1X43A

Solution structure of the sh3 domain of endophilin b1 (sh3g1b1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
81
structure length
81
Chain Sequence
b'GSSGSSGLNDLKESSNNRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITYLELLNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 domain GRB2-like protein B1
publication title Solution structure of the SH3 domain of Endophilin B1 (Sh3g1b1)
rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 9
structure length 81
sequence length 81
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x43A01
5GJWB 5IH2A 2LP5A 2DL8A 2MIOA 5ECAA 2O9VA 2EPDA 4J9DA 4OMQA 1CKBA 2JM8A 2K9GA 2EGEA 1TUDA 2KE9A 2C0OA 4IIOA 4F16A 2CREA 2DBMA 3EG3A 2D0NA 3QWYA 4Z8AA 1K9AA 4OMOA 1AEYA 2M0YA 1NG2A 2J05A 2YDLA 4CC3A 1IO6A 2C0IA 2FG0A 2W10A 1PNJA 1SRMA 1PKSA 1H92A 2CT4A 2HCKA 3TSZA 1QCFA 2O88A 1JO8A 1AWOA 1ZUUA 4AG1C 1KJWA 1GCQA 2BZ8A 1AOJA 3EG0A 1UJYA 2YSQA 1A0NB 2FPEA 4RTWA 2C0TA 1RI9A 1AZEA 3UATA 1FMKA 2RQWA 4JZ4A 3EGUA 3UA6A 2O2OA 3VS5A 2AZVA 2DX1A 2J6FA 3O5ZA 1M3AA 3UF4A 1X27A 1ZUKA 2ECZA 2EYXA 2KR3A 4JJCA 1Z9QA 1QWFA 5IHNA 1KFZA 1ABQA 3JV3A 2L0AA 3M0RA 4RTXA 2JT4A 1SPKA 3RBBB 2LZ6B 1MV3A 2ESWA 2KNBB 2A28A 4ORZA 2D8HA 3I9QA 2ROLA 3VS4A 2RQUA 1QKWA 2GNCA 1NYFA 1PWTA 1GBQA 1J3TA 3FJ5A 4JZ3A 4K11A 2A36A 1G2BA 2ED1A 1WXBA 1YNZA 1N5ZA 1W1FA 3NMZC 2GTJA 2AK5A 1VA7A 2HBWA 3IQLA 1I1JA 2EYZA 1JQQA 2SRCA 4CC4B 2B86A 2LQWA 2DVJA 1AWXA 2BTTA 1ABOA 4RTZA 4RTTA 5GJVB 1U3OA 2KT1A 4RUGA 2CUBA 4KRTA 4D8DA 2RF0A 4DEYA 1OEBA 2YUQA 3M0TA 2X3XD 1MUZA 4HXJA 4JJDA 5FWCA 2L3SA 1ARKA 3TSWA 1K4US 1W6XA 1UGVA 2D1XA 3VS0A 2F2WA 3EHRA 1JU5C 4LNPA 1NYGA 3KFVA 1I07A 1Y57A 2LNHB 2E5KA 2DF6A 4JJBA 4M4ZA 1YP5A 3R6NA 1ZX6A 1CSKA 1X6GA 2RQRA 2MCNA 2KYMA 1BB9A 4AFQC 2EGCA 1JXOA 4ZNXA 2A08A 5FW9A 1GCQC 4J9FA 2K79A 4HCKA 1M3CA 3PVQA 2HSPA 2KT8A 2DYBA 1HD3A 5HCKA 1YCSB 2IIMA 4J9HA 1UE9A 2P4RA 2DILA 3A98A 2EBPA 3VS6A 1UFFA 1PRLC 2F2XA 4HVWA 1PHTA 1ZBJA 1ZLMA 1TUCA 3VS1A 2D8JA 1E7OA 1GFCA 2OI3A 1U5SA 1S1NA 1NLOC 4HVVA 1UJ0A 2PZ1A 2RNAA 4LUEA 1JEGA 2VVKA 1XOVA 1GFDA 1KIKA 1ZSGA 2JM9A 4OMLA 4CC7A 1U06A 2M51A 2DRKA 1VYVA 2X3WD 1SRLA 2J7IA 2I0NA 2H8HA 1CKAA 2DLPA 2EYWA 3I5RA 1UG1A 2KXDA 1B3QA 1EFNA 2CSQA 2F2VA 2FRWA 2DJQA 2JXBA 3PE0A 1PKTA 4J9IA 2DNUA 2AZSA 1HSQA 4JPBW 4EIKA 4ESRA 1WXUA 2FRYA 1AZGB 2CT3A 2MOXA 3M0UA 1I0CA 2ENMA 1LCKA 1NLPC 2DMOA 2EW3A 2K2MA 1UDLA 2K7AA 1T0HA 4Z89A 1WX6A 4Y92A 1MV0B 2EGAA 4E6RA 1WLPB 1VYUA 2J6KA 3H0HA 1V1CA 2DL5A 2V1QA 2LJ3A 1T0JA 1W70A 4F17A 2AKLA 3RNJA 3U23A 5IHIA 3NHNA 5EC7A 2CSIA 1X2KA 2FO0A 2VWFA 4LE9A 2KEAA 3NGPA 3THKA 3TVTA 1BK2A 1QKXA 2O9SA 2VKNA 2L3PA 2DBKA 1M30A 1Z9ZA 2JW4A 4A63B 2BZXA 2J6OA 4GLMA 4F14A 2GQIA 3EG2A 2GBQA 2DRMA 2PTKA 2JMCA 3H0IA 4LN2A 3UA7A 1AVZC 3NPFA 4GBQA 1T3LA 1AD5A 3VS7A 2LX7A 4AG2C 2JS0A 2SEMA 2YUPA 1UHFA 3I35A 3CQTA 2LJ1A 3H0FA 2GGRA 2RMOA 2EYYA 2KYBA 1OPKA 3VS3A 2GTOA 3ZL7C 4RTVA 2DL7A 2KRSA 3VRZA 1SSHA 1NEGA 4R0KA 2YT6A 4X1VA 1WFWA 3EG1A 2G6FX 4OMMA 2OAWA 1UECA 4HVUA 2RN8A 2KRNA 5IHKA 5L23A 1WI7A 1X43A 2K3BA 4OMPA 1WIEA 3REAB 1RUWA 1WYXA 2JMAA 2ED0A 1ZUYA 2YUOA 1TG0A 3PVLA 4D8KA 1WDXA 4WCIA 2CUDA 2KGTA 2KBTA 1AWWA 4AFUC 2HDAA 3SHWA 1NM7A 2KRMA 2DL4A 2A37A 3VS2A 1AWJA 2RQVA 2CH4A 2QDLA 1K0SA 2OJ2A 2RPNA 2LQNA 5IXFA 2JS2A 4RTYA 2DA9A 4AFZC 4Z88A 1QLYA 1RLPC 4AFSC 3H41A 1NEBA 1M3BA 1YN8A 1K0XA 3VRYA 1M27C 1KSWA 3ULRB 2W0ZA 5FWBA 1H3HA 2NUZA 2O31A 1Y0MA 1JXMA 1B07A 1GBRA 5I22A 5IXBA 2ROTA 4J9BA 5I11A 2CDTA 2K6DA 4J9CA 4J9EA 2XMFA 3I5SA 2KXCA 2AKKA 4LUDA 3REBB 1UUEA 4QT7A 2KROA 1YWPA 2EVRA 2FPDA 2PNIA 1GRIA 1RLQC 2FEIA 2YUNA 1BBZA 1OV3A 1OPLA 3QWXX 2L2PA 1T3SA 3M0QA 2DE0X 1M8MA 4IIMA 1SHGA 3SEMA 2NWMA 1QWEA 4DEXA 1X6BA 2V1RA 2LCSA 2JTEA 4OMNA 2EQIA 1BU1A 2DM1A 2DL3A 4RTUA 1SHFA 3LH5A 2ABLA 2LMJA 1OOTA 1K1ZA 3GBQA 1UHCA 1PRMC 3C0CA 4CC2A 1G83A 2BZYA 3M0PA 3M0SA 2LJ0A 4FSSA 4J9GA 1X69A 1E6HA 1WXTA 2HEQA 1GCPA 2EKHA 1FYNA 1WA7A 2J06A 1VYTA 1X2QA 2L3QA 1K76A 2RQTA 1HJDA 3EHQA 1GL5A 2FPFA 1YWOA 1E6GA 2CH4W 1UTIA 1SEMA 1H8KA
chains in the Genus database with same CATH superfamily
5GJWB 2BKDN 1WGSA 3OYNA 2PQWA 2DL8A 2MIOA 2EPDA 3OY9A 3CBMA 1W2BA 2GFUA 3JCMd 1CKBA 2K9GA 1BYMA 1RADB 5GMKm 1YI2Q 2C0OA 3MP6A 4FSXA 2JJ9A 3QZ9B 1KD1U 1KC8U 4BB7A 4E7SA 2MK5A 3WXMB 1IO6A 3CCJQ 4A4KA 2W10A 3GIBA 2RK1A 1RI0A 4BE0A 1VQ5A 4AG1C 3R6OA 5J39A 2EKOA 3J80E 2NUTB 1FX7A 2BZ8A 4E7ZA 2YSQA 1OZ3A 1F1BB 2FPEA 2C0TA 2DTIA 1RI9A 4M78G 4A54A 2YXYA 4JZ4A 3EGUA 1QMCA 3M53A 1VQNA 3VS5A 3C12A 2K5FA 3CC2Q 2J6FA 3ME9A 3O5ZA 4JS5A 3MPUB 1I5LA 2FZKB 2KR3A 4JJCA 5CQXA 1PSEA 4C92C 2PUOB 1IZ6A 2M1HA 2ZPEB 1KQSP 5IHNA 4JRKA 1ABQA 2L0AA 3OYHA 2D9TA 3M0RA 1SPKA 3OW2S 4DOVA 5I2MA 2X9HA 5KCHA 3HPWA 2LZ6B 3RIRA 1MV3A 3RR6A 4WF2A 2KNBB 4ORZA 3CPWA 3M4GA 4OMFB 2XDPA 2E41A 1QKWA 1NYFA 2DKGA 3ASKA 5GAN6 1J3TA 3C94A 2A36A 4C5EA 1YJ9T 4J6YA 1N5ZA 4KUDK 1MMGA 1ZA1B 4HCCA 4QKUA 1Q95G 3M57A 1WHLA 1B34B 3CCSA 4RTZA 3EFRA 1VQ4T 1PD0A 2KT1A 4BI8B 1OEBA 3M0TA 4HXJA 1HYOA 4PFZA 1K73C 1U8RA 2L3SA 1ARKA 5KYWA 2RJCA 5GAOp 2E6NA 4LD6A 1D1BA 4J5YA 1VQOT 2VASA 1FWZA 1JU5C 1V29B 1NYGA 2K5LA 4LNPA 1I07A 2X4JA 2E5KA 5GAN5 2KQWA 1BCOA 1ZX6A 1G3YA 1NPRA 3E1SA 1R77A 1X6GA 2RQRA 4C5GA 2EGCA 2RHIA 4ZNXA 3SFMA 4DBRA 2QXFA 2FVUA 3S3OA 2KT8A 2OTLT 5HCKA 1HD3A 3E9FA 2IIMA 3G7ZA 2P4RA 2DILA 2M0OA 4C0DB 3QYGB 2EBPA 3BY7A 4PL6A 1PRLC 5HY6A 2F2XA 4DBFA 4JS4A 3CD6Q 1NPPA 3CCEA 2CP7A 4PJOF 2D8JA 4CI0C 4LXCA 1NLOC 1Q86R 1NBEB 2LC4A 1WZOA 1IRXA 2CP2A 4ATOA 1RACB 2F5TX 2VVKA 1XOVA 4KH0B 3VU3C 1ZSGA 4OMLA 5GAN4 1MGQA 1SRLA 2J7IA 2I0NA 1CKAA 5LJ3j 3I5RA 1QVFS 5CCAA 2FRWA 3PIPA 1YJWT 4BACA 3G4SQ 5I21A 4JPBW 3CBPA 2ZPIB 2RI2A 4QVCA 5J3BA 2PU9B 3CPFA 3GLXA 1ZQ1A 2DIQA 2KAFA 4NL2A 3URGA 1LVKA 4OF1A 1OYXA 5A0LA 1YHQA 1LCKA 1NLPC 4N4IA 3CXCP 1D1AA 1VQNQ 2M16A 3TEEA 5KYXA 3LLRA 1U1TA 2MF2A 4J7IA 1M9SA 2LJ3A 1RABB 1YJNT 2JTFA 4E7IA 2EFIA 1VQ7A 1X2KA 2VWFA 5HKCA 4LE9A 2KEAA 3X24B 1C1AA 2VKNA 2L3PA 1X6OA 1M30A 1VQKA 2JW4A 1KK7A 4M77B 2EWNA 4IUTA 1TH7A 4M75D 5CAIA 2GBQA 3L2VA 1V76A 2FZGB 4XTXA 4JLGA 4M78E 4J6WA 4GBQA 1LJOA 1AD5A 2LX7A 1MNEA 2SEMA 2YUPA 4FM4B 