1X43A

Solution structure of the sh3 domain of endophilin b1 (sh3g1b1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
81
structure length
81
Chain Sequence
GSSGSSGLNDLKESSNNRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITYLELLNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of Endophilin B1 (Sh3g1b1)
rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords SH3 domain GRB2-like protein B1
total genus 9
structure length 81
sequence length 81
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x43A01
1RLQC 3EGUA 5FWBA 2A36A 2JT4A 3QWXX 1WFWA 1JO8A 2D8JA 1YNZA 2M51A 2YT6A 5HCKA 4ESRA 2FPEA 2DL8A 1SRLA 1ZLMA 2B86A 2CUBA 1W6XA 2SRCA 1PRLC 2L3SA 5IXFA 4K11A 1OOTA 3R6NA 1AWJA 4AFZC 4LN2A 1ZUKA 2O31A 1UGVA 2GGRA 2LQWA 2RPNA 4R0KA 2DJQA 4FSSA 2JS2A 2KRNA 2DL4A 1AWXA 4HVUA 4M4ZA 1T0HA 2MCNA 1ABQA 1V1CA 4DEYA 1M27C 1HSQA 1ZUYA 3PE0A 1K0SA 2EGAA 2JMAA 3VS2A 2HBWA 2ABLA 4JZ4A 2LQNA 2LJ1A 1MV0B 1ZSGA 1GCPA 1SSHA 2CSQA 1MV3A 4A63B 1WXBA 1OV3A 4OMNA 4LNPA 2GBQA 4OMLA 2KT8A 1KFZA 1K1ZA 3UA6A 4D8DA 1KIKA 1VYUA 2H8HA 2K7AA 1G83A 1UECA 2P4RA 1WX6A 4J9BA 4IIOA 3EG3A 2EYZA 2AK5A 4J9CA 1YWOA 3NGPA 1FMKA 1SRMA 3I5SA 2X3WD 1NEGA 2D1XA 4J9EA 5L23A 2K79A 4J9HA 2VVKA 4F16A 1WIEA 2YUPA 2DMOA 2RQRA 2A37A 3SHWA 1I0CA 2DRKA 4JPBW 1GRIA 1K4US 2X3XD 1W1FA 2EBPA 2LX7A 2D0NA 2ENMA 2YSQA 1VYVA 1G2BA 1ZX6A 3LH5A 1QWEA 1Y57A 1WXTA 2KT1A 1ZUUA 1Z9QA 2BTTA 2EW3A 4Z88A 1ABOA 1UE9A 4CC7A 4GBQA 3REAB 4AG2C 2F2VA 1KSWA 2C0IA 1ZBJA 2YUOA 3VS5A 3TSZA 2KR3A 4X1VA 2K2MA 5I22A 2C0TA 3EHRA 2RQUA 5I11A 4HCKA 2W0ZA 1GFCA 4HVWA 4RTUA 5GJWB 1UFFA 1X2KA 2YUNA 3NMZC 2DBKA 2CT4A 4JZ3A 4RTWA 4Y92A 3VS7A 2JW4A 4ZNXA 2EGCA 4GLMA 2VKNA 1E6HA 1B07A 1XOVA 2EPDA 1JEGA 1N5ZA 1T3SA 3M0UA 2KEAA 1M3BA 4F17A 3RNJA 4Z8AA 1NLPC 2JM9A 1E6GA 1WDXA 1GL5A 4JJDA 1Y0MA 2E5KA 1IO6A 1AEYA 2DBMA 2O2OA 4CC4B 2F2WA 1QKWA 1X27A 3PVQA 1U5SA 1X6GA 2KBTA 3TSWA 4OMPA 1OEBA 1VYTA 1PNJA 1WXUA 3EG1A 3VS0A 3VRZA 2FO0A 2JXBA 5EC7A 2O88A 1JQQA 1KJWA 4HXJA 3H41A 2V1RA 1YN8A 2YUQA 2RNAA 3NPFA 2A08A 2J6FA 3IQLA 1GBQA 2DL5A 2DLPA 2CH4W 2DX1A 2ECZA 2FG0A 1H3HA 4LE9A 1AZGB 1AVZC 2ED0A 3EHQA 2DVJA 3VS1A 1QLYA 1I07A 2GNCA 1M3CA 1CSKA 3M0PA 2LCSA 3KFVA 1T3LA 3H0IA 2G6FX 1CKBA 2A28A 2KROA 2FPDA 1B3QA 4IIMA 1AZEA 2RN8A 1EFNA 3I5RA 1HJDA 3M0TA 4CC2A 1UG1A 1UJYA 4F14A 1NEBA 1WI7A 3TVTA 2RF0A 5FWCA 2DL7A 1J3TA 1NLOC 2FEIA 1RUWA 3M0QA 1UDLA 2EQIA 5GJVB 1YP5A 2J6KA 1T0JA 4J9DA 2DYBA 1M3AA 2OI3A 1JXOA 4AG1C 2PZ1A 3M0SA 2K3BA 2EVRA 2EYXA 1QKXA 1SHGA 4LUDA 1YWPA 4JJBA 2RQWA 2DM1A 1PWTA 3VS6A 2KE9A 2I0NA 4OMQA 3EG0A 2CT3A 2AZSA 1GCQA 2CREA 2XMFA 2VWFA 4HVVA 3REBB 1W70A 2J7IA 2L2PA 1PRMC 3RBBB 2V1QA 2CDTA 2J6OA 4RUGA 2LZ6B 4RTTA 2KRMA 3C0CA 3THKA 4E6RA 4EIKA 2DILA 2HCKA 2KXDA 1X43A 1X69A 1TUDA 3H0HA 4J9GA 2O9SA 2DA9A 1RI9A 5ECAA 4WCIA 1NYGA 1U06A 2K6DA 1Z9ZA 3JV3A 1BK2A 3I9QA 3UATA 2BZYA 2GQIA 1AWOA 5FW9A 4JJCA 2DRMA 1ARKA 2ROLA 2RMOA 2OJ2A 2CH4A 2RQTA 1JXMA 1QWFA 2ESWA 1SPKA 2LNHB 2KYBA 1HD3A 2CUDA 3U23A 3SEMA 4QT7A 4LUEA 2EGEA 2LJ0A 4RTXA 2J05A 2JTEA 4OMOA 2JMCA 1GCQC 2FRYA 2ED1A 1S1NA 1H8KA 3ULRB 1LCKA 2C0OA 1JU5C 2DL3A 3EG2A 3CQTA 3UF4A 4AFSC 2HEQA 1RLPC 3VRYA 2HSPA 5IHKA 2L3QA 1TUCA 2HDAA 4J9IA 1OPKA 1X6BA 1WA7A 1GFDA 1PKSA 4RTYA 3FJ5A 1K76A 4CC3A 1TG0A 2DE0X 2LP5A 2MOXA 4AFQC 1NM7A 3ZL7C 2L0AA 2PNIA 2IIMA 1MUZA 2JM8A 1M8MA 2LMJA 5IXBA 1CKAA 1UUEA 1BU1A 1BB9A 4KRTA 2CSIA 1PKTA 4J9FA 2DF6A 3H0FA 3UA7A 1UTIA 2QDLA 1H92A 2KNBB 2O9VA 5IHNA 2BZ8A 2FPFA 2J06A 1QCFA 2DNUA 1UJ0A 2EKHA 4OMMA 1I1JA 1M30A 5IHIA 4ORZA 1WLPB 2NUZA 1VA7A 3GBQA 2SEMA 2YDLA 3O5ZA 2AKLA 1UHFA 1AWWA 2W10A 2JS0A 1UHCA 3VS4A 2BZXA 2AKKA 2EYYA 2L3PA 5IH2A 1FYNA 4RTZA 4RTVA 2NWMA 1WYXA 2EYWA 1AD5A 2ROTA 2KXCA 4Z89A 3A98A 1X2QA 3I35A 3QWYA 4DEXA 1E7OA 2GTJA 3NHNA 2LJ3A 1K9AA 2FRWA 1U3OA 1A0NB 1OPLA 2AZVA 2OAWA 2KYMA 1SEMA 1GBRA 2F2XA 3VS3A 1K0XA 1YCSB 2M0YA 3PVLA 2K9GA 1AOJA 2GTOA 1PHTA 1NG2A 2D8HA 2RQVA 3M0RA 1BBZA 2PTKA 2MIOA 1SHFA 2KRSA 2KGTA 4AFUC 1NYFA 4D8KA
chains in the Genus database with same CATH superfamily
