1X43A

Solution structure of the sh3 domain of endophilin b1 (sh3g1b1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
81
structure length
81
Chain Sequence
GSSGSSGLNDLKESSNNRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITYLELLNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of Endophilin B1 (Sh3g1b1)
rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords SH3 domain GRB2-like protein B1
total genus 9
structure length 81
sequence length 81
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x43A01
1QKWA 3TSZA 3M0SA 5I11A 2DL8A 1QWFA 4ORZA 1K9AA 2KXCA 1RUWA 1GBRA 2K3BA 1E6GA 1GCQA 1Y57A 1GBQA 4J9CA 4IIOA 2DE0X 2DMOA 3GBQA 1LCKA 1BU1A 1QKXA 2P4RA 2CUDA 1A0NB 3CQTA 1NEBA 1NM7A 1M3BA 3A98A 4K11A 1WLPB 2YUQA 3UA6A 2KNBB 4HXJA 1PKSA 2OI3A 4J9EA 1W6XA 2ECZA 1NLOC 4Y92A 1UUEA 3VS4A 1AWWA 1ZUUA 4AFQC 1GFDA 1UJ0A 2YT6A 1SRLA 2AK5A 2DYBA 1ZUKA 2M0YA 2GTJA 4LUEA 2YUPA 2O9SA 2PTKA 2HBWA 1SRMA 2OAWA 1BK2A 1NG2A 2EKHA 2FRWA 3M0QA 3KFVA 2ABLA 1X27A 2J6OA 2K7AA 4D8DA 3VS7A 2LNHB 1K1ZA 4J9FA 1AEYA 1QLYA 1AWOA 2PZ1A 4FSSA 2CT3A 3EG1A 5I22A 1AD5A 2EQIA 3I9QA 1QCFA 2LP5A 1VYTA 4LN2A 2RN8A 4E6RA 2J6KA 2GNCA 4RTWA 1OPKA 1AOJA 2FRYA 2RQTA 1WXTA 3REAB 5L23A 1NEGA 2LJ0A 4HVVA 5EC7A 2O88A 3EGUA 5IHNA 4OMPA 4RTZA 1K0SA 4OMNA 1H92A 2F2WA 2AKLA 4JJBA 3H0FA 3R6NA 3EG2A 3UATA 2O9VA 5IHKA 1H3HA 3FJ5A 1AZEA 1BB9A 4OMOA 2CUBA 1JQQA 2LJ1A 2KRSA 2SEMA 2LQNA 1WX6A 2L3PA 2NWMA 2EVRA 1WA7A 2EW3A 3VS2A 4AG2C 2DL3A 1AWJA 1YCSB 2B86A 4CC3A 4F17A 5HCKA 2KXDA 4A63B 2KEAA 2JM8A 3EHQA 1UJYA 2RNAA 1UHCA 1UE9A 1CKBA 1V1CA 3RNJA 2G6FX 2YDLA 3VRZA 2LCSA 1TG0A 3M0TA 1UTIA 2F2VA 1Y0MA 3VS1A 4CC7A 1K4US 2J6FA 2PNIA 1KIKA 2BZYA 2MIOA 4AG1C 2BZ8A 2JM9A 2EYXA 3M0PA 3PE0A 2J06A 2JW4A 1NYGA 4RTYA 2DL7A 1X2QA 4AFZC 2LQWA 1I1JA 2GQIA 2L3QA 3EHRA 1WDXA 1PKTA 4HVWA 2DJQA 2NUZA 1ZBJA 2L0AA 2GGRA 2W10A 5FW9A 1XOVA 1UFFA 2JTEA 4F14A 1M3CA 3C0CA 2DRMA 4RTVA 1M3AA 1SHGA 2KGTA 4JZ3A 1TUDA 2ROTA 2LJ3A 2BTTA 1NLPC 4HCKA 1AWXA 2L2PA 1ARKA 4X1VA 1OOTA 2KBTA 3H0IA 1S1NA 3UF4A 5IH2A 1ZUYA 1HSQA 2JMCA 2W0ZA 4M4ZA 4GBQA 1JO8A 1AVZC 4J9HA 2ED0A 2RMOA 2ROLA 2RQUA 2DILA 1GRIA 1JXMA 2J05A 2CDTA 1GCPA 3H0HA 1VYVA 1M30A 4D8KA 2JT4A 2DX1A 1CKAA 2RF0A 4DEXA 2CREA 5IXBA 1JEGA 2EYZA 3VRYA 4J9DA 2DBMA 2CT4A 1OPLA 2FO0A 4Z88A 2IIMA 4JJDA 1T0JA 2FPEA 3I5RA 2A37A 4F16A 4HVUA 3IQLA 1G2BA 2C0IA 4RTTA 1MUZA 2MOXA 4KRTA 2A08A 2EGCA 2HCKA 2X3WD 1HD3A 1PRLC 1ZSGA 2CSIA 2YSQA 2ESWA 1W70A 1T0HA 2A36A 1N5ZA 4GLMA 2RQRA 2DA9A 4J9GA 2KR3A 2L3SA 4CC2A 2DF6A 2J7IA 2K2MA 3THKA 1I07A 2DBKA 1GL5A 4JPBW 2KROA 1VYUA 3VS6A 2AZVA 2FPFA 4QT7A 1KSWA 2E5KA 2DRKA 3REBB 4DEYA 2GBQA 1X43A 2GTOA 3PVQA 3TSWA 1PNJA 4LE9A 4CC4B 1EFNA 2EYYA 3EG3A 1VA7A 2DL5A 4J9BA 4RUGA 1E6HA 2LMJA 1WXBA 1X69A 1X6BA 3M0RA 2VKNA 1ABOA 2F2XA 2CH4W 2SRCA 4LNPA 2K79A 2HDAA 1WXUA 5IHIA 2JS2A 3VS3A 1YP5A 2A28A 4RTUA 2MCNA 1H8KA 2O2OA 3LH5A 2FG0A 2YUNA 1UG1A 3H41A 3VS5A 1MV3A 2JXBA 1K0XA 1T3SA 1X2KA 4R0KA 2FPDA 3ULRB 1SHFA 1WYXA 1W1FA 1KFZA 1E7OA 2V1RA 1BBZA 5FWBA 3M0UA 1QWEA 2JMAA 1TUCA 1X6GA 2RQWA 3I5SA 1JXOA 2YUOA 2K6DA 1YWOA 1ZX6A 5GJWB 2DNUA 4ZNXA 3SEMA 1AZGB 3QWXX 2JS0A 2EPDA 2FEIA 1SEMA 1J3TA 2RQVA 1RLQC 1MV0B 1ABQA 1U3OA 3UA7A 2AZSA 4OMQA 4AFUC 5GJVB 2M51A 2DM1A 1WI7A 1B07A 2EBPA 2CSQA 1UECA 1B3QA 1YWPA 1I0CA 1T3LA 2ENMA 3NHNA 1FYNA 2CH4A 2AKKA 1K76A 1GFCA 5ECAA 3O5ZA 1PRMC 1WFWA 3SHWA 3NMZC 3PVLA 4OMLA 4RTXA 2DLPA 2K9GA 2BZXA 2V1QA 2LZ6B 3I35A 2HSPA 2VVKA 1OV3A 4EIKA 1NYFA 5FWCA 1M8MA 2DVJA 1GCQC 2EGEA 4ESRA 2EGAA 4JZ4A 2KE9A 4IIMA 2EYWA 1CSKA 2D8JA 3NPFA 4LUDA 2XMFA 1HJDA 1ZLMA 4OMMA 4J9IA 3ZL7C 1U06A 2X3XD 3EG0A 1Z9ZA 4Z89A 1JU5C 2O31A 2D8HA 2KRNA 3NGPA 1PHTA 2D1XA 3U23A 3TVTA 1M27C 4AFSC 5IXFA 1U5SA 1YN8A 3JV3A 2C0OA 2ED1A 2OJ2A 1UDLA 1RLPC 2LX7A 1PWTA 3VS0A 1RI9A 1IO6A 3RBBB 2I0NA 2VWFA 1G83A 4Z8AA 2KYMA 3QWYA 1SPKA 1KJWA 1OEBA 2H8HA 4JJCA 1Z9QA 2D0NA 4WCIA 2HEQA 2C0TA 2KRMA 2RPNA 2KYBA 1WIEA 2DL4A 1SSHA 2KT1A 2KT8A 2QDLA 1UGVA 1YNZA 1UHFA 1FMKA
chains in the Genus database with same CATH superfamily
4HCZA 3EG9A 1UB4A 3TSZA 1VQ7T 4KT0E 1QCNA 1IGUA 5I11A 2DL8A 1QWFA 2F69A 1FMVA 4ORZA 1B34B 1I5OB 1RACB 1YI2Q 1VQKT 3EGDB 3PGGA 3GNFB 3FRNA 4J6XA 2MMPA 2GCXA 3LGLA 4KUIA 1VQOT 1A0NB 2QEXA 4Z02A 4DOWA 1M3BA 4HCCA 3CXCA 2LCLA 1BCOA 2KNBB 4JLGA 4HXJA 4BE2A 1WNLA 1QVFP 1W6XA 2ECZA 4M77C 4Y92A 1UUEA 1WQWA 2HQHA 4CRIA 2L3RA 4QQ6A 1SRLA 3CCRT 3EFSA 2PVDB 1Q81U 2E64A 2HBWA 1KK7A 1NG2A 2XK0A 1X27A 2XU8A 3OS2A 1K73U 4J9FA 1I81A 3NTKA 4M75C 1QLYA 3SFMA 3VU3C 4E2FB 2P0QA 4XAXB 5J39A 2WACA 2QQSA 3MCAB 3CPWS 1KC8U 4C8QD 4C0ZA 4C92D 2AHJB 1YJ9T 1VYTA 4E47A 1G3TA 1WHGA 3UPUA 3V7RA 2GNCA 2RQTA 3OYGA 3REAB 2LJ0A 2O88A 3EGUA 2FYKA 1RAFB 3EFRA 3QIIA 1G5VA 3FLGA 1WHKA 4OMNA 1H92A 4FSXA 2DVEA 4JJBA 3R6NA 5D7UA 4Q5WA 1H3HA 5GAMf 5KYUB 5CKDA 3OYNA 2CUBA 1JQQA 2KRSA 2SEMA 4A4EA 5LJ5f 2EJ9A 3JCMd 4BE0A 2B86A 1YCSB 5GANd 4F7UA 2L8DA 3CCST 4M77D 3EHQA 5CKEA 1UHCA 5GAMe 3RNJA 2G6FX 3MEVA 1YIJT 1QW1A 2ZPBB 3VRZA 4RG8A 4BY6B 2QG9B 5IT9E 3DKMA 3M0TA 1MMAA 2F2VA 3A1PA 3P8DA 1I4K1 3VS1A 3OY9A 4PJOF 1YITQ 1YITT 3A8LB 4AG1C 2JM9A 2GF7A 3M4GA 1Q7YR 4PJOE 1S72T 2OTLT 5CQYA 5KCHA 1RAIB 3HHTB 5GANe 2PUKB 4CI0C 3EG9B 3QSUA 3EH2A 4AFZC 4KUDK 3OYCA 2YRVA 4C5EA 1I1JA 3SB2A 4HA8A 3LLRA 5GMKj 2GQIA 5FU7C 4OB0B 4C0DC 4HVWA 1K73R 1N8RR 2ZAEA 2OTJT 1VQLQ 2W10A 2ZPEB 5GAN4 1EZZB 3J7AF 4RTVA 4JZ3A 1SHGA 2KGTA 3OSSC 1FWZA 2LJ3A 2BTTA 1NLPC 4HCKA 5LJ3h 1AWXA 2XKOC 2K5FA 4PFZA 2JMCA 2W0ZA 3E19A 3QKJA 2YRDA 2ED0A 3X26B 4QVDA 5LL6S 1V29B 1JXMA 3G4ST 4II1A 3V8JA 5KYNA 4ZGDB 3E1SA 2QQAA 3CCLT 2EYZA 5M9OA 3HFOA 4O6JA 1T0JA 4F16A 1RAAB 5GAN6 1RAGB 3HRTA 3JCMQ 3CCLQ 3PIPA 1D1BA 2RHIA 4JDSA 3LWIA 1M4ZA 3RERA 2X9HA 1MMGA 3RESA 1GXIE 1Y96A 3CCQQ 2ESWA 1T0HA 4X9CA 3PNWC 2L5QA 4MZTA 2A36A 1U8RA 1N5ZA 4L59A 2X35A 3QJYA 1IHWA 5CO7A 1IXDA 1Q7YU 4DBFA 1OI1A 1I07A 1VYUA 5FU6B 2AZVA 1KSWA 4C8QE 3VYGA 2NLUA 3REBB 4DEYA 2JTMA 2GBQA 4C8QF 1X43A 7AT1B 5C0MA 3T9NA 3GLXA 3SDZA 1Q86U 4CC4B 2EQUA 1JJ2A 2E70A 3EG3A 4B9WA 2LT4A 4RUGA 1PSFA 5KCOA 2JNGA 2YXYA 4XU0A 5CQXA 4DOVA 1X6BA 3FDRA 1W4SA 2HL3A 1DJ7B 