9L A;  5HR6 A;  1ZQJ A;  1KSP A;  3ICX A;  2ZIV A;  2BDU A;  4FZN A;  3T5L A;  3WKE A;  1K5O A;  2FMQ A;  1U47 A;  3WU2 U;  2E8N A;  4Q8E A;  2UVU A;  8ICV A;  2ZUD A;  2ISP A;  4K4G A;  4F4X A;  4F91 B;  5J0P A;  5DQH A;  9ICQ A;  1ZQL A;  1S0M A;  4OO1 J;  4U6P A;  3RH5 A;  3LDA A;  4OJ5 A;  4PZO A;  2VA3 A;  4UB3 A;  2BCS A;  1SXD A;  3C21 A;  3H4D A;  4DL2 A;  3RJK A;  4ED3 A;  2KD1 A;  2DUY A;  1TAQ A;  1D8B A;  9ICP A;  4J9M A;  4J9K A;  3SQI A;  5KFR A;  3HX0 A;  5KFF A;  5T14 A;  3OHA A;  4EBD A;  2ZUB A;  5ALR A;  2MAX A;  5ALS A;  4I2I A;  1L8L A;  1S0O A;  3FDS A;  2KIW A;  1CUK A;  1SB3 C;  5HML A;  2HW3 A;  3IP4 B;  2G0A A;  1PK3 A;  5ALP A;  1NI3 A;  4TQS A;  1LB2 B;  2KVS A;  1Q46 A;  4Q45 A;  5AI9 A;  2HBM A;  4DL7 A;  3OSP A;  1TFR A;  3PX0 A;  4QZB A;  3F2C A;  3GV8 B;  4DOB A;  1J2M A;  5EWE A;  3GV7 B;  2WB1 C;  3BQ0 A;  2KTQ A;  2A1A A;  3EWA A;  1TKD A;  4KIT B;  5AM5 A;  3ISD A;  1LV5 A;  4PGQ A;  5ALI A;  4I2E A;  2XCA A;  5HHH A;  2FPM A;  2FLN A;  3T5J A;  2IHN A;  2E8P A;  3RAQ A;  1KTQ A;  5KFV A;  4Q44 A;  3BQT A;  4C80 A;  3QU9 A;  4XQ8 A;  3MBY A;  1PZN A;  4DOC A;  2BGW A;  2Q4T A;  3RB4 A;  4F93 B;  5KFU A;  2PFN A;  1S0V A;  3HJE A;  3AL0 B;  1ZQK A;  3UQ2 A;  2UVR A;  2HHQ A;  5ALX A;  1NJW A;  4J9P A;  1S76 D;  3Q8L A;  4J03 A;  8ICI A;  3B0Y A;  3UPQ A;  4ECR A;  9ICF A;  2ZG6 A;  3WK7 A;  3NGD A;  3FAH A;  3HKZ F;  3PO4 A;  2CPR A;  4RUA A;  2WFA A;  3WK9 A;  3B0X A;  1SKS A;  2MRL A;  5EE3 A;  8ICP A;  2L5Y A;  1ARO P;  4O3R A;  4MFC A;  4RPZ A;  4QZI A;  1RQN A;  4KLO A;  1YT3 A;  4IR1 A;  3TAR A;  4JUZ A;  4KTQ A;  2PI4 A;  5KT3 A;  4FO6 A;  3PW5 A;  3JPQ A;  5J8Y A;  9ICJ A;  1X40 A;  1ZET A;  3OSN A;  4QWE A;  2ZIU B;  3PW0 A;  3PX6 A;  1N48 A;  2A1J B;  1GO3 F;  9ICR A;  3N97 B;  3MGI A;  3B9J A;  3WKD A;  4ECZ A;  4UBB A;  2YTU A;  4C4S A;  4J9S A;  3JPT A;  2G07 A;  3R9K A;  4NLG A;  4YG2 A;  4DLG A;  3H4B A;  1XC9 A;  3IM1 A;  2BPF A;  2HBK A;  1H38 A;  5HMM A;  4DFJ A;  1WCN A;  3N7R C;  3AU2 A;  1V9P A;  4US9 A;  1J2N A;  3L4P A;  2XY5 A;  3PST A;  4F5O A;  1QLN A;  2UVV A;  8ICS A;  3V7K A;  2M0N A;  2I5H A;  2EAM A;  4KLD A;  4NWI