2MK5A 5FWBA 4M7DG 2QA4A 3QWXX 2DVEA 2YT6A 2FPEA 4PJOB 1MMAA 4C5HA 1U1TA 1VQ7Q 1C6VX 4FYVB 1FMVA 2QDYB 1KHIA 3JB9H 1YI2Q 2GGRA 2RPNA 2DJQA 3VYHB 2DD4A 2KRNA 3E2UA 2VC8A 2KY9A 2MCNA 4QVDA 1M1KR 1H641 2QK0A 4ZTJA 3LH0A 3EG9A 2RI5A 1YIJA 2OX7A 3VS2A 2RK2A 3OS5A 4LXCA 2HKQB 5FRNA 4M77C 2M9UA 2E5QA 1ZSGA 4QVZA 2CSQA 1OV3A 8AT1B 4OMNA 3UDCA 1Q82U 3QIIA 4OMLA 2GBQA 3CC2A 4M7AF 3QJ6A 5DLOA 2A0FB 3A1PA 3META 5KH6A 4F7UG 3CPWP 2DK3A 4N4GA 3GNFB 1UECA 2P4RA 2LT4A 2P84A 4J9BA 2LC4A 2XHCA 4DBRA 4OB0B 4QQDA 3OW2S 4JRKA 3I5SA 2X3WD 5FU7B 4ZN3A 2D1XA 4N4HA 5CKBA 1YJWQ 4J9HA 3LWHA 4F16A 1WIEA 2DMOA 4DQ2A 3OBWA 2DRKA 4JRPA 2X3XD 3HL8A 3G71T 3BE3A 3C95A 5M9OA 3VKIA 4A54A 5KYYA 5GANf 2ENMA 3RMSA 2YSQA 1V29B 1G2BA 2XIDA 4M77F 1YITQ 1QWEA 5GANe 4V2SA 2EQUA 1WXTA 4MDXA 1WQ7A 3JCMX 5LJ3e 4M7DF 1NPPA 3CCLT 4J6YA 4M75A 4CC7A 3REAB 3CXCP 4AG2C 3H9NA 2F2VA 6AT1B 4N0AC 1C0MA 4M78C 1FMWA 3G7ZA 1IHWA 1ACMB 4FW2A 4LDUA 3UPUA 3T9NA 5KCOA 3CMET 1YJNQ 1SG5A 1UFFA 4BE1A 1YJ9Q 4PJOE 2QEXT 3M54A 2VV5A 1XQHA 2RO0A 4M77A 1IREB 2X51A 2YRVA 3M0UA 1EX4A 5KCHA 3CCET 2JM9A 1E6GA 3BY7A 1TOVA 4PNOA 3EFSA 2O2OA 4CC4B 1QKWA 3WVDB 1VUBA 5GAOr 1W2BS 4M7AG 2HD0A 1VQ5Q 1PNJA 4FYXB 2LCCA 4M78A 4F7UB 2RHYA 4NL3A 4B9XA 1VQPA 2L89A 1VQOA 1KG1A 1JQQA 3CMAT 3M4YA 2X4YA 2QEXA 1ZSZA 4JLGA 1YN8A 4NS5A 1FX7A 1F1BB 4RCBA 2K57A 2E64A 3IQLA 1BI3A 3MHXA 3OMCA 2CZ7B 3CCJQ 2XU8A 1VQNQ 2IPOB 4FIBA 1CSKA 3M0PA 2CP5A 4J6XA 2BE7D 1Q82R 1M90U 2G6FX 2XICA 3P8BB 2FHDA 1NBEB 5FU6B 1AZEA 2RN8A 1EFNA 3CCVQ 1D0ZA 1UJYA 2JUFA 1YHQA 2RF0A 2NUPB 1RADB 1RL2A 1RACB 1JRIA 2QQRA 2FEIA 5CQYA 1UDLA 1VQ5T 3GLXA 4QKUA 1YBYA 1ZSZB 1QCOA 3GP8A 3EFOB 4AG1C 4C8QE 2K3BA 5J39A 1YJNA 2DM1A 3OMGA 3JSCA 4M7AA 4M78B 4LD9K 5DLQE 5KE2A 1WJSA 2CT3A 2LCLA 2XMFA 4TVRA 2J7IA 3MPUB 4J7FA 1QVPA 4X9DA 2CDTA 2J6OA 3I55Q 2LZ6B 2PU9B 4RTTA 5CIUA 3CCSQ 1TS9A 1D1BA 2LDMA 4EIKA 2DILA 1N27A 2AT1B 1R0BG 1D09B 2EIFA 2V26A 2KXDA 4RCCA 1WHGA 1RI9A 3PIOA 5ECAA 2ZPBB 2F5TX 2GQIA 1PCXA 2DO3A 3CCLA 4QW2A 1AWOA 5FW9A 3JCMQ 3F70A 2R5MA 3EH2A 4JJNK 1H3ZA 2ROLA 2V8KA 1JXMA 5GAN4 1QWFA 2ESWA 1SPKA 3RERA 4PJLA 4QT7A 5GANd 3CC7T 1UEBA 3JAME 1GCQC 2E3HA 2HMAA 1N8RC 3EG2A 1YI2T 4AFSC 2HEQA 3HP9A 5KYXB 2DERA 2X4WA 1M90C 2HDAA 2QQAA 1VQ6Q 1IB8A 5FU6C 3N5BB 1QVGS 1I5OB 2DE0X 2VB6A 3C12A 4AFQC 2CP3A 1VQKT 4PJNA 2JM8A 1I81A 2E3IA 5FROA 2LMJA 2GFAA 4KH0B 1CKAA 5GAMg 4PJMA 2FZKB 4EMKC 1BU1A 1DJ7B 4J7IA 2CSIA 4J9FA 3QHSA 3EGDB 4BE0A 2QDLA 3VU3C 4RG8A 3JCMh 5GAN6 4ZGEB 2BKDN 2CZ1B 2DNUA 1OQKA 4M7DB 1I1JA 3M58A 5IHIA 1VQMQ 3V7CA 3CMAQ 1XJWB 2RHZA 3GBQA 4RKUE 2SEMA 2QYZA 3O5ZA 4GLKA 3CCMT 4AT1B 2X9HA 1NZ9A 3CCUT 1OZ3A 2L8DA 1UHFA 2ZPIB 5LJ5j 3C4SA 1B34A 3L2RA 2AKKA 3CCLQ 3G6EQ 4BD3A 1W4SA 3HKSA 2CP0A 3RKYA 1B34B 2M1HA 2EJGA 1KD1U 2ROTA 4E7SA 3A8LB 3EG9B 4Q5WA 2QG9B 2GTJA 2P4TA 2FZCB 4BI8B 2LJ3A 2FRWA 2KYMA 2AZVA 1KD1R 1NJIR 1K0XA 2K4YA 3CEYA 3VV0A 3E1SA 4FCYA 4LD6A 3M9QA 4M75B 2A7YA 3PVLA 1Q86C 2K9GA 1PHTA 2RQVA 4PJOA 4C8QG 1WHLA 3SD4A 1R8OB 2MIOA 3V8KA 2KRSA 5LJ3d 2P0PA 2PUKB 4XAXB 1G5VA 5GAMh 1NYFA 1YIJT 2E41A 2RHXA 1RLQC 3EGUA 1M1KU 1WFWA 2M51A 1YNZA 1I4K1 1ZLMA 3HSBA 5GANh 2B86A 2SRCA 4ATOA 4K11A 3INZA 2KVQG 5LJ5f 4A4EA 1ZSZC 1AWJA 4C92G 1ZUKA 3J80E 1Q7YR 4ME7A 4R0KA 4OMFB 3OYHA 4C0ZA 1T0HA 3QZ9B 1ABQA 1M27C 3G4ST 1K0SA 3QBYA 4B6MA 2EGAA 2JMAA 1YI2A 4IUTA 1K9MU 3P8DA 2LQNA 3AHUA 1RAIB 3QXEB 1MV0B 1WHJA 2RI3A 1AT1B 1TTHB 1BYMA 4A63B 1WXBA 2MWOA 3OA6A 1WHKA 4BDYA 4LNPA 4C92C 1WNLA 4M75C 2EYQA 4OB2B 4PFZA 4J83A 3JB9D 2DAQA 2H8HA 1M1FA 1M2VA 2L5QA 1PM3A 3EG3A 3UWNA 2EYZA 1VQMT 1OZ2A 3A8GB 1SRMA 2XDPA 3MEVA 4OB1B 1WHHA 1HK9A 1YJNT 1UGRB 2A37A 1KHCA 4JPBW 1VQNT 4M75G 4QQ6A 2QEXQ 3S3MA 2RJCA 1VQPT 1VYVA 4KGVB 5IAYA 3OW2A 2Y90A 5I2MA 1Y57A 2NUTB 1OU9A 2KT1A 4HKEA 4Z88A 2K2VA 4XTZA 5KYXA 4GBQA 4FYYB 2M02A 3L42A 5D7UA 5C0MA 1ZBJA 2YUOA 2YWWA 3VS5A 1M1KC 2KR3A 2AHJB 5I22A 1M2VB 1MNDA 2AIRB 2RQUA 1PD1A 2MYSA 4HCKA 4NOYA 2W0ZA 2QASA 2YUNA 2HL3A 1JJ2A 1N9SA 4C0DB 1VOMA 4RTWA 4Y92A 3VS7A 2QAZA 3CBOA 2EGCA 4O6JA 4GLMA 2VKNA 2HAXA 1Y71A 1JB0E 3HFOA 1Y07A 1E6HA 1MGQA 1XOVA 2QQBA 5CR2A 1N5ZA 2XDDA 4F17A 4Z8AA 3PFSA 4XU0A 3G6ET 4FW1A 4M78D 2QA4T 1QQJA 2FVUA 2DBMA 4A4FA 3PVQA 3TU4K 1W2BP 1FWZA 3PMIA 3TSWA 1Q81R 1QVFA 3LGFA 1OYXA 3EGDA 5HK3A 1WXUA 3VRZA 2DJZA 2DKGA 2JXBA 5GANj 2LNVA 3S3NA 2LTOA 1KJWA 1M1GA 4HXJA 2GCXA 4KUIA 2COWA 2V1RA 1G3WA 1NPRA 3OYDA 3FC3A 2DPPB 3G1JA 5KYWA 2KSSA 3OYGA 3ZFJA 2A08A 4M7AB 1GBQA 1K73R 3QYHB 4J6WA 2R57A 2OAUA 3KBGA 2DX1A 1R77A 2P0KA 1BIBA 4MDWA 1H3HA 1VQ6A 2EJFA 4LE9A 1LNXA 4C0DC 1AVZC 4M7AD 2E6NA 2GNCA 1M3CA 3L2VA 3H0IA 3RDVA 1IHVA 3PTAA 3CPWS 1KC8R 5IN1A 1B3QA 2V8JA 2ZPGB 3LWIA 4IIMA 3OYMA 3I5RA 1K8AC 2QQSA 4CC2A 1UG1A 4ANJA 3S6WA 2DL7A 4QQGA 4JRIA 2HNIA 4FU6A 2D0QB 2FL7A 2V8IA 2WSEE 4JDSA 2QI2A 1RUWA 2EQIA 5GAMd 3HFNA 1NJIU 3CCVT 4J9DA 4HCBA 1C1AA 2DEUA 2PZ1A 3VUZA 4Z02A 4ZN1A 2EVRA 1QKXA 2OTJQ 4XU3A 