2CZ7B 3CCJQ 4KULA 1BKBA 4M7DB 3VS3A 2A28A 1SG5A 4RTUA 2MCNA 2FG0A 2E4HA 3G71A 2H3EB 1MV3A 2KSSA 3JCMV 1X2KA 4R0KA 1SHFA 1WYXA 4M77F 3OYHA 1KFZA 2EWNA 2V1RA 2MWPA 2JMAA 4P5NA 1M1KU 2YUOA 2D0QB 1ZX6A 1LVKA 5HKCA 3SEMA 2P84A 4ZGJB 2EPDA 3A8GB 1J3TA 3G6EA 1C0MA 4C92B 4X9DA 1U3OA 3CMEA 2BIVA 4M7AG 1I5LA 4L5GA 2ZPHB 1W2BS 2R57A 3JB9F 2QQRA 5FU6C 4PJLA 2DM1A 3L42A 2HMAA 1R0BG 4LDYA 4OMFB 1YWPA 3QYHB 3CBMA 4E7KA 3G7ZA 2QTVA 1IREB 2YLCA 4N4IA 4XQ3A 2H3JA 3OW2S 3NHNA 5CR2A 2AKKA 3MP6A 3BDLA 1GFCA 5ECAA 2EFIA 1QVGP 2EJGA 3NMZC 4HCBA 4XTVA 2BZXA 2V1QA 1D0XA 1TUGB 2COZA 5LJ5g 2HSPA 1OV3A 3JCMf 3G6EQ 3X25B 4D6WA 5LJ3j 2DVJA 2NUPA 1I8FA 1IGQA 2EGAA 3RUXA 1TOVA 5KYYB 4EMGA 4MMKA 3KBGA 1K9MC 1IRXA 3ZL7C 1YBYA 3EG0A 2ZPIB 1JU5C 1OX8A 2KRNA 1IZ6A 3INZA 2DFUA 3NGPA 3TVTA 3CCVT 1YN8A 5GMKm 2RJFA 1FMWA 3CC4Q 1D3BB 1UDLA 4J8OA 4XU2A 1RI9A 3QYGB 1D0YA 1U1TA 1LNXA 4JUVA 2VWFA 3PMIA 1JJ2S 2KYMA 3AHUA 1KHIA 2MK5A 1OEBA 5I2SA 3L2WA 4PK4A 5CCAA 2HEQA 2GFUA 2KYBA 1WIEA 1SSHA 2KT8A 3CC2Q 2OTLQ 4KRTA 2DTHA 1QKWA 3CCQA 1XTDA 2E6ZA 1K9AA 2KXCA 1QQJA 1GBRA 1E6GA 3QZ9B 2QEXQ 1Y57A 4RCCA 4IIOA 2DMOA 4EMHA 5GAN7 3X28B 2BUDA 2RD1A 1KD1R 1D3BA 2CZ0B 2CUDA 3CQTA 2YHTA 4ELZC 1NM7A 4K11A 1N9SA 4GLKA 3NTIA 3VUBA 2LNVA 4J9EA 5LJ5j 4XTWA 1AWWA 2FL7A 4ZN1A 2XICA 4AFQC 4C92G 3G6ET 3O8VA 4ME7A 4NOYA 3V8KA 1UJ0A 3HFNA 4PJOB 2QA4Q 2M0YA 1X01A 3WVDB 1VQ7A 2YUPA 1VIEA 5GAN3 2DD4A 1SRMA 3HRUA 2ABLA 2J6OA 3EGDA 4D8DA 3VS7A 3BDUA 1K1ZA 2DYIA 1K8AU 5FRMA 1AEYA 4MDWA 4FSSA 1Q86C 2YLBA 1VQ5T 1UEBA 2EQIA 3I9QA 1OU9A 2LP5A 2V8KA 4C8QC 2KVQG 2RN8A 3QPHA 4E6RA 1OX9A 3UWNA 4FYWB 4RTWA 1OYXA 2KAFA 1WGSA 5L23A 4OP0A 4OGCA 5GANh 5EC7A 3OYLA 4RTZA 5KYXB 3OYJA 2XI9A 2F2WA 2AKLA 1WHMA 3UATA 3V8LA 2E3IA 4F7UG 2O9VA 3OBWA 5IHKA 1M1KC 3FJ5A 4J6WA 1BB9A 1BYMA 4E7HA 3FB9A 4C92E 3URGA 2FZGB 2RJCA 1G3WA 5GAOm 4AG2C 3JB9J 2DL3A 1AWJA 1G3YA 1NZ9A 4OF1A 4JLIA 3M54A 2KEAA 4IURA 1UJYA 2XG8D 2RNAA 2ATCB 1NPPA 1V1CA 1VQPT 2YDLA 4X34A 1Q86R 4WTOB 1PD0A 4IUQA 4BDZA 1RAEB 3JB9H 1ACMB 2RH2A 2J6FA 1NJIU 4M75G 1VQ4A 2EYXA 8ATCB 1HYOA 3PE0A 4UC4A 4ATOA 4BUGA 4PJOD 3L2ZA 2HBPA 2XHCA 2L3QA 4KGZB 2DJQA 1HK9A 4XTZA 3CC7Q 2CGHA 1FXXA 3OMCA 2L0AA 3VKIA 1AHJB 4LDXA 2RJEA 1XJWB 3GIBA 1UFFA 3OYDA 2DO3A 2YWWA 1D09B 2ROTA 3OA6A 1OOTA 1K73C 3UF4A 3SD4A 5A0DA 5DM7R 2NYSA 4QW2A 1JO8A 5GAOn 4J9HA 3A5ZB 3HKSA 3CPFA 1YHQA 4M78A 5GAOq 2OTLA 3G71T 2CZ1B 4ZGEB 1KQ2A 1VYVA 4M7DC 3UDCA 3P8BB 1CKAA 2RF0A 2JVVA 3VRYA 4J9DA 4ZTJA 2FO0A 1OPLA 1W2BA 1QVFS 2IIMA 2FPEA 2RI2A 2CP7A 3OYEA 2EAYA 2ZCFB 3IQLA 1Y96B 4HVUA 4BI4A 3LYIA 3N5BB 2A3LA 4DA4A 1MUZA 2MOXA 4BY6C 3OYMA 2A08A 2X3WD 1HD3A 2YSQA 1W70A 1LOJA 1VQLT 4M77A 1KQ1A 3CEYA 2DF6A 1NJIR 3D7SB 4PJJA 4LD9K 3I56A 3G4SA 4QT7A 4M78B 2E5KA 3X24B 2E1HA 1N8RC 4F7UE 2FHDA 5C6SA 3PVQA 1RABB 1EFNA 4BACA 1VA7A 3A8MB 2X51A 1YJNT 4C92F 4C5HA 5CKHA 3M0RA 2VKNA 2F2XA 2QI2A 2HDAA 3C94A 3JAME 1YP5A 1SKUB 2M16A 1X6OA 4EMKA 3CCUQ 2XIDA 3LGFA 5LJ3g 3J81E 1VQPQ 1E7OA 5FWBA 2FZKB 3UT1A 1X6GA 2RQWA 3I5SA 1JXOA 3HTRA 3BW1A 1YWOA 3OYFA 2GFAA 3L2VA 2ZGWA 3QWXX 3OQ5A 2JS0A 2FEIA 1VQ5Q 3CC7T 2RQVA 1RLQC 1WQ7A 3RKXA 2AZSA 4M7AC 4N0AC 3RKWA 2FB7A 5GJVB 3M56A 2XDDA 2M51A 4M75E 2D6FA 4C92A 1B3QA 1M2VB 4C5IA 4F7UB 5CAIA 2BE7D 3M58A 2CH4A 3LW5E 4FM4B 1G8XA 1WFWA 3EFOB 3JCMc 1YHQT 2DIQA 1WJSA 3CCMA 3H6ZA 4RTXA 2K9GA 3SWNC 4PFPA 2MAMA 2QAZA 3I35A 2ZPFB 2HQEA 2VVKA 1VQ9T 1VQNQ 4EIKA 2EQJA 3JCMP 2EQKA 3NTHA 2DXTA 1GCQC 3E9GA 4ESRA 3CMEQ 4IIMA 2EYWA 4JRIA 2D8JA 4LUDA 1S72Q 2XMFA 1TTHB 4OMMA 3ER0A 2X3XD 4Y28E 2VUBA 2O31A 3QXEB 1IHVA 1QCOA 2EIFA 2QEXT 2RA2A 4AFSC 1U5SA 2DXUA 5GANf 3JV3A 2OJ2A 1RLPC 2VXFA 4OB3B 3EH1A 1PWTA 3S3NA 1PD1A 4JS5A 1KQSS 2E41A 2E12A 4M78G 2RI5A 3TCJA 3QWYA 1KG1A 5A0LA 1M2OA 4JJCA 2HL5C 1YJWT 4M7DG 2E65A 1Z9QA 3C95A 3GOXA 4QVZA 1BI0A 1M90C 5IN1A 2RPNA 2V8JA 3L2QA 4E7ZA 1YNZA 2PVGB 2CKKA 2M9UA 4B6MA 3CD6Q 5GMKi 5CK9A 2QXFA 4IKFA 5AYFA 2LT1A 3SWNB 3WVEB 4EMKB 1VQ8A 3L2UA 2YRCA 2NUTB 3NFCA 3PFSA 3CC4A 4MZPA 4M77B 2JZ2A 3A8HB 1QKXA 3JCMe 1JBMA 4BI3A 1NEBA 4Y91A 1WLPB 2YUQA 2LQ8A 3UA6A 2OI3A 1NLOC 1SF9A 4MMLA 4M7DD 1ZUUA 4F7UF 1GFDA 4QKUA 2HD0A 2YT6A 2DYBA 4PLLA 1VQ7Q 4LUEA 1QMCA 5GAMh 1KQSA 1M90R 2PTKA 2QQ9A 3BE3A 3RMQA 1BK2A 3M0QA 3CXCP 4XTUA 3OBYA 5GAOp 4PJOA 2LNHB 4WF2A 4QQGA 2QYZA 3TEEA 2P4TA 1UGQB 4LDUA 4PJNA 2CT3A 1TU0B 4JRQA 1AD5A 2DXBA 3OSVA 3ZEHA 2R5AA 4ZTFA 3ZBDA 2QA4A 4E7JA 2J6KA 1AT1B 2JUFA 2AT1B 1OPKA 2FRYA 1WXTA 1NEGA 1QP3A 2XDPA 3KUFA 2MF2A 4OMPA 2E6NA 4C0DB 3H0FA 3RIRA 1VUBA 3GP8A 2QA4T 4GY5A 3RKYA 4HT8A 2QASA 1MGQA 4M78C 5I2MA 2LJ1A 4JS4A 3OYKA 2LQNA 3MO8A 2NWMA 2EVRA 1WA7A 3VS2A 1YI2A 3Q1JA 1N6AA 2M0OA 5HCKA 1H641 1PM3A 4JRKA 1WHJA 4NS5A 2DEQA 3CCVA 4M78F 2HZYA 2DXCA 4R56A 1TS9A 3C12A 2EJFA 4DQ2A 1MMNA 2Y90A 1QVGA 2VGMA 4J83A 4PLIA 4CC7A 1K4US 2LC4A 2BZYA 3CPWP 1O9SA 2MIOA 2BZ8A 3CD6T 1IB8A 2JW4A 1NYGA 3BFMA 2EQMA 4A4HA 2DL7A 2A7YA 3S6WA 5KYUA 2LQWA 3E9FA 4LDWA 5GMKl 3FJPA 2NUZA 1KHCA 1ZBJA 1KD1U 1EIFA 3GNGA 2GGRA 3P8HA 1XOVA 2C06A 3QDRB 4F14A 2RJDA 3C0CA 1OZ2A 4A4FA 2K3YA 2RHYA 1VIFA 3MP8A 3MHXA 1ARKA 1Q81C 2JJ9A 1YHQQ 1VOMA 1HSQA 3CMAT 3CMAQ 2VYTA 4M4ZA 1R77A 4GBQA 1B7TA 5CIUA 2RHUA 3RR6A 2RMOA 3EAEA 2DILA 1BCMA 1GRIA 2VB6A 4J7FA 3BY7A 2DX1A 2CREA 5LJ3d 3LH0A 1JEGA 5HK3A 2DERA 1PCXA 1ZBXA 2C0IA 4E7IA 5GANg 4RTTA 5CVIA 3ZFJA 1TH7A 2EGCA 2HCKA 3VUZA 1ZSZA 1PRLC 2DTOA 3OS0A 1JJ2P 1OULA 3AT1B 2DA9A 1ZA2B 4E7SA 2KK4A 4J9GA 2KR3A 2L3SA 3V7SA 3EGXA 4BD3A 2LDMA 3OMGA 3THKA 3JB9G 4JPBW 1WHLA 2LRQA 2RM4A 2MYSA 5FROA 3TSWA 1PNJA 1Q82U 4LE9A 3MJXA 3PT9A 4L6V5 2XD0A 1D1CA 2DPPB 2RB6A 4M7AE 4XU3A 1XNIA 2DL5A 4J9BA 4FCYA 3CCMT 1E6HA 3VJPA 2LMJA 2KI7A 2V26A 1VQ9A 3HPWA 3L1AA 1ABOA 2CH4W 2SRCA 2F5KA 1KC8R 4IUTA 4A54A 1MNDA 1MMDA 3CCEQ 3JRZA 3FC3A 2JS2A 1ZSZB 1OZ3A 3I56Q 3MKDA 1TSFA 1ZA1B 1H8KA 1M1FA 1UG1A 5D6XA 4JJNK 4OB1B 5KE3A 2PU9B 3HP9A 3H41A 3VS5A 4KBMB 2JXBA 4QVCA 1ZSZC 3F70A 3JCMJ 1VQPA 2FPDA 3ULRB 2ZPGB 3QO3A 1W1FA 2QQBA 1QWEA 4N0AA 4FYYB 3PTAA 2DTIA 3JB9D 2Y4XA 5CKFA 5GJWB 4ZN3A 3M55A 3J80E 4PJOC 1SEMA 4EDUA 3QHSA 1VQ6A 2LX9A 1M9SA 1PC0A 2HQXA 2VGNA 3UA7A 3TQ7P 2COYA 5HY6A 2WSFE 