3CCSQ 5GMKe 3H0FA 4XU0A 2D6FA 2DEUA 1ZSZC 3CPWP 2EYYA 1C0MA 1OQKA 2HZYA 2KYBA 1Q82R 3ZL7C 2KRSA 1NEGA 4R0KA 4JRPA 3EG1A 2PVDB 1UGRB 5DLQE 1WHGA 4CRIA 3PFSA 2KRNA 5LJ5h 4E47A 4N0AC 2HBPA 3RKYA 1WIEA 3PMTA 2GCXA 3OSSC 3REAB 2X4XA 1WYXA 5GANh 2D0QB 2YUOA 3PVLA 4D8KA 1MHNA 2BUDA 3L2ZA 2KGTA 2DXTA 3JCMP 1IB8A 2WACA 5DLOA 4KT0E 4FL6A 5D7UA 1VQLT 2FYKA 3SHWA 4ZGJB 1WQWA 3RKWA 2KRMA 4KGXB 2R5AA 2A37A 2XHCA 2OJ2A 4BY6C 2R58A 2F69A 2QA4Q 1VQPT 2FHDA 1QLYA 4QVDA 2X35A 1M27C 1KSWA 1I4K1 2LNVA 3QJ6A 2W0ZA 2NUZA 1B07A 1MNDA 4JUVA 3LGFA 5KH6A 2ROTA 3V7RA 3CCMA 3OYMA 4XTWA 2CDTA 4J9CA 5KYUB 2XMFA 4RG8A 1BIAA 1VQMA 1YITA 4QT7A 2RH2A 1YWPA 2LVMA 2L2PA 4PLLA 1M8MA 4IIMA 3SEMA 2NWMA 2DK3A 3P8HA 2COYA 1X6BA 2EQIA 3EG9A 2EQJA 2DM1A 3CCUA 2M02A 3RUXA 3GBQA 1YIJA 2QGGA 3WVEB 2E3HA 1FMWA 3JSCA 1X69A 1VQ5T 4UC4A 1OZ2A 1VQ7Q 2WSEE 4E7LA 8ATCB 2HEQA 1TUGB 1YI2A 2ZPGB 1ZBXA 1K73R 5CR2A 1WA7A 4XTZA 4R56A 3BE3A 1VQKQ 2R5MA 5M9OA 4M75A 4IUQA 1GL5A 1S72A 3CCJA 4FYWB 2CH4W 2YHTA 4C0GA 1SEMA 4C0DC 4PJOE 2DEQA 4C8QC 2LP5A 5CKBA 4J6XA 2QEXT 1Y96A 1RAGB 1TUDA 3MO8A 5GMKi 4GY5A 4IIOA 4F16A 2DBMA 3MEUA 3QWYA 1QCOA 3CC2A 1K9AA 2VXEA 3EFOA 4OMOA 2M0YA 4F7UF 4M75F 3CMAA 4II1A 4C8QD 4CC3A 3QYHB 2C0IA 1SRMA 2CT4A 2HCKA 5GANe 2AT1B 1ZUUA 5KYNA 4XTYA 3CMEA 2LT1A 3CCST 3ZBDA 1KJWA 1GCQA 3EG0A 1AOJA 4XAXB 1UJYA 1A0NB 2QI2A 4X9CA 4HT8A 5KYYB 2NYSA 2RQWA 1KG1A 2O2OA 3ER0A 2QTVA 3VUZA 3FIFA 1M3AA 3UF4A 1X27A 2ECZA 2EYXA 4JRIA 2EQUA 2QQBA 1QWFA 2LQKA 8AT1B 3OW2A 3PNWC 1IGQA 3P8DA 1P92A 1QVPA 3GF5A 3EG9B 3JCMf 1RAEB 4M75G 1SG5A 2ROLA 3VS4A 2RQUA 3I55A 4LDUA 2RHUA 2RI5A 3G6EA 1GBQA 3FJ5A 2CP3A 4JZ3A 4K11A 1M90C 1G2BA 3HTRA 1YNZA 3CCQT 1W1FA 3VV0A 1VA7A 4Z02A 4RCBA 3CCMQ 2CP0A 1I1JA 5GAOn 2F5KA 4N4HA 2EYZA 1JQQA 4M77C 3CCET 2SRCA 4FYYB 4J7FA 2LQWA 4L6V5 2DVJA 1AWXA 4RTTA 5GJVB 4RUGA 2CUBA 3HP9A 4D8DA 2MPXC 2ZZDA 2RF0A 4QQDA 3TCJA 2ZGWA 4LDWA 5FWCA 2A3LA 4N4GA 2PUKB 2CYZB 5FLXE 2XICA 1Q86U 5CKFA 3N5BB 2HQXA 1UGVA 2H3JA 2D1XA 3VS0A 4KH1B 3CD6A 3KFVA 2KDSA 2LNHB 2LCLA 3DB4A 3JCMg 2DF6A 3CCUQ 4M4ZA 3EGXB 2L5QA 1IREB 1YIJQ 1SKUB 1K9MC 5KE3A 2EIFA 1BB9A 3EFOB 1WHHA 2A08A 4HCZA 5FW9A 2P0PA 2K79A 2OX7A 1JRIA 3O8VA 3G71Q 4FIBA 2DYBA 1YCSB 4JRQA 2K5IA 3UT1A 2HSEB 2E10A 4J9HA 4ME7A 1YHQT 4RKUE 4OB1B 4XTUA 4HVWA 1PHTA 1ZLMA 1TUCA 4L5GA 3EH1A 3LW5E 1OU8A 5GAMh 1UGSB 1S72Q 2OI3A 3G4SA 1TOVA 5L8RE 4HVVA 2HAXA 5GANd 1JEGA 2NUPB 1QP2A 4JDSA 3CC7Q 3JB9H 1M8VA 2VGMA 4B6MA 4CC7A 1VQKT 5GMKj 2X3WD 3L1AA 1QVFA 4PJNA 3A1PA 1QVGS 4M7AC 3FC3A 1NE8A 2JOYA 3CMAQ 1ACMB 4C8QA 4KULA 4OGEA 1M90U 4J9IA 3FEOA 2AZSA 1HSQA 1JJ2A 4ESRA 4O6JA 4GLKA 5GAOq 4HT9A 2FRYA 3CMEQ 2BIVA 4IUPA 4FT4A 2CT3A 4BE1A 2O4XB 2ZPHB 4OGCA 4M78B 4QW2A 4M7AD 4A53A 1WJSA 1UDLA 4C92D 4Z89A 2QAZA 4Y92A 3JB9J 3CEYA 1MV0B 4E6RA 4WTOB 3GNFB 2J6KA 2V1QA 4C8QF 4F17A 2AKLA 1Q82U 3C95A 3RNJA 3AHUA 2E1HA 2XKOC 4BD3A 2CSIA 1M2OA 3THKA 3TVTA 1QKXA 2O9SA 4EMKB 2DBKA 4ZN1A 1Z9ZA 5DM7R 3MP1A 2QTXA 3I55Q 1R0BG 3OYKA 2XK0A 3G6EQ 4F14A 5CQYA 3DB3A 1RAHB 4DBHA 2DRMA 3S3MA 4HKEA 3M59A 4KUIA 1NJIC 2P0QA 4KGZB 4HCBA 4X9DA 4PJOA 4R55A 3MEWA 3OW2P 2OTJA 3MJXA 1FXXA 1KHCA 1UHFA 1WHKA 2DD5A 3WVDB 4AT1B 9ATCB 3A8HB 2GGRA 2DXUA 2RMOA 2CZ1B 4C8QG 2AHJB 2DL7A 5CKHA 5LL6S 3PGGA 1SF9A 2EAYA 4OMMA 3EFSA 3CCMT 3META 2QQ9A 4HVUA 4F7UE 2RN8A 4M75E 3PIOA 5IHKA 2COZA 1D1CA 5L23A 1VQMT 1YITT 2K3BA 2QA4A 1VQ8A 2QK0A 5CVIA 2ED0A 2RJEA 3LX7A 4KGVB 3QHSA 1N27A 4WCIA 2MAMA 4MDXA 4IURA 2CZ6B 5CKDA 3CXCS 3JCMb 4AFUC 2HMAA 2HDAA 5GAMe 1X01A 1NM7A 4M77F 2DL4A 5A0DA 2Y90A 2CH4A 1YIJT 1VQ6A 2V8JA 2C06A 2FB7A 3A5ZB 3SWNC 3L2UA 1NEBA 4J83A 2QGFB 1W2BP 1K0XA 1SSFA 1YI2T 3ULRB 2E65A 4ELYC 2O31A 4PJOG 1JXMA 3E2UA 1QCNA 4C0ZA 2E64A 1GBRA 2XDBA 5I22A 4M7DC 4RCCA 1HXDA 3J81E 3I5SA 2DJZA 3FJPA 1S72T 3REBB 3CCJT 1UUEA 1K73U 2XU8A 2EVRA 2PNIA 4A4GA 2KK4A 3RESA 5KYWB 4E7JA 1VOMA 5FU7B 4LD9K 4DBQA 4BDZA 3BW1A 4M7DD 4PJOB 2V1RA 3JB9F 2LCSA 1M90R 4M7AA 3CC2T 4EPCA 2DL3A 4RTUA 4C92A 3CC4Q 3LH5A 4PJMA 3CMAT 3FRNA 1K1ZA 5GAMf 3OYCA 1O75A 4DQ2A 1G83A 2BZYA 1D0XA 2DTOA 4MMKA 3M4YA 2GF7A 1JJ2P 3CMET 3UWNA 3QIIA 4MMLA 1M4ZA 3FDRA 1M5Q1 1I8FA 2MWOA 3A8MB 5LJ3h 1JBMA 1VYTA 3HRUA 2AIRB 4M7AF 2L3RA 4FYXB 1K76A 2RQTA 4C92F 1M1KC 1HJDA 3EHQA 1TXQA 3BFMA 2CP6A 3QXEB 1G3WA 4PFPA 1YBYA 3CCVQ 1K9MR 1N8RC 4BI3A 4C5IA 1K8AC 2O9VA 4FT2A 4OMQA 2OTJQ 2JM8A 4A4EA 2EGEA 2H3EB 2KE9A 4A4HA 4C5HA 2V8IA 4NL3A 3I55T 1I5OB 3F70A 2D0NA 4Q5WA 1M2VA 1WPYA 4Z8AA 1AEYA 3I56Q 1PC0A 2RHXA 2V8KA 1KQ2A 2YDLA 4EMGA 2MI6A 3OYDA 2WSCE 1G5VA 1LPLA 2FG0A 1PNJA 3GPLA 5GAMd 3TSZA 3PT9A 3JCMX 1AWOA 1PCXA 1QW1A 4M7AG 1VQ8Q 3OYFA 2QDYB 3RDVA 4Y28E 4C92G 1PM3A 3UATA 5KYXB 3TQ7P 3OYJA 1R0CB 2XG8D 2Z0WA 2AZVA 4ZTFA 5D6YA 2DX1A 1VQ9Q 1ZUKA 3KBGA 2LX9A 4XU2A 5CK9A 2EJ9A 3CD6T 3A8LB 1EZZB 2JT4A 3X25B 1OI1A 3RBBB 1BI3A 4C8QE 3CCRQ 1VQ6Q 1VIEA 4MDWA 2K2VA 1G8XA 2A28A 2D8HA 3I9QA 2RK2A 1QQJA 2GNCA 1IGUA 4QQGA 4YTLA 5GAN2 4JLIA 2ED1A 1Q81C 4OVAA 4ZN3A 1OX8A 4EMKC 4PKCC 4BUGA 1H641 3NMZC 2HBWA 2JN0A 4CC4B 2B86A 1ZA2B 3G4ST 3OS2A 2BTTA 1OULA 4O5VA 3OYYA 3HRTA 3KXTA 2PVOB 3EGDA 2YLBA 4DEYA 3G71A 1WHMA 3TU4K 1MUZA 1UEBA 2KY9A 3TSWA 1K4US 2E70A 4HA8A 4TVRA 3RERA 3V8LA 4RMOA 1N8RU 1K8AU 3EHRA 2E6ZA 1VQNT 1Y57A 2R57A 4F7UA 3V7CA 1YP5A 1NJIR 3H9NA 3QZ5B 3GOXA 2EJGA 2KYMA 2LRQA 4AFQC 1JXOA 4J9FA 3FLGA 4HCKA 1W4SA 3PVQA 5A2QE 2HSPA 4AMCA 2K57A 3CC7A 4E7HA 1D0YA 2LTOA 1UE9A 3OMCA 4M7DF 3A98A 3VS6A 1UFFA 2ZAEA 5LJ5e 3HKSA 4M77E 1Y71A 4XK8E 1UJ0A 3ZFJA 1D3BA 2IVWA 4NOYA 4LUEA 1ZSZA 2DD4A 1KIKA 2JM9A 1U06A 2M51A 2ATCB 2DRKA 3OS5A 3RMSA 1YJ9Q 3SD4A 2H8HA 1QVGA 3PMIA 2DLPA 2EYWA 1N6AA 3INZA 1AHJB 3QPHA 2KXDA 3A8OB 1EFNA 2CSQA 2VGNA 2COWA 4N0AA 1PKTA 2VB6A 1KD1C 1KC8C 2DNUA 2RI3A 1VQ4Q 4ANJA 3J7AF 1TS9A 2OTJT 1R8OB 4D6WA 2KSSA 2B8AA 2MOXA 3M0UA 3LGLA 4F7UG 1I0CA 1IXDA 2ENMA 3VYGA 2DMOA 2EW3A 2K2MA 1VQOQ 1WX6A 3E19A 1VYUA 3H0HA 1V1CA 2DL5A 2QASA 4LDVA 1W70A 5LJ5f 3U23A 5GAMj 5IHIA 2V26A 1GXIE 3NHNA 5EC7A 1VQ8T 2QA4T 4PJLA 2DIGA 5GANf 3QG1A 2FL7A 2JUFA 2RM4A 2OTLQ 2X51A 1UGQB 4M75B 5FU6B 3QO3A 1TTHB 2BZXA 4GLMA 3M54A 1JB0E 2VXFA 3M55A 1BI0A 3JAME 2JMCA 4M7AE 5EG2A 