1X40A

Solution structure of the sam domain of human arap2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
GSSGSSGMSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRILKQLQIILSKMQDIPIYASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARAP2
publication title Solution structure of the SAM domain of human ARAP2
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1x40A00
1SXEA 2F8KA 1WWUA 2ESEA 2KIVA 2KMDA 1WWVA 3K1RB 5JU5A 1PK3A 1SV4A 5KNIA 2DKZA 2QARB 3HILA 4IS7A 5J8YA 3TADC 1F0MA 2Y9UA 1KW4A 1COKA 1Z1VA 5JRTA 1OXJA 2JV3A 2QB0A 5F3XB 4RQNA 1OW5A 3KKAC 2EAMA 2KE7A 4PZOA 1JI7A 2EAOA 2E8MA 1SXDA 1RG6A 2YTUA 1X40A 1SGGA 3SENA 2EAPA 2F44A 5L1MA 2D3DA 2KG5A 2KSOB 2ES6A 2QKQA 2Y9TA 1LKYA 3BS5B 2K60A 1SV0A 4RQMA 2E8OA 2GLEA 2K4PA 5J8YC 1DXSA 2E8PA 3IDWA 2D8CA 2QB1A 1UCVA 3H8MA 2LMRA 2QARA 3BQ7A 2QB0B 3TADA 1PK1B 1V85A 3BS5A 2DKXA 2F3NA 2EANA 1UQVA 2L5YA 3BS7A 4MHVA 3KKAA 1X9XA 4NL9A 5JTIA 1V38A 2FE9A 1LKYB 1X66A 2E8NA 1SV0C 1B4FA 2B6GA 3SEIA 2LPEA 2DL0A 2KSOA 1B0XA 4PZNA 4NJ8A 4NL9C 1PK1A 3TACB
chains in the Genus database with same CATH superfamily
1WWUA 5G5HA 1MA7A 3D6JA 7ICQA 4ED2A 3BDPA 4PGYA 7ICNA 1S5LU 3QU7A 3IRUA 1Z4NA 1QQ6A 3N7SC 2KNJA 4P0PB 4J9RA 2XICA 2Y0SF 1ZD3A 3WKEA 4UB6U 4FS1A 1XO0A 4O3NA 4KMUA 1DRGA 1ZQWA 3QZ7A 4DQIA 7ICFA 5AKHA 1FIQA 3HJEA 5KL1B 1N5WA 5GTIU 2JZBB 4BWJA 1RYUA 4IL6U 1N60A 4U6PA 5AM3A 3M9MB 2C2RA 4EENA 3CYMA 4YCXA 2HHXA 2WF5A 4QW8A 2K60A 1OUQA 3E58A 1N63A 5J0QA 5ALLA 2Y1IA 5ALQA 4IQVA 2FI1A 1XSLA 3QUCA 4PJ0U 2E8OA 3TFRA 5KT6A 9ICUA 1ZQVA 7ICRA 3A0BU 4J9OA 4I2AA 4FZLA 2HBKA 7ICSA 2YN4A 2N1RA 5KFCA 4NXZA 4R8UA 2P66A 2FPKA 2A3VA 1KBUA 3PW0A 2MA1A 4LZDA 4Y2TA 3PR5B 2ZUDA 3FDSA 4BGDA 4Q8FA 2JH7A 2YMLA 4QWDA 3OPXA 3MGIA 5J0WA 4F2SA 3L5KA 5L1IA 2ZUBA 3S6JA 4KLQA 3AQFA 4TUPA 4Q8EA 2I6XA 3MR2A 5ALYA 1QH9A 1K1SA 4YXMA 3QU4A 3WU2U 8ICTA 4YXJA 1NJWA 1KFTA 4R63A 1WG8A 4GXJA 1ZQPA 2FDRA 5IIIA 3KFUF 4MEXA 3NVVA 3T3FA 4F5OA 2XCPA 3C28A 3WK8A 1T3NA 3PSTA 4CF4A 5BOLA 4JV2A 5IILA 4I29A 1KW4A 9ICWA 5J0TA 2E1FA 4XRHA 5J2FA 4M6WB 4IQUA 5AM0A 4R66A 1Q8KA 3KZXA 3EZ5A 2K8AA 1LB2B 4DS4A 3KHLA 5ALIA 5J0SA 3QYPA 5J2JA 1JX4A 1SZPA 3E0FA 4DL2A 2RDIA 5J2DA 9ICVA 5KFXA 2YMQA 2BCVA 5AKLA 2P6UA 2W9BA 5ALGA 2PMZC 5HR7A 2B0CA 2PXIA 1XO1A 3QUQA 8ICOA 1SKSA 3AMZA 2KICA 3AU6A 4E0DA 3IDWA 1UA0A 2IOHA 2KVSA 2A1JA 3TAQA 2WB1C 3OSNA 4JWNA 3FAHA 3HT3A 2PMZF 4NLGA 1V9PA 1FEZA 4CF5A 2KIWA 2DBYA 4QZ9A 1Z1BA 4K4GA 2DKXA 2H3IA 9ICHA 4PHPA 2W9CA 3R9KA 4RNOA 2WB1F 2HMXA 5IINA 4XA5A 5KFVA 3N28A 1ZQHA 2IMWP 1U45A 1KTQA 2PKEA 1RM6C 3PV8A 4F5RA 5KFGA 2HW3A 1MQ2A 4UB8U 2HHTA 5AK5A 1KL9A 4ECWA 4ED1A 2B21A 5JU5A 4M9GA 4UW9A 4DQQA 2AXTU 2LYAA 3C2MA 3V7JA 3F53A 3ZDBA 2BCRA 4KLIA 2QB0A 2VA2A 4RT2A 2XY6A 2KE7A 4HAIA 5AI6A 3UXOA 3AM9A 2LM4A 7ICJA 1YZ6A 2J6UA 1TK5A 1PZNA 1SGGA 1HUOA 5CRXA 2IHMA 2W9MA 4MFCA 4UAUA 9ICMA 1IM4A 3MBYA 3C2KA 5JUMA 3GIIA 2QKQA 4Q43A 2GWSA 1TFRA 4DFDA 2XY5A 5KFZA 3SV4A 3JPQA 2UVUA 1NZBA 2D6FC 4BWMA 4ICAA 3AUOA 4Y2JA 4KITB 3MR3A 2AGPA 3PO5A 5ALWA 1N62A 4F72A 3QEAZ 1S0VA 2QARA 3C5FA 4J9NA 1FO4A 3PW2A 1MQ3A 3RJIA 4BDPA 4IR9A 7ICOA 3Q8SB 3MABA 3NVWA 5AM1A 4DLGA 1LVHA 2F3NA 1UQVA 4F4KA 4NL9A 3OGUA 2W43A 4I2HA 2LYBA 4YG2A 5KAIU 5ALJA 5ALFA 4P2HA 1Z3EB 5AKGA 2KP7A 2FE9A 4RZRA 1LKYB 3RJHA 2B6GA 3JPTA 9ICIA 2DGZA 4EBEA 4RQ6A 2NRWA 3RBDA 1ZQNA 5KG3A 8ICLA 2AQ0A 4UATA 3HX0A 3BQ0A 3ONNA 3C23A 8ICGA 3PW5A 3UMCA 3H8JA 5AK3A 1CRXA 3HILA 3MGHA 4J9KA 1D8YA 2ZJ8A 3MFHA 5DBBA 4M47A 8ICZA 4XQ8A 5L9XA 2XGPA 5KG0A 4MF8A 3PR4A 1KFSA 4LVSA 5DKWA 5KFNA 3RJKA 5FP0A 2YTUA 4FBUA 2G5IB 3HPOA 2YMPA 4ZH4A 2RRDA 3LWMA 3MDCA 5KT5A 2WF8A 1SL1A 1SWVA 4Z6FA 3VCBA 3KOOA 5KFLA 2JR5A 3N7PD 3EUB2 4J9SA 2FLLA 5EOZA 3DDHA 2WAQC 2VA3A 2KJ5A 7ICEA 4MFAA 5KT3A 2KFZA 1TV9A 3NTUA 5J2AA 3SYZA 5DB7A 1F44A 4Z6CA 2KHVA 3TADA 2W11A 4RQ3A 2EDUA 4IQTA 3ISCA 3PMNA 5DBAA 4DQRA 3NASA 1DGSA 2FMQA 2L5YA 1JUDA 2WAQF 4TUSA 5HR6A 4RNNA 3I1YA 2RP5A 3J81j 2NRVA 5B66U 5EWEA 3PSPA 4EX6A 3C29A 4C8KA 7ICVA 2PFPA 1YZ7A 4NLKA 2W55A 2W9AA 3TACB 1CI4A 