A;  3C2M A;  1NK4 A;  3QU2 A;  2RQ5 A;  2FE9 A;  7ICN A;  4M6W A;  1TK8 A;  2ZUC A;  1IIP A;  1KL9 A;  2KN7 A;  5IIK A;  8ICU A;  2K4E A;  5EE1 A;  4NLZ A;  4BWM A;  1O03 A;  2NRT A;  4JWM A;  3FM9 A;  2CXY A;  4JV0 A;  3C2K A;  5ALE A;  1KKX A;  2YMM A;  2HHV A;  8ICQ A;  3H40 A;  9ICA A;  3BQ7 A;  4DWI A;  2R8I A;  8ICH A;  2HOI A;  2HMX A;  3IHQ B;  1L7N A;  2R8G A;  2G08 A;  4RPX A;  5L1J A;  3Q8K A;  3F53 A;  2K60 A;  3MDC A;  2D6F C;  4F92 B;  4M2Y A;  5CHG A;  4NLK A;  2FJ6 A;  1UCV A;  1COK A;  3SEN A;  2KEY A;  3ETL A;  4KLJ A;  2DGZ A;  2F8L A;  1ZQT A;  1ZQM A;  2VA2 A;  1NKC A;  5ALH A;  4IRC A;  3RJE A;  4XUS A;  2PFO A;  3KZI U;  4Y2Y A;  3BQ2 A;  2Y9U A;  2ASL A;  4RT3 A;  5KFQ A;  3RB0 A;  3G6V A;  4I2F A;  1X9W A;  1ZJM A;  4ACO A;  1TE2 A;  4KLI A;  4FFD A;  2RDJ A;  4EYH B;  8ICC A;  4ECV A;  1X9X A;  4PGX A;  4J9L A;  9ICN A;  4PZN A;  2A3V A;  2W9C B;  1NK0 A;  4MEY A;  1SKR A;  3NS1 A;  2XCP A;  2KIV A;  5KFM A;  4F8R A;  2NO4 A;  3QUB A;  4B9V A;  3D2Q A;  3C1Y A;  3ETR A;  2KNJ A;  2R8K A;  3ZDE A;  5HR7 A;  2EH9 A;  4DSF A;  2GWS A;  3C23 A;  4NJ8 A;  1JRP A;  2NRZ A;  4GIB A;  1ZQD A;  2FDR A;  5J2D A;  4DFD A;  1NK5 A;  4DL3 A;  2DF4 B;  3ZI4 A;  2RLT A;  3RBD A;  2NYV A;  5G5H A;  1SGG A;  3V7J A;  5JRT A;  2F1I A;  4QNL A;  2LYH A;  2YMP A;  3A0B U;  5HP4 A;  2Y0S C;  2W43 A;  2OWO A;  1KLN A;  2J6T A;  2OYY A;  3C28 A;  3KTQ A;  8ICR A;  1JUD A;  2H3I A;  1YZ7 A;  4QZD A;  8ICW A;  5D49 A;  4GFJ A;  2W55 A;  2PKE A;  3RJJ A;  2ZJ5 A;  2XY6 A;  2NV3 A;  2AU0 A;  2F1J A;  2KHQ A;  2BCR A;  1SKW A;  2EAN A;  3U26 A;  3V72 A;  2V4R A;  1JMS A;  5ALL A;  4YFK A;  2W3S A;  1A0P A;  3QZ7 A;  4F72 A;  5EWG A;  1A76 A;  5DQG A;  2FPK A;  3ZDB A;  1JIH A;  4JV1 A;  4HAI A;  4DF8 A;  2KHV A;  4YXJ A;  4CE6 A;  3J81 j;  2F3N A;  4LZD A;  5EE9 A;  3QEA Z;  5KFE A;  1MA7 A;  4NY8 A;  4BGD A;  5AK4 A;  2DKZ A;  4UAV A;  3WK8 A;  4DFK A;  5AKI A;  5KG6 A;  5L1K A;  2R8H A;  3PX4 A;  1L3S A;  1WWU A;  3TKA A;  2Z7J A;  3GII A;  1UPH A;  4YR0 A;  4KLM A;  4DS5 A;  3I76 A;  4C8O A;  7ICG A;  2EZY A;  4X5V A;  1QQ5 A;  1S8O A;  2XO7 A;  2B6G A;  4I2D A;  1PVQ A;  2PFQ A;  4OJ6 A;  5L1I A;  3BZK A;  3RTV A;  3T3F A;  2KK0 A;  1WG8 A;  4P0P A;  5KFO A;  4ED6 A;  3NUQ A;  1TVA A;  9ICC A;  3I28 A;  2DPI A;  1B4F A;  3HRD D;  5DG8 A;  2V4Q A;  5DDY A;  4K4H A;  2A1J A;  1ZQW A;  4DEZ A;  4IL6 U;  1ED1 A;  4P0Q A;  3QNM A;  4YQW A;  1RPL A;  3F5A A;  4GXI A;  4OJO A;  4DQR A;  5J0S A;  1C20 A;  5HNK A;  3NVY A;  1UT8 A;  5KL8 B;  1KEJ A;  1HEK A;  2I6X A;  1SIJ A;  1HIW A;  1RXV A;  4DSE A;  8ICO A;  3QX7 A;  5DLF A;  3MDA A;  2ZIX A;  4RNM A;  2D3D A;  5L1M A;  4B9T A;  2H3F A;  4TUP A;  2PMZ F;  3MR6 A;  1ZQN A;  1PVP A;  1T94 A;  2JEI A;  4US8 A;  3OHB A;  3S6J A;  1FFU A;  4UAU A;  3QXG A;  3NVV A;  4Z6E A;  2ISO A;  4PHA A;  2DFL A;  4P0P B;  2P35 A;  3F5E A;  3K75 D;  5J2I A;  4ELV A;  5CRX A;  4UAR A;  3M1Y A;  4YR3 A;  3SEI A;  1CRX A;  3KHG A;  5ALW A;  1TV9 A;  4EEK A;  2K8B B;  5DGB A;  5KG4 A;  5J0O A;  5EE0 A;  2K4H A;  1X66 A;  5KG0 A;  1V97 A;  2HVH A;  3PML A;  3OPX A;  8ICN A;  1VLB A;  3PW4 A;  3SAF A;  4QZH A;  1ZQI A;  2F2A B;  1FFV A;  2F76 X;  3QE9 Y;  1SV0 A;  3KFU F;  4R8U A;  4KLS A;  4ED0 A;  3RJH A;  3RF9 A;  5CWR A;  1N2X A;  2EDU A;  5AK6 A;  3JPO A;  4I29 A;  5KFG A;  3KOO A;  1ZJN A;  4F71 A;  3IN5 A;  1CI4 A;  2PI5 A;  2AQ4 A;  4AP9 A;  4KX3 A;  2KJ9 A;  2WB1 F;  4J9O A;  3PY8 A;  4DF4 A;  2K4P A;  7ICF A;  2LI6 A;  2BDP A;  1KFS A;  3GFK B;  3C2L A;  2ESE A;  2BPG A;  4KN7 A;  2VAN A;  1T3N A;  2AHO B;  3HWT A;  4C8K A;  3ORY A;  5AM2 A;  4CRX A;  1S77 D;  2P6U A;  2LBO A;  5DB6 A;  7ICL A;  3LVV A;  1XNS A;  4UQG A;  5J2J A;  7ICP A;  4TQR A;  2ZJ8 A;  4HYK A;  5C0Y A;  1MQ2 A;  4GC7 A;  5AK3 A;  5H2F U;  4P4O A;  3C5G A;  1SXE A;  3IRU A;  4RQN A;  3N28 A;  4ELT A;  1ZQP A;  3WK5 A;  2EZX A;  1UA0 A;  1Z00 B;  1Q3U A;  4F3O A;  4ECS A;  1O08 A;  4M0A A;  1JX4 A;  2RDI A;  3V6K A;  5DG9 A;  3MR5 A;  4O5K A;  1KBU A;  1KW4 A;  5AKX A;  3K1R B;  1BPX A;  1ZQV A;  5AI0 A;  2WF9 A;  1FEZ A;  4AYB F;  2CRX A;  2VKQ A;  2MSN A;  3AUO A;  3SZ2 A;  4PL1 A;  4P4P A;  4F4K A;  9ICL A;  5A0L A;  3GV5 B;  3A0H U;  2ASD A;  4ZH4 A;  2JR5 A;  2F77 X;  2WF8 A;  4Y2Q A;  2MUT A;  4KLH A;  2P66 A;  3H8S A;  2F8K A;  5TZV A;  2H3Z