4M77D 3H0IA 3M56A 3UA7A 4EDUA 1TU0B 4C92E 1Y96B 3NFCA 3JRZA 3AT1B 1U1SA 1T3LA 3OYLA 3NTIA 1VQ6T 3VS7A 3HRSA 3HHTB 3I35A 3CQTA 2LJ1A 3VKIA 1B34A 4OP0A 4V2SA 1WJRA 1OPKA 3S6WA 3VS3A 2GTOA 5LJ3d 3JCMJ 2CKKA 3VRZA 1SSHA 5LJ5g 2YLCA 3X28B 2YT6A 4X1VA 1EX4A 5GAN8 3SDZA 1M1KR 3V8JA 2OAWA 1H3ZA 1KQSS 1UECA 5GANg 3L2QA 1YJWQ 1ZSZB 2DYIA 2QQSA 5LJ5d 1X43A 4OMPA 5GMKl 1RUWA 1N8RR 1K8AR 2JMAA 1ZUYA 2DXCA 1VQ7T 4QQ6A 3OYBA 1WDXA 4FCYA 2HL3A 3DLMA 2CUDA 3CXCA 2KBTA 2K3YA 3JB9D 2GFAA 1H8KA 1VIFA 2E3IA 4PFOA 4XU1A 2DFUA 1YJNQ 3VS2A 1AWJA 2RQVA 2VUBA 1K0SA 2RPNA 3TREA 5IXFA 5GAN3 2JS2A 2DA9A 2M9UA 1RLPC 2HQHA 5DY9A 3HL8A 2ZPFB 4Y91A 4B9XA 5C6SA 3QDRB 5FWBA 1H3HA 1Y0MA 2YRVA 2EQMA 4BY6B 4BDYA 4OB2B 1EIFA 1G3TA 2CZ7B 4DA4A 3CC4A 1XNIA 3MEAA 5I11A 2K6DA 2KXCA 1IHWA 5D6XA 2AKKA 1BKBA 5GAN7 1VUBA 4OB0B 5I2SA 5GAOl 3M9QA 2QEXA 1RLQC 1XTDA 1OV3A 1OPLA 1HK9A 4MZPA 5GAOm 1T3SA 3X26B 2DE0X 1MMDA 4PJJA 1NZ9A 4EMHA 1SHGA 3GNGA 6AT1B 1QWEA 2RB6A 1K9MU 3OA6A 1OX9A 1Q81R 1QVGP 1B7TA 2ABLA 1OOTA 1UHCA 1PRMC 4FSSA 3M0PA 2EQKA 2LJ0A 3CCVA 2EJFA 5IAYA 1E6HA 3QDFA 5CO7A 2G3RA 1WXTA 2JZ2A 5GMKh 3EAEA 1XJWB 2DZCA 2OAUA 1FYNA 3OS1A 2VYTA 1PSFA 1X2QA 4LDXA 1VQLQ 3I56A 2L3QA 5KE2A 2PVGB 4M7DE 2A7YA 5AYFA 4M77A 2X4YA 1UTIA 1BCMA 4E2FB 4PNOA 5IH2A 3OYEA 1VQPQ 5ECAA 2K4YA 4J9DA 1W2BS 4FW2A 3MEVA 5C0MA 2IG0A 3L2RA 2CREA 3EG3A 5KCOA 3UDCA 3CCQA 2VC8A 4C8QB 5HK3A 1VQ9A 3VJPA 1NG2A 4PLIA 1ZHIA 2J05A 2QYZA 2JTMA 3OBWA 2P4TA 3MP8A 3CCLA 1PKSA 3CCUT 1H92A 2CP5A 1RAAB 1MMAA 1QCFA 2O88A 1JO8A 3CCRA 3OYAA 3H8ZA 2I2LA 4RTWA 2DPPB 1AZEA 2RA2A 3G71T 1FMKA 3DLLA 3UA6A 2HNIA 1RAIB 1AT1B 1D0ZA 1Z9QA 2QQAA 1KFZA 1M1FA 3JV3A 3OYIA 4RTXA 1LNXA 3LH0A 2BE7D 1KD1R 1JJ2S 5LJ5j 1KC8R 1VQ5Q 2ESWA 1LOJA 2JVVA 3CPWS 2YRCA 2XDDA 5GANj 5A0GA 1NJIU 1PWTA 4M77G 3CC7T 4XU3A 3PTAA 1X75C 1G3SA 1WXBA 1Y07A 3MCAB 2CGHA 2DXBA 3LWHA 2GTJA 4M75C 2AK5A 5FU6C 1YFNA 3IQLA 1QVFP 4FYVB 1OU9A 3VUBA 4IUUA 4RG2A 1UGPB 2CS7A 1ABOA 4KBMB 1N9RA 5KYUA 3OSVA 5FRNA 1U3OA 2QEXQ 2HQEA 4KRTA 2ZCFB 3DKMA 3VYHB 2YUQA 2X3XD 4JJDA 1Q7YC 3S3NA 4J8OA 1W6XA 2F2WA 3MHXA 4JJBA 3HSBA 1PD1A 5GAOr 3R6NA 1M1GA 1CSKA 4P5NA 3BDLA 2MCNA 3V7SA 3GP8A 3JCMh 1GCQC 3OB9A 4BE2A 3JB9G 1M3CA 2EYQA 2KMTA 2DAQA 2JNGA 1FMVA 2A0FB 3JCMQ 5GAMg 3D7SB 1YJ9A 3G6ET 3OBYA 1ZBJA 4PK4A 2E5QA 3VS1A 1E7OA 1PG5B 1GFCA 1QP3A 2F1LA 5FROA 1U5SA 1S1NA 4A4FA 1VQ4A 3T9NA 3QJYA 2PZ1A 4DOWA 2RNAA 3OQ5A 3ZEHA 1WNLA 3QKJA 4FU6A 3OYGA 1GFDA 4XTVA 2FZCB 4MZTA 2DTHA 1VYVA 3FB9A 4F04B 1VQOA 1DJ7B 4QVZA 3CCQQ 2P84A 2Y4YA 5FRMA 1UG1A 1B3QA 3CCEQ 2F2VA 4M78C 2DJQA 2JXBA 2CZ0B 3PE0A 3QUIA 3CCLQ 5IT9E 4EIKA 1TSFA 1WXUA 4BI4A 3QSUA 1AZGB 1N9SA 2RJDA 4M7AB 2OTLA 3LYIA 2MMPA 4C92B 3EH2A 3JCMW 3HFOA 2RHZA 2K7AA 1T0HA 1I81A 1BIBA 4M78D 3RMQA 5KYYA 2EGAA 2LQ8A 1WLPB 1C6VX 2X4WA 1RL2A 1T0JA 2K3XA 1D09B 1Q7YU 3OMGA 2FO0A 3SWNA 3NGPA 3QBYA 3UPUA 3CBOA 1BK2A 1M1KU 3OS0A 2BE9B 2DVEA 3RKXA 4A63B 1YHQQ 2J6OA 1RAFB 2GQIA 2GQVA 2LCCA 3EG2A 2PTKA 4M7DA 2DZ9A 4LN2A 1AVZC 1YJWA 5IN1A 3Q1JA 3NPFA 1KQ1A 3L42A 1BI2A 3M5AA 2XD0A 2YRDA 2DO3A 4AG2C 1XQHA 2JS0A 1M2VB 1UB4A 3JCMc 3SB2A 5LJ3e 1MMNA 4XQ3A 4RTVA 4VUBA 3KUFA 3NTHA 1WFWA 5AT1B 4IKFA 2G6FX 1KQSA 4JJNK 2E4HA 3BDUA 3CC4T 4NS5A 1YJNA 5HK0A 4B9WA 3JCMe 1Q86C 2RO0A 1WI7A 5J26A 2RD1A 2KVQG 5D6WA 2L89A 2YWWA 4ZTJA 3EGXA 1TG0A 2KI7A 3M58A 2LDMA 5CKEA 2NLUA 2QQRA 2ZPBB 3JCMV 1AWWA 1IHVA 3NTKA 4LDYA 3V8KA 2IPOB 3C4SA 2QDLA 2HKNA 2LQNA 4IUVA 3CCVT 4RTYA 3P8BB 4AFZC 4Z88A 3A8GB 4AFSC 1Q81U 3H41A 2VV5A 4M7DG 1M3BA 1YN8A 1YCYA 3VRYA 4ZGEB 5LJ3f 2NUPA 2NUTA 4MZMA 1WJQA 5IXBA 2HD0A 2HKQB 3I56T 3SWNB 3JB9I 1TWBA 5FU7C 4J9BA 3X20B 4J9EA 2Y4XA 4ZGDB 3EGDB 4LUDA 4X34A 4PJOC 2KROA 2FPDA 1GRIA 2FEIA 2YUNA 1BBZA 7AT1B 3QWXX 4E7KA 2WSFE 3M0QA 2DERA 1WHJA 2O01E 4M7DB 4DEXA 4C0FA 3H6ZA 3LWIA 2L8DA 4F7UB 5CIUA 1VQLA 2JTEA 4OMNA 2QG9B 3MKDA 1BU1A 1Y7XA 1VQ9T 2O4XA 4PJOD 1SHFA 2LT4A 4FW1A 4M78A 2LMJA 2MYSA 1VQMQ 3C0CA 4CC2A 1YITQ 3CCLT 3M0SA 1WQ7A 2HL5C 4ELZC 4J9GA 2MWPA 1KHIA 1VQPA 5LJ3g 3CCRT 2XI9A 1GCPA 1BI1A 2EKHA 1Q82C 4OB3B 2DETA 2P0KA 1O9SA 2RHYA 2J06A 1Q7YR 3G1JA 4EMKA 4L59A 4M78F 3HFNA 3L2WA 2E12A 2FPFA 1YWOA 2RJFA 3E9GA 1E6GA 1D3BB 2XIDA
chains in the Genus database with same CATH topology
5GJWB 5IH2A 2LP5A 2DL8A 2MIOA 5ECAA 2O9VA 2EPDA 4J9DA 4OMQA 1CKBA 2JM8A 2K9GA 2EGEA 1TUDA 2KE9A 2C0OA 4IIOA 4F16A 2CREA 2DBMA 3EG3A 2D0NA 3QWYA 4Z8AA 1K9AA 4OMOA 1AEYA 2M0YA 1NG2A 2J05A 2YDLA 4CC3A 1IO6A 2C0IA 2FG0A 2W10A 1PNJA 1SRMA 1PKSA 1H92A 2CT4A 2HCKA 3TSZA 1QCFA 2O88A 1JO8A 1AWOA 1ZUUA 4AG1C 1KJWA 1GCQA 2BZ8A 1AOJA 3EG0A 1UJYA 2YSQA 1A0NB 2FPEA 4RTWA 2C0TA 1RI9A 1AZEA 3UATA 1FMKA 2RQWA 4JZ4A 3EGUA 3UA6A 2O2OA 3VS5A 2AZVA 2DX1A 2J6FA 3O5ZA 1M3AA 3UF4A 1X27A 1ZUKA 2ECZA 2EYXA 2KR3A 4JJCA 1Z9QA 1QWFA 5IHNA 1KFZA 1ABQA 3JV3A 2L0AA 3M0RA 4RTXA 2JT4A 1SPKA 3RBBB 2LZ6B 1MV3A 2ESWA 2KNBB 2A28A 4ORZA 2D8HA 3I9QA 2ROLA 3VS4A 2RQUA 1QKWA 2GNCA 1NYFA 1PWTA 1GBQA 1J3TA 3FJ5A 4JZ3A 4K11A 2A36A 1G2BA 2ED1A 1WXBA 1YNZA 1N5ZA 1W1FA 3NMZC 2GTJA 2AK5A 1VA7A 2HBWA 3IQLA 1I1JA 2EYZA 1JQQA 2SRCA 4CC4B 2B86A 2LQWA 2DVJA 1AWXA 2BTTA 1ABOA 4RTZA 4RTTA 5GJVB 1U3OA 2KT1A 4RUGA 2CUBA 4KRTA 4D8DA 2RF0A 4DEYA 1OEBA 2YUQA 3M0TA 2X3XD 1MUZA 4HXJA 4JJDA 5FWCA 2L3SA 1ARKA 3TSWA 1K4US 1W6XA 1UGVA 2D1XA 3VS0A 2F2WA 3EHRA 1JU5C 4LNPA 1NYGA 3KFVA 1I07A 1Y57A 2LNHB 2E5KA 2DF6A 4JJBA 4M4ZA 1YP5A 3R6NA 1ZX6A 1CSKA 1X6GA 2RQRA 2MCNA 2KYMA 1BB9A 4AFQC 2EGCA 1JXOA 4ZNXA 2A08A 5FW9A 1GCQC 4J9FA 2K79A 4HCKA 1M3CA 3PVQA 2HSPA 2KT8A 2DYBA 1HD3A 5HCKA 1YCSB 2IIMA 4J9HA 1UE9A 2P4RA 2DILA 3A98A 2EBPA 3VS6A 1UFFA 1PRLC 2F2XA 4HVWA 1PHTA 1ZBJA 1ZLMA 1TUCA 3VS1A 2D8JA 1E7OA 1GFCA 2OI3A 1U5SA 1S1NA 1NLOC 4HVVA 1UJ0A 2PZ1A 2RNAA 4LUEA 1JEGA 2VVKA 1XOVA 1GFDA 1KIKA 1ZSGA 2JM9A 4OMLA 4CC7A 1U06A 2M51A 2DRKA 1VYVA 2X3WD 1SRLA 2J7IA 2I0NA 2H8HA 1CKAA 2DLPA 2EYWA 3I5RA 1UG1A 2KXDA 1B3QA 1EFNA 2CSQA 2F2VA 2FRWA 2DJQA 2JXBA 3PE0A 1PKTA 4J9IA 2DNUA 2AZSA 1HSQA 4JPBW 4EIKA 4ESRA 1WXUA 2FRYA 1AZGB 2CT3A 2MOXA 3M0UA 1I0CA 2ENMA 1LCKA 1NLPC 2DMOA 2EW3A 2K2MA 1UDLA 2K7AA 1T0HA 4Z89A 1WX6A 4Y92A 1MV0B 2EGAA 4E6RA 1WLPB 1VYUA 2J6KA 