3DB4A 5FRNA 2FZCB 4OMQA 5GAN5 1WI7A 1B07A 2EBPA 2CSQA 3CCVQ 5GAN2 1RI0A 1I0CA 1BI3A 2R5MA 4FT2A 3S3MA 3CMAA 2DZCA 3JCMX 2ENMA 1K8AC 5A2QE 3O5ZA 5D6YA 1PRMC 3SHWA 4B9XA 2GQVA 2HSEB 1H3ZA 5DLQE 3PVLA 4OMLA 3A8OB 2DJZA 3CCRQ 4KH1B 1Q7YC 5KYWA 1G3SA 4AMCA 1VQ6Q 3L2RA 2QGGA 3CC7A 4M77E 4LDVA 5FU7B 4JZ4A 2KE9A 3ME9A 4M7AB 4RKUE 3QUIA 5A0GA 2QK0A 2O4XB 3OS1A 1VQ8Q 1CSKA 1O75A 2OX7A 2E10A 2MPXC 3MP1A 4J9IA 2DETA 1Z9ZA 1M5Q1 4XTXA 2A0FB 2COWA 3OYYA 4FIBA 2K5LA 4PFOA 2RHZA 4NL3A 3DLMA 4M75F 2LCCA 2D9TA 2KDSA 4RMOA 4C8QB 1RL2A 2KY9A 2LX7A 3VS0A 4N4GA 3EFOA 1MNEA 2FVUA 1IO6A 3RBBB 2I0NA 1SPKA 1BI2A 2HKNA 2H8HA 1WHHA 1MHNA 4FT4A 3QDFA 1Q82C 4MDXA 4WCIA 4C5GA 3OW2A 2C0TA 5LJ5e 1D0ZA 1OU8A 2KRMA 4NL2A 2DL4A 2KT1A 2BE9B 4V2SA 1UHFA 3M0SA 3DB3A 3E2UA 4OVAA 1OQKA 4FW2A 1RUWA 2K3BA 5D6WA 2K3XA 1GCQA 2P0PA 3CCLA 1GBQA 4XU1A 3I55A 4J9CA 3I56T 2DE0X 5LJ3f 3GBQA 1LCKA 4A4GA 2AIRB 1BU1A 3CCET 2P4RA 3SWNA 3EGXB 2NUTA 4XTYA 1BIAA 1R0CB 3A98A 4AT1B 1YJNA 3OYAA 1Y07A 1PKSA 1QVFA 1YI2T 3HSBA 5IAYA 3QBYA 3VS4A 3CCEA 4FYXB 5EG2A 5LJ3e 2LVMA 4C92C 1VQ6T 2AK5A 2XDBA 5GANj 5KYWB 1JB0E 1ZUKA 1VQOQ 4M7AA 2GTJA 3CC2A 3QJ6A 1B34A 2O9SA 5J26A 1YJWQ 2OAWA 4BE1A 1NE8A 2EKHA 3RDVA 2FRWA 1VQ8T 2KMTA 3KFVA 3M57A 2IPOB 2K7AA 1N8RU 1VQKQ 1ZQ1A 3FIFA 1D1AA 3JSCA 1Q95G 1AWOA 2PZ1A 3C4SA 3EG1A 5I22A 4FYVB 4PKCC 3OYIA 1QCFA 3G4SQ 1M1KR 2K57A 4LN2A 1WPYA 3CCUT 5AT1B 5KE2A 3PMTA 2Y4YA 3TU4K 2CYZB 4JRPA 4EMKC 1AOJA 4C0GA 3MEAA 4HVVA 4LD6A 5GMKe 2O4XA 5IHNA 1K0SA 1UGRB 3HL8A 2B8AA 1QVGS 1VQMT 5HK0A 3EG2A 1YITA 4M7DE 1VQKA 2IVWA 2CP3A 1S72A 4M7DF 4VUBA 1AZEA 5L8RE 2QTXA 2DEUA 4M78E 3META 3CBPA 3FEOA 4FW1A 4OMOA 5GAOl 1WX6A 2L3PA 3M4YA 1M8VA 3R6OA 2EW3A 3DLLA 1VQMA 4CC3A 4C8QA 1YJ9Q 2OTJA 4F17A 2KXDA 4A63B 1BI1A 2JM8A 1SSFA 4FU6A 1UE9A 1CKBA 4OGEA 4M7AD 1Q82R 1ZHIA 2M02A 2LCSA 1TG0A 1UTIA 1NBEB 2HAXA 1WZOA 1Y0MA 4M78D 1VQ9Q 1RAHB 2PNIA 1KIKA 2PUOB 4F04B 3M0PA 3TREA 1VQNT 2J06A 4E7LA 2LTOA 5CKBA 3CMET 4KH0B 4RTYA 1X2QA 6AT1B 1TWBA 2K4YA 3JCMh 2EYQA 5J3BA 3EHRA 1WDXA 2G3RA 2QDYB 1PKTA 2VV5A 2F5TX 4BI8B 3WXMB 5FW9A 4DBRA 3CCRA 2JTEA 1M3CA 3G71Q 2DRMA 1W2BP 1M3AA 1FX7A 1TUDA 3X20B 2L2PA 3CC4T 4X1VA 2KBTA 3H0IA 1S1NA 5IH2A 1ZUYA 3RMSA 5FLXE 2LQKA 4IUPA 1AVZC 3QZ5B 1VQMQ 2ROLA 2RQUA 2X4XA 2K5IA 4FL6A 3CD6A 4PNOA 1NJIC 3CCJT 2J05A 2CDTA 1GCPA 2X4WA 8AT1B 3H0HA 4PJMA 4ANJA 1HXDA 1M30A 2L89A 4D8KA 2JT4A 3CC2T 4DEXA 3KXTA 3OS5A 1M1GA 5IXBA 1N27A 1YJ9A 3H8ZA 2DBMA 2CT4A 2DKGA 4Z88A 4A4KA 4JJDA 1JRIA 2R58A 3I5RA 2A37A 3ASKA 1C1AA 4M7AF 2HNIA 1G2BA 1YJNQ 1YIJA 1X75C 4J7IA 2K2VA 3G1JA 2CP5A 1M2VA 1KQSP 1R8OB 2OAUA 1ZSGA 2CSIA 3QG1A 1QVPA 2RI3A 1N9RA 2RO0A 5GAN8 4MZMA 3MPUB 4GLMA 4N4HA 2RQRA 3CCUA 1PSEA 4CC2A 2WSEE 3M9QA 1KD1C 2J7IA 2K2MA 2MI6A 2X4JA 4M75A 3CCMQ 2DBKA 5GAMd 4BDYA 3GPLA 1GL5A 4IUVA 1NPRA 2KROA 2QGFB 2BKDN 3VS6A 1XQHA 2FPFA 1QP2A 2DRKA 1K9MR 2GTOA 1Y71A 1UGPB 3JCMb 3LX7A 2EYYA 1LPLA 2DZ9A 2RK2A 4IUUA 2CP6A 2VXEA 1P92A 1WXBA 1X69A 4LNPA 2K79A 1WXUA 3CCSQ 1EX4A 5IHIA 4RG2A 3CPWA 4O5VA 5GAOr 4HKEA 2O2OA 3LH5A 3S3OA 2YUNA 3M59A 4DBQA 2VASA 4ELYC 9ATCB 5GAMg 1K0XA 3M5AA 1T3SA 1VQLA 4M75B 3JB9I 3HRSA 1VQOA 2V8IA 1Q81R 1V76A 5GMKh 4OB2B 1BBZA 1VQNA 3M0UA 2DAQA 1C6VX 1TUCA 4J6YA 3CXCS 5LJ5d 5KYXA 2K6DA 1VQ5A 2DNUA 4ZNXA 1AZGB 1TXQA 3VV0A 2PVOB 1VQ4Q 2F1LA 3I55T 4EPCA 3I55Q 3OB9A 3V7CA 2E5QA 1MV0B 1ABQA 2EKOA 4M7DA 5GAMj 2P0KA 1K8AR 4AFUC 2VC8A 4M77G 1UECA 3OYBA 1KC8C 2X4YA 4R55A 1M90U 2JN0A 2I2LA 2DD5A 4J5YA 1WJRA 3VYHB 1YIJQ 1BIBA 1T3LA 1FYNA 1K76A 2PQWA 2M1HA 3M53A 2NUPB 3H9NA 4KGVB 4RCBA 4XK8E 1F1BB 2DLPA 3CCJA 2LZ6B 3MEUA 2OTJQ 4KGXB 4TVRA 1YJWA 4HT9A 1NYFA 4C0FA 5FWCA 1M8MA 1PG5B 1K9MU 1YCYA 4LXCA 2EGEA 3CBOA 4A53A 5I21A 1U1SA 3NPFA 1LJOA 1HJDA 4C8QG 1ZLMA 1U06A 2IG0A 2DIGA 2CZ6B 3JCMg 4Z89A 2RK1A 5KYYA 3CCQT 2D8HA 1PHTA 2D1XA 3U23A 2O01E 5DY9A 1M27C 5IXFA 3GF5A 2DK3A 4PJOG 2C0OA 2ED1A 1UGSB 3CCSA 1Y7XA 4BB7A 5LJ5h 1RADB 2CP2A 4QQDA 4M75D 2JOYA 2MWOA 1VQ4T 2Z0WA 1WJQA 2JTFA 1G83A 4Z8AA 1KJWA 2HKQB 2KQWA 3MEWA 3OW2P 2WSCE 2CS7A 1YFNA 2E3HA 4YTLA 2ZZDA 3LWHA 5KH6A 2D0NA 5DLOA 4DBHA 2CP0A 4PL6A 3PIOA 2QDLA 3JCMW 1UGVA 2RHXA 1FMKA
chains in the Genus database with same CATH topology
1QKWA 3TSZA 3M0SA 5I11A 2DL8A 1QWFA 4ORZA 1K9AA 2KXCA 1RUWA 1GBRA 2K3BA 1E6GA 1GCQA 1Y57A 1GBQA 4J9CA 4IIOA 2DE0X 2DMOA 3GBQA 1LCKA 1BU1A 1QKXA 2P4RA 2CUDA 1A0NB 3CQTA 1NEBA 1NM7A 1M3BA 3A98A 4K11A 1WLPB 2YUQA 3UA6A 2KNBB 4HXJA 1PKSA 2OI3A 4J9EA 1W6XA 2ECZA 1NLOC 4Y92A 1UUEA 3VS4A 1AWWA 1ZUUA 4AFQC 1GFDA 1UJ0A 2YT6A 1SRLA 2AK5A 2DYBA 1ZUKA 2M0YA 2GTJA 4LUEA 2YUPA 2O9SA 2PTKA 2HBWA 1SRMA 2OAWA 1BK2A 1NG2A 2EKHA 2FRWA 3M0QA 3KFVA 2ABLA 1X27A 2J6OA 2K7AA 4D8DA 3VS7A 2LNHB 1K1ZA 4J9FA 1AEYA 1QLYA 1AWOA 2PZ1A 4FSSA 2CT3A 3EG1A 5I22A 1AD5A 2EQIA 3I9QA 1QCFA 2LP5A 1VYTA 4LN2A 2RN8A 4E6RA 2J6KA 2GNCA 4RTWA 1OPKA 1AOJA 2FRYA 2RQTA 1WXTA 3REAB 5L23A 1NEGA 2LJ0A 4HVVA 5EC7A 2O88A 3EGUA 5IHNA 4OMPA 4RTZA 1K0SA 4OMNA 1H92A 2F2WA 2AKLA 4JJBA 3H0FA 3R6NA 3EG2A 3UATA 2O9VA 5IHKA 1H3HA 3FJ5A 1AZEA 1BB9A 4OMOA 2CUBA 1JQQA 2LJ1A 2KRSA 2SEMA 2LQNA 1WX6A 2L3PA 2NWMA 2EVRA 1WA7A 2EW3A 3VS2A 4AG2C 2DL3A 1AWJA 1YCSB 2B86A 4CC3A 4F17A 5HCKA 2KXDA 4A63B 2KEAA 2JM8A 3EHQA 1UJYA 2RNAA 1UHCA 1UE9A 1CKBA 1V1CA 3RNJA 2G6FX 2YDLA 3VRZA 2LCSA 1TG0A 3M0TA 1UTIA 2F2VA 1Y0MA 3VS1A 4CC7A 1K4US 2J6FA 2PNIA 1KIKA 2BZYA 2MIOA 4AG1C 2BZ8A 2JM9A 2EYXA 3M0PA 3PE0A 2J06A 2JW4A 1NYGA 4RTYA 2DL7A 1X2QA 4AFZC 2LQWA 1I1JA 2GQIA 2L3QA 3EHRA 1WDXA 1PKTA 4HVWA 2DJQA 2NUZA 1ZBJA 2L0AA 2GGRA 2W10A 5FW9A 1XOVA 1UFFA 2JTEA 4F14A 1M3CA 3C0CA 2DRMA 4RTVA 1M3AA 1SHGA 2KGTA 4JZ3A 1TUDA 2ROTA 2LJ3A 2BTTA 1NLPC 4HCKA 1AWXA 2L2PA 1ARKA 4X1VA 1OOTA 2KBTA 3H0IA 1S1NA 3UF4A 5IH2A 1ZUYA 1HSQA 2JMCA 2W0ZA 4M4ZA 4GBQA 1JO8A 1AVZC 4J9HA 2ED0A 2RMOA 2ROLA 2RQUA 2DILA 1GRIA 1JXMA 2J05A 2CDTA 1GCPA 3H0HA 1VYVA 1M30A 4D8KA 2JT4A 2DX1A 1CKAA 2RF0A 4DEXA 2CREA 5IXBA 1JEGA 2EYZA 3VRYA 4J9DA 2DBMA 2CT4A 1OPLA 2FO0A 4Z88A 2IIMA 4JJDA 1T0JA 2FPEA 3I5RA 2A37A 4F16A 4HVUA 3IQLA 1G2BA 2C0IA 4RTTA 1MUZA 2MOXA 4KRTA 2A08A 2EGCA 2HCKA 2X3WD 1HD3A 1PRLC 1ZSGA 2CSIA 2YSQA 2ESWA 