1YWPA 1VQ9Q 2CKKA 1Y96B 2EJ9A 2I0NA 1D0XA 3EG0A 3QG1A 4E2FB 3G71Q 1QMCA 1TH7A 1GCQA 4HVVA 2CP6A 1PRMC 2LT1A 3RBBB 3NTKA 4RUGA 2ZPEB 2KRMA 1ZBXA 1YIJQ 1VQ9A 4E6RA 4JLIA 1N8RR 4WTOB 1JBMA 3CCRQ 3CCQT 1IZ6A 1TUDA 4J9GA 2O9SA 5CKFA 4E7HA 4N0AA 1NYGA 2K6DA 1BK2A 4MMKA 2GF7A 2BZYA 3I55T 1OX9A 3DLLA 5GAN8 3URGA 2OJ2A 2RQTA 2COZA 2NLUA 2KYBA 2DTIA 2KAFA 1KK7A 2HQHA 3MEAA 4M7DE 3CCVA 4RTXA 5CCAA 2J05A 2JTEA 2JMCA 2ZAEA 4EMKB 2CZ6B 1S1NA 2FRYA 4OGCA 5LJ3g 4PLLA 4J5YA 1LCKA 2DIQA 3CQTA 1LPLA 4JUVA 4GY5A 1O9SA 3VRYA 2HSPA 3FRNA 1OPKA 4C8QD 4DOVA 4CC3A 3CBPA 1K8AU 3C94A 2K5IA 4XU1A 3MKDA 1KQ1A 4FYWB 1KC8C 3NTIA 1M5Q1 2L0AA 2PNIA 2IIMA 4R56A 4XTYA 2FZGB 2O4XA 2HQEA 5IXBA 1JJ2S 3HRSA 3Q1JA 2P0QA 1LJOA 3ER0A 4M7AE 5CQXA 3UA7A 2KNBB 4A4GA 2O9VA 4D6WA 2BIVA 3CD6T 4XU2A 1OI1A 2EKHA 2DFUA 4E7JA 4O5VA 1IGQA 4LDXA 1M30A 1VQOQ 4ORZA 3OB9A 2E6ZA 2ZGWA 1U8RA 2YDLA 1QVFS 2JTMA 3RKWA 1M8VA 3PT9A 1UHCA 1Q86R 2NUPA 2EFIA 3VS4A 3OSSC 4BUGA 3DKMA 2M16A 3MEUA 2EYYA 1LVKA 3OYFA 3CCEQ 1BKBA 1Q82C 4RTZA 2NWMA 1WYXA 2EYWA 3SFMA 2OTLQ 3ME9A 4DBFA 1X2QA 2DXBA 4HCCA 4E7LA 1PG5B 4R55A 2PVOB 1OPLA 4PLIA 3VS3A 3A8MB 4FT2A 3JCMV 2BE9B 1YCSB 1Q7YC 2G3RA 2F1LA 5EG2A 1AOJA 4IUPA 2GTOA 1MNEA 1NG2A 2D8HA 4E7KA 3M0RA 4OP0A 5GAN7 5KYWB 2PTKA 5KYUB 2EKOA 3ZBDA 2DD5A 2LRQA 5D6WA 1VQLQ 4D8KA 4IKFA 2JT4A 4X9CA 2MAMA 3V7RA 8ATCB 4ESRA 2DL8A 1W6XA 4E47A 2VYTA 2L3SA 5IXFA 3CXCS 3BW1A 3R6NA 4AFZC 1I8FA 2MF2A 4RMOA 1UGVA 1ZQ1A 2CP7A 2RH2A 3JCMb 1VIEA 1SF9A 3LGLA 4FSSA 2JS2A 3JCMP 2DL4A 1U1SA 1AWXA 5A0DA 4DOWA 4M4ZA 4OF1A 4DEYA 3A8HB 2Z0WA 1W2BA 3PE0A 4J8OA 3OQ5A 2ABLA 4JZ4A 2LJ1A 2JN0A 3QDFA 5A0LA 2X35A 3JCMW 5GMKm 2Y4YA 3CCST 4D8DA 3CCRA 1JJ2P 1LOJA 4M78E 1KIKA 2K7AA 1G83A 5DM7R 2VUBA 3OYJA 2DYIA 2XDBA 5GAN5 5KYUA 2AK5A 4J9CA 1YWOA 3J81E 3CCJA 1FMKA 3JRZA 4KGZB 3KXTA 1NEGA 3A5ZB 4J9EA 5L23A 3AT1B 2K79A 3HPWA 2C06A 2VVKA 1N8RU 1WJRA 1I0CA 1UGPB 1GRIA 1MMGA 5HK0A 1K4US 3OYNA 4IUVA 3X24B 1WJQA 3CC2T 2COYA 1BI0A 3E9FA 5CAIA 3LH5A 3PNWC 2JTFA 2EQKA 4BY6C 1YJ9A 2EW3A 4PJOF 1UE9A 3CCRT 1SKUB 3QPHA 4PFPA 1KSWA 2C0IA 2R5AA 3TSZA 4X1VA 2K2MA 4PFOA 2VGNA 3EHRA 5KE3A 1G3SA 4HVWA 1GFCA 4RTUA 5GJWB 1X2KA 3NMZC 4KULA 2DBKA 3FLGA 3M56A 2CT4A 3WVEB 2HQXA 4JZ3A 4C8QF 4M77E 3RESA 4DBHA 1TXQA 1B07A 2EPDA 1RAGB 5GAOp 2EWNA 1JEGA 2DZCA 1T3SA 1FXXA 1N9RA 1M3BA 2KEAA 3NFCA 3RNJA 1NE8A 2JJ9A 1NLPC 3HRTA 3JCMJ 1WDXA 1GL5A 3OS1A 1Y0MA 1IO6A 1X6GA 2B8AA 3MEWA 2RJDA 3OS2A 2KBTA 4OMPA 1WQWA 2H3EB 1VYTA 1D3BB 3VS0A 2FO0A 1BI1A 3X26B 1KD1C 5LJ5g 5EC7A 2A3LA 2O4XB 1UB4A 2XD0A 3H41A 3CD6A 2YUQA 3CPFA 1G3YA 1BCMA 5AYFA 1IRXA 3NPFA 5HY6A 2DL5A 2K5LA 2ZPFB 4MZTA 4C8QC 2ECZA 1P92A 2ED0A 2OTJT 2DVJA 3VS1A 1QLYA 1I07A 4OGEA 3KFVA 2DXCA 1YCYA 3A8OB 2A28A 2QQ9A 4YTLA 3OYCA 2FPDA 4X34A 4CI0C 2H3JA 2DXUA 2O01E 3CCQA 2XG8D 3LYIA 2KQWA 4F14A 1NEBA 3TVTA 1WI7A 4A53A 3S3OA 4XQ3A 5FWCA 4BE2A 1VQ7A 4EPCA 2L3RA 2YRCA 4E7ZA 5D6XA 2RK1A 5J26A 1YP5A 2DTOA 1UGSB 4Y91A 1M3AA 4C5IA 3CCUA 3CCQQ 1JXOA 3M0SA 2I2LA 3CMAA 2EQMA 3WXMB 1SHGA 4LUDA 3OYIA 2RQWA 1Q81U 4M7DC 3L2WA 1RABB 3LLRA 2D6FA 5CKHA 3I55A 1PWTA 2HSEB 2EAYA 4OB3B 3DLMA 4DA4A 2RJFA 4QVCA 1D1AA 3JCMd 2VWFA 3REBB 1W70A 2FB7A 2L2PA 1YJWA 4IUQA 1K9MC 2E65A 4FM4B 2RM4A 5CKEA 3THKA 3UT1A 1K73U 3L2ZA 3SDZA 1VQKA 1X69A 3OYAA 3CC4T 4F7UE 4L59A 1Z9ZA 4P5NA 1RAEB 3UATA 3I9QA 3I56Q 2E10A 4CRIA 3LX7A 3EAEA 1Q95G 2E12A 1ARKA 2RMOA 1VQ8Q 3JCMg 2LQKA 2JOYA 1O75A 2LNHB 4F04B 4HCZA 1HD3A 2CUDA 1R0CB 3SEMA 4EMKA 4LUEA 2EGEA 1IXDA 2LJ0A 2XI9A 1BIAA 4OMOA 3QUIA 1TU0B 2ED1A 1H8KA 5LJ5h 1OX8A 2C0OA 2DL3A 1RLPC 2IVWA 2YLBA 5IHKA 1VQ8A 4BI3A 3OS0A 5DY9A 1GFDA 1PKSA 4RTYA 3FJ5A 1Q86U 3BDLA 3JCMf 2MOXA 1WPYA 2ZZDA 5GAOm 4C92D 1QVGA 3M55A 1NM7A 4LDYA 3ZL7C 5LJ5d 3G4SA 2QA4Q 1XNIA 4DBQA 1KC8U 1VQKQ 2WSCE 2Y4XA 3CC7A 3E19A 3HRUA 3DB3A 3VJPA 1M9SA 1VQNA 1BB9A 4KRTA 5LL6S 2QGFB 1PKTA 2WACA 5I2SA 1V76A 5GAMj 3NTHA 1UTIA 4XTVA 1Q81C 2OTLT 2BZ8A 1WHMA 4HT9A 1QCFA 5GMKh 5GAOl 2R58A 7AT1B 3TEEA 1WLPB 2RI2A 2NUZA 5FLXE 4BI4A 2DEQA 1QW1A 3EFOA 5CVIA 2AKLA 3X20B 1AWWA 2JS0A 1QP3A 2XKOC 4RG2A 4M7DD 5GAMe 1GXIE 2QXFA 3DB4A 4IUUA 1FYNA 1ZHIA 4RTVA 3GNGA 1EIFA 4HA8A 1AD5A 2KXCA 2ZCFB 4FT4A 4Z89A 3A98A 3FIFA 1YFNA 3M53A 1S72T 4EDUA 2OTLA 3I35A 1VQ4T 2VXFA 4DEXA 4LDVA 3NHNA 2NYSA 3QKJA 1K9AA 4OVAA 1U3OA 4ZTFA 1A0NB 2NUTA 3CCEA 2F2XA 3JB9J 3E9GA 4E7IA 4ZGJB 2M0YA 4L6V5 2PVGB 2BUDA 2E70A 1Q7YU 3SWNA 1QVGP 1BBZA 4BACA 2DTHA 4EMGA 1NJIC 1KQSS 3FJPA 2A36A 3SWNB 1JO8A 2D8JA 5HCKA 1SRLA 1TWBA 