5ALKA 2OH2A 4B9LA 4YMOA 2KIVA 3GQCA 2ZIWA 1PVRA 3SZ2A 5KFEA 4IC9A 4RQ7A 4YMMA 1QSYA 1J2NA 4YQWA 5L1LA 3RB0A 4CDGA 5DQGA 4F71A 1A0PA 2KTQA 1OXJA 4F4YA 4O3QA 3VC8A 4EYIB 2G06A 2HHVA 1NJYA 4Z6DA 4DSLA 5KFKA 4GXIA 5CA7A 2K8CB 3IHQB 3RBEA 3WKDA 4C8MA 2MUTB 2KG5A 3H40A 2PFQA 5DGAA 4DEZA 1ZD4A 4QZFA 2V4RA 3C2LA 1RXWA 2KN7A 4M6WA 1AROP 2GLEA 4TUQA 4DSKA 3JPRA 2O6KA 2FPMA 5KFYA 1NK5A 4NLCA 1B22A 2YMMA 4CF3A 5DB9A 2ASDA 3F5EA 5EE1A 4B9SA 2ZG6A 3QUTA 4DS5A 1SKRA 2OXOA 2H5XA 1Z00A 2RLTA 3UM9A 1ZQCA 4QZGA 2GH1A 3FC4A 4QW9A 2FPLA 1NK7A 2OM6A 4F93B 2BGWA 4YR3A 2BZFA 4Y2VA 2KV2A 3M7DA 3WK9A 3NVYA 3GDXA 2AGQA 2ZIXA 4KN7A 2WFAA 1KEJA 3GFKB 2IOFA 1ZJNA 4DFJA 4O3MA 8ICAA 1N2XA 2ESEA 1TAUA 4DQPA 4YN4A 5E79U 5KT4A 5ALUA 3M9NB 4GIBA 4OD0A 5J2GA 1ZQ1C 3TADC 1ZQFA 4ECTA 3C5GA 1WCNA 4KX5A 2JH1A 1A76A 1ZQXA 2LHTA 4US9A 2XVTA 3NVZA 2BPCA 4NM2A 2PI5A 7ICUA 4ECSA 4OCZA 1ZQQA 5CWRA 4PHEA 1D8BA 4PL2A 3SAGA 9ICPA 2CN1A 4TQRA 4ECYA 2JEIA 3ALRA 1ZYQA 1RPLA 2KSOB 1JIHA 2ES6A 1ZQRA 2HSZA 4I2CA 2E3TA 2IBKA 8ICBA 2KOBA 7ICIA 3MGVA 1YT3A 3GZFA 3MFIA 3NS1A 4KX3A 5HMLA 8ICVA 5G5GA 3PW7A 1BPYA 4FFDA 2UVVA 4O5EA 2FMSA 1T4GA 4UARA 4XUSA 3V7LA 4PH5A 1D9DA 7ICGA 1ECWA 1S97A 5AHXA 5D49A 4P0QB 5EWFA 1T3QA 3D2SA 3F2BA 2KZZA 1V85A 4CCHA 4NWIA 3ED5A 2OHFA 4QWAA 4C0ZA 4R65A 2ZIUA 4G3IA 3RRGA 5AM4A 3QXGA 9ICOA 2H3QA 2DPJA 2F1IA 1ZQGA 3KBBA 1ZQUA 2KK0A 2LM1A 1O08A 4EEYA 2KJ9A 3I76A 2H3FA 4OJOA 3ORYA 4Z6EA 1WWVA 3M6ZA 3NRWA 2RDJA 4GC6A 5AI0A 5ALZA 4O3PA 5J2EA 4IS7A 5ALOA 2VJ5A 2VJ4A 5KFIA 5KT2A 5HNKA 3NGDA 5JRTA 5KAFU 4Q44A 3Q8QB 5ALRA 3NRZA 1BPEA 1U9LA 9ICJA 1XC9A 5KFAA 3K75D 1TKDA 4O0IA 4C8LA 1ZETA 1NI3A 5KFSA 1QSSA 2G5HB 4RPXA 5HP4A 2ZIVA 5DLGA 9ICKA 4KLJA 5J29A 3EYZA 4LZGA 2W7OA 1KLNA 2BCSA 1SWWA 3Q8MA 3QU9A 4RQMA 2KVCA 3ZDDA 2BCQA 1LV5A 3RJJA 4QWBA 4IRCA 9ICQA 1UCVA 1V97A 3AQEA 1TK0A 2V9WA 3WK4A 5KFBA 8ICRA 4JUZA 8ICJA 5L1KA 4I2GA 1X9SA 4F2RA 3B0XA 3WKBA 2JEJA 4Y2YA 5ALVA 3BS7A 2ZTEA 2EZXA 4GXKA 9ICFA 1H38A 1V38A 2V4QA 9ICTA 4NM1A 3T79A 3HW8A 4OJ6A 4QZEA 3RB4A 1Q3VA 2KZ3A 3RR7A 5D46A 2DFLA 3QZ8A 3LYSA 2YY6A 4P4PA 4RU9A 1SV4A 4ECRA 2BQRA 5KFQA 4UASA 1CUKA 4GLXA 2XCAA 4UB4A 4DFMA 1C7YA 1MN8A 3KTQA 9ICXA 2LI6A 8ICUA 4C80A 3SAFA 3TARA 3SR6A 2F1JA 4ECQA 2W3RA 4KN4A 2K4EA 3SI8A 1NKEA 2IOFK 4CE6A 2A1AA 2K4IA 2R8GA 1Q46A 5AI4A 5C5JA 4DOCA 3PVXA 2UVWA 1L7NA 1FFVA 4FZMA 4DWIA 1BVSA 1ZD2P 3TQ1A 3GV5B 4G9BA 4QZIA 1ZQJA 8ICWA 2QB1A 3Q8PB 2ISOA 3C21A 4M04A 3N7RC 3IG5A 4YR2A 2MUTA 1SIJA 4ELUA 8ICIA 1COOA 3C1ZA 2HHQA 1ZQAA 2XGQA 1C20A 5AKEA 3JPPA 3V7KA 5AKIA 1SKWA 1D9FA 4CGZA 8ICQA 4JV0A 5DQIA 4UAZA 2R8JA 4OJPA 4TURA 3H0MB 3LWLA 2KHQA 2WF9A 3BZCA 2DL0A 2KKVA 4PZNA 2G0AA 3JPSA 4UB2A 4I2JA 5KFPA 3KZIU 2MRLA 5KFDA 5IIKA 1WYGA 5B5EU 3LVWA 2OYYA 2HDOA 2BDPA 2W54A 1ZQKA 3RB6A 1RQLA 4R8UB 5HHHA 2BQUA 2NYVA 3PZPA 3H4BA 3ISDA 2AH5A 4Y2SA 4DOBA 1ZQDA 1ZQIA 3BQ2A 9ICAA 1COKA 4QWCA 4ECVA 2FLPA 2BQ3A 1UPHA 2EZZA 4KLGA 3TI0A 1KSPA 1SL0A 3HKZC 4F5NA 5DDMA 1BPZA 4YMNA 2C2DA 1L3UA 2EAOA 5ALTA 4JMUA 4PGQA 2ZJAA 1X40A 2KZMA 4DL3A 2D3DA 4C4TA 2FLNA 9ICCA 1X9WA 5KFWA 1SV0A 5J2CA 3WK7A 3HKZF 4RUCA 8ICKA 4MF2A 4C4SA 1X42A 2EH9A 4DFKA 2ZTDA 3E2EA 3M1YA 3O0FA 1S10A 2XO7A 3ISBA 2LBOA 3BJYA 1TE2A 4UAWA 2C2EA 1J2MA 3FM9A 8ICHA 3RAQA 4J9QA 2HBMA 3ZDCA 4P0PA 2ZTCA 3FYHA 5AI8A 4UBBA 3PSIA 2JEFA 2YB1A 4J9MA 2ALZA 2P35A 8ICMA 2R8KA 4J9LA 4IQWA 1U47A 4DF4A 4QNLA 5KT7A 2JZBA 4P0QA 4O3OA 5ALNA 2OEHA 3V6KA 4BJQA 1FFUA 4ED0A 3EW9A 5ALSA 2A1JB 2LKYA 3BQ1A 3RH4A 1S8OA 3T5JA 3AU2A 4KTQA 5J0XA 2ATLA 3V72A 5HMMA 1F0MA 4DSFA 2GOLA 2ZJ5A 3TANA 5IIOA 1Z1VA 5AM2A 2IA6A 3ETRA 4TQSA 3BZKA 1UT8A 1NK4A 4B9MA 2W9CB 4KLOA 3ZD8A 3KD3A 3GV7B 2FJ6A 1AQ6A 3KHRA 4PGXA 5CHGA 3MR5A 4DLEA 1ZQBA 4I2BA 2F1HA 3DV9A 3ETLA 5AKZA 2Q4TA 2HBJA 3C1YA 3I28A 4BXOB 2Y9TA 1NK6A 4I2FA 2PFOA 2WF7A 1DK2A 1L3VA 5T14A 4QIWC 4DF8A 3GU3A 1TAMA 4JK1A 5DG8A 1NK9A 1ZQLA 3LK9A 1P7DA 1QTMA 4NV0A 4QJFB 4M9LA 8ICFA 3GIKA 2HCFA 1N61A 4QZDA 4NLBA 4B9TA 4EBCA 5AKJA 2HHWA 2QLTA 2QB0B 1UA1A 3TFSA 4UB5A 4QIWF 3B9JA 4JB3A 5AKYA 5J0UA 