1W70A 1T0HA 2A36A 1N5ZA 4GLMA 2RQRA 2DA9A 4J9GA 2KR3A 2L3SA 4CC2A 2DF6A 2J7IA 2K2MA 3THKA 1I07A 2DBKA 1GL5A 4JPBW 2KROA 1VYUA 3VS6A 2AZVA 2FPFA 4QT7A 1KSWA 2E5KA 2DRKA 3REBB 4DEYA 2GBQA 1X43A 2GTOA 3PVQA 3TSWA 1PNJA 4LE9A 4CC4B 1EFNA 2EYYA 3EG3A 1VA7A 2DL5A 4J9BA 4RUGA 1E6HA 2LMJA 1WXBA 1X69A 1X6BA 3M0RA 2VKNA 1ABOA 2F2XA 2CH4W 2SRCA 4LNPA 2K79A 2HDAA 1WXUA 5IHIA 2JS2A 3VS3A 1YP5A 2A28A 4RTUA 2MCNA 1H8KA 2O2OA 3LH5A 2FG0A 2YUNA 1UG1A 3H41A 3VS5A 1MV3A 2JXBA 1K0XA 1T3SA 1X2KA 4R0KA 2FPDA 3ULRB 1SHFA 1WYXA 1W1FA 1KFZA 1E7OA 2V1RA 1BBZA 5FWBA 3M0UA 1QWEA 2JMAA 1TUCA 1X6GA 2RQWA 3I5SA 1JXOA 2YUOA 2K6DA 1YWOA 1ZX6A 5GJWB 2DNUA 4ZNXA 3SEMA 1AZGB 3QWXX 2JS0A 2EPDA 2FEIA 1SEMA 1J3TA 2RQVA 1RLQC 1MV0B 1ABQA 1U3OA 3UA7A 2AZSA 4OMQA 4AFUC 5GJVB 2M51A 2DM1A 1WI7A 1B07A 2EBPA 2CSQA 1UECA 1B3QA 1YWPA 1I0CA 1T3LA 2ENMA 3NHNA 1FYNA 2CH4A 2AKKA 1K76A 1GFCA 5ECAA 3O5ZA 1PRMC 1WFWA 3SHWA 3NMZC 3PVLA 4OMLA 4RTXA 2DLPA 2K9GA 2BZXA 2V1QA 2LZ6B 3I35A 2HSPA 2VVKA 1OV3A 4EIKA 1NYFA 5FWCA 1M8MA 2DVJA 1GCQC 2EGEA 4ESRA 2EGAA 4JZ4A 2KE9A 4IIMA 2EYWA 1CSKA 2D8JA 3NPFA 4LUDA 2XMFA 1HJDA 1ZLMA 4OMMA 4J9IA 3ZL7C 1U06A 2X3XD 3EG0A 1Z9ZA 4Z89A 1JU5C 2O31A 2D8HA 2KRNA 3NGPA 1PHTA 2D1XA 3U23A 3TVTA 1M27C 4AFSC 5IXFA 1U5SA 1YN8A 3JV3A 2C0OA 2ED1A 2OJ2A 1UDLA 1RLPC 2LX7A 1PWTA 3VS0A 1RI9A 1IO6A 3RBBB 2I0NA 2VWFA 1G83A 4Z8AA 2KYMA 3QWYA 1SPKA 1KJWA 1OEBA 2H8HA 4JJCA 1Z9QA 2D0NA 4WCIA 2HEQA 2C0TA 2KRMA 2RPNA 2KYBA 1WIEA 2DL4A 1SSHA 2KT1A 2KT8A 2QDLA 1UGVA 1YNZA 1UHFA 1FMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKW A;  3TSZ A;  3M0S A;  5I11 A;  2DL8 A;  1QWF A;  4ORZ A;  1K9A A;  2KXC A;  1RUW A;  1GBR A;  2K3B A;  1E6G A;  1GCQ A;  1Y57 A;  1GBQ A;  4J9C A;  4IIO A;  2DE0 X;  2DMO A;  3GBQ A;  1LCK A;  1BU1 A;  1QKX A;  2P4R A;  2CUD A;  1A0N B;  3CQT A;  1NEB A;  1NM7 A;  1M3B A;  3A98 A;  4K11 A;  1WLP B;  2YUQ A;  3UA6 A;  2KNB B;  4HXJ A;  1PKS A;  2OI3 A;  4J9E A;  1W6X A;  2ECZ A;  1NLO C;  4Y92 A;  1UUE A;  3VS4 A;  1AWW A;  1ZUU A;  4AFQ C;  1GFD A;  1UJ0 A;  2YT6 A;  1SRL A;  2AK5 A;  2DYB A;  1ZUK A;  2M0Y A;  2GTJ A;  4LUE A;  2YUP A;  2O9S A;  2PTK A;  2HBW A;  1SRM A;  2OAW A;  1BK2 A;  1NG2 A;  2EKH A;  2FRW A;  3M0Q A;  3KFV A;  2ABL A;  1X27 A;  2J6O A;  2K7A A;  4D8D A;  3VS7 A;  2LNH B;  1K1Z A;  4J9F A;  1AEY A;  1QLY A;  1AWO A;  2PZ1 A;  4FSS A;  2CT3 A;  3EG1 A;  5I22 A;  1AD5 A;  2EQI A;  3I9Q A;  1QCF A;  2LP5 A;  1VYT A;  4LN2 A;  2RN8 A;  4E6R A;  2J6K A;  2GNC A;  4RTW A;  1OPK A;  1AOJ A;  2FRY A;  2RQT A;  1WXT A;  3REA B;  5L23 A;  1NEG A;  2LJ0 A;  4HVV A;  5EC7 A;  2O88 A;  3EGU A;  5IHN A;  4OMP A;  4RTZ A;  1K0S A;  4OMN A;  1H92 A;  2F2W A;  2AKL A;  4JJB A;  3H0F A;  3R6N A;  3EG2 A;  3UAT A;  2O9V A;  5IHK A;  1H3H A;  3FJ5 A;  1AZE A;  1BB9 A;  4OMO A;  2CUB A;  1JQQ A;  2LJ1 A;  2KRS A;  2SEM A;  2LQN A;  1WX6 A;  2L3P A;  2NWM A;  2EVR A;  1WA7 A;  2EW3 A;  3VS2 A;  4AG2 C;  2DL3 A;  1AWJ A;  1YCS B;  2B86 A;  4CC3 A;  4F17 A;  5HCK A;  2KXD A;  4A63 B;  2KEA A;  2JM8 A;  3EHQ A;  1UJY A;  2RNA A;  1UHC A;  1UE9 A;  1CKB A;  1V1C A;  3RNJ A;  2G6F X;  2YDL A;  3VRZ A;  2LCS A;  1TG0 A;  3M0T A;  1UTI A;  2F2V A;  1Y0M A;  3VS1 A;  4CC7 A;  1K4U S;  2J6F A;  2PNI A;  1KIK A;  2BZY A;  2MIO A;  4AG1 C;  2BZ8 A;  2JM9 A;  2EYX A;  3M0P A;  3PE0 A;  2J06 A;  2JW4 A;  1NYG A;  4RTY A;  2DL7 A;  1X2Q A;  4AFZ C;  2LQW A;  1I1J A;  2GQI A;  2L3Q A;  3EHR A;  1WDX A;  1PKT A;  4HVW A;  2DJQ A;  2NUZ A;  1ZBJ A;  2L0A A;  2GGR A;  2W10 A;  5FW9 A;  1XOV A;  1UFF A;  2JTE A;  4F14 A;  1M3C A;  3C0C A;  2DRM A;  4RTV A;  1M3A A;  1SHG A;  2KGT A;  4JZ3 A;  1TUD A;  2ROT A;  2LJ3 A;  2BTT A;  1NLP C;  4HCK A;  1AWX A;  2L2P A;  1ARK A;  4X1V A;  1OOT A;  2KBT A;  3H0I A;  1S1N A;  3UF4 A;  5IH2 A;  1ZUY A;  1HSQ A;  2JMC A;  2W0Z A;  4M4Z A;  4GBQ A;  1JO8 A;  1AVZ C;  4J9H A;  2ED0 A;  2RMO A;  2ROL A;  2RQU A;  2DIL A;  1GRI A;  1JXM A;  2J05 A;  2CDT A;  1GCP A;  3H0H A;  1VYV A;  1M30 A;  4D8K A;  2JT4 A;  2DX1 A;  1CKA A;  2RF0 A;  4DEX A;  2CRE A;  5IXB A;  1JEG A;  2EYZ A;  3VRY A;  4J9D A;  2DBM A;  2CT4 A;  1OPL A;  2FO0 A;  4Z88 A;  2IIM A;  4JJD A;  1T0J A;  2FPE A;  3I5R A;  2A37 A;  4F16 A;  4HVU A;  3IQL A;  1G2B A;  2C0I A;  4RTT A;  1MUZ A;  2MOX A;  4KRT A;  2A08 A;  2EGC A;  2HCK A;  2X3W D;  1HD3 A;  1PRL C;  1ZSG A;  2CSI A;  2YSQ A;  2ESW A;  1W70 A;  1T0H A;  2A36 A;  1N5Z A;  4GLM A;  2RQR A;  2DA9 A;  4J9G A;  2KR3 A;  2L3S A;  4CC2 A;  2DF6 A;  2J7I A;  2K2M A;  3THK A;  1I07 A;  2DBK A;  1GL5 A;  4JPB W;  2KRO A;  1VYU A;  3VS6 A;  2AZV A;  2FPF A;  4QT7 A;  1KSW A;  2E5K A;  2DRK A;  3REB B;  4DEY A;  2GBQ A;  1X43 A;  2GTO A;  3PVQ A;  3TSW A;  1PNJ A;  4LE9 A;  4CC4 B;  1EFN A;  2EYY A;  3EG3 A;  1VA7 A;  2DL5 A;  4J9B A;  4RUG A;  1E6H A;  2LMJ A;  1WXB A;  1X69 A;  1X6B A;  3M0R A;  2VKN A;  1ABO A;  2F2X A;  2CH4 W;  2SRC A;  4LNP A;  2K79 A;  2HDA A;  1WXU A;  5IHI A;  2JS2 A;  3VS3 A;  1YP5 A;  2A28 A;  4RTU A;  2MCN A;  1H8K A;  2O2O A;  3LH5 A;  2FG0 A;  2YUN A;  1UG1 A;  3H41 A;  3VS5 A;  1MV3 A;  2JXB A;  1K0X A;  1T3S A;  1X2K A;  4R0K A;  2FPD A;  3ULR B;  1SHF A;  1WYX A;  1W1F A;  1KFZ A;  1E7O A;  2V1R A;  1BBZ A;  5FWB A;  3M0U A;  1QWE A;  2JMA A;  1TUC A;  1X6G A;  2RQW A;  3I5S A;  1JXO A;  2YUO A;  2K6D A;  1YWO A;  1ZX6 A;  5GJW B;  2DNU A;  4ZNX A;  3SEM A;  1AZG B;  3QWX X;  2JS0 A;  2EPD A;  2FEI A;  1SEM A;  1J3T A;  2RQV A;  1RLQ C;  1MV0 B;  1ABQ A;  1U3O A;  3UA7 A;  2AZS A;  4OMQ A;  4AFU C;  5GJV B;  2M51 A;  2DM1 A;  1WI7 A;  1B07 A;  2EBP A;  2CSQ A;  1UEC A;  1B3Q A;  1YWP A;  1I0C A;  1T3L A;  2ENM A;  3NHN A;  1FYN A;  2CH4 A;  2AKK A;  1K76 A;  1GFC A;  5ECA A;  3O5Z A;  1PRM C;  1WFW A;  3SHW A;  3NMZ C;  3PVL A;  4OML A;  4RTX A;  2DLP A;  2K9G A;  2BZX A;  2V1Q A;  2LZ6 B;  3I35 A;  2HSP A;  2VVK A;  1OV3 A;  4EIK A;  1NYF A;  5FWC A;  1M8M A;  2DVJ A;  1GCQ C;  2EGE A;  4ESR A;  2EGA A;  4JZ4 A;  2KE9 A;  4IIM A;  2EYW A;  1CSK A;  2D8J A;  3NPF A;  4LUD A;  2XMF A;  1HJD A;  1ZLM A;  4OMM A;  4J9I A;  3ZL7 C;  1U06 A;  2X3X D;  3EG0 A;  1Z9Z A;  4Z89 A;  1JU5 C;  2O31 A;  2D8H A;  2KRN A;  3NGP A;  1PHT A;  2D1X A;  3U23 A;  3TVT A;  1M27 C;  4AFS C;  5IXF A;  1U5S A;  1YN8 A;  3JV3 A;  2C0O A;  2ED1 A;  2OJ2 A;  1UDL A;  1RLP C;  2LX7 A;  1PWT A;  3VS0 A;  1RI9 A;  1IO6 A;  3RBB B;  2I0N A;  2VWF A;  1G83 A;  4Z8A A;  2KYM A;  3QWY A;  1SPK A;  1KJW A;  1OEB A;  2H8H A;  4JJC A;  1Z9Q A;  2D0N A;  4WCI A;  2HEQ A;  2C0T A;  2KRM A;  2RPN A;  2KYB A;  1WIE A;  2DL4 A;  1SSH A;  2KT1 A;  2KT8 A;  2QDL A;  1UGV A;  1YNZ A;  1UHF A;  1FMK A; 