2CUBA 1QCNA 1PRLC 2XK0A 1AHJB 1OOTA 3CBMA 3OY9A 4KH1B 4KGXB 3CD6Q 4LN2A 2O31A 1VQOT 1TSFA 2LQWA 2YHTA 3P8HA 3OBYA 4HVUA 1YJ9T 4MMLA 1V1CA 1BI2A 1YITA 1VQ7T 1HSQA 2F69A 1VQMA 1S72A 1ZUYA 2JZ2A 2QTVA 3RR6A 4M75E 1YHQT 3RIRA 4C92E 2HBWA 3JB9F 1X6OA 4HT8A 1VQ8T 3RKXA 5CK9A 1GCPA 1SSHA 4C5GA 4M77D 5IT9E 3EFRA 3EGXB 1MV3A 3V8JA 1PSEA 3OYKA 4JS5A 1KFZA 2KT8A 3MP1A 1K1ZA 3UA6A 1VYUA 3OYLA 2D9TA 1HYOA 5CO7A 1WX6A 4IIOA 3CXCA 3MP8A 3MO8A 3NGPA 3QDRB 3CC2Q 1I5LA 5GMKj 2YUPA 2RQRA 3SHWA 1W1FA 3CC4A 1D0YA 2EBPA 3JCMe 2DETA 2LX7A 4L5GA 1ZA1B 2D0NA 5A2QE 2KDSA 2RA2A 1ZX6A 3L2QA 1G8XA 4M77G 1WGSA 3V8LA 1ZUUA 1Z9QA 2BTTA 3QYGB 2LX9A 3CCSA 1ABOA 5GANg 2RD1A 4N4IA 1PD0A 3VYGA 3JB9I 3M4GA 1YHQQ 4FL6A 2C0TA 5I11A 1K8AR 2DZ9A 1MMDA 2OTJA 3JCMc 1MHNA 1HXDA 4LDWA 2JW4A 4ZNXA 4XK8E 3KUFA 2K3YA 3JB9G 5GAN3 3MCAB 3MP6A 5CKDA 4JJDA 2E5KA 2DIGA 1AEYA 2F2WA 4PKCC 1X27A 1U5SA 4C5EA 2MMPA 1UGQB 2VGMA 2HBPA 2K3XA 1OEBA 2HKNA 5LJ3j 3EG1A 2DXTA 2RHUA 2QGGA 2VXEA 3FEOA 5LJ3h 3V7SA 2O88A 1SSFA 3RUXA 3CC4Q 4F7UA 4C92A 3G4SQ 2YLCA 2RNAA 3X28B 1M2OA 2J6FA 2E4HA 1YJWT 4C92B 2DLPA 2ZPHB 2RB6A 4IURA 2CH4W 3I56A 2FG0A 1VIFA 1AZGB 3EHQA 5GMKl 4M75D 2LCSA 1T3LA 1PC0A 2WSFE 3BFMA 3ZEHA 4ELZC 1CKBA 3CC7Q 3OSVA 2KROA 4C8QA 3TQ7P 2CS7A 3OW2P 3O8VA 4C0FA 4PL6A 1HJDA 3M0TA 1BCOA 2ATCB 4NL2A 3G6EA 2FYKA 2HZYA 2RHIA 3GPLA 2JNGA 9ATCB 1J3TA 3TREA 1NLOC 3RMQA 3M0QA 1VQ4A 4UC4A 4A4KA 4JRQA 1WZOA 5GJVB 4WF2A 1EZZB 2J6KA 3MJXA 1T0JA 2DYBA 2OI3A 3VUBA 5GMKe 2YRDA 1VQPQ 2EYXA 1PSFA 5GAN2 4M78G 2KMTA 4M77B 4JJBA 2CYZB 1KQSA 3CPWA 3VS6A 1RAHB 2KE9A 1XTDA 2PQWA 4PJOG 4OMQA 2X4JA 3LW5E 3TCJA 2AZSA 2CREA 2F5KA 5GAOq 1TUGB 3HHTB 3FB9A 2V1QA 3M57A 3I56T 2X4XA 3C0CA 4Y28E 2HCKA 1VQLA 2IG0A 1K73C 1X43A 2RJEA 3H0HA 3D7SB 2DA9A 4PJOC 3M5AA 1K9MR 3CCUQ 3X25B 4WCIA 1U06A 3JV3A 5KYYB 4JJCA 5FRMA 2DRMA 4KUDK 2CH4A 3H6ZA 3QSUA 4M7AC 4A4HA 2M0OA 2LQ8A 3U23A 1Y7XA 2YXYA 4C8QB 1VQ9T 1S72Q 3GIBA 3ULRB 1G3TA 2GFUA 3OYYA 1JU5C 3UF4A 5LJ3f 1VQ4Q 1MMNA 2L3QA 1TUCA 1ZA2B 3OYBA 4FSXA 4J9IA 5C6SA 2K5FA 1X6BA 1WA7A 1K76A 1TG0A 5FU7C 4C92F 5A0GA 2LP5A 4M75F 4C0GA 5KYNA 1RAAB 3ASKA 2MI6A 2JVVA 1MUZA 3CCMQ 1M8MA 4PK4A 4B9WA 1QP2A 2QTXA 4KT0E 2MPXC 1VQ6T 4M78F 1Y96A 3HTRA 1UUEA 1QVFP 1OU8A 3L2UA 2EQJA 1RAFB 2DF6A 3H0FA 3PMTA 1H92A 3G71A 5IHNA 5GMKi 5LJ5e 1X01A 3R6OA 2PVDB 2VASA 2FPFA 1M90R 2J06A 3SB2A 2MWPA 3BDUA 3QO3A 1B7TA 5HKCA 3OYEA 1UJ0A 4MZPA 4OMMA 3CMEQ 5GAOn 4AMCA 3CCJT 5I21A 1VA7A 3EH1A 1KQSP 4JS4A 3PGGA 4BY6B 2LVMA 2W10A 2CZ0B 4ZGDB 2BZXA 2CP2A 3FDRA 5L8RE 4BDZA 3L1AA 3EGXA 1OULA 2L3PA 5IH2A 4ELYC 3GOXA 1KQ2A 4BB7A 3J7AF 4M7DA 3QZ5B 4F7UF 1YITT 3M59A 2KI7A 4XTWA 2E1HA 3QWYA 1VQ5A 2CGHA 3CMEA 1D1CA 1E7OA 1N6AA 4PJJA 4MZMA 3QJYA 4PJOD 2GQVA 2OAWA 1SEMA 2PUOB 1GBRA 5J3BA 4EMHA 1M4ZA 3PIPA 2HL5C 3GF5A 5GAMf 1RI0A 4XTXA 4KBMB 1X75C 5AT1B 5D6YA 4II1A 4VUBA 3H8ZA 1D3BA 1SHFA 3SWNC 4XTUA 3CCMA 1VQLT 2KGTA 4AFUC 1IGUA 2KK4A
chains in the Genus database with same CATH topology
1RLQC 3EGUA 5FWBA 2A36A 2JT4A 3QWXX 1WFWA 1JO8A 2D8JA 1YNZA 2M51A 2YT6A 5HCKA 4ESRA 2FPEA 2DL8A 1SRLA 1ZLMA 2B86A 2CUBA 1W6XA 2SRCA 1PRLC 2L3SA 5IXFA 4K11A 1OOTA 3R6NA 1AWJA 4AFZC 4LN2A 1ZUKA 2O31A 1UGVA 2GGRA 2LQWA 2RPNA 4R0KA 2DJQA 4FSSA 2JS2A 2KRNA 2DL4A 1AWXA 4HVUA 4M4ZA 1T0HA 2MCNA 1ABQA 1V1CA 4DEYA 1M27C 1HSQA 1ZUYA 3PE0A 1K0SA 2EGAA 2JMAA 3VS2A 2HBWA 2ABLA 4JZ4A 2LQNA 2LJ1A 1MV0B 1ZSGA 1GCPA 1SSHA 2CSQA 1MV3A 4A63B 1WXBA 1OV3A 4OMNA 4LNPA 2GBQA 4OMLA 2KT8A 1KFZA 1K1ZA 3UA6A 4D8DA 1KIKA 1VYUA 2H8HA 2K7AA 1G83A 1UECA 2P4RA 1WX6A 4J9BA 4IIOA 3EG3A 2EYZA 2AK5A 4J9CA 1YWOA 3NGPA 1FMKA 1SRMA 3I5SA 2X3WD 1NEGA 2D1XA 4J9EA 5L23A 2K79A 4J9HA 2VVKA 4F16A 1WIEA 2YUPA 2DMOA 2RQRA 2A37A 3SHWA 1I0CA 2DRKA 4JPBW 1GRIA 1K4US 2X3XD 1W1FA 2EBPA 2LX7A 2D0NA 2ENMA 2YSQA 1VYVA 1G2BA 1ZX6A 3LH5A 1QWEA 1Y57A 1WXTA 2KT1A 1ZUUA 1Z9QA 2BTTA 2EW3A 4Z88A 1ABOA 1UE9A 4CC7A 4GBQA 3REAB 4AG2C 2F2VA 1KSWA 2C0IA 1ZBJA 2YUOA 3VS5A 3TSZA 2KR3A 4X1VA 2K2MA 5I22A 2C0TA 3EHRA 2RQUA 5I11A 4HCKA 2W0ZA 1GFCA 4HVWA 4RTUA 5GJWB 1UFFA 1X2KA 2YUNA 3NMZC 2DBKA 2CT4A 4JZ3A 4RTWA 4Y92A 3VS7A 2JW4A 4ZNXA 2EGCA 4GLMA 2VKNA 1E6HA 1B07A 1XOVA 2EPDA 1JEGA 1N5ZA 1T3SA 3M0UA 2KEAA 1M3BA 4F17A 3RNJA 4Z8AA 1NLPC 2JM9A 1E6GA 1WDXA 1GL5A 4JJDA 1Y0MA 2E5KA 1IO6A 1AEYA 2DBMA 2O2OA 4CC4B 2F2WA 1QKWA 1X27A 3PVQA 1U5SA 1X6GA 2KBTA 3TSWA 4OMPA 1OEBA 1VYTA 1PNJA 1WXUA 3EG1A 3VS0A 3VRZA 2FO0A 2JXBA 5EC7A 2O88A 1JQQA 1KJWA 4HXJA 3H41A 2V1RA 1YN8A 2YUQA 2RNAA 3NPFA 2A08A 2J6FA 3IQLA 1GBQA 2DL5A 2DLPA 2CH4W 2DX1A 2ECZA 2FG0A 1H3HA 4LE9A 1AZGB 1AVZC 2ED0A 3EHQA 2DVJA 3VS1A 1QLYA 1I07A 2GNCA 1M3CA 1CSKA 3M0PA 2LCSA 3KFVA 1T3LA 3H0IA 2G6FX 1CKBA 2A28A 2KROA 2FPDA 1B3QA 4IIMA 1AZEA 2RN8A 1EFNA 3I5RA 1HJDA 3M0TA 4CC2A 1UG1A 1UJYA 4F14A 1NEBA 1WI7A 3TVTA 2RF0A 5FWCA 2DL7A 1J3TA 1NLOC 2FEIA 1RUWA 3M0QA 1UDLA 2EQIA 5GJVB 1YP5A 2J6KA 1T0JA 4J9DA 2DYBA 1M3AA 2OI3A 1JXOA 4AG1C 2PZ1A 3M0SA 2K3BA 2EVRA 2EYXA 1QKXA 1SHGA 4LUDA 1YWPA 4JJBA 2RQWA 2DM1A 1PWTA 3VS6A 2KE9A 2I0NA 4OMQA 3EG0A 2CT3A 2AZSA 1GCQA 2CREA 2XMFA 2VWFA 4HVVA 3REBB 1W70A 2J7IA 2L2PA 1PRMC 3RBBB 2V1QA 2CDTA 2J6OA 4RUGA 2LZ6B 4RTTA 2KRMA 3C0CA 3THKA 4E6RA 4EIKA 2DILA 2HCKA 2KXDA 1X43A 1X69A 1TUDA 3H0HA 4J9GA 2O9SA 2DA9A 1RI9A 5ECAA 4WCIA 1NYGA 1U06A 2K6DA 1Z9ZA 3JV3A 1BK2A 3I9QA 3UATA 2BZYA 2GQIA 1AWOA 5FW9A 4JJCA 2DRMA 1ARKA 2ROLA 2RMOA 2OJ2A 2CH4A 2RQTA 1JXMA 1QWFA 2ESWA 1SPKA 2LNHB 2KYBA 1HD3A 2CUDA 3U23A 3SEMA 4QT7A 4LUEA 2EGEA 2LJ0A 4RTXA 2J05A 2JTEA 4OMOA 2JMCA 1GCQC 2FRYA 2ED1A 1S1NA 1H8KA 3ULRB 1LCKA 2C0OA 1JU5C 2DL3A 3EG2A 3CQTA 3UF4A 4AFSC 2HEQA 1RLPC 3VRYA 2HSPA 5IHKA 2L3QA 1TUCA 2HDAA 4J9IA 1OPKA 1X6BA 1WA7A 1GFDA 1PKSA 4RTYA 3FJ5A 1K76A 4CC3A 1TG0A 2DE0X 2LP5A 2MOXA 4AFQC 1NM7A 3ZL7C 2L0AA 2PNIA 2IIMA 1MUZA 2JM8A 1M8MA 2LMJA 5IXBA 1CKAA 1UUEA 1BU1A 1BB9A 4KRTA 2CSIA 1PKTA 4J9FA 2DF6A 3H0FA 3UA7A 1UTIA 2QDLA 1H92A 2KNBB 2O9VA 5IHNA 2BZ8A 2FPFA 2J06A 1QCFA 2DNUA 1UJ0A 2EKHA 4OMMA 1I1JA 1M30A 5IHIA 4ORZA 1WLPB 2NUZA 1VA7A 3GBQA 2SEMA 2YDLA 3O5ZA 2AKLA 1UHFA 1AWWA 2W10A 2JS0A 1UHCA 3VS4A 2BZXA 2AKKA 2EYYA 2L3PA 5IH2A 1FYNA 4RTZA 4RTVA 2NWMA 1WYXA 2EYWA 1AD5A 2ROTA 2KXCA 4Z89A 3A98A 1X2QA 3I35A 3QWYA 4DEXA 1E7OA 2GTJA 3NHNA 2LJ3A 1K9AA 2FRWA 1U3OA 1A0NB 1OPLA 2AZVA 2OAWA 2KYMA 1SEMA 1GBRA 2F2XA 3VS3A 1K0XA 1YCSB 2M0YA 3PVLA 2K9GA 1AOJA 2GTOA 1PHTA 1NG2A 2D8HA 2RQVA 3M0RA 1BBZA 2PTKA 2MIOA 1SHFA 2KRSA 2KGTA 4AFUC 1NYFA 4D8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLQ C;  3EGU A;  5FWB A;  2A36 A;  2JT4 A;  3QWX X;  1WFW A;  1JO8 A;  2D8J A;  1YNZ A;  2M51 A;  2YT6 A;  5HCK A;  4ESR A;  2FPE A;  2DL8 A;  1SRL A;  1ZLM A;  2B86 A;  2CUB A;  1W6X A;  2SRC A;  1PRL C;  2L3S A;  5IXF A;  4K11 A;  1OOT A;  3R6N A;  1AWJ A;  4AFZ C;  4LN2 A;  1ZUK A;  2O31 A;  1UGV A;  2GGR A;  2LQW A;  2RPN A;  4R0K A;  2DJQ A;  4FSS A;  2JS2 A;  2KRN A;  2DL4 A;  1AWX A;  4HVU A;  4M4Z A;  1T0H A;  2MCN A;  1ABQ A;  1V1C A;  4DEY A;  1M27 C;  1HSQ A;  1ZUY A;  3PE0 A;  1K0S A;  2EGA A;  2JMA A;  3VS2 A;  2HBW A;  2ABL A;  4JZ4 A;  2LQN A;  2LJ1 A;  1MV0 B;  1ZSG A;  1GCP A;  1SSH A;  2CSQ A;  1MV3 A;  4A63 B;  1WXB A;  1OV3 A;  4OMN A;  4LNP A;  2GBQ A;  4OML A;  2KT8 A;  1KFZ A;  1K1Z A;  3UA6 A;  4D8D A;  1KIK A;  1VYU A;  2H8H A;  2K7A A;  1G83 A;  1UEC A;  2P4R A;  1WX6 A;  4J9B A;  4IIO A;  3EG3 A;  2EYZ A;  2AK5 A;  4J9C A;  1YWO A;  3NGP A;  1FMK A;  1SRM A;  3I5S A;  2X3W D;  1NEG A;  2D1X A;  4J9E A;  5L23 A;  2K79 A;  4J9H A;  2VVK A;  4F16 A;  1WIE A;  2YUP A;  2DMO A;  2RQR A;  2A37 A;  3SHW A;  1I0C A;  2DRK A;  4JPB W;  1GRI A;  1K4U S;  2X3X D;  1W1F A;  2EBP A;  2LX7 A;  2D0N A;  2ENM A;  2YSQ A;  1VYV A;  1G2B A;  1ZX6 A;  3LH5 A;  1QWE A;  1Y57 A;  1WXT A;  2KT1 A;  1ZUU A;  1Z9Q A;  2BTT A;  2EW3 A;  4Z88 A;  1ABO A;  1UE9 A;  4CC7 A;  4GBQ A;  3REA B;  4AG2 C;  2F2V A;  1KSW A;  2C0I A;  1ZBJ A;  2YUO A;  3VS5 A;  3TSZ A;  2KR3 A;  4X1V A;  2K2M A;  5I22 A;  2C0T A;  3EHR A;  2RQU A;  5I11 A;  4HCK A;  2W0Z A;  1GFC A;  4HVW A;  4RTU A;  5GJW B;  1UFF A;  1X2K A;  2YUN A;  3NMZ C;  2DBK A;  2CT4 A;  4JZ3 A;  4RTW A;  4Y92 A;  3VS7 A;  2JW4 A;  4ZNX A;  2EGC A;  4GLM A;  2VKN A;  1E6H A;  1B07 A;  1XOV A;  2EPD A;  1JEG A;  1N5Z A;  1T3S A;  3M0U A;  2KEA A;  1M3B A;  4F17 A;  3RNJ A;  4Z8A A;  1NLP C;  2JM9 A;  1E6G A;  1WDX A;  1GL5 A;  4JJD A;  1Y0M A;  2E5K A;  1IO6 A;  1AEY A;  2DBM A;  2O2O A;  4CC4 B;  2F2W A;  1QKW A;  1X27 A;  3PVQ A;  1U5S A;  1X6G A;  2KBT A;  3TSW A;  4OMP A;  1OEB A;  1VYT A;  1PNJ A;  1WXU A;  3EG1 A;  3VS0 A;  3VRZ A;  2FO0 A;  2JXB A;  5EC7 A;  2O88 A;  1JQQ A;  1KJW A;  4HXJ A;  3H41 A;  2V1R A;  1YN8 A;  2YUQ A;  2RNA A;  3NPF A;  2A08 A;  2J6F A;  3IQL A;  1GBQ A;  2DL5 A;  2DLP A;  2CH4 W;  2DX1 A;  2ECZ A;  2FG0 A;  1H3H A;  4LE9 A;  1AZG B;  1AVZ C;  2ED0 A;  3EHQ A;  2DVJ A;  3VS1 A;  1QLY A;  1I07 A;  2GNC A;  1M3C A;  1CSK A;  3M0P A;  