3H0HA 1V1CA 2DL5A 2V1QA 2LJ3A 1T0JA 1W70A 4F17A 2AKLA 3RNJA 3U23A 5IHIA 3NHNA 5EC7A 2CSIA 1X2KA 2FO0A 2VWFA 4LE9A 2KEAA 3NGPA 3THKA 3TVTA 1BK2A 1QKXA 2O9SA 2VKNA 2L3PA 2DBKA 1M30A 1Z9ZA 2JW4A 4A63B 2BZXA 2J6OA 4GLMA 4F14A 2GQIA 3EG2A 2GBQA 2DRMA 2PTKA 2JMCA 3H0IA 4LN2A 3UA7A 1AVZC 3NPFA 4GBQA 1T3LA 1AD5A 3VS7A 2LX7A 4AG2C 2JS0A 2SEMA 2YUPA 1UHFA 3I35A 3CQTA 2LJ1A 3H0FA 2GGRA 2RMOA 2EYYA 2KYBA 1OPKA 3VS3A 2GTOA 3ZL7C 4RTVA 2DL7A 2KRSA 3VRZA 1SSHA 1NEGA 4R0KA 2YT6A 4X1VA 1WFWA 3EG1A 2G6FX 4OMMA 2OAWA 1UECA 4HVUA 2RN8A 2KRNA 5IHKA 5L23A 1WI7A 1X43A 2K3BA 4OMPA 1WIEA 3REAB 1RUWA 1WYXA 2JMAA 2ED0A 1ZUYA 2YUOA 1TG0A 3PVLA 4D8KA 1WDXA 4WCIA 2CUDA 2KGTA 2KBTA 1AWWA 4AFUC 2HDAA 3SHWA 1NM7A 2KRMA 2DL4A 2A37A 3VS2A 1AWJA 2RQVA 2CH4A 2QDLA 1K0SA 2OJ2A 2RPNA 2LQNA 5IXFA 2JS2A 4RTYA 2DA9A 4AFZC 4Z88A 1QLYA 1RLPC 4AFSC 3H41A 1NEBA 1M3BA 1YN8A 1K0XA 3VRYA 1M27C 1KSWA 3ULRB 2W0ZA 5FWBA 1H3HA 2NUZA 2O31A 1Y0MA 1JXMA 1B07A 1GBRA 5I22A 5IXBA 2ROTA 4J9BA 5I11A 2CDTA 2K6DA 4J9CA 4J9EA 2XMFA 3I5SA 2KXCA 2AKKA 4LUDA 3REBB 1UUEA 4QT7A 2KROA 1YWPA 2EVRA 2FPDA 2PNIA 1GRIA 1RLQC 2FEIA 2YUNA 1BBZA 1OV3A 1OPLA 3QWXX 2L2PA 1T3SA 3M0QA 2DE0X 1M8MA 4IIMA 1SHGA 3SEMA 2NWMA 1QWEA 4DEXA 1X6BA 2V1RA 2LCSA 2JTEA 4OMNA 2EQIA 1BU1A 2DM1A 2DL3A 4RTUA 1SHFA 3LH5A 2ABLA 2LMJA 1OOTA 1K1ZA 3GBQA 1UHCA 1PRMC 3C0CA 4CC2A 1G83A 2BZYA 3M0PA 3M0SA 2LJ0A 4FSSA 4J9GA 1X69A 1E6HA 1WXTA 2HEQA 1GCPA 2EKHA 1FYNA 1WA7A 2J06A 1VYTA 1X2QA 2L3QA 1K76A 2RQTA 1HJDA 3EHQA 1GL5A 2FPFA 1YWOA 1E6GA 2CH4W 1UTIA 1SEMA 1H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJW B;  5IH2 A;  2LP5 A;  2DL8 A;  2MIO A;  5ECA A;  2O9V A;  2EPD A;  4J9D A;  4OMQ A;  1CKB A;  2JM8 A;  2K9G A;  2EGE A;  1TUD A;  2KE9 A;  2C0O A;  4IIO A;  4F16 A;  2CRE A;  2DBM A;  3EG3 A;  2D0N A;  3QWY A;  4Z8A A;  1K9A A;  4OMO A;  1AEY A;  2M0Y A;  1NG2 A;  2J05 A;  2YDL A;  4CC3 A;  1IO6 A;  2C0I A;  2FG0 A;  2W10 A;  1PNJ A;  1SRM A;  1PKS A;  1H92 A;  2CT4 A;  2HCK A;  3TSZ A;  1QCF A;  2O88 A;  1JO8 A;  1AWO A;  1ZUU A;  4AG1 C;  1KJW A;  1GCQ A;  2BZ8 A;  1AOJ A;  3EG0 A;  1UJY A;  2YSQ A;  1A0N B;  2FPE A;  4RTW A;  2C0T A;  1RI9 A;  1AZE A;  3UAT A;  1FMK A;  2RQW A;  4JZ4 A;  3EGU A;  3UA6 A;  2O2O A;  3VS5 A;  2AZV A;  2DX1 A;  2J6F A;  3O5Z A;  1M3A A;  3UF4 A;  1X27 A;  1ZUK A;  2ECZ A;  2EYX A;  2KR3 A;  4JJC A;  1Z9Q A;  1QWF A;  5IHN A;  1KFZ A;  1ABQ A;  3JV3 A;  2L0A A;  3M0R A;  4RTX A;  2JT4 A;  1SPK A;  3RBB B;  2LZ6 B;  1MV3 A;  2ESW A;  2KNB B;  2A28 A;  4ORZ A;  2D8H A;  3I9Q A;  2ROL A;  3VS4 A;  2RQU A;  1QKW A;  2GNC A;  1NYF A;  1PWT A;  1GBQ A;  1J3T A;  3FJ5 A;  4JZ3 A;  4K11 A;  2A36 A;  1G2B A;  2ED1 A;  1WXB A;  1YNZ A;  1N5Z A;  1W1F A;  3NMZ C;  2GTJ A;  2AK5 A;  1VA7 A;  2HBW A;  3IQL A;  1I1J A;  2EYZ A;  1JQQ A;  2SRC A;  4CC4 B;  2B86 A;  2LQW A;  2DVJ A;  1AWX A;  2BTT A;  1ABO A;  4RTZ A;  4RTT A;  5GJV B;  1U3O A;  2KT1 A;  4RUG A;  2CUB A;  4KRT A;  4D8D A;  2RF0 A;  4DEY A;  1OEB A;  2YUQ A;  3M0T A;  2X3X D;  1MUZ A;  4HXJ A;  4JJD A;  5FWC A;  2L3S A;  1ARK A;  3TSW A;  1K4U S;  1W6X A;  1UGV A;  2D1X A;  3VS0 A;  2F2W A;  3EHR A;  1JU5 C;  4LNP A;  1NYG A;  3KFV A;  1I07 A;  1Y57 A;  2LNH B;  2E5K A;  2DF6 A;  4JJB A;  4M4Z A;  1YP5 A;  3R6N A;  1ZX6 A;  1CSK A;  1X6G A;  2RQR A;  2MCN A;  2KYM A;  1BB9 A;  4AFQ C;  2EGC A;  1JXO A;  4ZNX A;  2A08 A;  5FW9 A;  1GCQ C;  4J9F A;  2K79 A;  4HCK A;  1M3C A;  3PVQ A;  2HSP A;  2KT8 A;  2DYB A;  1HD3 A;  5HCK A;  1YCS B;  2IIM A;  4J9H A;  1UE9 A;  2P4R A;  2DIL A;  3A98 A;  2EBP A;  3VS6 A;  1UFF A;  1PRL C;  2F2X A;  4HVW A;  1PHT A;  1ZBJ A;  1ZLM A;  1TUC A;  3VS1 A;  2D8J A;  1E7O A;  1GFC A;  2OI3 A;  1U5S A;  1S1N A;  1NLO C;  4HVV A;  1UJ0 A;  2PZ1 A;  2RNA A;  4LUE A;  1JEG A;  2VVK A;  1XOV A;  1GFD A;  1KIK A;  1ZSG A;  2JM9 A;  4OML A;  4CC7 A;  1U06 A;  2M51 A;  2DRK A;  1VYV A;  2X3W D;  1SRL A;  2J7I A;  2I0N A;  2H8H A;  1CKA A;  2DLP A;  2EYW A;  3I5R A;  1UG1 A;  2KXD A;  1B3Q A;  1EFN A;  2CSQ A;  2F2V A;  2FRW A;  2DJQ A;  2JXB A;  3PE0 A;  1PKT A;  4J9I A;  2DNU A;  2AZS A;  1HSQ A;  4JPB W;  4EIK A;  4ESR A;  1WXU A;  2FRY A;  1AZG B;  2CT3 A;  2MOX A;  3M0U A;  1I0C A;  2ENM A;  1LCK A;  1NLP C;  2DMO A;  2EW3 A;  2K2M A;  1UDL A;  2K7A A;  1T0H A;  4Z89 A;  1WX6 A;  4Y92 A;  1MV0 B;  2EGA A;  4E6R A;  1WLP B;  1VYU A;  2J6K A;  3H0H A;  1V1C A;  2DL5 A;  2V1Q A;  2LJ3 A;  1T0J A;  1W70 A;  4F17 A;  2AKL A;  3RNJ A;  3U23 A;  5IHI A;  3NHN A;  5EC7 A;  2CSI A;  1X2K A;  2FO0 A;  2VWF A;  4LE9 A;  2KEA A;  3NGP A;  3THK A;  3TVT A;  1BK2 A;  1QKX A;  2O9S A;  2VKN A;  2L3P A;  2DBK A;  1M30 A;  1Z9Z A;  2JW4 A;  4A63 B;  2BZX A;  2J6O A;  4GLM A;  4F14 A;  2GQI A;  3EG2 A;  2GBQ A;  2DRM A;  2PTK A;  2JMC A;  3H0I A;  4LN2 A;  3UA7 A;  1AVZ C;  3NPF A;  4GBQ A;  1T3L A;  1AD5 A;  3VS7 A;  2LX7 A;  4AG2 C;  2JS0 A;  2SEM A;  2YUP A;  1UHF A;  3I35 A;  3CQT A;  2LJ1 A;  3H0F A;  2GGR A;  2RMO A;  2EYY A;  2KYB A;  1OPK A;  3VS3 A;  2GTO A;  3ZL7 C;  4RTV A;  2DL7 A;  2KRS A;  3VRZ A;  1SSH A;  1NEG A;  4R0K A;  2YT6 A;  4X1V A;  1WFW A;  3EG1 A;  2G6F X;  4OMM A;  2OAW A;  1UEC A;  4HVU A;  2RN8 A;  2KRN A;  5IHK A;  5L23 A;  1WI7 A;  1X43 A;  2K3B A;  4OMP A;  1WIE A;  3REA B;  1RUW A;  1WYX A;  2JMA A;  2ED0 A;  1ZUY A;  2YUO A;  1TG0 A;  3PVL A;  4D8K A;  1WDX A;  4WCI A;  2CUD A;  2KGT A;  2KBT A;  1AWW A;  4AFU C;  2HDA A;  3SHW A;  1NM7 A;  2KRM A;  2DL4 A;  2A37 A;  3VS2 A;  1AWJ A;  2RQV A;  2CH4 A;  2QDL A;  1K0S A;  2OJ2 A;  2RPN A;  2LQN A;  5IXF A;  2JS2 A;  4RTY A;  2DA9 A;  4AFZ C;  4Z88 A;  1QLY A;  1RLP C;  4AFS C;  3H41 A;  1NEB A;  1M3B A;  1YN8 A;  1K0X A;  3VRY A;  1M27 C;  1KSW A;  3ULR B;  2W0Z A;  5FWB A;  1H3H A;  2NUZ A;  2O31 A;  1Y0M A;  1JXM A;  1B07 A;  1GBR A;  5I22 A;  5IXB A;  2ROT A;  4J9B A;  5I11 A;  2CDT A;  2K6D A;  4J9C A;  4J9E A;  2XMF A;  3I5S A;  2KXC A;  2AKK A;  4LUD A;  3REB B;  1UUE A;  4QT7 A;  2KRO A;  1YWP A;  2EVR A;  2FPD A;  2PNI A;  1GRI A;  1RLQ C;  2FEI A;  2YUN A;  1BBZ A;  1OV3 A;  1OPL A;  3QWX X;  2L2P A;  1T3S A;  3M0Q A;  2DE0 X;  1M8M A;  4IIM A;  1SHG A;  3SEM A;  2NWM A;  1QWE A;  4DEX A;  1X6B A;  2V1R A;  2LCS A;  2JTE A;  4OMN A;  2EQI A;  1BU1 A;  2DM1 A;  2DL3 A;  4RTU A;  1SHF A;  3LH5 A;  2ABL A;  2LMJ A;  1OOT A;  1K1Z A;  3GBQ A;  1UHC A;  1PRM C;  3C0C A;  4CC2 A;  1G83 A;  2BZY A;  3M0P A;  3M0S A;  2LJ0 A;  4FSS A;  4J9G A;  1X69 A;  1E6H A;  1WXT A;  2HEQ A;  1GCP A;  2EKH A;  1FYN A;  1WA7 A;  2J06 A;  1VYT A;  1X2Q A;  2L3Q A;  1K76 A;  2RQT A;  1HJD A;  3EHQ A;  1GL5 A;  2FPF A;  1YWO A;  1E6G A;  2CH4 W;  1UTI A;  1SEM A;  1H8K A; 