1X2IA 1KFDA 1ZOLA 2EANA 3H8WA 4DFPA 2MU2A 5L1JA 4Y2PA 2ISPA 4US8A 1KN5A 1ZD5A 4C4RA 2BPFA 5KG4A 1SV0C 1B4FA 4CNQA 5AI5A 2AJQA 1QLNA 4EX7A 4OJLA 2JEGA 3L4PA 2F8KA 2W04A 1ZRNA 1A77A 7ICPA 9ICNA 1L7MA 2CPRA 2NO5A 2Q0ZX 2R8HA 2QARB 3G6XA 4KLLA 3U26A 4NLNA 3T5LA 3KHHA 2ZXIA 2WTFA 2K4HA 3HWTA 4F8RA 5IIMA 2OWOA 5ALEA 5AICA 3IP4B 4QZCA 4ED3A 5DBCA 2H3ZA 4HYKA 1WCLA 3PO4A 2F44A 1RYSA 4WJ3B 1N48A 2PI4A 4PHDA 2HBLA 1BPXA 4ECUA 2UVRA 2E1EA 4M9NA 3H7IA 5KG1A 4IR1A 5KFRA 3RF9A 2BDUA 4KLHA 2R8IA 4QZBA 4RQ5A 1Q3UA 4O5CA 2G09A 1L6NA 1ED1A 2RQ5A 1Z19A 2HVIA 2W03A 2VKQA 3A0HU 4Q45A 3KKAA 4F91B 4ED8A 5CJ7A 2JGAA 4RQ2A 3MR6A 1ZQMA 4O3RA 1BNOA 1L7OA 3JPOA 1S76D 5J0PA 2ASLA 2VA8A 2H3VA 1F5SA 5KG5A 3T5KA 3G6VA 2W3SA 3D2QA 4EELA 1BPDA 2YX8A 3WKAA 3UQ0A 4JV1A 7ICMA 1IG6A 4KLDA 4DSEA 4I27A 2KMDA 3RJEA 1SZHA 1PK3A 3UMBA 4J03A 5KNIA 2NRXA 4DOAA 3V6HA 5J2HA 5J8YA 1U4BA 4LJXA 4C7YA 2R18A 1U48A 1NZPA 3M8SA 3PY8A 3H0LB 4A8EA 9ICSA 2JV3A 5F3XB 4AP9A 3F2DA 2EAMA 3F5AA 5HHIA 3GILA 2F77X 3OJSA 5KL8B 4KLSA 1O03A 2G07A 4P4MA 1X6IA 1ZXIA 5A0LA 4Y2UA 5L1MA 3M6KA 4UAYA 4DL7A 4DCCA 9ICRA 2KD1A 3H4DA 1LKYA 3BS5B 5KG6A 4B9UA 3UXPA 3GIMA 2ZIWB 4QZHA 3OSPA 1JMSA 2K4PA 1KRPA 5J2BA 4ED7A 3RJGA 4IRKA 4UB1A 3RJFA 4RPYA 1EXNA 1HEKA 2AU0A 1QCKA 5AK6A 2F2AB 3CNHA 5BOMA 2E5SA 3CRXA 3BQ7A 1XSPA 4DSIA 4F4ZA 5ALDA 5J0OA 2AHOB 2DUYA 5J2KA 2LYHA 1DGJA 3IN5A 1S0MA 1X9XA 4BX9C 4YFKA 3Q8KA 2EZYA 1T8EA 4R64A 5DG7A 5JTIA 1RDFA 4KLTA 3PNCA 2GO7A 4GC7A 5KFUA 2LPEA 4YP3A 2DWQA 3ICXA 3UPQA 3ZDAA 4NY8A 8ICNA 3RR8A 5J0YA 1L7PA 3OTQA 2YB4A 3MDAA 2NV3A 4RUAA 4C7ZA 4GFJA 2RHFA 3ZDEA 8ICEA 4ECZA 5KFTA 2DQNB 3MC1A 2HI0A 1NNLA 3M8RA 5ALPA 7ICLA 1SL2A 5DGBA 3HP6A 2NO4A 1M6YA 2KKPA 1KKXA 2Y9UA 3CW2C 3H8SA 4QZ8A 4M2YA 1TVAA 7ICTA 1Z00B 2I9GA 5KFHA 5ALXA 3OHBA 1OW5A 1N5XA 3KKAC 1L3TA 1X9MA 4F3OA 1TK8A 4B9NA 2M0NA 1JN3A 4YR0A 4Y2XA 3EPGA 1URJA 3PW4A 2ZIXB 2HHSA 4K4IA 4EBDA 5CR0A 4EYHB 5C0YA 2ASJA 4EZ9A 4FBTA 3QU5A 4AYBC 5ALHA 4YVZA 1ZQEA 5J8YC 1L5UA 2E8PA 3QU2A 2W8LA 1BPBA 4F4XA 2D8CA 1PVQA 4QWEA 5AKXA 4C8NA 4B9VA 2LMRA 3B0YA 3PSFA 5DG9A 2VANA 4FO6A 4BXOA 1PK1B 2JHDA 3UQ2A 5DLFA 3RFAA 8ICXA 2MAXA 1IXRA 4AYBF 3RH5A 5KFOA 4DL6A 3GV8B 4QZAA 1UHUA 4OO1J 2CXYA 2FMPA 1KDHA 5KTQA 5TZVA 3N97B 3PMLA 1RYRA 1N56A 9ICLA 1NKCA 2ZUCA 3ZD9A 5DDYA 1NJZA 1SXEA 3H0RB 1UT5A 4Y2QA 4IRDA 2K8BB 2EQYA 1VDVA 3L3FX 5EWGA 2J6SA 2XY7A 1TAQA 3IV6A 2DKZA 4DL4A 2AQ4A 8ICCA 4F4WA 3M9OB 4KLFA 4UB3A 2IHNA 4KLMA 3PX0A 2BR0A 2J6TA 4I2EA 4BUGA 3NUQA 4PHAA 2XC9A 1XWLA 2A19A 2BPGA 1DOQA 2ZIUB 5TISU 4PZOA 2AGOA 3UXNA 4X5VA 2JRZA 1VJ5A 5J0RA 4U7CA 4DL5A 5CB1A 1XSNA 3Q8RB 2DPIA 2G08A 1Z4OA 3KHGA 1T7PA 4Y2RA 3T5HA 3K1ZA 5EE9A 3Q8LA 1HJPA 4CRXA 1K5OA 3PX6A 1NK8A 3QUBA 3HRDD 1RQNA 5KFMA 3D2NA 2PFNA 3H8MA 5DB8A 2P6RA 1PVPA 5AM5A 4O9MA 4C8OA 1JROA 4KLEA 5AK4A 1GO3F 3WK5A 4F5QA 3SAHA 1NK0A 1S77D 5AIAA 4ELTA 3RAXA 2ZXHA 2ZIVB 2KFNA 1HUZA 4I2DA 2W8KA 3OJUA 3AEVA 4RT3A 3SEIA 2KSOA 1B0XA 3GIJA 5IIJA 4NJ8A 4NLZA 1ZQZA 2Y1JA 1BGXT 3BQTA 4M9HA 3K1RB 2NRZA 5DQHA 7ICKA 5KFFA 2BHNA 3LVVA 1X6JA 8ICPA 3THVA 4YD1A 2HOIA 5CP2A 2W9BB 5KG7A 3AN1A 1HIWA 2Z7JA 4F92B 2W7PA 1QSLA 4RQ1A 1CEZA 3WKCA 3SV3A 4M0AA 1L8OA 1ZQYA 2E8MA 4ECXA 4K4HA 4B6JA 9ICGA 5DB6A 4UQGA 1JXEA 4F5PA 2KJ8A 3K4GA 3QE9Y 3SENA 2EAPA 4ACOA 4UBCA 1S0NA 1B43A 4DQSA 1MSWD 4RPZA 4EEKA 2KEYA 8ICSA 8ICYA 1QQ5A 2F8LA 1XNSA 3JPNA 5KFJA 5ALMA 5GTHU 2I1QA 1DXSA 3SMVA 4EZ6A 3G6YA 4I28A 1S0OA 2F76X 1J97A 1VLBA 1PUZA 4O5KA 5EE0A 4ED6A 3ZI4A 5KG2A 3TAPA 3IG8A 3BS5A 1A6SA 2ODGA 4JWMA 3QNMA 3PX4A 1K1QA 4RQ8A 4RQ0A 3RH6A 4MHVA 4M9JA 5D4BA 1ZQTA 3RRHA 3OHAA 1NOMA 1X66A 2E8NA 5F9LA 4YD2A 2XI9A 9ICEA 3V6JA 3UMGA 5AIBA 2HOFA 1SB3C 3CP8A 1RZTA 4KLUA 3N4MB 4FE3A 4NL9C 1NJXA 1ZJMA 5CEHA 4PL1A 4O3SA 9ICBA 5BPCA 2HVHA 2VIXA 4UAVA 4P4OA 3EPIA 4USAA 4MEYA 2K89A 2C22A 2BCUA 2XIDA 4OJ5A 1NKBA 2CRXA 4I2IA 3RB3A 1DK3A 3QX7A 1L3SA 2MSNA 4RQNA 1RXVA 1ZRMA 1JRPA 1JI7A 1L8LA 4ZOHC 3SD7A 5J2IA 1JALA 1SXDA 1XU4A 1RG6A 2NRTA 1IIPA 1IV8A 4RQ4A 4RNMA 4ELVA 4J9PA 1T94A 2I5HA 2OCEA 4F50A 4PPXA 1Y88A 1D8LA 2DF4B 5H2FU 7ICHA 1ZQOA 1JXLA 3RTVA 3EWAA 5F9NA 1S9FA 3WK6A 2HOQA 1QQ7A 2C28A 4FS2A 5EE3A 1BNPA 1XS9D 3QEBZ 2JMGA 5AI9A 2YQEA 4DSJA 4MFFA 5AKKA 2JXJA 1WUDA 2WHEA 3F2CA 3SQIA 1KQQA 3IM1A 2BKEA 1ZQSA 2M9NA 2WF6A 5K4LA 3TKAA 3AL0B 1MC8A 3DEEA 4DO9A 2HHUA 3LDAA 2Y0SC 4KMOB 1U49A 4FZNA 1PK1A