2LCS A;  3KFV A;  1T3L A;  3H0I A;  2G6F X;  1CKB A;  2A28 A;  2KRO A;  2FPD A;  1B3Q A;  4IIM A;  1AZE A;  2RN8 A;  1EFN A;  3I5R A;  1HJD A;  3M0T A;  4CC2 A;  1UG1 A;  1UJY A;  4F14 A;  1NEB A;  1WI7 A;  3TVT A;  2RF0 A;  5FWC A;  2DL7 A;  1J3T A;  1NLO C;  2FEI A;  1RUW A;  3M0Q A;  1UDL A;  2EQI A;  5GJV B;  1YP5 A;  2J6K A;  1T0J A;  4J9D A;  2DYB A;  1M3A A;  2OI3 A;  1JXO A;  4AG1 C;  2PZ1 A;  3M0S A;  2K3B A;  2EVR A;  2EYX A;  1QKX A;  1SHG A;  4LUD A;  1YWP A;  4JJB A;  2RQW A;  2DM1 A;  1PWT A;  3VS6 A;  2KE9 A;  2I0N A;  4OMQ A;  3EG0 A;  2CT3 A;  2AZS A;  1GCQ A;  2CRE A;  2XMF A;  2VWF A;  4HVV A;  3REB B;  1W70 A;  2J7I A;  2L2P A;  1PRM C;  3RBB B;  2V1Q A;  2CDT A;  2J6O A;  4RUG A;  2LZ6 B;  4RTT A;  2KRM A;  3C0C A;  3THK A;  4E6R A;  4EIK A;  2DIL A;  2HCK A;  2KXD A;  1X43 A;  1X69 A;  1TUD A;  3H0H A;  4J9G A;  2O9S A;  2DA9 A;  1RI9 A;  5ECA A;  4WCI A;  1NYG A;  1U06 A;  2K6D A;  1Z9Z A;  3JV3 A;  1BK2 A;  3I9Q A;  3UAT A;  2BZY A;  2GQI A;  1AWO A;  5FW9 A;  4JJC A;  2DRM A;  1ARK A;  2ROL A;  2RMO A;  2OJ2 A;  2CH4 A;  2RQT A;  1JXM A;  1QWF A;  2ESW A;  1SPK A;  2LNH B;  2KYB A;  1HD3 A;  2CUD A;  3U23 A;  3SEM A;  4QT7 A;  4LUE A;  2EGE A;  2LJ0 A;  4RTX A;  2J05 A;  2JTE A;  4OMO A;  2JMC A;  1GCQ C;  2FRY A;  2ED1 A;  1S1N A;  1H8K A;  3ULR B;  1LCK A;  2C0O A;  1JU5 C;  2DL3 A;  3EG2 A;  3CQT A;  3UF4 A;  4AFS C;  2HEQ A;  1RLP C;  3VRY A;  2HSP A;  5IHK A;  2L3Q A;  1TUC A;  2HDA A;  4J9I A;  1OPK A;  1X6B A;  1WA7 A;  1GFD A;  1PKS A;  4RTY A;  3FJ5 A;  1K76 A;  4CC3 A;  1TG0 A;  2DE0 X;  2LP5 A;  2MOX A;  4AFQ C;  1NM7 A;  3ZL7 C;  2L0A A;  2PNI A;  2IIM A;  1MUZ A;  2JM8 A;  1M8M A;  2LMJ A;  5IXB A;  1CKA A;  1UUE A;  1BU1 A;  1BB9 A;  4KRT A;  2CSI A;  1PKT A;  4J9F A;  2DF6 A;  3H0F A;  3UA7 A;  1UTI A;  2QDL A;  1H92 A;  2KNB B;  2O9V A;  5IHN A;  2BZ8 A;  2FPF A;  2J06 A;  1QCF A;  2DNU A;  1UJ0 A;  2EKH A;  4OMM A;  1I1J A;  1M30 A;  5IHI A;  4ORZ A;  1WLP B;  2NUZ A;  1VA7 A;  3GBQ A;  2SEM A;  2YDL A;  3O5Z A;  2AKL A;  1UHF A;  1AWW A;  2W10 A;  2JS0 A;  1UHC A;  3VS4 A;  2BZX A;  2AKK A;  2EYY A;  2L3P A;  5IH2 A;  1FYN A;  4RTZ A;  4RTV A;  2NWM A;  1WYX A;  2EYW A;  1AD5 A;  2ROT A;  2KXC A;  4Z89 A;  3A98 A;  1X2Q A;  3I35 A;  3QWY A;  4DEX A;  1E7O A;  2GTJ A;  3NHN A;  2LJ3 A;  1K9A A;  2FRW A;  1U3O A;  1A0N B;  1OPL A;  2AZV A;  2OAW A;  2KYM A;  1SEM A;  1GBR A;  2F2X A;  3VS3 A;  1K0X A;  1YCS B;  2M0Y A;  3PVL A;  2K9G A;  1AOJ A;  2GTO A;  1PHT A;  1NG2 A;  2D8H A;  2RQV A;  3M0R A;  1BBZ A;  2PTK A;  2MIO A;  1SHF A;  2KRS A;  2KGT A;  4AFU C;  1NYF A;  4D8K A; 
#chains in the Genus database with same CATH topology
 2MK5 A;  5FWB A;  4M7D G;  2QA4 A;  3QWX X;  2DVE A;  2YT6 A;  2FPE A;  4PJO B;  1MMA A;  4C5H A;  1U1T A;  1VQ7 Q;  1C6V X;  4FYV B;  1FMV A;  2QDY B;  1KHI A;  3JB9 H;  1YI2 Q;  2GGR A;  2RPN A;  2DJQ A;  3VYH B;  2DD4 A;  2KRN A;  3E2U A;  2VC8 A;  2KY9 A;  2MCN A;  4QVD A;  1M1K R;  1H64 1;  2QK0 A;  4ZTJ A;  3LH0 A;  3EG9 A;  2RI5 A;  1YIJ A;  2OX7 A;  3VS2 A;  2RK2 A;  3OS5 A;  4LXC A;  2HKQ B;  5FRN A;  4M77 C;  2M9U A;  2E5Q A;  1ZSG A;  4QVZ A;  2CSQ A;  1OV3 A;  8AT1 B;  4OMN A;  3UDC A;  1Q82 U;  3QII A;  4OML A;  2GBQ A;  3CC2 A;  4M7A F;  3QJ6 A;  5DLO A;  2A0F B;  3A1P A;  3MET A;  5KH6 A;  4F7U G;  3CPW P;  2DK3 A;  4N4G A;  3GNF B;  1UEC A;  2P4R A;  2LT4 A;  2P84 A;  4J9B A;  2LC4 A;  2XHC A;  4DBR A;  4OB0 B;  4QQD A;  3OW2 S;  4JRK A;  3I5S A;  2X3W D;  5FU7 B;  4ZN3 A;  2D1X A;  4N4H A;  5CKB A;  1YJW Q;  4J9H A;  3LWH A;  4F16 A;  1WIE A;  2DMO A;  4DQ2 A;  3OBW A;  2DRK A;  4JRP A;  2X3X D;  3HL8 A;  3G71 T;  3BE3 A;  3C95 A;  5M9O A;  3VKI A;  4A54 A;  5KYY A;  5GAN f;  2ENM A;  3RMS A;  2YSQ A;  1V29 B;  1G2B A;  2XID A;  4M77 F;  1YIT Q;  1QWE A;  5GAN e;  4V2S A;  2EQU A;  1WXT A;  4MDX A;  1WQ7 A;  3JCM X;  5LJ3 e;  4M7D F;  1NPP A;  3CCL T;  4J6Y A;  4M75 A;  4CC7 A;  3REA B;  3CXC P;  4AG2 C;  3H9N A;  2F2V A;  6AT1 B;  4N0A C;  1C0M A;  4M78 C;  1FMW A;  3G7Z A;  1IHW A;  1ACM B;  4FW2 A;  4LDU A;  3UPU A;  3T9N A;  5KCO A;  3CME T;  1YJN Q;  1SG5 A;  1UFF A;  4BE1 A;  1YJ9 Q;  4PJO E;  2QEX T;  3M54 A;  2VV5 A;  1XQH A;  2RO0 A;  4M77 A;  1IRE B;  2X51 A;  2YRV A;  3M0U A;  1EX4 A;  5KCH A;  3CCE T;  2JM9 A;  1E6G A;  3BY7 A;  1TOV A;  4PNO A;  3EFS A;  2O2O A;  4CC4 B;  1QKW A;  3WVD