#chains in the Genus database with same CATH topology
 5GJW B;  2BKD N;  1WGS A;  3OYN A;  2PQW A;  2DL8 A;  2MIO A;  2EPD A;  3OY9 A;  3CBM A;  1W2B A;  2GFU A;  3JCM d;  1CKB A;  2K9G A;  1BYM A;  1RAD B;  5GMK m;  1YI2 Q;  2C0O A;  3MP6 A;  4FSX A;  2JJ9 A;  3QZ9 B;  1KD1 U;  1KC8 U;  4BB7 A;  4E7S A;  2MK5 A;  3WXM B;  1IO6 A;  3CCJ Q;  4A4K A;  2W10 A;  3GIB A;  2RK1 A;  1RI0 A;  4BE0 A;  1VQ5 A;  4AG1 C;  3R6O A;  5J39 A;  2EKO A;  3J80 E;  2NUT B;  1FX7 A;  2BZ8 A;  4E7Z A;  2YSQ A;  1OZ3 A;  1F1B B;  2FPE A;  2C0T A;  2DTI A;  1RI9 A;  4M78 G;  4A54 A;  2YXY A;  4JZ4 A;  3EGU A;  1QMC A;  3M53 A;  1VQN A;  3VS5 A;  3C12 A;  2K5F A;  3CC2 Q;  2J6F A;  3ME9 A;  3O5Z A;  4JS5 A;  3MPU B;  1I5L A;  2FZK B;  2KR3 A;  4JJC A;  5CQX A;  1PSE A;  4C92 C;  2PUO B;  1IZ6 A;  2M1H A;  2ZPE B;  1KQS P;  5IHN A;  4JRK A;  1ABQ A;  2L0A A;  3OYH A;  2D9T A;  3M0R A;  1SPK A;  3OW2 S;  4DOV A;  5I2M A;  2X9H A;  5KCH A;  3HPW A;  2LZ6 B;  3RIR A;  1MV3 A;  3RR6 A;  4WF2 A;  2KNB B;  4ORZ A;  3CPW A;  3M4G A;  4OMF B;  2XDP A;  2E41 A;  1QKW A;  1NYF A;  2DKG A;  3ASK A;  5GAN 6;  1J3T A;  3C94 A;  2A36 A;  4C5E A;  1YJ9 T;  4J6Y A;  1N5Z A;  4KUD K;  1MMG A;  1ZA1 B;  4HCC A;  4QKU A;  1Q95 G;  3M57 A;  1WHL A;  1B34 B;  3CCS A;  4RTZ A;  3EFR A;  1VQ4 T;  1PD0 A;  2KT1 A;  4BI8 B;  1OEB A;  3M0T A;  4HXJ A;  1HYO A;  4PFZ A;  1K73 C;  1U8R A;  2L3S A;  1ARK A;  5KYW A;  2RJC A;  5GAO p;  2E6N A;  4LD6 A;  1D1B A;  4J5Y A;  1VQO T;  2VAS A;  1FWZ A;  1JU5 C;  1V29 B;  1NYG A;  2K5L A;  4LNP A;  1I07 A;  2X4J A;  2E5K A;  5GAN 5;  2KQW A;  1BCO A;  1ZX6 A;  1G3Y A;  1NPR A;  3E1S A;  1R77 A;  1X6G A;  2RQR A;  4C5G A;  2EGC A;  2RHI A;  4ZNX A;  3SFM A;  4DBR A;  2QXF A;  2FVU A;  3S3O A;  2KT8 A;  2OTL T;  5HCK A;  1HD3 A;  3E9F A;  2IIM A;  3G7Z A;  2P4R A;  2DIL A;  2M0O A;  4C0D B;  3QYG B;  2EBP A;  3BY7 A;  4PL6 A;  1PRL C;  5HY6 A;  2F2X A;  4DBF A;  4JS4 A;  3CD6 Q;  1NPP A;  3CCE A;  2CP7 A;  4PJO F;  2D8J A;  4CI0 C;  4LXC A;  1NLO C;  1Q86 R;  1NBE B;  2LC4 A;  1WZO A;  1IRX A;  2CP2 A;  4ATO A;  1RAC B;  2F5T X;  2VVK A;  1XOV A;  4KH0 B;  3VU3 C;  1ZSG A;  4OML A;  5GAN 4;  1MGQ A;  1SRL A;  2J7I A;  2I0N A;  1CKA A;  5LJ3 j;  3I5R A;  1QVF S;  5CCA A;  2FRW A;  3PIP A;  1YJW T;  4BAC A;  3G4S Q;  5I21 A;  4JPB W;  3CBP A;  2ZPI B;  2RI2 A;  4QVC A;  5J3B A;  2PU9 B;  3CPF A;  3GLX A;  1ZQ1 A;  2DIQ A;  2KAF A;  4NL2 A;  3URG A;  1LVK A;  4OF1 A;  1OYX A;  5A0L A;  1YHQ A;  1LCK A;  1NLP C;  4N4I A;  3CXC P;  1D1A A;  1VQN Q;  2M16 A;  3TEE A;  5KYX A;  3LLR A;  1U1T A;  2MF2 A;  4J7I A;  1M9S A;  2LJ3 A;  1RAB B;  1YJN T;  2JTF A;  4E7I A;  2EFI A;  1VQ7 A;  1X2K A;  2VWF A;  5HKC A;  4LE9 A;  2KEA A;  3X24 B;  1C1A A;  2VKN A;  2L3P A;  1X6O A;  1M30 A;  1VQK A;  2JW4 A;  1KK7 A;  4M77 B;  2EWN A;  4IUT A;  1TH7 A;  4M75 D;  5CAI A;  2GBQ A;  3L2V A;  1V76 A;  2FZG B;  4XTX A;  4JLG A;  4M78 E;  4J6W A;  4GBQ A;  1LJO A;  1AD5 A;  2LX7 A;  1MNE A;  2SEM A;  2YUP A;  4FM4 B;  3CCS Q;  5GMK e;  3H0F A;  4XU0 A;  2D6F A;  2DEU A;  1ZSZ C;  3CPW P;  2EYY A;  1C0M A;  1OQK A;  2HZY A;  2KYB A;  1Q82 R;  3ZL7 C;  2KRS A;  1NEG A;  4R0K A;  4JRP A;  3EG1 A;  2PVD B;  1UGR B;  5DLQ E;  1WHG A;  4CRI A;  3PFS A;  2KRN A;  5LJ5 h;  4E47 A;  4N0A C;  2HBP A;  3RKY A;  1WIE A;  3PMT A;  2GCX A;  3OSS C;  3REA B;  2X4X A;  1WYX A;  5GAN h;  2D0Q B;  2YUO A;  3PVL A;  4D8K A;  1MHN A;  2BUD A;  3L2Z A;  2KGT A;  2DXT A;  3JCM P;  1IB8 A;  2WAC A;  5DLO A;  4KT0 E;  4FL6 A;  5D7U A;  1VQL T;  2FYK A;  3SHW A;  4ZGJ B;  1WQW A;  3RKW A;  2KRM A;  4KGX B;  2R5A A;  2A37 A;  2XHC A;  2OJ2 A;  4BY6 C;  2R58 A;  2F69 A;  2QA4 Q;  1VQP T;  2FHD A;  1QLY A;  4QVD A;  2X35 A;  1M27 C;  1KSW A;  1I4K 1;  2LNV A;  3QJ6 A;  2W0Z A;  2NUZ A;  1B07 A;  1MND A;  4JUV A;  3LGF A;  5KH6 A;  2ROT A;  3V7R A;  3CCM A;  3OYM A;  4XTW A;  2CDT A;  4J9C A;  5KYU B;  2XMF A;  4RG8 A;  1BIA A;  1VQM A;  1YIT A;  4QT7 A;  2RH2 A;  1YWP A;  2LVM A;  2L2P A;  4PLL A;  1M8M A;  4IIM A;  3SEM A;  2NWM A;  2DK3 A;  3P8H A;  2COY A;  1X6B A;  2EQI A;  3EG9 A;  2EQJ A;  2DM1 A;  3CCU A;  2M02 A;  3RUX A;  3GBQ A;  1YIJ A;  2QGG A;  3WVE B;  2E3H A;  1FMW A;  3JSC A;  1X69 A;  1VQ5 T;  4UC4 A;  1OZ2 A;  1VQ7 Q;  2WSE E;  4E7L A;  8ATC B;  2HEQ A;  1TUG B;  1YI2 A;  2ZPG B;  1ZBX A;  1K73 R;  5CR2 A;  1WA7 A;  4XTZ A;  4R56 A;  3BE3 A;  1VQK Q;  2R5M A;  5M9O A;  4M75 A;  4IUQ A;  1GL5 A;  1S72 A;  3CCJ A;  4FYW B;  2CH4 W;  2YHT A;  4C0G A;  1SEM A;  4C0D C;  4PJO E;  2DEQ A;  4C8Q C;  2LP5 A;  5CKB A;  4J6X A;  2QEX T;  1Y96 A;  1RAG B;  1TUD A;  3MO8 A;  5GMK i;  4GY5 A;  4IIO A;  4F16 A;  2DBM A;  3MEU A;  3QWY A;  1QCO A;  3CC2 A;  1K9A A;  2VXE A;  3EFO A;  4OMO A;  2M0Y A;  4F7U F;  4M75 F;  3CMA A;  4II1 A;  4C8Q D;  4CC3 A;  3QYH B;  2C0I A;  1SRM A;  2CT4 A;  2HCK A;  5GAN e;  2AT1 B;  1ZUU A;  5KYN A;  4XTY A;  3CME A;  2LT1 A;  3CCS T;  3ZBD A;  1KJW A;  1GCQ A;  3EG0 A;  1AOJ A;  4XAX B;  1UJY A;  1A0N B;  2QI2 A;  4X9C A;  4HT8 A;  5KYY B;  2NYS A;  2RQW A;  1KG1 A;  2O2O A;  3ER0 A;  2QTV A;  3VUZ A;  3FIF A;  1M3A A;  3UF4 A;  1X27 A;  2ECZ A;  2EYX A;  4JRI A;  2EQU A;  2QQB A;  1QWF A;  2LQK A;  8AT1 B;  3OW2 A;  3PNW C;  1IGQ A;  3P8D A;  1P92 A;  1QVP A;  3GF5 A;  3EG9 B;  3JCM f;  1RAE B;  4M75 G;  1SG5 A;  