A;  2YB1 A;  2AH5 A;  3C29 A;  2AGQ A;  4RQ8 A;  2OH2 A;  1V38 A;  5D4B A;  4YD2 A;  2ODG A;  4JB3 A;  1U4B A;  2KSO A;  3UXN A;  2B21 A;  1SL1 A;  3MGH A;  2BQ3 A;  1L3U A;  4CCH A;  1BPE A;  3TAQ A;  1D8Y A;  8ICY A;  5L9X A;  3UQ0 A;  3HP6 A;  4EEY A;  3EPG A;  2FPL A;  1K1Q A;  1RYS A;  4YMM A;  4DSI A;  2KSO B;  2IOF A;  4Y2V A;  3O0F A;  3EZ5 A;  1KFD A;  2J6U A;  1B22 A;  1XSN A;  2CN1 A;  3TAC B;  4UAY A;  4JMU A;  1RYU A;  3G6X A;  1XO0 A;  1OUQ A;  2LYA A;  5J2G A;  3H0M B;  4ECT A;  2W9B A;  4M6W B;  4P2H A;  1X6J A;  3GU3 A;  2W7P A;  5ALD A;  4B6J A;  3QU5 A;  5KFY A;  4BDP A;  2W9B B;  3RB6 A;  4Y2T A;  2Y1I A;  3H8W A;  1T3Q A;  3V6J A;  4EZ9 A;  4KLF A;  3GIL A;  3D2N A;  1X2I A;  1MC8 A;  2BCQ A;  2KFN A;  8ICG A;  5CB1 A;  2BQR A;  2LKY A;  4F4W A;  4P4M A;  4FBT A;  4ED2 A;  8ICM A;  2JGA A;  3RRH A;  2ZJA A;  5KG3 A;  4YP3 A;  4C7Y A;  3UMG A;  3LVW A;  5EWF A;  4Y2R A;  3SV4 A;  1L8O A;  1NK8 A;  2FMS A;  2HHX A;  3CW2 C;  3LWM A;  2ZXI A;  4KN4 A;  8ICX A;  2ZIW B;  4RPY A;  3TFS A;  1N56 A;  5DB9 A;  5CR0 A;  2PFP A;  4AYB C; 
#chains in the Genus database with same CATH homology
 2EAO A;  4NL9 A;  1SV4 A;  2K4P A;  1PK3 A;  1B0X A;  1JI7 A;  2E8M A;  2Y9T A;  2ESE A;  5JTI A;  2K60 A;  1PK1 A;  2D3D A;  5L1M A;  3BS7 A;  1COK A;  1UCV A;  4RQM A;  3SEN A;  2KSO B;  2YTU A;  2LPE A;  4NL9 C;  2EAN A;  5JU5 A;  2QB0 B;  2Y9U A;  2D8C A;  3TAC B;  2QAR B;  5J8Y C;  1UQV A;  2GLE A;  1WWV A;  5F3X B;  3TAD A;  1SXE A;  2E8P A;  4RQN A;  3IDW A;  1PK1 B;  1V85 A;  1X9X A;  1F0M A;  4PZN A;  2QKQ A;  2EAP A;  2F3N A;  1OXJ A;  1SV0 C;  3SEI A;  2KIV A;  2DKZ A;  2E8N A;  1DXS A;  1WWU A;  1KW4 A;  2QAR A;  3K1R B;  2F44 A;  1X66 A;  2EAM A;  2ES6 A;  3BS5 A;  1LKY B;  2DL0 A;  5KNI A;  2KG5 A;  1RG6 A;  3HIL A;  2FE9 A;  2B6G A;  4PZO A;  3H8M A;  2LMR A;  4NJ8 A;  1SXD A;  2L5Y A;  4MHV A;  2DKX A;  1OW5 A;  1SV0 A;  2KMD A;  3KKA A;  2F8K A;  1B4F A;  4IS7 A;  2QB0 A;  2QB1 A;  3KKA C;  1LKY A;  1SGG A;  3BS5 B;  2JV3 A;  5JRT A;  1V38 A;  2E8O A;  3TAD C;  1Z1V A;  2KE7 A;  5J8Y A;  2KSO A;  1X40 A;  3BQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...