B;  1VUB A;  5GAO r;  1W2B S;  4M7A G;  2HD0 A;  1VQ5 Q;  1PNJ A;  4FYX B;  2LCC A;  4M78 A;  4F7U B;  2RHY A;  4NL3 A;  4B9X A;  1VQP A;  2L89 A;  1VQO A;  1KG1 A;  1JQQ A;  3CMA T;  3M4Y A;  2X4Y A;  2QEX A;  1ZSZ A;  4JLG A;  1YN8 A;  4NS5 A;  1FX7 A;  1F1B B;  4RCB A;  2K57 A;  2E64 A;  3IQL A;  1BI3 A;  3MHX A;  3OMC A;  2CZ7 B;  3CCJ Q;  2XU8 A;  1VQN Q;  2IPO B;  4FIB A;  1CSK A;  3M0P A;  2CP5 A;  4J6X A;  2BE7 D;  1Q82 R;  1M90 U;  2G6F X;  2XIC A;  3P8B B;  2FHD A;  1NBE B;  5FU6 B;  1AZE A;  2RN8 A;  1EFN A;  3CCV Q;  1D0Z A;  1UJY A;  2JUF A;  1YHQ A;  2RF0 A;  2NUP B;  1RAD B;  1RL2 A;  1RAC B;  1JRI A;  2QQR A;  2FEI A;  5CQY A;  1UDL A;  1VQ5 T;  3GLX A;  4QKU A;  1YBY A;  1ZSZ B;  1QCO A;  3GP8 A;  3EFO B;  4AG1 C;  4C8Q E;  2K3B A;  5J39 A;  1YJN A;  2DM1 A;  3OMG A;  3JSC A;  4M7A A;  4M78 B;  4LD9 K;  5DLQ E;  5KE2 A;  1WJS A;  2CT3 A;  2LCL A;  2XMF A;  4TVR A;  2J7I A;  3MPU B;  4J7F A;  1QVP A;  4X9D A;  2CDT A;  2J6O A;  3I55 Q;  2LZ6 B;  2PU9 B;  4RTT A;  5CIU A;  3CCS Q;  1TS9 A;  1D1B A;  2LDM A;  4EIK A;  2DIL A;  1N27 A;  2AT1 B;  1R0B G;  1D09 B;  2EIF A;  2V26 A;  2KXD A;  4RCC A;  1WHG A;  1RI9 A;  3PIO A;  5ECA A;  2ZPB B;  2F5T X;  2GQI A;  1PCX A;  2DO3 A;  3CCL A;  4QW2 A;  1AWO A;  5FW9 A;  3JCM Q;  3F70 A;  2R5M A;  3EH2 A;  4JJN K;  1H3Z A;  2ROL A;  2V8K A;  1JXM A;  5GAN 4;  1QWF A;  2ESW A;  1SPK A;  3RER A;  4PJL A;  4QT7 A;  5GAN d;  3CC7 T;  1UEB A;  3JAM E;  1GCQ C;  2E3H A;  2HMA A;  1N8R C;  3EG2 A;  1YI2 T;  4AFS C;  2HEQ A;  3HP9 A;  5KYX B;  2DER A;  2X4W A;  1M90 C;  2HDA A;  2QQA A;  1VQ6 Q;  1IB8 A;  5FU6 C;  3N5B B;  1QVG S;  1I5O B;  2DE0 X;  2VB6 A;  3C12 A;  4AFQ C;  2CP3 A;  1VQK T;  4PJN A;  2JM8 A;  1I81 A;  2E3I A;  5FRO A;  2LMJ A;  2GFA A;  4KH0 B;  1CKA A;  5GAM g;  4PJM A;  2FZK B;  4EMK C;  1BU1 A;  1DJ7 B;  4J7I A;  2CSI A;  4J9F A;  3QHS A;  3EGD B;  4BE0 A;  2QDL A;  3VU3 C;  4RG8 A;  3JCM h;  5GAN 6;  4ZGE B;  2BKD N;  2CZ1 B;  2DNU A;  1OQK A;  4M7D B;  1I1J A;  3M58 A;  5IHI A;  1VQM Q;  3V7C A;  3CMA Q;  1XJW B;  2RHZ A;  3GBQ A;  4RKU E;  2SEM A;  2QYZ A;  3O5Z A;  4GLK A;  3CCM T;  4AT1 B;  2X9H A;  1NZ9 A;  3CCU T;  1OZ3 A;  2L8D A;  1UHF A;  2ZPI B;  5LJ5 j;  3C4S A;  1B34 A;  3L2R A;  2AKK A;  3CCL Q;  3G6E Q;  4BD3 A;  1W4S A;  3HKS A;  2CP0 A;  3RKY A;  1B34 B;  2M1H A;  2EJG A;  1KD1 U;  2ROT A;  4E7S A;  3A8L B;  3EG9 B;  4Q5W A;  2QG9 B;  2GTJ A;  2P4T A;  2FZC B;  4BI8 B;  2LJ3 A;  2FRW A;  2KYM A;  2AZV A;  1KD1 R;  1NJI R;  1K0X A;  2K4Y A;  3CEY A;  3VV0 A;  3E1S A;  4FCY A;  4LD6 A;  3M9Q A;  4M75 B;  2A7Y A;  3PVL A;  1Q86 C;  2K9G A;  1PHT A;  2RQV A;  4PJO A;  4C8Q G;  1WHL A;  3SD4 A;  1R8O B;  2MIO A;  3V8K A;  2KRS A;  5LJ3 d;  2P0P A;  2PUK B;  4XAX B;  1G5V A;  5GAM h;  1NYF A;  1YIJ T;  2E41 A;  2RHX A;  1RLQ C;  3EGU A;  1M1K U;  1WFW A;  2M51 A;  1YNZ A;  1I4K 1;  1ZLM A;  3HSB A;  5GAN h;  2B86 A;  2SRC A;  4ATO A;  4K11 A;  3INZ A;  2KVQ G;  5LJ5 f;  4A4E A;  1ZSZ C;  1AWJ A;  4C92 G;  1ZUK A;  3J80 E;  1Q7Y R;  4ME7 A;  4R0K A;  4OMF B;  3OYH A;  4C0Z A;  1T0H A;  3QZ9 B;  1ABQ A;  1M27 C;  3G4S T;  1K0S A;  3QBY A;  4B6M A;  2EGA A;  2JMA A;  1YI2 A;  4IUT A;  1K9M U;  3P8D A;  2LQN A;  3AHU A;  1RAI B;  3QXE B;  1MV0 B;  1WHJ A;  2RI3 A;  1AT1 B;  1TTH B;  1BYM A;  4A63 B;  1WXB A;  2MWO A;  3OA6 A;  1WHK A;  4BDY A;  4LNP A;  4C92 C;  1WNL A;  4M75 C;  2EYQ A;  4OB2 B;  4PFZ A;  4J83 A;  3JB9 D;  2DAQ A;  2H8H A;  1M1F A;  1M2V A;  2L5Q A;  1PM3 A;  3EG3 A;  3UWN A;  2EYZ A;  1VQM T;  1OZ2 A;  3A8G B;  1SRM A;  2XDP A;  3MEV A;  4OB1 B;  1WHH A;  1HK9 A;  1YJN T;  1UGR B;  2A37 A;  1KHC A;  4JPB W;  1VQN T;  4M75 G;  4QQ6 A;  2QEX Q;  3S3M A;  2RJC A;  1VQP T;  1VYV A;  4KGV B;  5IAY A;  3OW2 A;  2Y90 A;  5I2M A;  1Y57 A;  2NUT B;  1OU9 A;  2KT1 A;  4HKE A;  4Z88 A;  2K2V A;  4XTZ A;  5KYX A;  4GBQ A;  4FYY B;  2M02 A;  3L42 A;  5D7U A;  5C0M A;  1ZBJ A;  2YUO A;  2YWW A;  3VS5 A;  1M1K C;  2KR3 A;  2AHJ B;  5I22 A;  1M2V B;  1MND A;  2AIR B;  2RQU A;  1PD1 A;  2MYS A;  4HCK A;  4NOY A;  2W0Z A;  2QAS A;  2YUN A;  2HL3 A;  1JJ2 A;  1N9S A;  4C0D B;  1VOM A;  4RTW A;  4Y92 A;  3VS7 A;  2QAZ A;  3CBO A;  2EGC A;  4O6J A;  4GLM A;  2VKN A;  2HAX A;  1Y71 A;  1JB0 E;  3HFO A;  1Y07 A;  1E6H A;  1MGQ A;  1XOV A;  2QQB A;  5CR2 A;  1N5Z A;  2XDD A;  4F17 A;  4Z8A A;  3PFS A;  4XU0 A;  