2ROL A;  3VS4 A;  2RQU A;  3I55 A;  4LDU A;  2RHU A;  2RI5 A;  3G6E A;  1GBQ A;  3FJ5 A;  2CP3 A;  4JZ3 A;  4K11 A;  1M90 C;  1G2B A;  3HTR A;  1YNZ A;  3CCQ T;  1W1F A;  3VV0 A;  1VA7 A;  4Z02 A;  4RCB A;  3CCM Q;  2CP0 A;  1I1J A;  5GAO n;  2F5K A;  4N4H A;  2EYZ A;  1JQQ A;  4M77 C;  3CCE T;  2SRC A;  4FYY B;  4J7F A;  2LQW A;  4L6V 5;  2DVJ A;  1AWX A;  4RTT A;  5GJV B;  4RUG A;  2CUB A;  3HP9 A;  4D8D A;  2MPX C;  2ZZD A;  2RF0 A;  4QQD A;  3TCJ A;  2ZGW A;  4LDW A;  5FWC A;  2A3L A;  4N4G A;  2PUK B;  2CYZ B;  5FLX E;  2XIC A;  1Q86 U;  5CKF A;  3N5B B;  2HQX A;  1UGV A;  2H3J A;  2D1X A;  3VS0 A;  4KH1 B;  3CD6 A;  3KFV A;  2KDS A;  2LNH B;  2LCL A;  3DB4 A;  3JCM g;  2DF6 A;  3CCU Q;  4M4Z A;  3EGX B;  2L5Q A;  1IRE B;  1YIJ Q;  1SKU B;  1K9M C;  5KE3 A;  2EIF A;  1BB9 A;  3EFO B;  1WHH A;  2A08 A;  4HCZ A;  5FW9 A;  2P0P A;  2K79 A;  2OX7 A;  1JRI A;  3O8V A;  3G71 Q;  4FIB A;  2DYB A;  1YCS B;  4JRQ A;  2K5I A;  3UT1 A;  2HSE B;  2E10 A;  4J9H A;  4ME7 A;  1YHQ T;  4RKU E;  4OB1 B;  4XTU A;  4HVW A;  1PHT A;  1ZLM A;  1TUC A;  4L5G A;  3EH1 A;  3LW5 E;  1OU8 A;  5GAM h;  1UGS B;  1S72 Q;  2OI3 A;  3G4S A;  1TOV A;  5L8R E;  4HVV A;  2HAX A;  5GAN d;  1JEG A;  2NUP B;  1QP2 A;  4JDS A;  3CC7 Q;  3JB9 H;  1M8V A;  2VGM A;  4B6M A;  4CC7 A;  1VQK T;  5GMK j;  2X3W D;  3L1A A;  1QVF A;  4PJN A;  3A1P A;  1QVG S;  4M7A C;  3FC3 A;  1NE8 A;  2JOY A;  3CMA Q;  1ACM B;  4C8Q A;  4KUL A;  4OGE A;  1M90 U;  4J9I A;  3FEO A;  2AZS A;  1HSQ A;  1JJ2 A;  4ESR A;  4O6J A;  4GLK A;  5GAO q;  4HT9 A;  2FRY A;  3CME Q;  2BIV A;  4IUP A;  4FT4 A;  2CT3 A;  4BE1 A;  2O4X B;  2ZPH B;  4OGC A;  4M78 B;  4QW2 A;  4M7A D;  4A53 A;  1WJS A;  1UDL A;  4C92 D;  4Z89 A;  2QAZ A;  4Y92 A;  3JB9 J;  3CEY A;  1MV0 B;  4E6R A;  4WTO B;  3GNF B;  2J6K A;  2V1Q A;  4C8Q F;  4F17 A;  2AKL A;  1Q82 U;  3C95 A;  3RNJ A;  3AHU A;  2E1H A;  2XKO C;  4BD3 A;  2CSI A;  1M2O A;  3THK A;  3TVT A;  1QKX A;  2O9S A;  4EMK B;  2DBK A;  4ZN1 A;  1Z9Z A;  5DM7 R;  3MP1 A;  2QTX A;  3I55 Q;  1R0B G;  3OYK A;  2XK0 A;  3G6E Q;  4F14 A;  5CQY A;  3DB3 A;  1RAH B;  4DBH A;  2DRM A;  3S3M A;  4HKE A;  3M59 A;  4KUI A;  1NJI C;  2P0Q A;  4KGZ B;  4HCB A;  4X9D A;  4PJO A;  4R55 A;  3MEW A;  3OW2 P;  2OTJ A;  3MJX A;  1FXX A;  1KHC A;  1UHF A;  1WHK A;  2DD5 A;  3WVD B;  4AT1 B;  9ATC B;  3A8H B;  2GGR A;  2DXU A;  2RMO A;  2CZ1 B;  4C8Q G;  2AHJ B;  2DL7 A;  5CKH A;  5LL6 S;  3PGG A;  1SF9 A;  2EAY A;  4OMM A;  3EFS A;  3CCM T;  3MET A;  2QQ9 A;  4HVU A;  4F7U E;  2RN8 A;  4M75 E;  3PIO A;  5IHK A;  2COZ A;  1D1C A;  5L23 A;  1VQM T;  1YIT T;  2K3B A;  2QA4 A;  1VQ8 A;  2QK0 A;  5CVI A;  2ED0 A;  2RJE A;  3LX7 A;  4KGV B;  3QHS A;  1N27 A;  4WCI A;  2MAM A;  4MDX A;  4IUR A;  2CZ6 B;  5CKD A;  3CXC S;  3JCM b;  4AFU C;  2HMA A;  2HDA A;  5GAM e;  1X01 A;  1NM7 A;  4M77 F;  2DL4 A;  5A0D A;  2Y90 A;  2CH4 A;  1YIJ T;  1VQ6 A;  2V8J A;  2C06 A;  2FB7 A;  3A5Z B;  3SWN C;  3L2U A;  1NEB A;  4J83 A;  2QGF B;  1W2B P;  1K0X A;  1SSF A;  1YI2 T;  3ULR B;  2E65 A;  4ELY C;  2O31 A;  4PJO G;  1JXM A;  3E2U A;  1QCN A;  4C0Z A;  2E64 A;  1GBR A;  2XDB A;  5I22 A;  4M7D C;  4RCC A;  1HXD A;  3J81 E;  3I5S A;  2DJZ A;  3FJP A;  1S72 T;  3REB B;  3CCJ T;  1UUE A;  1K73 U;  2XU8 A;  2EVR A;  2PNI A;  4A4G A;  2KK4 A;  3RES A;  5KYW B;  4E7J A;  1VOM A;  5FU7 B;  4LD9 K;  4DBQ A;  4BDZ A;  3BW1 A;  4M7D D;  4PJO B;  2V1R A;  3JB9 F;  2LCS A;  1M90 R;  4M7A A;  3CC2 T;  4EPC A;  2DL3 A;  4RTU A;  4C92 A;  3CC4 Q;  3LH5 A;  4PJM A;  3CMA T;  3FRN A;  1K1Z A;  5GAM f;  3OYC A;  1O75 A;  4DQ2 A;  1G83 A;  2BZY A;  1D0X A;  2DTO A;  4MMK A;  3M4Y A;  2GF7 A;  1JJ2 P;  3CME T;  3UWN A;  3QII A;  4MML A;  1M4Z A;  3FDR A;  1M5Q 1;  1I8F A;  2MWO A;  3A8M B;  5LJ3 h;  1JBM A;  1VYT A;  3HRU A;  2AIR B;  4M7A F;  2L3R A;  4FYX B;  1K76 A;  2RQT A;  4C92 F;  1M1K C;  1HJD A;  3EHQ A;  1TXQ A;  3BFM A;  2CP6 A;  3QXE B;  1G3W A;  4PFP A;  1YBY A;  3CCV Q;  1K9M R;  1N8R C;  4BI3 A;  4C5I A;  1K8A C;  2O9V A;  4FT2 A;  4OMQ A;  2OTJ Q;  2JM8 A;  4A4E A;  2EGE A;  2H3E B;  2KE9 A;  4A4H A;  4C5H A;  2V8I A;  4NL3 A;  3I55 T;  1I5O B;  3F70 A;  2D0N A;  4Q5W A;  1M2V A;  1WPY A;  4Z8A A;  1AEY A;  3I56 Q;  1PC0 A;  2RHX A;  2V8K A;  1KQ2 A;  2YDL A;  4EMG A;  2MI6 A;  3OYD A;  2WSC E;  1G5V A;  1LPL A;  2FG0 A;  1PNJ A;  3GPL A;  5GAM d;  3TSZ A;  3PT9 A;  3JCM X;  1AWO A;  1PCX A;  1QW1 A;  4M7A G;  1VQ8 Q;  3OYF A;  2QDY B;  3RDV A;  4Y28 E;  4C92 G;  1PM3 A;  3UAT A;  5KYX B;  3TQ7 P;  3OYJ A;  1R0C B;  2XG8 D;  2Z0W A;  2AZV A;  4ZTF A;  5D6Y A;  2DX1 A;  1VQ9 Q;  1ZUK A;  3KBG A;  2LX9 A;  4XU2 A;  5CK9 A;  2EJ9 A;  3CD6 T;  3A8L B;  1EZZ B;  2JT4 A;  3X25 B;  1OI1 A;  3RBB B;  1BI3 A;  4C8Q E;  3CCR Q;  1VQ6 Q;  1VIE A;  4MDW A;  2K2V A;  1G8X A;  2A28 A;  2D8H A;  3I9Q A;  2RK2 A;  1QQJ A;  2GNC A;  1IGU A;  4QQG A;  4YTL A;  5GAN 2;  4JLI A;  2ED1 A;  1Q81 C;  4OVA A;  4ZN3 A;  1OX8 A;  4EMK C;  4PKC C;  4BUG A;  1H64 1;  3NMZ C;  2HBW A;  2JN0 A;  4CC4 B;  2B86 A;  1ZA2 B;  3G4S T;  3OS2 A;  2BTT A;  1OUL A;  4O5V A;  3OYY A;  3HRT A;  3KXT A;  2PVO B;  3EGD A;  2YLB A;  4DEY A;  3G71 A;  1WHM A;  3TU4 K;  1MUZ A;  1UEB A;  2KY9 A;  3TSW A;  1K4U S;  2E70 A;  4HA8 A;  4TVR A;  3RER A;  3V8L A;  4RMO A;  1N8R U;  1K8A U;  3EHR A;  2E6Z A;  1VQN T;  1Y57 A;  2R57 A;  4F7U A;  3V7C A;  1YP5 A;  1NJI R;  3H9N A;  3QZ5 B;  3GOX A;  2EJG A;  2KYM A;  2LRQ A;  4AFQ C;  1JXO A;  4J9F A;  3FLG A;  4HCK A;  1W4S A;  3PVQ A;  5A2Q E;  2HSP A;  4AMC A;  2K57 A;  3CC7 A;  4E7H A;  1D0Y A;  2LTO A;  1UE9 A;  3OMC A;  4M7D F;  3A98 A;  3VS6 A;  1UFF A;  2ZAE A;  5LJ5 e;  3HKS A;  4M77 E;  1Y71 A;  4XK8 E;  1UJ0 A;  3ZFJ A;  1D3B A;  2IVW A;  4NOY A;  4LUE A;  1ZSZ A;  2DD4 A;  1KIK A;  2JM9 A;  1U06 A;  2M51 A;  2ATC B;  2DRK A;  3OS5 A;  3RMS A;  1YJ9 Q;  3SD4 A;  2H8H A;  1QVG A;  3PMI A;  2DLP A;  2EYW A;  1N6A A;  3INZ A;  1AHJ B;  3QPH A;  2KXD A;  3A8O B;  1EFN A;  2CSQ A;  2VGN A;  