#chains in the Genus database with same CATH topology
 4HCZ A;  3EG9 A;  1UB4 A;  3TSZ A;  1VQ7 T;  4KT0 E;  1QCN A;  1IGU A;  5I11 A;  2DL8 A;  1QWF A;  2F69 A;  1FMV A;  4ORZ A;  1B34 B;  1I5O B;  1RAC B;  1YI2 Q;  1VQK T;  3EGD B;  3PGG A;  3GNF B;  3FRN A;  4J6X A;  2MMP A;  2GCX A;  3LGL A;  4KUI A;  1VQO T;  1A0N B;  2QEX A;  4Z02 A;  4DOW A;  1M3B A;  4HCC A;  3CXC A;  2LCL A;  1BCO A;  2KNB B;  4JLG A;  4HXJ A;  4BE2 A;  1WNL A;  1QVF P;  1W6X A;  2ECZ A;  4M77 C;  4Y92 A;  1UUE A;  1WQW A;  2HQH A;  4CRI A;  2L3R A;  4QQ6 A;  1SRL A;  3CCR T;  3EFS A;  2PVD B;  1Q81 U;  2E64 A;  2HBW A;  1KK7 A;  1NG2 A;  2XK0 A;  1X27 A;  2XU8 A;  3OS2 A;  1K73 U;  4J9F A;  1I81 A;  3NTK A;  4M75 C;  1QLY A;  3SFM A;  3VU3 C;  4E2F B;  2P0Q A;  4XAX B;  5J39 A;  2WAC A;  2QQS A;  3MCA B;  3CPW S;  1KC8 U;  4C8Q D;  4C0Z A;  4C92 D;  2AHJ B;  1YJ9 T;  1VYT A;  4E47 A;  1G3T A;  1WHG A;  3UPU A;  3V7R A;  2GNC A;  2RQT A;  3OYG A;  3REA B;  2LJ0 A;  2O88 A;  3EGU A;  2FYK A;  1RAF B;  3EFR A;  3QII A;  1G5V A;  3FLG A;  1WHK A;  4OMN A;  1H92 A;  4FSX A;  2DVE A;  4JJB A;  3R6N A;  5D7U A;  4Q5W A;  1H3H A;  5GAM f;  5KYU B;  5CKD A;  3OYN A;  2CUB A;  1JQQ A;  2KRS A;  2SEM A;  4A4E A;  5LJ5 f;  2EJ9 A;  3JCM d;  4BE0 A;  2B86 A;  1YCS B;  5GAN d;  4F7U A;  2L8D A;  3CCS T;  4M77 D;  3EHQ A;  5CKE A;  1UHC A;  5GAM e;  3RNJ A;  2G6F X;  3MEV A;  1YIJ T;  1QW1 A;  2ZPB B;  3VRZ A;  4RG8 A;  4BY6 B;  2QG9 B;  5IT9 E;  3DKM A;  3M0T A;  1MMA A;  2F2V A;  3A1P A;  3P8D A;  1I4K 1;  3VS1 A;  3OY9 A;  4PJO F;  1YIT Q;  1YIT T;  3A8L B;  4AG1 C;  2JM9 A;  2GF7 A;  3M4G A;  1Q7Y R;  4PJO E;  1S72 T;  2OTL T;  5CQY A;  5KCH A;  1RAI B;  3HHT B;  5GAN e;  2PUK B;  4CI0 C;  3EG9 B;  3QSU A;  3EH2 A;  4AFZ C;  4KUD K;  3OYC A;  2YRV A;  4C5E A;  1I1J A;  3SB2 A;  4HA8 A;  3LLR A;  5GMK j;  2GQI A;  5FU7 C;  4OB0 B;  4C0D C;  4HVW A;  1K73 R;  1N8R R;  2ZAE A;  2OTJ T;  1VQL Q;  2W10 A;  2ZPE B;  5GAN 4;  1EZZ B;  3J7A F;  4RTV A;  4JZ3 A;  1SHG A;  2KGT A;  3OSS C;  1FWZ A;  2LJ3 A;  2BTT A;  1NLP C;  4HCK A;  5LJ3 h;  1AWX A;  2XKO C;  2K5F A;  4PFZ A;  2JMC A;  2W0Z A;  3E19 A;  3QKJ A;  2YRD A;  2ED0 A;  3X26 B;  4QVD A;  5LL6 S;  1V29 B;  1JXM A;  3G4S T;  4II1 A;  3V8J A;  5KYN A;  4ZGD B;  3E1S A;  2QQA A;  3CCL T;  2EYZ A;  5M9O A;  3HFO A;  4O6J A;  1T0J A;  4F16 A;  1RAA B;  5GAN 6;  1RAG B;  3HRT A;  3JCM Q;  3CCL Q;  3PIP A;  1D1B A;  2RHI A;  4JDS A;  3LWI A;  1M4Z A;  3RER A;  2X9H A;  1MMG A;  3RES A;  1GXI E;  1Y96 A;  3CCQ Q;  2ESW A;  1T0H A;  4X9C A;  3PNW C;  2L5Q A;  4MZT A;  2A36 A;  1U8R A;  1N5Z A;  4L59 A;  2X35 A;  3QJY A;  1IHW A;  5CO7 A;  1IXD A;  1Q7Y U;  4DBF A;  1OI1 A;  1I07 A;  1VYU A;  5FU6 B;  2AZV A;  1KSW A;  4C8Q E;  3VYG A;  2NLU A;  3REB B;  4DEY A;  2JTM A;  2GBQ A;  4C8Q F;  1X43 A;  7AT1 B;  5C0M A;  3T9N A;  3GLX A;  3SDZ A;  1Q86 U;  4CC4 B;  2EQU A;  1JJ2 A;  2E70 A;  3EG3 A;  4B9W A;  2LT4 A;  4RUG A;  1PSF A;  5KCO A;  2JNG A;  2YXY A;  4XU0 A;  5CQX A;  4DOV A;  1X6B A;  3FDR A;  1W4S A;  2HL3 A;  1DJ7 B;  2CZ7 B;  3CCJ Q;  4KUL A;  1BKB A;  4M7D B;  3VS3 A;  2A28 A;  1SG5 A;  4RTU A;  2MCN A;  2FG0 A;  2E4H A;  3G71 A;  2H3E B;  1MV3 A;  2KSS A;  3JCM V;  1X2K A;  4R0K A;  1SHF A;  1WYX A;  4M77 F;  3OYH A;  1KFZ A;  2EWN A;  2V1R A;  2MWP A;  2JMA A;  4P5N A;  1M1K U;  2YUO A;  2D0Q B;  1ZX6 A;  1LVK A;  5HKC A;  3SEM A;  2P84 A;  4ZGJ B;  2EPD A;  3A8G B;  1J3T A;  3G6E A;  1C0M A;  4C92 B;  4X9D A;  1U3O A;  3CME A;  2BIV A;  4M7A G;  1I5L A;  4L5G A;  2ZPH B;  1W2B S;  2R57 A;  3JB9 F;  2QQR A;  5FU6 C;  4PJL A;  2DM1 A;  3L42 A;  2HMA A;  1R0B G;  4LDY A;  4OMF B;  1YWP A;  3QYH B;  3CBM A;  4E7K A;  3G7Z A;  2QTV A;  1IRE B;  2YLC A;  4N4I A;  4XQ3 A;  2H3J A;  3OW2 S;  3NHN A;  5CR2 A;  2AKK A;  3MP6 A;  3BDL A;  1GFC A;  5ECA A;  2EFI A;  1QVG P;  2EJG A;  3NMZ C;  4HCB A;  4XTV A;  2BZX A;  2V1Q A;  1D0X A;  1TUG B;  2COZ A;  5LJ5 g;  2HSP A;  1OV3 A;  3JCM f;  3G6E Q;  3X25 B;  4D6W A;  5LJ3 j;  2DVJ A;  2NUP A;  1I8F A;  1IGQ A;  2EGA A;  3RUX A;  1TOV A;  5KYY B;  4EMG A;  4MMK A;  3KBG A;  1K9M C;  1IRX A;  3ZL7 C;  1YBY A;  3EG0 A;  2ZPI B;  1JU5 C;  1OX8 A;  2KRN A;  1IZ6 A;  3INZ A;  2DFU A;  3NGP A;  3TVT A;  3CCV T;  1YN8 A;  5GMK m;  2RJF A;  1FMW A;  3CC4 Q;  1D3B B;  1UDL A;  4J8O A;  4XU2 A;  1RI9 A;  3QYG B;  1D0Y A;  1U1T A;  1LNX A;  4JUV A;  2VWF A;  3PMI A;  1JJ2 S;  2KYM A;  3AHU A;  1KHI A;  2MK5 A;  1OEB A;  5I2S A;  3L2W A;  4PK4 A;  5CCA A;  2HEQ A;  2GFU A;  2KYB A;  1WIE A;  1SSH A;  2KT8 A;  3CC2 Q;  2OTL Q;  4KRT A;  2DTH A;  1QKW A;  3CCQ A;  1XTD A;  2E6Z A;  1K9A A;  2KXC A;  1QQJ A;  1GBR A;  1E6G A;  3QZ9 B;  2QEX Q;  1Y57 A;  4RCC A;  4IIO A;  2DMO A;  4EMH A;  5GAN 7;  3X28 B;  2BUD A;  2RD1 A;  1KD1 R;  1D3B A;  2CZ0 B;  2CUD A;  3CQT A;  2YHT A;  4ELZ C;  1NM7 A;  4K11 A;  1N9S A;  4GLK A;  3NTI A;  3VUB A;  2LNV A;  4J9E A;  5LJ5 j;  4XTW A;  1AWW A;  2FL7 A;  4ZN1 A;  2XIC A;  4AFQ C;  4C92 G;  3G6E T;  3O8V A;  4ME7 A;  4NOY A;  3V8K A;  1UJ0 A;  3HFN A;  4PJO B;  2QA4 Q;  2M0Y A;  1X01 A;  3WVD B;  1VQ7 A;  2YUP A;  1VIE A;  5GAN 3;  2DD4 A;  1SRM A;  3HRU A;  2ABL A;  2J6O A;  3EGD A;  4D8D A;  3VS7 A;  3BDU A;  1K1Z A;  2DYI A;  1K8A U;  5FRM A;  1AEY A;  4MDW A;  4FSS A;  1Q86 C;  2YLB A;  1VQ5 T;  1UEB A;  2EQI A;  3I9Q A;  