chains in the Genus database with same CATH topology
1SXEA 2F8KA 1WWUA 2ESEA 2KIVA 2KMDA 1WWVA 3K1RB 5JU5A 1PK3A 1SV4A 5KNIA 2DKZA 2QARB 3HILA 4IS7A 5J8YA 3TADC 1F0MA 2Y9UA 1KW4A 1COKA 1Z1VA 5JRTA 1OXJA 2JV3A 2QB0A 5F3XB 4RQNA 1OW5A 3KKAC 2EAMA 2KE7A 4PZOA 1JI7A 2EAOA 2E8MA 1SXDA 1RG6A 2YTUA 1X40A 1SGGA 3SENA 2EAPA 2F44A 5L1MA 2D3DA 2KG5A 2KSOB 2ES6A 2QKQA 2Y9TA 1LKYA 3BS5B 2K60A 1SV0A 4RQMA 2E8OA 2GLEA 2K4PA 5J8YC 1DXSA 2E8PA 3IDWA 2D8CA 2QB1A 1UCVA 3H8MA 2LMRA 2QARA 3BQ7A 2QB0B 3TADA 1PK1B 1V85A 3BS5A 2DKXA 2F3NA 2EANA 1UQVA 2L5YA 3BS7A 4MHVA 3KKAA 1X9XA 4NL9A 5JTIA 1V38A 2FE9A 1LKYB 1X66A 2E8NA 1SV0C 1B4FA 2B6GA 3SEIA 2LPEA 2DL0A 2KSOA 1B0XA 4PZNA 4NJ8A 4NL9C 1PK1A 3TACB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SXE A;  2F8K A;  1WWU A;  2ESE A;  2KIV A;  2KMD A;  1WWV A;  3K1R B;  5JU5 A;  1PK3 A;  1SV4 A;  5KNI A;  2DKZ A;  2QAR B;  3HIL A;  4IS7 A;  5J8Y A;  3TAD C;  1F0M A;  2Y9U A;  1KW4 A;  1COK A;  1Z1V A;  5JRT A;  1OXJ A;  2JV3 A;  2QB0 A;  5F3X B;  4RQN A;  1OW5 A;  3KKA C;  2EAM A;  2KE7 A;  4PZO A;  1JI7 A;  2EAO A;  2E8M A;  1SXD A;  1RG6 A;  2YTU A;  1X40 A;  1SGG A;  3SEN A;  2EAP A;  2F44 A;  5L1M A;  2D3D A;  2KG5 A;  2KSO B;  2ES6 A;  2QKQ A;  2Y9T A;  1LKY A;  3BS5 B;  2K60 A;  1SV0 A;  4RQM A;  2E8O A;  2GLE A;  2K4P A;  5J8Y C;  1DXS A;  2E8P A;  3IDW A;  2D8C A;  2QB1 A;  1UCV A;  3H8M A;  2LMR A;  2QAR A;  3BQ7 A;  2QB0 B;  3TAD A;  1PK1 B;  1V85 A;  3BS5 A;  2DKX A;  2F3N A;  2EAN A;  1UQV A;  2L5Y A;  3BS7 A;  4MHV A;  3KKA A;  1X9X A;  4NL9 A;  5JTI A;  1V38 A;  2FE9 A;  1LKY B;  1X66 A;  2E8N A;  1SV0 C;  1B4F A;  2B6G A;  3SEI A;  2LPE A;  2DL0 A;  2KSO A;  1B0X A;  4PZN A;  4NJ8 A;  4NL9 C;  1PK1 A;  3TAC B; 
#chains in the Genus database with same CATH topology
 1WWU A;  5G5H A;  1MA7 A;  3D6J A;  7ICQ A;  4ED2 A;  3BDP A;  4PGY A;  7ICN A;  1S5L U;  3QU7 A;  3IRU A;  1Z4N A;  1QQ6 A;  3N7S C;  2KNJ A;  4P0P B;  4J9R A;  2XIC A;  2Y0S F;  1ZD3 A;  3WKE A;  4UB6 U;  4FS1 A;  1XO0 A;  4O3N A;  4KMU A;  1DRG A;  1ZQW A;  3QZ7 A;  4DQI A;  7ICF A;  5AKH A;  1FIQ A;  3HJE A;  5KL1 B;  1N5W A;  5GTI U;  2JZB B;  4BWJ A;  1RYU A;  4IL6 U;  1N60 A;  4U6P A;  5AM3 A;  3M9M B;  2C2R A;  4EEN A;  3CYM A;  4YCX A;  2HHX A;  2WF5 A;  4QW8 A;  2K60 A;  1OUQ A;  3E58 A;  1N63 A;  5J0Q A;  5ALL A;  2Y1I A;  5ALQ A;  4IQV A;  2FI1 A;  1XSL A;  3QUC A;  4PJ0 U;  2E8O A;  3TFR A;  5KT6 A;  9ICU A;  1ZQV A;  7ICR A;  3A0B U;  4J9O A;  4I2A A;  4FZL A;  2HBK A;  7ICS A;  2YN4 A;  2N1R A;  5KFC A;  4NXZ A;  4R8U A;  2P66 A;  2FPK A;  2A3V A;  1KBU A;  3PW0 A;  2MA1 A;  4LZD A;  4Y2T A;  3PR5 B;  2ZUD A;  3FDS A;  4BGD A;  4Q8F A;  2JH7 A;  2YML A;  4QWD A;  3OPX A;  3MGI A;  5J0W A;  4F2S A;  3L5K A;  5L1I A;  2ZUB A;  3S6J A;  4KLQ A;  3AQF A;  4TUP A;  4Q8E A;  2I6X A;  3MR2 A;  5ALY A;  1QH9 A;  1K1S A;  4YXM A;  3QU4 A;  3WU2 U;  8ICT A;  4YXJ A;  1NJW A;  1KFT A;  4R63 A;  1WG8 A;  4GXJ A;  1ZQP A;  2FDR A;  5III A;  3KFU F;  4MEX A;  3NVV A;  3T3F A;  4F5O A;  2XCP A;  3C28 A;  3WK8 A;  1T3N A;  3PST A;  4CF4 A;  5BOL A;  4JV2 A;  5IIL A;  4I29 A;  1KW4 A;  9ICW A;  5J0T A;  2E1F A;  4XRH A;  5J2F A;  4M6W B;  4IQU A;  5AM0 A;  4R66 A;  1Q8K A;  3KZX A;  3EZ5 A;  2K8A A;  1LB2 B;  4DS4 A;  3KHL A;  5ALI A;  5J0S A;  3QYP A;  5J2J A;  1JX4 A;  1SZP A;  3E0F A;  4DL2 A;  2RDI A;  5J2D A;  9ICV A;  5KFX A;  2YMQ A;  2BCV A;  5AKL A;  2P6U A;  2W9B A;  5ALG A;  2PMZ C;  5HR7 A;  2B0C A;  2PXI A;  1XO1 A;  3QUQ A;  8ICO A;  1SKS A;  3AMZ A;  2KIC A;  3AU6 A;  4E0D A;  3IDW A;  1UA0 A;  2IOH A;  2KVS A;  2A1J A;  3TAQ A;  2WB1 C;  3OSN A;  4JWN A;  3FAH A;  3HT3 A;  2PMZ F;  4NLG A;  1V9P A;  1FEZ A;  4CF5 A;  2KIW A;  2DBY A;  4QZ9 A;  1Z1B A;  4K4G A;  2DKX A;  2H3I A;  9ICH A;  4PHP A;  2W9C A;  3R9K A;  4RNO A;  2WB1 F;  2HMX A;  5IIN A;  4XA5 A;  5KFV A;  3N28 A;  1ZQH A;  2IMW P;  1U45 A;  1KTQ A;  2PKE A;  1RM6 C;  3PV8 A;  4F5R A;  5KFG A;  2HW3 A;  1MQ2 A;  4UB8 U;  2HHT A;  5AK5 A;  1KL9 A;  4ECW A;  4ED1 A;  2B21 A;  5JU5 A;  4M9G A;  4UW9 A;  4DQQ A;  2AXT U;  2LYA A;  3C2M A;  3V7J A;  3F53 A;  3ZDB A;  2BCR A;  4KLI A;  2QB0 A;  2VA2 A;  4RT2 A;  2XY6 A;  2KE7 A;  4HAI A;  5AI6 A;  3UXO A;  3AM9 A;  2LM4 A;  7ICJ A;  1YZ6 A;  2J6U A;  1TK5 A;  1PZN A;  1SGG A;  1HUO A;  5CRX A;  2IHM A;  2W9M A;  4MFC A;  4UAU A;  9ICM A;  1IM4 A;  3MBY A;  3C2K A;  5JUM A;  3GII A;  2QKQ A;  4Q43 A;  2GWS A;  1TFR A;  4DFD A;  2XY5 A;  5KFZ A;  3SV4 A;  3JPQ A;  2UVU A;  1NZB A;  2D6F C;  4BWM A;  4ICA A;  3AUO A;  4Y2J A;  4KIT B;  3MR3 A;  2AGP A;  3PO5 A;  5ALW A;  1N62 A;  4F72 A;  3QEA Z;  1S0V A;  2QAR A;  3C5F A;  4J9N A;  1FO4 A;  3PW2 A;  1MQ3 A;  3RJI A;  4BDP A;  4IR9 A;  7ICO A;  3Q8S B;  3MAB A;  3NVW A;  5AM1 A;  4DLG A;  1LVH A;  2F3N A;  1UQV A;  4F4K A;  4NL9 A;  3OGU A;  2W43 A;  4I2H A;  2LYB A;  4YG2 A;  5KAI U;  5ALJ A;  5ALF A;  4P2H A;  1Z3E B;  5AKG A;  2KP7 A;  2FE9 A;  4RZR A;  1LKY B;  3RJH A;  2B6G A;  3JPT A;  9ICI A;  2DGZ A;  4EBE A;  4RQ6 A;  2NRW A;  3RBD A;  1ZQN A;  5KG3 A;  8ICL A;  2AQ0 A;  4UAT A;  3HX0 A;  3BQ0 A;  3ONN A;  3C23 A;  8ICG A;  3PW5 A;  3UMC A;  3H8J A;  5AK3 A;  1CRX A;  3HIL A;  3MGH A;  4J9K A;  1D8Y A;  2ZJ8 A;  3MFH A;  5DBB A;  4M47 A;  8ICZ A;  4XQ8 A;  5L9X A;  2XGP A;  5KG0 A;  4MF8 A;  3PR4 A;  1KFS A;  4LVS A;  5DKW A;  5KFN A;  3RJK A;  5FP0 A;  2YTU A;  4FBU A;  2G5I B;  3HPO A;  2YMP A;  4ZH4 A;  2RRD A;  3LWM A;  3MDC A;  5KT5 A;  2WF8 A;  1SL1 A;  1SWV A;  4Z6F A;  3VCB A;  3KOO A;  5KFL A;  2JR5 A;  3N7P D;  3EUB 2;  4J9S A;  2FLL A;  5EOZ A;  3DDH A;  2WAQ C;  2VA3 A;  2KJ5 A;  7ICE A;  4MFA A;  5KT3 A;  2KFZ A;  1TV9 A;  3NTU A;  5J2A A;  3SYZ A;  5DB7 A;  1F44 A;  4Z6C A;  2KHV A;  3TAD A;  2W11 A;  4RQ3 A;  2EDU A;  4IQT A;  3ISC A;  3PMN A;  5DBA A;  4DQR A;  3NAS A;  1DGS A;  2FMQ A;  2L5Y A;  1JUD A;  2WAQ F;  4TUS A;  5HR6 A;  4RNN A;  3I1Y A;  2RP5 A;  3J81 j;  2NRV A;  5B66 U;  5EWE A;  3PSP A;  4EX6 A;  3C29 A;  4C8K A;  7ICV A;  2PFP A;  1YZ7 A;  4NLK A;  2W55 A;  2W9A A;  3TAC B;  1CI4 A;  5ALK A;  2OH2 A;  4B9L A;  4YMO A;  2KIV A;  3GQC A;  2ZIW A;  1PVR A;  3SZ2 A;  5KFE A;  4IC9 A;  4RQ7 A;  4YMM A;  1QSY A;  1J2N A;  4YQW A;  5L1L A;  3RB0 A;  4CDG A;  5DQG A;  4F71 A;  1A0P A;  2KTQ A;  1OXJ A;  4F4Y A;  4O3Q A;  3VC8 A;  4EYI B;  2G06 A;  2HHV A;  1NJY A;  4Z6D A;  4DSL A;  5KFK A;  4GXI A;  5CA7 A;  2K8C B;  3IHQ B;  3RBE A;  3WKD A;  4C8M A;  2MUT B;  2KG5 A;  3H40 A;  2PFQ A;  5DGA A;  4DEZ A;  1ZD4 A;  4QZF A;  2V4R A;  3C2L A;  1RXW A;  2KN7 A;  4M6W A;  1ARO P;  2GLE A;  4TUQ A;  4DSK A;  3JPR A;  2O6K A;  2FPM A;  5KFY A;  1NK5 A;  4NLC A;  1B22 A;  2YMM A;  4CF3 A;  5DB9 A;  2ASD A;  3F5E A;  5EE1 A;  4B9S A;  2ZG6 A;  3QUT A;  4DS5 A;  1SKR A;  2OXO A;  2H5X A;  1Z00 A;  2RLT A;  3UM9 A;  1ZQC A;  4QZG A;  2GH1 A;  3FC4 A;  4QW9 A;  2FPL A;  1NK7 A;  2OM6 A;  4F93 B;  2BGW A;  4YR3 A;  2BZF A;  4Y2V A;  2KV2 A;  3M7D A;  3WK9 A;  3NVY A;  3GDX A;  2AGQ A;  2ZIX A;  4KN7 A;  2WFA A;  1KEJ A;  3GFK B;  2IOF A;  1ZJN A;  4DFJ A;  4O3M A;  8ICA A;  1N2X A;  2ESE A;  1TAU A;  4DQP A;  4YN4 A;  5E79 U;  5KT4 A;  5ALU A;  3M9N B;  4GIB A;  4OD0 A;  5J2G A;  1ZQ1 C;  3TAD C;  1ZQF A;  4ECT A;  3C5G A;  1WCN A;  4KX5 A;  2JH1 A;  1A76 A;  1ZQX A;  2LHT A;  4US9 A;  2XVT A;  3NVZ A;  2BPC A;  4NM2 A;  2PI5 A;  7ICU A;  4ECS A;  4OCZ A;  1ZQQ A;  5CWR A;  4PHE A;  1D8B A;  4PL2 A;  3SAG A;  9ICP A;  2CN1 A;  4TQR A;  4ECY A;  2JEI A;  3ALR A;  1ZYQ A;  1RPL A;  2KSO B;  1JIH A;  2ES6 A;  1ZQR A;  2HSZ A;  4I2C A;  2E3T A;  2IBK A;  8ICB A;  2KOB A;  