2COW A;  4N0A A;  1PKT A;  2VB6 A;  1KD1 C;  1KC8 C;  2DNU A;  2RI3 A;  1VQ4 Q;  4ANJ A;  3J7A F;  1TS9 A;  2OTJ T;  1R8O B;  4D6W A;  2KSS A;  2B8A A;  2MOX A;  3M0U A;  3LGL A;  4F7U G;  1I0C A;  1IXD A;  2ENM A;  3VYG A;  2DMO A;  2EW3 A;  2K2M A;  1VQO Q;  1WX6 A;  3E19 A;  1VYU A;  3H0H A;  1V1C A;  2DL5 A;  2QAS A;  4LDV A;  1W70 A;  5LJ5 f;  3U23 A;  5GAM j;  5IHI A;  2V26 A;  1GXI E;  3NHN A;  5EC7 A;  1VQ8 T;  2QA4 T;  4PJL A;  2DIG A;  5GAN f;  3QG1 A;  2FL7 A;  2JUF A;  2RM4 A;  2OTL Q;  2X51 A;  1UGQ B;  4M75 B;  5FU6 B;  3QO3 A;  1TTH B;  2BZX A;  4GLM A;  3M54 A;  1JB0 E;  2VXF A;  3M55 A;  1BI0 A;  3JAM E;  2JMC A;  4M7A E;  5EG2 A;  4M77 D;  3H0I A;  3M56 A;  3UA7 A;  4EDU A;  1TU0 B;  4C92 E;  1Y96 B;  3NFC A;  3JRZ A;  3AT1 B;  1U1S A;  1T3L A;  3OYL A;  3NTI A;  1VQ6 T;  3VS7 A;  3HRS A;  3HHT B;  3I35 A;  3CQT A;  2LJ1 A;  3VKI A;  1B34 A;  4OP0 A;  4V2S A;  1WJR A;  1OPK A;  3S6W A;  3VS3 A;  2GTO A;  5LJ3 d;  3JCM J;  2CKK A;  3VRZ A;  1SSH A;  5LJ5 g;  2YLC A;  3X28 B;  2YT6 A;  4X1V A;  1EX4 A;  5GAN 8;  3SDZ A;  1M1K R;  3V8J A;  2OAW A;  1H3Z A;  1KQS S;  1UEC A;  5GAN g;  3L2Q A;  1YJW Q;  1ZSZ B;  2DYI A;  2QQS A;  5LJ5 d;  1X43 A;  4OMP A;  5GMK l;  1RUW A;  1N8R R;  1K8A R;  2JMA A;  1ZUY A;  2DXC A;  1VQ7 T;  4QQ6 A;  3OYB A;  1WDX A;  4FCY A;  2HL3 A;  3DLM A;  2CUD A;  3CXC A;  2KBT A;  2K3Y A;  3JB9 D;  2GFA A;  1H8K A;  1VIF A;  2E3I A;  4PFO A;  4XU1 A;  2DFU A;  1YJN Q;  3VS2 A;  1AWJ A;  2RQV A;  2VUB A;  1K0S A;  2RPN A;  3TRE A;  5IXF A;  5GAN 3;  2JS2 A;  2DA9 A;  2M9U A;  1RLP C;  2HQH A;  5DY9 A;  3HL8 A;  2ZPF B;  4Y91 A;  4B9X A;  5C6S A;  3QDR B;  5FWB A;  1H3H A;  1Y0M A;  2YRV A;  2EQM A;  4BY6 B;  4BDY A;  4OB2 B;  1EIF A;  1G3T A;  2CZ7 B;  4DA4 A;  3CC4 A;  1XNI A;  3MEA A;  5I11 A;  2K6D A;  2KXC A;  1IHW A;  5D6X A;  2AKK A;  1BKB A;  5GAN 7;  1VUB A;  4OB0 B;  5I2S A;  5GAO l;  3M9Q A;  2QEX A;  1RLQ C;  1XTD A;  1OV3 A;  1OPL A;  1HK9 A;  4MZP A;  5GAO m;  1T3S A;  3X26 B;  2DE0 X;  1MMD A;  4PJJ A;  1NZ9 A;  4EMH A;  1SHG A;  3GNG A;  6AT1 B;  1QWE A;  2RB6 A;  1K9M U;  3OA6 A;  1OX9 A;  1Q81 R;  1QVG P;  1B7T A;  2ABL A;  1OOT A;  1UHC A;  1PRM C;  4FSS A;  3M0P A;  2EQK A;  2LJ0 A;  3CCV A;  2EJF A;  5IAY A;  1E6H A;  3QDF A;  5CO7 A;  2G3R A;  1WXT A;  2JZ2 A;  5GMK h;  3EAE A;  1XJW B;  2DZC A;  2OAU A;  1FYN A;  3OS1 A;  2VYT A;  1PSF A;  1X2Q A;  4LDX A;  1VQL Q;  3I56 A;  2L3Q A;  5KE2 A;  2PVG B;  4M7D E;  2A7Y A;  5AYF A;  4M77 A;  2X4Y A;  1UTI A;  1BCM A;  4E2F B;  4PNO A;  5IH2 A;  3OYE A;  1VQP Q;  5ECA A;  2K4Y A;  4J9D A;  1W2B S;  4FW2 A;  3MEV A;  5C0M A;  2IG0 A;  3L2R A;  2CRE A;  3EG3 A;  5KCO A;  3UDC A;  3CCQ A;  2VC8 A;  4C8Q B;  5HK3 A;  1VQ9 A;  3VJP A;  1NG2 A;  4PLI A;  1ZHI A;  2J05 A;  2QYZ A;  2JTM A;  3OBW A;  2P4T A;  3MP8 A;  3CCL A;  1PKS A;  3CCU T;  1H92 A;  2CP5 A;  1RAA B;  1MMA A;  1QCF A;  2O88 A;  1JO8 A;  3CCR A;  3OYA A;  3H8Z A;  2I2L A;  4RTW A;  2DPP B;  1AZE A;  2RA2 A;  3G71 T;  1FMK A;  3DLL A;  3UA6 A;  2HNI A;  1RAI B;  1AT1 B;  1D0Z A;  1Z9Q A;  2QQA A;  1KFZ A;  1M1F A;  3JV3 A;  3OYI A;  4RTX A;  1LNX A;  3LH0 A;  2BE7 D;  1KD1 R;  1JJ2 S;  5LJ5 j;  1KC8 R;  1VQ5 Q;  2ESW A;  1LOJ A;  2JVV A;  3CPW S;  2YRC A;  2XDD A;  5GAN j;  5A0G A;  1NJI U;  1PWT A;  4M77 G;  3CC7 T;  4XU3 A;  3PTA A;  1X75 C;  1G3S A;  1WXB A;  1Y07 A;  3MCA B;  2CGH A;  2DXB A;  3LWH A;  2GTJ A;  4M75 C;  2AK5 A;  5FU6 C;  1YFN A;  3IQL A;  1QVF P;  4FYV B;  1OU9 A;  3VUB A;  4IUU A;  4RG2 A;  1UGP B;  2CS7 A;  1ABO A;  4KBM B;  1N9R A;  5KYU A;  3OSV A;  5FRN A;  1U3O A;  2QEX Q;  2HQE A;  4KRT A;  2ZCF B;  3DKM A;  3VYH B;  2YUQ A;  2X3X D;  4JJD A;  1Q7Y C;  3S3N A;  4J8O A;  1W6X A;  2F2W A;  3MHX A;  4JJB A;  3HSB A;  1PD1 A;  5GAO r;  3R6N A;  1M1G A;  1CSK A;  4P5N A;  3BDL A;  2MCN A;  3V7S A;  3GP8 A;  3JCM h;  1GCQ C;  3OB9 A;  4BE2 A;  3JB9 G;  1M3C A;  2EYQ A;  2KMT A;  2DAQ A;  2JNG A;  1FMV A;  2A0F B;  3JCM Q;  5GAM g;  3D7S B;  1YJ9 A;  3G6E T;  3OBY A;  1ZBJ A;  4PK4 A;  2E5Q A;  3VS1 A;  1E7O A;  1PG5 B;  1GFC A;  1QP3 A;  2F1L A;  5FRO A;  1U5S A;  1S1N A;  4A4F A;  1VQ4 A;  3T9N A;  3QJY A;  2PZ1 A;  4DOW A;  2RNA A;  3OQ5 A;  3ZEH A;  1WNL A;  3QKJ A;  4FU6 A;  3OYG A;  1GFD A;  4XTV A;  2FZC B;  4MZT A;  2DTH A;  1VYV A;  3FB9 A;  4F04 B;  1VQO A;  1DJ7 B;  4QVZ A;  3CCQ Q;  2P84 A;  2Y4Y A;  5FRM A;  1UG1 A;  1B3Q A;  3CCE Q;  2F2V A;  4M78 C;  2DJQ A;  2JXB A;  2CZ0 B;  3PE0 A;  3QUI A;  3CCL Q;  5IT9 E;  4EIK A;  1TSF A;  1WXU A;  4BI4 A;  3QSU A;  1AZG B;  1N9S A;  2RJD A;  4M7A B;  2OTL A;  3LYI A;  2MMP A;  4C92 B;  3EH2 A;  3JCM W;  3HFO A;  2RHZ A;  2K7A A;  1T0H A;  1I81 A;  1BIB A;  4M78 D;  3RMQ A;  5KYY A;  2EGA A;  2LQ8 A;  1WLP B;  1C6V X;  2X4W A;  1RL2 A;  1T0J A;  2K3X A;  1D09 B;  1Q7Y U;  3OMG A;  2FO0 A;  3SWN A;  3NGP A;  3QBY A;  3UPU A;  3CBO A;  1BK2 A;  1M1K U;  3OS0 A;  2BE9 B;  2DVE A;  3RKX A;  4A63 B;  1YHQ Q;  2J6O A;  1RAF B;  2GQI A;  2GQV A;  2LCC A;  3EG2 A;  2PTK A;  4M7D A;  2DZ9 A;  4LN2 A;  1AVZ C;  1YJW A;  5IN1 A;  3Q1J A;  3NPF A;  1KQ1 A;  3L42 A;  1BI2 A;  3M5A A;  2XD0 A;  2YRD A;  2DO3 A;  4AG2 C;  1XQH A;  2JS0 A;  1M2V B;  1UB4 A;  3JCM c;  3SB2 A;  5LJ3 e;  1MMN A;  4XQ3 A;  4RTV A;  4VUB A;  3KUF A;  3NTH A;  1WFW A;  5AT1 B;  4IKF A;  2G6F X;  1KQS A;  4JJN K;  2E4H A;  3BDU A;  3CC4 T;  4NS5 A;  1YJN A;  5HK0 A;  4B9W A;  3JCM e;  1Q86 C;  2RO0 A;  1WI7 A;  5J26 A;  2RD1 A;  2KVQ G;  5D6W A;  2L89 A;  2YWW A;  4ZTJ A;  3EGX A;  1TG0 A;  2KI7 A;  3M58 A;  2LDM A;  5CKE A;  2NLU A;  2QQR A;  2ZPB B;  3JCM V;  1AWW A;  1IHV A;  3NTK A;  4LDY A;  3V8K A;  2IPO B;  3C4S A;  2QDL A;  2HKN A;  2LQN A;  4IUV A;  3CCV T;  4RTY A;  3P8B B;  4AFZ C;  4Z88 A;  3A8G B;  4AFS C;  1Q81 U;  3H41 A;  2VV5 A;  4M7D G;  1M3B A;  1YN8 A;  1YCY A;  3VRY A;  4ZGE B;  5LJ3 f;  2NUP A;  2NUT A;  4MZM A;  1WJQ A;  5IXB A;  2HD0 A;  2HKQ B;  3I56 T;  3SWN B;  3JB9 I;  1TWB A;  5FU7 C;  4J9B A;  3X20 B;  4J9E A;  2Y4X A;  4ZGD B;  3EGD B;  4LUD A;  4X34 A;  4PJO C;  2KRO A;  2FPD A;  1GRI A;  2FEI A;  2YUN A;  1BBZ A;  7AT1 B;  3QWX X;  4E7K A;  2WSF E;  3M0Q A;  2DER A;  1WHJ A;  2O01 E;  4M7D B;  4DEX A;  4C0F A;  3H6Z A;  3LWI A;  2L8D A;  4F7U B;  5CIU A;  1VQL A;  2JTE A;  4OMN A;  2QG9 B;  3MKD A;  1BU1 A;  1Y7X A;  1VQ9 T;  2O4X A;  4PJO D;  1SHF A;  2LT4 A;  4FW1 A;  4M78 A;  2LMJ A;  2MYS A;  1VQM Q;  3C0C A;  4CC2 A;  1YIT Q;  3CCL T;  3M0S A;  1WQ7 A;  2HL5 C;  4ELZ C;  4J9G A;  2MWP A;  1KHI A;  1VQP A;  5LJ3 g;  3CCR T;  2XI9 A;  1GCP A;  1BI1 A;  2EKH A;  1Q82 C;  4OB3 B;  2DET A;  2P0K A;  1O9S A;  2RHY A;  2J06 A;  1Q7Y R;  3G1J A;  4EMK A;  4L59 A;  4M78 F;  3HFN A;  3L2W A;  2E12 A;  2FPF A;  1YWO A;  2RJF A;  3E9G A;  1E6G A;  1D3B B;  2XID A; 