1OU9 A;  2LP5 A;  2V8K A;  4C8Q C;  2KVQ G;  2RN8 A;  3QPH A;  4E6R A;  1OX9 A;  3UWN A;  4FYW B;  4RTW A;  1OYX A;  2KAF A;  1WGS A;  5L23 A;  4OP0 A;  4OGC A;  5GAN h;  5EC7 A;  3OYL A;  4RTZ A;  5KYX B;  3OYJ A;  2XI9 A;  2F2W A;  2AKL A;  1WHM A;  3UAT A;  3V8L A;  2E3I A;  4F7U G;  2O9V A;  3OBW A;  5IHK A;  1M1K C;  3FJ5 A;  4J6W A;  1BB9 A;  1BYM A;  4E7H A;  3FB9 A;  4C92 E;  3URG A;  2FZG B;  2RJC A;  1G3W A;  5GAO m;  4AG2 C;  3JB9 J;  2DL3 A;  1AWJ A;  1G3Y A;  1NZ9 A;  4OF1 A;  4JLI A;  3M54 A;  2KEA A;  4IUR A;  1UJY A;  2XG8 D;  2RNA A;  2ATC B;  1NPP A;  1V1C A;  1VQP T;  2YDL A;  4X34 A;  1Q86 R;  4WTO B;  1PD0 A;  4IUQ A;  4BDZ A;  1RAE B;  3JB9 H;  1ACM B;  2RH2 A;  2J6F A;  1NJI U;  4M75 G;  1VQ4 A;  2EYX A;  8ATC B;  1HYO A;  3PE0 A;  4UC4 A;  4ATO A;  4BUG A;  4PJO D;  3L2Z A;  2HBP A;  2XHC A;  2L3Q A;  4KGZ B;  2DJQ A;  1HK9 A;  4XTZ A;  3CC7 Q;  2CGH A;  1FXX A;  3OMC A;  2L0A A;  3VKI A;  1AHJ B;  4LDX A;  2RJE A;  1XJW B;  3GIB A;  1UFF A;  3OYD A;  2DO3 A;  2YWW A;  1D09 B;  2ROT A;  3OA6 A;  1OOT A;  1K73 C;  3UF4 A;  3SD4 A;  5A0D A;  5DM7 R;  2NYS A;  4QW2 A;  1JO8 A;  5GAO n;  4J9H A;  3A5Z B;  3HKS A;  3CPF A;  1YHQ A;  4M78 A;  5GAO q;  2OTL A;  3G71 T;  2CZ1 B;  4ZGE B;  1KQ2 A;  1VYV A;  4M7D C;  3UDC A;  3P8B B;  1CKA A;  2RF0 A;  2JVV A;  3VRY A;  4J9D A;  4ZTJ A;  2FO0 A;  1OPL A;  1W2B A;  1QVF S;  2IIM A;  2FPE A;  2RI2 A;  2CP7 A;  3OYE A;  2EAY A;  2ZCF B;  3IQL A;  1Y96 B;  4HVU A;  4BI4 A;  3LYI A;  3N5B B;  2A3L A;  4DA4 A;  1MUZ A;  2MOX A;  4BY6 C;  3OYM A;  2A08 A;  2X3W D;  1HD3 A;  2YSQ A;  1W70 A;  1LOJ A;  1VQL T;  4M77 A;  1KQ1 A;  3CEY A;  2DF6 A;  1NJI R;  3D7S B;  4PJJ A;  4LD9 K;  3I56 A;  3G4S A;  4QT7 A;  4M78 B;  2E5K A;  3X24 B;  2E1H A;  1N8R C;  4F7U E;  2FHD A;  5C6S A;  3PVQ A;  1RAB B;  1EFN A;  4BAC A;  1VA7 A;  3A8M B;  2X51 A;  1YJN T;  4C92 F;  4C5H A;  5CKH A;  3M0R A;  2VKN A;  2F2X A;  2QI2 A;  2HDA A;  3C94 A;  3JAM E;  1YP5 A;  1SKU B;  2M16 A;  1X6O A;  4EMK A;  3CCU Q;  2XID A;  3LGF A;  5LJ3 g;  3J81 E;  1VQP Q;  1E7O A;  5FWB A;  2FZK B;  3UT1 A;  1X6G A;  2RQW A;  3I5S A;  1JXO A;  3HTR A;  3BW1 A;  1YWO A;  3OYF A;  2GFA A;  3L2V A;  2ZGW A;  3QWX X;  3OQ5 A;  2JS0 A;  2FEI A;  1VQ5 Q;  3CC7 T;  2RQV A;  1RLQ C;  1WQ7 A;  3RKX A;  2AZS A;  4M7A C;  4N0A C;  3RKW A;  2FB7 A;  5GJV B;  3M56 A;  2XDD A;  2M51 A;  4M75 E;  2D6F A;  4C92 A;  1B3Q A;  1M2V B;  4C5I A;  4F7U B;  5CAI A;  2BE7 D;  3M58 A;  2CH4 A;  3LW5 E;  4FM4 B;  1G8X A;  1WFW A;  3EFO B;  3JCM c;  1YHQ T;  2DIQ A;  1WJS A;  3CCM A;  3H6Z A;  4RTX A;  2K9G A;  3SWN C;  4PFP A;  2MAM A;  2QAZ A;  3I35 A;  2ZPF B;  2HQE A;  2VVK A;  1VQ9 T;  1VQN Q;  4EIK A;  2EQJ A;  3JCM P;  2EQK A;  3NTH A;  2DXT A;  1GCQ C;  3E9G A;  4ESR A;  3CME Q;  4IIM A;  2EYW A;  4JRI A;  2D8J A;  4LUD A;  1S72 Q;  2XMF A;  1TTH B;  4OMM A;  3ER0 A;  2X3X D;  4Y28 E;  2VUB A;  2O31 A;  3QXE B;  1IHV A;  1QCO A;  2EIF A;  2QEX T;  2RA2 A;  4AFS C;  1U5S A;  2DXU A;  5GAN f;  3JV3 A;  2OJ2 A;  1RLP C;  2VXF A;  4OB3 B;  3EH1 A;  1PWT A;  3S3N A;  1PD1 A;  4JS5 A;  1KQS S;  2E41 A;  2E12 A;  4M78 G;  2RI5 A;  3TCJ A;  3QWY A;  1KG1 A;  5A0L A;  1M2O A;  4JJC A;  2HL5 C;  1YJW T;  4M7D G;  2E65 A;  1Z9Q A;  3C95 A;  3GOX A;  4QVZ A;  1BI0 A;  1M90 C;  5IN1 A;  2RPN A;  2V8J A;  3L2Q A;  4E7Z A;  1YNZ A;  2PVG B;  2CKK A;  2M9U A;  4B6M A;  3CD6 Q;  5GMK i;  5CK9 A;  2QXF A;  4IKF A;  5AYF A;  2LT1 A;  3SWN B;  3WVE B;  4EMK B;  1VQ8 A;  3L2U A;  2YRC A;  2NUT B;  3NFC A;  3PFS A;  3CC4 A;  4MZP A;  4M77 B;  2JZ2 A;  3A8H B;  1QKX A;  3JCM e;  1JBM A;  4BI3 A;  1NEB A;  4Y91 A;  1WLP B;  2YUQ A;  2LQ8 A;  3UA6 A;  2OI3 A;  1NLO C;  1SF9 A;  4MML A;  4M7D D;  1ZUU A;  4F7U F;  1GFD A;  4QKU A;  2HD0 A;  2YT6 A;  2DYB A;  4PLL A;  1VQ7 Q;  4LUE A;  1QMC A;  5GAM h;  1KQS A;  1M90 R;  2PTK A;  2QQ9 A;  3BE3 A;  3RMQ A;  1BK2 A;  3M0Q A;  3CXC P;  4XTU A;  3OBY A;  5GAO p;  4PJO A;  2LNH B;  4WF2 A;  4QQG A;  2QYZ A;  3TEE A;  2P4T A;  1UGQ B;  4LDU A;  4PJN A;  2CT3 A;  1TU0 B;  4JRQ A;  1AD5 A;  2DXB A;  3OSV A;  3ZEH A;  2R5A A;  4ZTF A;  3ZBD A;  2QA4 A;  4E7J A;  2J6K A;  1AT1 B;  2JUF A;  2AT1 B;  1OPK A;  2FRY A;  1WXT A;  1NEG A;  1QP3 A;  2XDP A;  3KUF A;  2MF2 A;  4OMP A;  2E6N A;  4C0D B;  3H0F A;  3RIR A;  1VUB A;  3GP8 A;  2QA4 T;  4GY5 A;  3RKY A;  4HT8 A;  2QAS A;  1MGQ A;  4M78 C;  5I2M A;  2LJ1 A;  4JS4 A;  3OYK A;  2LQN A;  3MO8 A;  2NWM A;  2EVR A;  1WA7 A;  3VS2 A;  1YI2 A;  3Q1J A;  1N6A A;  2M0O A;  5HCK A;  1H64 1;  1PM3 A;  4JRK A;  1WHJ A;  4NS5 A;  2DEQ A;  3CCV A;  4M78 F;  2HZY A;  2DXC A;  4R56 A;  1TS9 A;  3C12 A;  2EJF A;  4DQ2 A;  1MMN A;  2Y90 A;  1QVG A;  2VGM A;  4J83 A;  4PLI A;  4CC7 A;  1K4U S;  2LC4 A;  2BZY A;  3CPW P;  1O9S A;  2MIO A;  2BZ8 A;  3CD6 T;  1IB8 A;  2JW4 A;  1NYG A;  3BFM A;  2EQM A;  4A4H A;  2DL7 A;  2A7Y A;  3S6W A;  5KYU A;  2LQW A;  3E9F A;  4LDW A;  5GMK l;  3FJP A;  2NUZ A;  1KHC A;  1ZBJ A;  1KD1 U;  1EIF A;  3GNG A;  2GGR A;  3P8H A;  1XOV A;  2C06 A;  3QDR B;  4F14 A;  2RJD A;  3C0C A;  1OZ2 A;  4A4F A;  2K3Y A;  2RHY A;  1VIF A;  3MP8 A;  3MHX A;  1ARK A;  1Q81 C;  2JJ9 A;  1YHQ Q;  1VOM A;  1HSQ A;  3CMA T;  3CMA Q;  2VYT A;  4M4Z A;  1R77 A;  4GBQ A;  1B7T A;  5CIU A;  2RHU A;  3RR6 A;  2RMO A;  3EAE A;  2DIL A;  1BCM A;  1GRI A;  2VB6 A;  4J7F A;  3BY7 A;  2DX1 A;  2CRE A;  5LJ3 d;  3LH0 A;  1JEG A;  5HK3 A;  2DER A;  1PCX A;  1ZBX A;  2C0I A;  4E7I A;  5GAN g;  4RTT A;  5CVI A;  3ZFJ A;  1TH7 A;  2EGC A;  2HCK A;  3VUZ A;  1ZSZ A;  1PRL C;  2DTO A;  3OS0 A;  1JJ2 P;  1OUL A;  3AT1 B;  2DA9 A;  1ZA2 B;  4E7S A;  2KK4 A;  4J9G A;  2KR3 A;  2L3S A;  3V7S A;  3EGX A;  4BD3 A;  2LDM A;  3OMG A;  3THK A;  3JB9 G;  4JPB W;  1WHL A;  2LRQ A;  2RM4 A;  2MYS A;  5FRO A;  3TSW A;  1PNJ A;  1Q82 U;  4LE9 A;  3MJX A;  3PT9 A;  4L6V 5;  2XD0 A;  1D1C A;  2DPP B;  2RB6 A;  4M7A E;  4XU3 A;  1XNI A;  2DL5 A;  4J9B A;  4FCY A;  3CCM T;  1E6H A;  