7ICI A;  3MGV A;  1YT3 A;  3GZF A;  3MFI A;  3NS1 A;  4KX3 A;  5HML A;  8ICV A;  5G5G A;  3PW7 A;  1BPY A;  4FFD A;  2UVV A;  4O5E A;  2FMS A;  1T4G A;  4UAR A;  4XUS A;  3V7L A;  4PH5 A;  1D9D A;  7ICG A;  1ECW A;  1S97 A;  5AHX A;  5D49 A;  4P0Q B;  5EWF A;  1T3Q A;  3D2S A;  3F2B A;  2KZZ A;  1V85 A;  4CCH A;  4NWI A;  3ED5 A;  2OHF A;  4QWA A;  4C0Z A;  4R65 A;  2ZIU A;  4G3I A;  3RRG A;  5AM4 A;  3QXG A;  9ICO A;  2H3Q A;  2DPJ A;  2F1I A;  1ZQG A;  3KBB A;  1ZQU A;  2KK0 A;  2LM1 A;  1O08 A;  4EEY A;  2KJ9 A;  3I76 A;  2H3F A;  4OJO A;  3ORY A;  4Z6E A;  1WWV A;  3M6Z A;  3NRW A;  2RDJ A;  4GC6 A;  5AI0 A;  5ALZ A;  4O3P A;  5J2E A;  4IS7 A;  5ALO A;  2VJ5 A;  2VJ4 A;  5KFI A;  5KT2 A;  5HNK A;  3NGD A;  5JRT A;  5KAF U;  4Q44 A;  3Q8Q B;  5ALR A;  3NRZ A;  1BPE A;  1U9L A;  9ICJ A;  1XC9 A;  5KFA A;  3K75 D;  1TKD A;  4O0I A;  4C8L A;  1ZET A;  1NI3 A;  5KFS A;  1QSS A;  2G5H B;  4RPX A;  5HP4 A;  2ZIV A;  5DLG A;  9ICK A;  4KLJ A;  5J29 A;  3EYZ A;  4LZG A;  2W7O A;  1KLN A;  2BCS A;  1SWW A;  3Q8M A;  3QU9 A;  4RQM A;  2KVC A;  3ZDD A;  2BCQ A;  1LV5 A;  3RJJ A;  4QWB A;  4IRC A;  9ICQ A;  1UCV A;  1V97 A;  3AQE A;  1TK0 A;  2V9W A;  3WK4 A;  5KFB A;  8ICR A;  4JUZ A;  8ICJ A;  5L1K A;  4I2G A;  1X9S A;  4F2R A;  3B0X A;  3WKB A;  2JEJ A;  4Y2Y A;  5ALV A;  3BS7 A;  2ZTE A;  2EZX A;  4GXK A;  9ICF A;  1H38 A;  1V38 A;  2V4Q A;  9ICT A;  4NM1 A;  3T79 A;  3HW8 A;  4OJ6 A;  4QZE A;  3RB4 A;  1Q3V A;  2KZ3 A;  3RR7 A;  5D46 A;  2DFL A;  3QZ8 A;  3LYS A;  2YY6 A;  4P4P A;  4RU9 A;  1SV4 A;  4ECR A;  2BQR A;  5KFQ A;  4UAS A;  1CUK A;  4GLX A;  2XCA A;  4UB4 A;  4DFM A;  1C7Y A;  1MN8 A;  3KTQ A;  9ICX A;  2LI6 A;  8ICU A;  4C80 A;  3SAF A;  3TAR A;  3SR6 A;  2F1J A;  4ECQ A;  2W3R A;  4KN4 A;  2K4E A;  3SI8 A;  1NKE A;  2IOF K;  4CE6 A;  2A1A A;  2K4I A;  2R8G A;  1Q46 A;  5AI4 A;  5C5J A;  4DOC A;  3PVX A;  2UVW A;  1L7N A;  1FFV A;  4FZM A;  4DWI A;  1BVS A;  1ZD2 P;  3TQ1 A;  3GV5 B;  4G9B A;  4QZI A;  1ZQJ A;  8ICW A;  2QB1 A;  3Q8P B;  2ISO A;  3C21 A;  4M04 A;  3N7R C;  3IG5 A;  4YR2 A;  2MUT A;  1SIJ A;  4ELU A;  8ICI A;  1COO A;  3C1Z A;  2HHQ A;  1ZQA A;  2XGQ A;  1C20 A;  5AKE A;  3JPP A;  3V7K A;  5AKI A;  1SKW A;  1D9F A;  4CGZ A;  8ICQ A;  4JV0 A;  5DQI A;  4UAZ A;  2R8J A;  4OJP A;  4TUR A;  3H0M B;  3LWL A;  2KHQ A;  2WF9 A;  3BZC A;  2DL0 A;  2KKV A;  4PZN A;  2G0A A;  3JPS A;  4UB2 A;  4I2J A;  5KFP A;  3KZI U;  2MRL A;  5KFD A;  5IIK A;  1WYG A;  5B5E U;  3LVW A;  2OYY A;  2HDO A;  2BDP A;  2W54 A;  1ZQK A;  3RB6 A;  1RQL A;  4R8U B;  5HHH A;  2BQU A;  2NYV A;  3PZP A;  3H4B A;  3ISD A;  2AH5 A;  4Y2S A;  4DOB A;  1ZQD A;  1ZQI A;  3BQ2 A;  9ICA A;  1COK A;  4QWC A;  4ECV A;  2FLP A;  2BQ3 A;  1UPH A;  2EZZ A;  4KLG A;  3TI0 A;  1KSP A;  1SL0 A;  3HKZ C;  4F5N A;  5DDM A;  1BPZ A;  4YMN A;  2C2D A;  1L3U A;  2EAO A;  5ALT A;  4JMU A;  4PGQ A;  2ZJA A;  1X40 A;  2KZM A;  4DL3 A;  2D3D A;  4C4T A;  2FLN A;  9ICC A;  1X9W A;  5KFW A;  1SV0 A;  5J2C A;  3WK7 A;  3HKZ F;  4RUC A;  8ICK A;  4MF2 A;  4C4S A;  1X42 A;  2EH9 A;  4DFK A;  2ZTD A;  3E2E A;  3M1Y A;  3O0F A;  1S10 A;  2XO7 A;  3ISB A;  2LBO A;  3BJY A;  1TE2 A;  4UAW A;  2C2E A;  1J2M A;  3FM9 A;  8ICH A;  3RAQ A;  4J9Q A;  2HBM A;  3ZDC A;  4P0P A;  2ZTC A;  3FYH A;  5AI8 A;  4UBB A;  3PSI A;  2JEF A;  2YB1 A;  4J9M A;  2ALZ A;  2P35 A;  8ICM A;  2R8K A;  4J9L A;  4IQW A;  1U47 A;  4DF4 A;  4QNL A;  5KT7 A;  2JZB A;  4P0Q A;  4O3O A;  5ALN A;  2OEH A;  3V6K A;  4BJQ A;  1FFU A;  4ED0 A;  3EW9 A;  5ALS A;  2A1J B;  2LKY A;  3BQ1 A;  3RH4 A;  1S8O A;  3T5J A;  3AU2 A;  4KTQ A;  5J0X A;  2ATL A;  3V72 A;  5HMM A;  1F0M A;  4DSF A;  2GOL A;  2ZJ5 A;  3TAN A;  5IIO A;  1Z1V A;  5AM2 A;  2IA6 A;  3ETR A;  4TQS A;  3BZK A;  1UT8 A;  1NK4 A;  4B9M A;  2W9C B;  4KLO A;  3ZD8 A;  3KD3 A;  3GV7 B;  2FJ6 A;  1AQ6 A;  3KHR A;  4PGX A;  5CHG A;  3MR5 A;  4DLE A;  1ZQB A;  4I2B A;  2F1H A;  3DV9 A;  3ETL A;  5AKZ A;  2Q4T A;  2HBJ A;  3C1Y A;  3I28 A;  4BXO B;  2Y9T A;  1NK6 A;  4I2F A;  2PFO A;  2WF7 A;  1DK2 A;  1L3V A;  5T14 A;  4QIW C;  4DF8 A;  3GU3 A;  1TAM A;  4JK1 A;  5DG8 A;  1NK9 A;  1ZQL A;  3LK9 A;  1P7D A;  1QTM A;  4NV0 A;  4QJF B;  4M9L A;  8ICF A;  3GIK A;  2HCF A;  1N61 A;  4QZD A;  4NLB A;  4B9T A;  4EBC A;  5AKJ A;  2HHW A;  2QLT A;  2QB0 B;  1UA1 A;  3TFS A;  4UB5 A;  4QIW F;  3B9J A;  4JB3 A;  5AKY A;  5J0U A;  1X2I A;  1KFD A;  1ZOL A;  2EAN A;  3H8W A;  4DFP A;  2MU2 A;  5L1J A;  4Y2P A;  2ISP A;  4US8 A;  1KN5 A;  1ZD5 A;  4C4R A;  2BPF A;  5KG4 A;  1SV0 C;  1B4F A;  4CNQ A;  5AI5 A;  2AJQ A;  1QLN A;  4EX7 A;  4OJL A;  2JEG A;  3L4P A;  2F8K A;  2W04 A;  1ZRN A;  1A77 A;  7ICP A;  9ICN A;  1L7M A;  2CPR A;  2NO5 A;  2Q0Z X;  2R8H A;  2QAR B;  3G6X A;  4KLL A;  3U26 A;  4NLN A;  3T5L A;  3KHH A;  2ZXI A;  2WTF A;  2K4H A;  3HWT A;  4F8R A;  5IIM A;  2OWO A;  5ALE A;  5AIC A;  3IP4 B;  4QZC A;  4ED3 A;  5DBC A;  2H3Z A;  4HYK A;  1WCL A;  3PO4 A;  2F44 A;  1RYS A;  4WJ3 B;  1N48 A;  2PI4 A;  4PHD A;  2HBL A;  1BPX A;  4ECU A;  2UVR A;  2E1E A;  4M9N A;  3H7I A;  5KG1 A;  4IR1 A;  5KFR A;  3RF9 A;  2BDU A;  4KLH A;  2R8I A;  4QZB A;  4RQ5 A;  1Q3U A;  4O5C A;  2G09 A;  1L6N A;  1ED1 A;  2RQ5 A;  1Z19 A;  2HVI A;  2W03 A;  2VKQ A;  3A0H U;  4Q45 A;  3KKA A;  4F91 B;  4ED8 A;  5CJ7 A;  2JGA A;  4RQ2 A;  3MR6 A;  1ZQM A;  4O3R A;  1BNO A;  1L7O A;  3JPO A;  1S76 D;  5J0P A;  2ASL A;  2VA8 A;  2H3V A;  1F5S A;  5KG5 A;  3T5K A;  3G6V A;  2W3S A;  3D2Q A;  4EEL A;  1BPD A;  2YX8 A;  3WKA A;  3UQ0 A;  4JV1 A;  7ICM A;  1IG6 A;  4KLD A;  4DSE A;  4I27 A;  2KMD A;  3RJE A;  1SZH A;  1PK3 A;  3UMB A;  4J03 A;  5KNI A;  2NRX A;  4DOA A;  3V6H A;  5J2H A;  5J8Y A;  1U4B A;  4LJX A;  4C7Y A;  2R18 A;  1U48 A;  1NZP A;  3M8S A;  3PY8 A;  3H0L B;  4A8E A;  9ICS A;  2JV3 A;  5F3X B;  4AP9 A;  3F2D A;  2EAM A;  3F5A A;  5HHI A;  3GIL A;  2F77 X;  3OJS A;  5KL8 B;  4KLS A;  1O03 A;  2G07 A;  4P4M A;  1X6I A;  1ZXI A;  5A0L A;  4Y2U A;  5L1M A;  3M6K A;  4UAY A;  4DL7 A;  4DCC A;  9ICR A;  2KD1 A;  3H4D A;  1LKY A;  3BS5 B;  5KG6 A;  4B9U A;  3UXP A;  3GIM A;  2ZIW B;  4QZH A;  3OSP A;  1JMS A;  2K4P A;  1KRP A;  5J2B A;  4ED7 A;  3RJG A;  4IRK A;  4UB1 A;  3RJF A;  4RPY A;  1EXN A;  1HEK A;  2AU0 A;  1QCK A;  5AK6 A;  2F2A B;  3CNH A;  5BOM A;  2E5S A;  3CRX A;  3BQ7 A;  1XSP A;  4DSI A;  4F4Z A;  5ALD A;  5J0O A;  2AHO B;  2DUY A;  5J2K A;  2LYH A;  1DGJ A;  3IN5 A;  1S0M A;  1X9X A;  4BX9 C;  4YFK A;  3Q8K A;  2EZY A;  1T8E A;  4R64 A;  5DG7 A;  5JTI A;  1RDF A;  4KLT A;  3PNC A;  2GO7 A;  4GC7 A;  5KFU A;  2LPE A;  4YP3 A;  2DWQ A;  3ICX A;  3UPQ A;  3ZDA A;  4NY8 A;  8ICN A;  3RR8 A;  5J0Y A;  1L7P A;  3OTQ A;  2YB4 A;  3MDA A;  2NV3 A;  4RUA A;  4C7Z A;  4GFJ A;  2RHF A;  3ZDE A;  8ICE A;  4ECZ A;  5KFT A;  2DQN B;  3MC1 A;  2HI0 A;  1NNL A;  3M8R A;  5ALP A;  7ICL A;  1SL2 A;  5DGB A;  3HP6 A;  2NO4 A;  1M6Y A;  2KKP A;  1KKX A;  2Y9U A;  3CW2 C;  3H8S A;  4QZ8 A;  4M2Y A;  1TVA A;  7ICT A;  1Z00 B;  2I9G A;  5KFH A;  5ALX A;  3OHB A;  1OW5 A;  1N5X A;  3KKA C;  1L3T A;  1X9M A;  4F3O A;  1TK8 A;  4B9N A;  2M0N A;  1JN3 A;  4YR0 A;  4Y2X A;  3EPG A;  1URJ A;  3PW4 A;  2ZIX B;  2HHS A;  4K4I A;  4EBD A;  5CR0 A;  4EYH B;  5C0Y A;  2ASJ A;  4EZ9 A;  4FBT A;  3QU5 A;  4AYB C;  5ALH A;  4YVZ A;  1ZQE A;  5J8Y C;  1L5U A;  2E8P A;  3QU2 A;  2W8L A;  1BPB A;  4F4X A;  2D8C A;  1PVQ A;  4QWE A;  5AKX A;  4C8N A;  4B9V A;  2LMR A;  3B0Y A;  3PSF A;  5DG9 A;  2VAN A;  4FO6 A;  4BXO A;  1PK1 B;  2JHD A;  3UQ2 A;  5DLF A;  3RFA A;  8ICX A;  2MAX A;  1IXR A;  4AYB F;  3RH5 A;  5KFO A;  4DL6 A;  3GV8 B;  4QZA A;  1UHU A;  4OO1 J;  2CXY A;  2FMP A;  1KDH A;  5KTQ A;  5TZV A;  3N97 B;  3PML A;  1RYR A;  1N56 A;  9ICL A;  1NKC A;  2ZUC A;  3ZD9 A;  5DDY A;  1NJZ A;  1SXE A;  3H0R B;  1UT5 A;  4Y2Q A;  4IRD A;  2K8B B;  2EQY A;  1VDV A;  3L3F X;  5EWG A;  2J6S A;  2XY7 A;  1TAQ A;  3IV6 A;  