#chains in the Genus database with same CATH homology
 5GJW B;  5IH2 A;  2LP5 A;  2DL8 A;  2MIO A;  5ECA A;  2O9V A;  2EPD A;  4J9D A;  4OMQ A;  1CKB A;  2JM8 A;  2K9G A;  2EGE A;  1TUD A;  2KE9 A;  2C0O A;  4IIO A;  4F16 A;  2CRE A;  2DBM A;  3EG3 A;  2D0N A;  3QWY A;  4Z8A A;  1K9A A;  4OMO A;  1AEY A;  2M0Y A;  1NG2 A;  2J05 A;  2YDL A;  4CC3 A;  1IO6 A;  2C0I A;  2FG0 A;  2W10 A;  1PNJ A;  1SRM A;  1PKS A;  1H92 A;  2CT4 A;  2HCK A;  3TSZ A;  1QCF A;  2O88 A;  1JO8 A;  1AWO A;  1ZUU A;  4AG1 C;  1KJW A;  1GCQ A;  2BZ8 A;  1AOJ A;  3EG0 A;  1UJY A;  2YSQ A;  1A0N B;  2FPE A;  4RTW A;  2C0T A;  1RI9 A;  1AZE A;  3UAT A;  1FMK A;  2RQW A;  4JZ4 A;  3EGU A;  3UA6 A;  2O2O A;  3VS5 A;  2AZV A;  2DX1 A;  2J6F A;  3O5Z A;  1M3A A;  3UF4 A;  1X27 A;  1ZUK A;  2ECZ A;  2EYX A;  2KR3 A;  4JJC A;  1Z9Q A;  1QWF A;  5IHN A;  1KFZ A;  1ABQ A;  3JV3 A;  2L0A A;  3M0R A;  4RTX A;  2JT4 A;  1SPK A;  3RBB B;  2LZ6 B;  1MV3 A;  2ESW A;  2KNB B;  2A28 A;  4ORZ A;  2D8H A;  3I9Q A;  2ROL A;  3VS4 A;  2RQU A;  1QKW A;  2GNC A;  1NYF A;  1PWT A;  1GBQ A;  1J3T A;  3FJ5 A;  4JZ3 A;  4K11 A;  2A36 A;  1G2B A;  2ED1 A;  1WXB A;  1YNZ A;  1N5Z A;  1W1F A;  3NMZ C;  2GTJ A;  2AK5 A;  1VA7 A;  2HBW A;  3IQL A;  1I1J A;  2EYZ A;  1JQQ A;  2SRC A;  4CC4 B;  2B86 A;  2LQW A;  2DVJ A;  1AWX A;  2BTT A;  1ABO A;  4RTZ A;  4RTT A;  5GJV B;  1U3O A;  2KT1 A;  4RUG A;  2CUB A;  4KRT A;  4D8D A;  2RF0 A;  4DEY A;  1OEB A;  2YUQ A;  3M0T A;  2X3X D;  1MUZ A;  4HXJ A;  4JJD A;  5FWC A;  2L3S A;  1ARK A;  3TSW A;  1K4U S;  1W6X A;  1UGV A;  2D1X A;  3VS0 A;  2F2W A;  3EHR A;  1JU5 C;  4LNP A;  1NYG A;  3KFV A;  1I07 A;  1Y57 A;  2LNH B;  2E5K A;  2DF6 A;  4JJB A;  4M4Z A;  1YP5 A;  3R6N A;  1ZX6 A;  1CSK A;  1X6G A;  2RQR A;  2MCN A;  2KYM A;  1BB9 A;  4AFQ C;  2EGC A;  1JXO A;  4ZNX A;  2A08 A;  5FW9 A;  1GCQ C;  4J9F A;  2K79 A;  4HCK A;  1M3C A;  3PVQ A;  2HSP A;  2KT8 A;  2DYB A;  1HD3 A;  5HCK A;  1YCS B;  2IIM A;  4J9H A;  1UE9 A;  2P4R A;  2DIL A;  3A98 A;  2EBP A;  3VS6 A;  1UFF A;  1PRL C;  2F2X A;  4HVW A;  1PHT A;  1ZBJ A;  1ZLM A;  1TUC A;  3VS1 A;  2D8J A;  1E7O A;  1GFC A;  2OI3 A;  1U5S A;  1S1N A;  1NLO C;  4HVV A;  1UJ0 A;  2PZ1 A;  2RNA A;  4LUE A;  1JEG A;  2VVK A;  1XOV A;  1GFD A;  1KIK A;  1ZSG A;  2JM9 A;  4OML A;  4CC7 A;  1U06 A;  2M51 A;  2DRK A;  1VYV A;  2X3W D;  1SRL A;  2J7I A;  2I0N A;  2H8H A;  1CKA A;  2DLP A;  2EYW A;  3I5R A;  1UG1 A;  2KXD A;  1B3Q A;  1EFN A;  2CSQ A;  2F2V A;  2FRW A;  2DJQ A;  2JXB A;  3PE0 A;  1PKT A;  4J9I A;  2DNU A;  2AZS A;  1HSQ A;  4JPB W;  4EIK A;  4ESR A;  1WXU A;  2FRY A;  1AZG B;  2CT3 A;  2MOX A;  3M0U A;  1I0C A;  2ENM A;  1LCK A;  1NLP C;  2DMO A;  2EW3 A;  2K2M A;  1UDL A;  2K7A A;  1T0H A;  4Z89 A;  1WX6 A;  4Y92 A;  1MV0 B;  2EGA A;  4E6R A;  1WLP B;  1VYU A;  2J6K A;  3H0H A;  1V1C A;  2DL5 A;  2V1Q A;  2LJ3 A;  1T0J A;  1W70 A;  4F17 A;  2AKL A;  3RNJ A;  3U23 A;  5IHI A;  3NHN A;  5EC7 A;  2CSI A;  1X2K A;  2FO0 A;  2VWF A;  4LE9 A;  2KEA A;  3NGP A;  3THK A;  3TVT A;  1BK2 A;  1QKX A;  2O9S A;  2VKN A;  2L3P A;  2DBK A;  1M30 A;  1Z9Z A;  2JW4 A;  4A63 B;  2BZX A;  2J6O A;  4GLM A;  4F14 A;  2GQI A;  3EG2 A;  2GBQ A;  2DRM A;  2PTK A;  2JMC A;  3H0I A;  4LN2 A;  3UA7 A;  1AVZ C;  3NPF A;  4GBQ A;  1T3L A;  1AD5 A;  3VS7 A;  2LX7 A;  4AG2 C;  2JS0 A;  2SEM A;  2YUP A;  1UHF A;  3I35 A;  3CQT A;  2LJ1 A;  3H0F A;  2GGR A;  2RMO A;  2EYY A;  2KYB A;  1OPK A;  3VS3 A;  2GTO A;  3ZL7 C;  4RTV A;  2DL7 A;  2KRS A;  3VRZ A;  1SSH A;  1NEG A;  4R0K A;  2YT6 A;  4X1V A;  1WFW A;  3EG1 A;  2G6F X;  4OMM A;  2OAW A;  1UEC A;  4HVU A;  2RN8 A;  2KRN A;  5IHK A;  5L23 A;  1WI7 A;  1X43 A;  2K3B A;  4OMP A;  1WIE A;  3REA B;  1RUW A;  1WYX A;  2JMA A;  2ED0 A;  1ZUY A;  2YUO A;  1TG0 A;  3PVL A;  4D8K A;  1WDX A;  4WCI A;  2CUD A;  2KGT A;  2KBT A;  1AWW A;  4AFU C;  2HDA A;  3SHW A;  1NM7 A;  2KRM A;  2DL4 A;  2A37 A;  3VS2 A;  1AWJ A;  2RQV A;  2CH4 A;  2QDL A;  1K0S A;  2OJ2 A;  2RPN A;  2LQN A;  5IXF A;  2JS2 A;  4RTY A;  2DA9 A;  4AFZ C;  4Z88 A;  1QLY A;  1RLP C;  4AFS C;  3H41 A;  1NEB A;  1M3B A;  1YN8 A;  1K0X A;  3VRY A;  1M27 C;  1KSW A;  3ULR B;  2W0Z A;  5FWB A;  1H3H A;  2NUZ A;  2O31 A;  1Y0M A;  1JXM A;  1B07 A;  1GBR A;  5I22 A;  5IXB A;  2ROT A;  4J9B A;  5I11 A;  2CDT A;  2K6D A;  4J9C A;  4J9E A;  2XMF A;  3I5S A;  2KXC A;  2AKK A;  4LUD A;  3REB B;  1UUE A;  4QT7 A;  2KRO A;  1YWP A;  2EVR A;  2FPD A;  2PNI A;  1GRI A;  1RLQ C;  2FEI A;  2YUN A;  1BBZ A;  1OV3 A;  1OPL A;  3QWX X;  2L2P A;  1T3S A;  3M0Q A;  2DE0 X;  1M8M A;  4IIM A;  1SHG A;  3SEM A;  2NWM A;  1QWE A;  4DEX A;  1X6B A;  2V1R A;  2LCS A;  2JTE A;  4OMN A;  2EQI A;  1BU1 A;  2DM1 A;  2DL3 A;  4RTU A;  1SHF A;  3LH5 A;  2ABL A;  2LMJ A;  1OOT A;  1K1Z A;  3GBQ A;  1UHC A;  1PRM C;  3C0C A;  4CC2 A;  1G83 A;  2BZY A;  3M0P A;  3M0S A;  2LJ0 A;  4FSS A;  4J9G A;  1X69 A;  1E6H A;  1WXT A;  2HEQ A;  1GCP A;  2EKH A;  1FYN A;  1WA7 A;  2J06 A;  1VYT A;  1X2Q A;  2L3Q A;  1K76 A;  2RQT A;  1HJD A;  3EHQ A;  1GL5 A;  2FPF A;  1YWO A;  1E6G A;  2CH4 W;  1UTI A;  1SEM A;  1H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...