3VJP A;  2LMJ A;  2KI7 A;  2V26 A;  1VQ9 A;  3HPW A;  3L1A A;  1ABO A;  2CH4 W;  2SRC A;  2F5K A;  1KC8 R;  4IUT A;  4A54 A;  1MND A;  1MMD A;  3CCE Q;  3JRZ A;  3FC3 A;  2JS2 A;  1ZSZ B;  1OZ3 A;  3I56 Q;  3MKD A;  1TSF A;  1ZA1 B;  1H8K A;  1M1F A;  1UG1 A;  5D6X A;  4JJN K;  4OB1 B;  5KE3 A;  2PU9 B;  3HP9 A;  3H41 A;  3VS5 A;  4KBM B;  2JXB A;  4QVC A;  1ZSZ C;  3F70 A;  3JCM J;  1VQP A;  2FPD A;  3ULR B;  2ZPG B;  3QO3 A;  1W1F A;  2QQB A;  1QWE A;  4N0A A;  4FYY B;  3PTA A;  2DTI A;  3JB9 D;  2Y4X A;  5CKF A;  5GJW B;  4ZN3 A;  3M55 A;  3J80 E;  4PJO C;  1SEM A;  4EDU A;  3QHS A;  1VQ6 A;  2LX9 A;  1M9S A;  1PC0 A;  2HQX A;  2VGN A;  3UA7 A;  3TQ7 P;  2COY A;  5HY6 A;  2WSF E;  3DB4 A;  5FRN A;  2FZC B;  4OMQ A;  5GAN 5;  1WI7 A;  1B07 A;  2EBP A;  2CSQ A;  3CCV Q;  5GAN 2;  1RI0 A;  1I0C A;  1BI3 A;  2R5M A;  4FT2 A;  3S3M A;  3CMA A;  2DZC A;  3JCM X;  2ENM A;  1K8A C;  5A2Q E;  3O5Z A;  5D6Y A;  1PRM C;  3SHW A;  4B9X A;  2GQV A;  2HSE B;  1H3Z A;  5DLQ E;  3PVL A;  4OML A;  3A8O B;  2DJZ A;  3CCR Q;  4KH1 B;  1Q7Y C;  5KYW A;  1G3S A;  4AMC A;  1VQ6 Q;  3L2R A;  2QGG A;  3CC7 A;  4M77 E;  4LDV A;  5FU7 B;  4JZ4 A;  2KE9 A;  3ME9 A;  4M7A B;  4RKU E;  3QUI A;  5A0G A;  2QK0 A;  2O4X B;  3OS1 A;  1VQ8 Q;  1CSK A;  1O75 A;  2OX7 A;  2E10 A;  2MPX C;  3MP1 A;  4J9I A;  2DET A;  1Z9Z A;  1M5Q 1;  4XTX A;  2A0F B;  2COW A;  3OYY A;  4FIB A;  2K5L A;  4PFO A;  2RHZ A;  4NL3 A;  3DLM A;  4M75 F;  2LCC A;  2D9T A;  2KDS A;  4RMO A;  4C8Q B;  1RL2 A;  2KY9 A;  2LX7 A;  3VS0 A;  4N4G A;  3EFO A;  1MNE A;  2FVU A;  1IO6 A;  3RBB B;  2I0N A;  1SPK A;  1BI2 A;  2HKN A;  2H8H A;  1WHH A;  1MHN A;  4FT4 A;  3QDF A;  1Q82 C;  4MDX A;  4WCI A;  4C5G A;  3OW2 A;  2C0T A;  5LJ5 e;  1D0Z A;  1OU8 A;  2KRM A;  4NL2 A;  2DL4 A;  2KT1 A;  2BE9 B;  4V2S A;  1UHF A;  3M0S A;  3DB3 A;  3E2U A;  4OVA A;  1OQK A;  4FW2 A;  1RUW A;  2K3B A;  5D6W A;  2K3X A;  1GCQ A;  2P0P A;  3CCL A;  1GBQ A;  4XU1 A;  3I55 A;  4J9C A;  3I56 T;  2DE0 X;  5LJ3 f;  3GBQ A;  1LCK A;  4A4G A;  2AIR B;  1BU1 A;  3CCE T;  2P4R A;  3SWN A;  3EGX B;  2NUT A;  4XTY A;  1BIA A;  1R0C B;  3A98 A;  4AT1 B;  1YJN A;  3OYA A;  1Y07 A;  1PKS A;  1QVF A;  1YI2 T;  3HSB A;  5IAY A;  3QBY A;  3VS4 A;  3CCE A;  4FYX B;  5EG2 A;  5LJ3 e;  2LVM A;  4C92 C;  1VQ6 T;  2AK5 A;  2XDB A;  5GAN j;  5KYW B;  1JB0 E;  1ZUK A;  1VQO Q;  4M7A A;  2GTJ A;  3CC2 A;  3QJ6 A;  1B34 A;  2O9S A;  5J26 A;  1YJW Q;  2OAW A;  4BE1 A;  1NE8 A;  2EKH A;  3RDV A;  2FRW A;  1VQ8 T;  2KMT A;  3KFV A;  3M57 A;  2IPO B;  2K7A A;  1N8R U;  1VQK Q;  1ZQ1 A;  3FIF A;  1D1A A;  3JSC A;  1Q95 G;  1AWO A;  2PZ1 A;  3C4S A;  3EG1 A;  5I22 A;  4FYV B;  4PKC C;  3OYI A;  1QCF A;  3G4S Q;  1M1K R;  2K57 A;  4LN2 A;  1WPY A;  3CCU T;  5AT1 B;  5KE2 A;  3PMT A;  2Y4Y A;  3TU4 K;  2CYZ B;  4JRP A;  4EMK C;  1AOJ A;  4C0G A;  3MEA A;  4HVV A;  4LD6 A;  5GMK e;  2O4X A;  5IHN A;  1K0S A;  1UGR B;  3HL8 A;  2B8A A;  1QVG S;  1VQM T;  5HK0 A;  3EG2 A;  1YIT A;  4M7D E;  1VQK A;  2IVW A;  2CP3 A;  1S72 A;  4M7D F;  4VUB A;  1AZE A;  5L8R E;  2QTX A;  2DEU A;  4M78 E;  3MET A;  3CBP A;  3FEO A;  4FW1 A;  4OMO A;  5GAO l;  1WX6 A;  2L3P A;  3M4Y A;  1M8V A;  3R6O A;  2EW3 A;  3DLL A;  1VQM A;  4CC3 A;  4C8Q A;  1YJ9 Q;  2OTJ A;  4F17 A;  2KXD A;  4A63 B;  1BI1 A;  2JM8 A;  1SSF A;  4FU6 A;  1UE9 A;  1CKB A;  4OGE A;  4M7A D;  1Q82 R;  1ZHI A;  2M02 A;  2LCS A;  1TG0 A;  1UTI A;  1NBE B;  2HAX A;  1WZO A;  1Y0M A;  4M78 D;  1VQ9 Q;  1RAH B;  2PNI A;  1KIK A;  2PUO B;  4F04 B;  3M0P A;  3TRE A;  1VQN T;  2J06 A;  4E7L A;  2LTO A;  5CKB A;  3CME T;  4KH0 B;  4RTY A;  1X2Q A;  6AT1 B;  1TWB A;  2K4Y A;  3JCM h;  2EYQ A;  5J3B A;  3EHR A;  1WDX A;  2G3R A;  2QDY B;  1PKT A;  2VV5 A;  2F5T X;  4BI8 B;  3WXM B;  5FW9 A;  4DBR A;  3CCR A;  2JTE A;  1M3C A;  3G71 Q;  2DRM A;  1W2B P;  1M3A A;  1FX7 A;  1TUD A;  3X20 B;  2L2P A;  3CC4 T;  4X1V A;  2KBT A;  3H0I A;  1S1N A;  5IH2 A;  1ZUY A;  3RMS A;  5FLX E;  2LQK A;  4IUP A;  1AVZ C;  3QZ5 B;  1VQM Q;  2ROL A;  2RQU A;  2X4X A;  2K5I A;  4FL6 A;  3CD6 A;  4PNO A;  1NJI C;  3CCJ T;  2J05 A;  2CDT A;  1GCP A;  2X4W A;  8AT1 B;  3H0H A;  4PJM A;  4ANJ A;  1HXD A;  1M30 A;  2L89 A;  4D8K A;  2JT4 A;  3CC2 T;  4DEX A;  3KXT A;  3OS5 A;  1M1G A;  5IXB A;  1N27 A;  1YJ9 A;  3H8Z A;  2DBM A;  2CT4 A;  2DKG A;  4Z88 A;  4A4K A;  4JJD A;  1JRI A;  2R58 A;  3I5R A;  2A37 A;  3ASK A;  1C1A A;  4M7A F;  2HNI A;  1G2B A;  1YJN Q;  1YIJ A;  1X75 C;  4J7I A;  2K2V A;  3G1J A;  2CP5 A;  1M2V A;  1KQS P;  1R8O B;  2OAU A;  1ZSG A;  2CSI A;  3QG1 A;  1QVP A;  2RI3 A;  1N9R A;  2RO0 A;  5GAN 8;  4MZM A;  3MPU B;  4GLM A;  4N4H A;  2RQR A;  3CCU A;  1PSE A;  4CC2 A;  2WSE E;  3M9Q A;  1KD1 C;  2J7I A;  2K2M A;  2MI6 A;  2X4J A;  4M75 A;  3CCM Q;  2DBK A;  5GAM d;  4BDY A;  3GPL A;  1GL5 A;  4IUV A;  1NPR A;  2KRO A;  2QGF B;  2BKD N;  3VS6 A;  1XQH A;  2FPF A;  1QP2 A;  2DRK A;  1K9M R;  2GTO A;  1Y71 A;  1UGP B;  3JCM b;  3LX7 A;  2EYY A;  1LPL A;  2DZ9 A;  2RK2 A;  4IUU A;  2CP6 A;  2VXE A;  1P92 A;  1WXB A;  1X69 A;  4LNP A;  2K79 A;  1WXU A;  3CCS Q;  1EX4 A;  5IHI A;  4RG2 A;  3CPW A;  4O5V A;  5GAO r;  4HKE A;  2O2O A;  3LH5 A;  3S3O A;  2YUN A;  3M59 A;  4DBQ A;  2VAS A;  4ELY C;  9ATC B;  5GAM g;  1K0X A;  3M5A A;  1T3S A;  1VQL A;  4M75 B;  3JB9 I;  3HRS A;  1VQO A;  2V8I A;  1Q81 R;  1V76 A;  5GMK h;  4OB2 B;  1BBZ A;  1VQN A;  3M0U A;  2DAQ A;  1C6V X;  1TUC A;  4J6Y A;  3CXC S;  5LJ5 d;  5KYX A;  2K6D A;  1VQ5 A;  2DNU A;  4ZNX A;  1AZG B;  1TXQ A;  3VV0 A;  2PVO B;  1VQ4 Q;  2F1L A;  3I55 T;  4EPC A;  3I55 Q;  3OB9 A;  3V7C A;  2E5Q A;  1MV0 B;  1ABQ A;  2EKO A;  4M7D A;  5GAM j;  2P0K A;  1K8A R;  4AFU C;  2VC8 A;  4M77 G;  1UEC A;  3OYB A;  1KC8 C;  2X4Y A;  4R55 A;  1M90 U;  2JN0 A;  2I2L A;  2DD5 A;  4J5Y A;  1WJR A;  3VYH B;  1YIJ Q;  1BIB A;  1T3L A;  1FYN A;  1K76 A;  2PQW A;  2M1H A;  3M53 A;  2NUP B;  3H9N A;  4KGV B;  4RCB A;  4XK8 E;  1F1B B;  2DLP A;  3CCJ A;  2LZ6 B;  3MEU A;  2OTJ Q;  4KGX B;  4TVR A;  1YJW A;  4HT9 A;  1NYF A;  4C0F A;  5FWC A;  1M8M A;  1PG5 B;  1K9M U;  1YCY A;  4LXC A;  2EGE A;  3CBO A;  4A53 A;  5I21 A;  1U1S A;  3NPF A;  1LJO A;  1HJD A;  4C8Q G;  1ZLM A;  1U06 A;  2IG0 A;  2DIG A;  2CZ6 B;  3JCM g;  4Z89 A;  2RK1 A;  5KYY A;  3CCQ T;  2D8H A;  1PHT A;  2D1X A;  3U23 A;  2O01 E;  5DY9 A;  1M27 C;  5IXF A;  3GF5 A;  2DK3 A;  4PJO G;  2C0O A;  2ED1 A;  1UGS B;  3CCS A;  1Y7X A;  4BB7 A;  5LJ5 h;  1RAD B;  2CP2 A;  4QQD A;  4M75 D;  2JOY A;  2MWO A;  1VQ4 T;  2Z0W A;  1WJQ A;  2JTF A;  1G83 A;  4Z8A A;  1KJW A;  2HKQ B;  2KQW A;  3MEW A;  3OW2 P;  2WSC E;  2CS7 A;  1YFN A;  2E3H A;  4YTL A;  2ZZD A;  3LWH A;  5KH6 A;  2D0N A;  5DLO A;  4DBH A;  2CP0 A;  4PL6 A;  3PIO A;  2QDL A;  3JCM W;  1UGV A;  2RHX A;  1FMK A; 