2DKZ A;  4DL4 A;  2AQ4 A;  8ICC A;  4F4W A;  3M9O B;  4KLF A;  4UB3 A;  2IHN A;  4KLM A;  3PX0 A;  2BR0 A;  2J6T A;  4I2E A;  4BUG A;  3NUQ A;  4PHA A;  2XC9 A;  1XWL A;  2A19 A;  2BPG A;  1DOQ A;  2ZIU B;  5TIS U;  4PZO A;  2AGO A;  3UXN A;  4X5V A;  2JRZ A;  1VJ5 A;  5J0R A;  4U7C A;  4DL5 A;  5CB1 A;  1XSN A;  3Q8R B;  2DPI A;  2G08 A;  1Z4O A;  3KHG A;  1T7P A;  4Y2R A;  3T5H A;  3K1Z A;  5EE9 A;  3Q8L A;  1HJP A;  4CRX A;  1K5O A;  3PX6 A;  1NK8 A;  3QUB A;  3HRD D;  1RQN A;  5KFM A;  3D2N A;  2PFN A;  3H8M A;  5DB8 A;  2P6R A;  1PVP A;  5AM5 A;  4O9M A;  4C8O A;  1JRO A;  4KLE A;  5AK4 A;  1GO3 F;  3WK5 A;  4F5Q A;  3SAH A;  1NK0 A;  1S77 D;  5AIA A;  4ELT A;  3RAX A;  2ZXH A;  2ZIV B;  2KFN A;  1HUZ A;  4I2D A;  2W8K A;  3OJU A;  3AEV A;  4RT3 A;  3SEI A;  2KSO A;  1B0X A;  3GIJ A;  5IIJ A;  4NJ8 A;  4NLZ A;  1ZQZ A;  2Y1J A;  1BGX T;  3BQT A;  4M9H A;  3K1R B;  2NRZ A;  5DQH A;  7ICK A;  5KFF A;  2BHN A;  3LVV A;  1X6J A;  8ICP A;  3THV A;  4YD1 A;  2HOI A;  5CP2 A;  2W9B B;  5KG7 A;  3AN1 A;  1HIW A;  2Z7J A;  4F92 B;  2W7P A;  1QSL A;  4RQ1 A;  1CEZ A;  3WKC A;  3SV3 A;  4M0A A;  1L8O A;  1ZQY A;  2E8M A;  4ECX A;  4K4H A;  4B6J A;  9ICG A;  5DB6 A;  4UQG A;  1JXE A;  4F5P A;  2KJ8 A;  3K4G A;  3QE9 Y;  3SEN A;  2EAP A;  4ACO A;  4UBC A;  1S0N A;  1B43 A;  4DQS A;  1MSW D;  4RPZ A;  4EEK A;  2KEY A;  8ICS A;  8ICY A;  1QQ5 A;  2F8L A;  1XNS A;  3JPN A;  5KFJ A;  5ALM A;  5GTH U;  2I1Q A;  1DXS A;  3SMV A;  4EZ6 A;  3G6Y A;  4I28 A;  1S0O A;  2F76 X;  1J97 A;  1VLB A;  1PUZ A;  4O5K A;  5EE0 A;  4ED6 A;  3ZI4 A;  5KG2 A;  3TAP A;  3IG8 A;  3BS5 A;  1A6S A;  2ODG A;  4JWM A;  3QNM A;  3PX4 A;  1K1Q A;  4RQ8 A;  4RQ0 A;  3RH6 A;  4MHV A;  4M9J A;  5D4B A;  1ZQT A;  3RRH A;  3OHA A;  1NOM A;  1X66 A;  2E8N A;  5F9L A;  4YD2 A;  2XI9 A;  9ICE A;  3V6J A;  3UMG A;  5AIB A;  2HOF A;  1SB3 C;  3CP8 A;  1RZT A;  4KLU A;  3N4M B;  4FE3 A;  4NL9 C;  1NJX A;  1ZJM A;  5CEH A;  4PL1 A;  4O3S A;  9ICB A;  5BPC A;  2HVH A;  2VIX A;  4UAV A;  4P4O A;  3EPI A;  4USA A;  4MEY A;  2K89 A;  2C22 A;  2BCU A;  2XID A;  4OJ5 A;  1NKB A;  2CRX A;  4I2I A;  3RB3 A;  1DK3 A;  3QX7 A;  1L3S A;  2MSN A;  4RQN A;  1RXV A;  1ZRM A;  1JRP A;  1JI7 A;  1L8L A;  4ZOH C;  3SD7 A;  5J2I A;  1JAL A;  1SXD A;  1XU4 A;  1RG6 A;  2NRT A;  1IIP A;  1IV8 A;  4RQ4 A;  4RNM A;  4ELV A;  4J9P A;  1T94 A;  2I5H A;  2OCE A;  4F50 A;  4PPX A;  1Y88 A;  1D8L A;  2DF4 B;  5H2F U;  7ICH A;  1ZQO A;  1JXL A;  3RTV A;  3EWA A;  5F9N A;  1S9F A;  3WK6 A;  2HOQ A;  1QQ7 A;  2C28 A;  4FS2 A;  5EE3 A;  1BNP A;  1XS9 D;  3QEB Z;  2JMG A;  5AI9 A;  2YQE A;  4DSJ A;  4MFF A;  5AKK A;  2JXJ A;  1WUD A;  2WHE A;  3F2C A;  3SQI A;  1KQQ A;  3IM1 A;  2BKE A;  1ZQS A;  2M9N A;  2WF6 A;  5K4L A;  3TKA A;  3AL0 B;  1MC8 A;  3DEE A;  4DO9 A;  2HHU A;  3LDA A;  2Y0S C;  4KMO B;  1U49 A;  4FZN A;  1PK1 A; 
#chains in the Genus database with same CATH homology
 1SXE A;  2F8K A;  1WWU A;  2ESE A;  2KIV A;  2KMD A;  1WWV A;  3K1R B;  5JU5 A;  1PK3 A;  1SV4 A;  5KNI A;  2DKZ A;  2QAR B;  3HIL A;  4IS7 A;  5J8Y A;  3TAD C;  1F0M A;  2Y9U A;  1KW4 A;  1COK A;  1Z1V A;  5JRT A;  1OXJ A;  2JV3 A;  2QB0 A;  5F3X B;  4RQN A;  1OW5 A;  3KKA C;  2EAM A;  2KE7 A;  4PZO A;  1JI7 A;  2EAO A;  2E8M A;  1SXD A;  1RG6 A;  2YTU A;  1X40 A;  1SGG A;  3SEN A;  2EAP A;  2F44 A;  5L1M A;  2D3D A;  2KG5 A;  2KSO B;  2ES6 A;  2QKQ A;  2Y9T A;  1LKY A;  3BS5 B;  2K60 A;  1SV0 A;  4RQM A;  2E8O A;  2GLE A;  2K4P A;  5J8Y C;  1DXS A;  2E8P A;  3IDW A;  2D8C A;  2QB1 A;  1UCV A;  3H8M A;  2LMR A;  2QAR A;  3BQ7 A;  2QB0 B;  3TAD A;  1PK1 B;  1V85 A;  3BS5 A;  2DKX A;  2F3N A;  2EAN A;  1UQV A;  2L5Y A;  3BS7 A;  4MHV A;  3KKA A;  1X9X A;  4NL9 A;  5JTI A;  1V38 A;  2FE9 A;  1LKY B;  1X66 A;  2E8N A;  1SV0 C;  1B4F A;  2B6G A;  3SEI A;  2LPE A;  2DL0 A;  2KSO A;  1B0X A;  4PZN A;  4NJ8 A;  4NL9 C;  1PK1 A;  3TAC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...