#chains in the Genus database with same CATH homology
 1QKW A;  3TSZ A;  3M0S A;  5I11 A;  2DL8 A;  1QWF A;  4ORZ A;  1K9A A;  2KXC A;  1RUW A;  1GBR A;  2K3B A;  1E6G A;  1GCQ A;  1Y57 A;  1GBQ A;  4J9C A;  4IIO A;  2DE0 X;  2DMO A;  3GBQ A;  1LCK A;  1BU1 A;  1QKX A;  2P4R A;  2CUD A;  1A0N B;  3CQT A;  1NEB A;  1NM7 A;  1M3B A;  3A98 A;  4K11 A;  1WLP B;  2YUQ A;  3UA6 A;  2KNB B;  4HXJ A;  1PKS A;  2OI3 A;  4J9E A;  1W6X A;  2ECZ A;  1NLO C;  4Y92 A;  1UUE A;  3VS4 A;  1AWW A;  1ZUU A;  4AFQ C;  1GFD A;  1UJ0 A;  2YT6 A;  1SRL A;  2AK5 A;  2DYB A;  1ZUK A;  2M0Y A;  2GTJ A;  4LUE A;  2YUP A;  2O9S A;  2PTK A;  2HBW A;  1SRM A;  2OAW A;  1BK2 A;  1NG2 A;  2EKH A;  2FRW A;  3M0Q A;  3KFV A;  2ABL A;  1X27 A;  2J6O A;  2K7A A;  4D8D A;  3VS7 A;  2LNH B;  1K1Z A;  4J9F A;  1AEY A;  1QLY A;  1AWO A;  2PZ1 A;  4FSS A;  2CT3 A;  3EG1 A;  5I22 A;  1AD5 A;  2EQI A;  3I9Q A;  1QCF A;  2LP5 A;  1VYT A;  4LN2 A;  2RN8 A;  4E6R A;  2J6K A;  2GNC A;  4RTW A;  1OPK A;  1AOJ A;  2FRY A;  2RQT A;  1WXT A;  3REA B;  5L23 A;  1NEG A;  2LJ0 A;  4HVV A;  5EC7 A;  2O88 A;  3EGU A;  5IHN A;  4OMP A;  4RTZ A;  1K0S A;  4OMN A;  1H92 A;  2F2W A;  2AKL A;  4JJB A;  3H0F A;  3R6N A;  3EG2 A;  3UAT A;  2O9V A;  5IHK A;  1H3H A;  3FJ5 A;  1AZE A;  1BB9 A;  4OMO A;  2CUB A;  1JQQ A;  2LJ1 A;  2KRS A;  2SEM A;  2LQN A;  1WX6 A;  2L3P A;  2NWM A;  2EVR A;  1WA7 A;  2EW3 A;  3VS2 A;  4AG2 C;  2DL3 A;  1AWJ A;  1YCS B;  2B86 A;  4CC3 A;  4F17 A;  5HCK A;  2KXD A;  4A63 B;  2KEA A;  2JM8 A;  3EHQ A;  1UJY A;  2RNA A;  1UHC A;  1UE9 A;  1CKB A;  1V1C A;  3RNJ A;  2G6F X;  2YDL A;  3VRZ A;  2LCS A;  1TG0 A;  3M0T A;  1UTI A;  2F2V A;  1Y0M A;  3VS1 A;  4CC7 A;  1K4U S;  2J6F A;  2PNI A;  1KIK A;  2BZY A;  2MIO A;  4AG1 C;  2BZ8 A;  2JM9 A;  2EYX A;  3M0P A;  3PE0 A;  2J06 A;  2JW4 A;  1NYG A;  4RTY A;  2DL7 A;  1X2Q A;  4AFZ C;  2LQW A;  1I1J A;  2GQI A;  2L3Q A;  3EHR A;  1WDX A;  1PKT A;  4HVW A;  2DJQ A;  2NUZ A;  1ZBJ A;  2L0A A;  2GGR A;  2W10 A;  5FW9 A;  1XOV A;  1UFF A;  2JTE A;  4F14 A;  1M3C A;  3C0C A;  2DRM A;  4RTV A;  1M3A A;  1SHG A;  2KGT A;  4JZ3 A;  1TUD A;  2ROT A;  2LJ3 A;  2BTT A;  1NLP C;  4HCK A;  1AWX A;  2L2P A;  1ARK A;  4X1V A;  1OOT A;  2KBT A;  3H0I A;  1S1N A;  3UF4 A;  5IH2 A;  1ZUY A;  1HSQ A;  2JMC A;  2W0Z A;  4M4Z A;  4GBQ A;  1JO8 A;  1AVZ C;  4J9H A;  2ED0 A;  2RMO A;  2ROL A;  2RQU A;  2DIL A;  1GRI A;  1JXM A;  2J05 A;  2CDT A;  1GCP A;  3H0H A;  1VYV A;  1M30 A;  4D8K A;  2JT4 A;  2DX1 A;  1CKA A;  2RF0 A;  4DEX A;  2CRE A;  5IXB A;  1JEG A;  2EYZ A;  3VRY A;  4J9D A;  2DBM A;  2CT4 A;  1OPL A;  2FO0 A;  4Z88 A;  2IIM A;  4JJD A;  1T0J A;  2FPE A;  3I5R A;  2A37 A;  4F16 A;  4HVU A;  3IQL A;  1G2B A;  2C0I A;  4RTT A;  1MUZ A;  2MOX A;  4KRT A;  2A08 A;  2EGC A;  2HCK A;  2X3W D;  1HD3 A;  1PRL C;  1ZSG A;  2CSI A;  2YSQ A;  2ESW A;  1W70 A;  1T0H A;  2A36 A;  1N5Z A;  4GLM A;  2RQR A;  2DA9 A;  4J9G A;  2KR3 A;  2L3S A;  4CC2 A;  2DF6 A;  2J7I A;  2K2M A;  3THK A;  1I07 A;  2DBK A;  1GL5 A;  4JPB W;  2KRO A;  1VYU A;  3VS6 A;  2AZV A;  2FPF A;  4QT7 A;  1KSW A;  2E5K A;  2DRK A;  3REB B;  4DEY A;  2GBQ A;  1X43 A;  2GTO A;  3PVQ A;  3TSW A;  1PNJ A;  4LE9 A;  4CC4 B;  1EFN A;  2EYY A;  3EG3 A;  1VA7 A;  2DL5 A;  4J9B A;  4RUG A;  1E6H A;  2LMJ A;  1WXB A;  1X69 A;  1X6B A;  3M0R A;  2VKN A;  1ABO A;  2F2X A;  2CH4 W;  2SRC A;  4LNP A;  2K79 A;  2HDA A;  1WXU A;  5IHI A;  2JS2 A;  3VS3 A;  1YP5 A;  2A28 A;  4RTU A;  2MCN A;  1H8K A;  2O2O A;  3LH5 A;  2FG0 A;  2YUN A;  1UG1 A;  3H41 A;  3VS5 A;  1MV3 A;  2JXB A;  1K0X A;  1T3S A;  1X2K A;  4R0K A;  2FPD A;  3ULR B;  1SHF A;  1WYX A;  1W1F A;  1KFZ A;  1E7O A;  2V1R A;  1BBZ A;  5FWB A;  3M0U A;  1QWE A;  2JMA A;  1TUC A;  1X6G A;  2RQW A;  3I5S A;  1JXO A;  2YUO A;  2K6D A;  1YWO A;  1ZX6 A;  5GJW B;  2DNU A;  4ZNX A;  3SEM A;  1AZG B;  3QWX X;  2JS0 A;  2EPD A;  2FEI A;  1SEM A;  1J3T A;  2RQV A;  1RLQ C;  1MV0 B;  1ABQ A;  1U3O A;  3UA7 A;  2AZS A;  4OMQ A;  4AFU C;  5GJV B;  2M51 A;  2DM1 A;  1WI7 A;  1B07 A;  2EBP A;  2CSQ A;  1UEC A;  1B3Q A;  1YWP A;  1I0C A;  1T3L A;  2ENM A;  3NHN A;  1FYN A;  2CH4 A;  2AKK A;  1K76 A;  1GFC A;  5ECA A;  3O5Z A;  1PRM C;  1WFW A;  3SHW A;  3NMZ C;  3PVL A;  4OML A;  4RTX A;  2DLP A;  2K9G A;  2BZX A;  2V1Q A;  2LZ6 B;  3I35 A;  2HSP A;  2VVK A;  1OV3 A;  4EIK A;  1NYF A;  5FWC A;  1M8M A;  2DVJ A;  1GCQ C;  2EGE A;  4ESR A;  2EGA A;  4JZ4 A;  2KE9 A;  4IIM A;  2EYW A;  1CSK A;  2D8J A;  3NPF A;  4LUD A;  2XMF A;  1HJD A;  1ZLM A;  4OMM A;  4J9I A;  3ZL7 C;  1U06 A;  2X3X D;  3EG0 A;  1Z9Z A;  4Z89 A;  1JU5 C;  2O31 A;  2D8H A;  2KRN A;  3NGP A;  1PHT A;  2D1X A;  3U23 A;  3TVT A;  1M27 C;  4AFS C;  5IXF A;  1U5S A;  1YN8 A;  3JV3 A;  2C0O A;  2ED1 A;  2OJ2 A;  1UDL A;  1RLP C;  2LX7 A;  1PWT A;  3VS0 A;  1RI9 A;  1IO6 A;  3RBB B;  2I0N A;  2VWF A;  1G83 A;  4Z8A A;  2KYM A;  3QWY A;  1SPK A;  1KJW A;  1OEB A;  2H8H A;  4JJC A;  1Z9Q A;  2D0N A;  4WCI A;  2HEQ A;  2C0T A;  2KRM A;  2RPN A;  2KYB A;  1WIE A;  2DL4 A;  1SSH A;  2KT1 A;  2KT8 A;  2QDL A;  1UGV A;  1YNZ A;  1UHF A;  1FMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...