3G6E T;  4FW1 A;  4M78 D;  2QA4 T;  1QQJ A;  2FVU A;  2DBM A;  4A4F A;  3PVQ A;  3TU4 K;  1W2B P;  1FWZ A;  3PMI A;  3TSW A;  1Q81 R;  1QVF A;  3LGF A;  1OYX A;  3EGD A;  5HK3 A;  1WXU A;  3VRZ A;  2DJZ A;  2DKG A;  2JXB A;  5GAN j;  2LNV A;  3S3N A;  2LTO A;  1KJW A;  1M1G A;  4HXJ A;  2GCX A;  4KUI A;  2COW A;  2V1R A;  1G3W A;  1NPR A;  3OYD A;  3FC3 A;  2DPP B;  3G1J A;  5KYW A;  2KSS A;  3OYG A;  3ZFJ A;  2A08 A;  4M7A B;  1GBQ A;  1K73 R;  3QYH B;  4J6W A;  2R57 A;  2OAU A;  3KBG A;  2DX1 A;  1R77 A;  2P0K A;  1BIB A;  4MDW A;  1H3H A;  1VQ6 A;  2EJF A;  4LE9 A;  1LNX A;  4C0D C;  1AVZ C;  4M7A D;  2E6N A;  2GNC A;  1M3C A;  3L2V A;  3H0I A;  3RDV A;  1IHV A;  3PTA A;  3CPW S;  1KC8 R;  5IN1 A;  1B3Q A;  2V8J A;  2ZPG B;  3LWI A;  4IIM A;  3OYM A;  3I5R A;  1K8A C;  2QQS A;  4CC2 A;  1UG1 A;  4ANJ A;  3S6W A;  2DL7 A;  4QQG A;  4JRI A;  2HNI A;  4FU6 A;  2D0Q B;  2FL7 A;  2V8I A;  2WSE E;  4JDS A;  2QI2 A;  1RUW A;  2EQI A;  5GAM d;  3HFN A;  1NJI U;  3CCV T;  4J9D A;  4HCB A;  1C1A A;  2DEU A;  2PZ1 A;  3VUZ A;  4Z02 A;  4ZN1 A;  2EVR A;  1QKX A;  2OTJ Q;  4XU3 A;  1YWP A;  1VQ9 Q;  2CKK A;  1Y96 B;  2EJ9 A;  2I0N A;  1D0X A;  3EG0 A;  3QG1 A;  4E2F B;  3G71 Q;  1QMC A;  1TH7 A;  1GCQ A;  4HVV A;  2CP6 A;  1PRM C;  2LT1 A;  3RBB B;  3NTK A;  4RUG A;  2ZPE B;  2KRM A;  1ZBX A;  1YIJ Q;  1VQ9 A;  4E6R A;  4JLI A;  1N8R R;  4WTO B;  1JBM A;  3CCR Q;  3CCQ T;  1IZ6 A;  1TUD A;  4J9G A;  2O9S A;  5CKF A;  4E7H A;  4N0A A;  1NYG A;  2K6D A;  1BK2 A;  4MMK A;  2GF7 A;  2BZY A;  3I55 T;  1OX9 A;  3DLL A;  5GAN 8;  3URG A;  2OJ2 A;  2RQT A;  2COZ A;  2NLU A;  2KYB A;  2DTI A;  2KAF A;  1KK7 A;  2HQH A;  3MEA A;  4M7D E;  3CCV A;  4RTX A;  5CCA A;  2J05 A;  2JTE A;  2JMC A;  2ZAE A;  4EMK B;  2CZ6 B;  1S1N A;  2FRY A;  4OGC A;  5LJ3 g;  4PLL A;  4J5Y A;  1LCK A;  2DIQ A;  3CQT A;  1LPL A;  4JUV A;  4GY5 A;  1O9S A;  3VRY A;  2HSP A;  3FRN A;  1OPK A;  4C8Q D;  4DOV A;  4CC3 A;  3CBP A;  1K8A U;  3C94 A;  2K5I A;  4XU1 A;  3MKD A;  1KQ1 A;  4FYW B;  1KC8 C;  3NTI A;  1M5Q 1;  2L0A A;  2PNI A;  2IIM A;  4R56 A;  4XTY A;  2FZG B;  2O4X A;  2HQE A;  5IXB A;  1JJ2 S;  3HRS A;  3Q1J A;  2P0Q A;  1LJO A;  3ER0 A;  4M7A E;  5CQX A;  3UA7 A;  2KNB B;  4A4G A;  2O9V A;  4D6W A;  2BIV A;  3CD6 T;  4XU2 A;  1OI1 A;  2EKH A;  2DFU A;  4E7J A;  4O5V A;  1IGQ A;  4LDX A;  1M30 A;  1VQO Q;  4ORZ A;  3OB9 A;  2E6Z A;  2ZGW A;  1U8R A;  2YDL A;  1QVF S;  2JTM A;  3RKW A;  1M8V A;  3PT9 A;  1UHC A;  1Q86 R;  2NUP A;  2EFI A;  3VS4 A;  3OSS C;  4BUG A;  3DKM A;  2M16 A;  3MEU A;  2EYY A;  1LVK A;  3OYF A;  3CCE Q;  1BKB A;  1Q82 C;  4RTZ A;  2NWM A;  1WYX A;  2EYW A;  3SFM A;  2OTL Q;  3ME9 A;  4DBF A;  1X2Q A;  2DXB A;  4HCC A;  4E7L A;  1PG5 B;  4R55 A;  2PVO B;  1OPL A;  4PLI A;  3VS3 A;  3A8M B;  4FT2 A;  3JCM V;  2BE9 B;  1YCS B;  1Q7Y C;  2G3R A;  2F1L A;  5EG2 A;  1AOJ A;  4IUP A;  2GTO A;  1MNE A;  1NG2 A;  2D8H A;  4E7K A;  3M0R A;  4OP0 A;  5GAN 7;  5KYW B;  2PTK A;  5KYU B;  2EKO A;  3ZBD A;  2DD5 A;  2LRQ A;  5D6W A;  1VQL Q;  4D8K A;  4IKF A;  2JT4 A;  4X9C A;  2MAM A;  3V7R A;  8ATC B;  4ESR A;  2DL8 A;  1W6X A;  4E47 A;  2VYT A;  2L3S A;  5IXF A;  3CXC S;  3BW1 A;  3R6N A;  4AFZ C;  1I8F A;  2MF2 A;  4RMO A;  1UGV A;  1ZQ1 A;  2CP7 A;  2RH2 A;  3JCM b;  1VIE A;  1SF9 A;  3LGL A;  4FSS A;  2JS2 A;  3JCM P;  2DL4 A;  1U1S A;  1AWX A;  5A0D A;  4DOW A;  4M4Z A;  4OF1 A;  4DEY A;  3A8H B;  2Z0W A;  1W2B A;  3PE0 A;  4J8O A;  3OQ5 A;  2ABL A;  4JZ4 A;  2LJ1 A;  2JN0 A;  3QDF A;  5A0L A;  2X35 A;  3JCM W;  5GMK m;  2Y4Y A;  3CCS T;  4D8D A;  3CCR A;  1JJ2 P;  1LOJ A;  4M78 E;  1KIK A;  2K7A A;  1G83 A;  5DM7 R;  2VUB A;  3OYJ A;  2DYI A;  2XDB A;  5GAN 5;  5KYU A;  2AK5 A;  4J9C A;  1YWO A;  3J81 E;  3CCJ A;  1FMK A;  3JRZ A;  4KGZ B;  3KXT A;  1NEG A;  3A5Z B;  4J9E A;  5L23 A;  3AT1 B;  2K79 A;  3HPW A;  2C06 A;  2VVK A;  1N8R U;  1WJR A;  1I0C A;  1UGP B;  1GRI A;  1MMG A;  5HK0 A;  1K4U S;  3OYN A;  4IUV A;  3X24 B;  1WJQ A;  3CC2 T;  2COY A;  1BI0 A;  3E9F A;  5CAI A;  3LH5 A;  3PNW C;  2JTF A;  2EQK A;  4BY6 C;  1YJ9 A;  2EW3 A;  4PJO F;  1UE9 A;  3CCR T;  1SKU B;  3QPH A;  4PFP A;  1KSW A;  2C0I A;  2R5A A;  3TSZ A;  4X1V A;  2K2M A;  4PFO A;  2VGN A;  3EHR A;  5KE3 A;  1G3S A;  4HVW A;  1GFC A;  4RTU A;  5GJW B;  1X2K A;  3NMZ C;  4KUL A;  2DBK A;  3FLG A;  3M56 A;  2CT4 A;  3WVE B;  2HQX A;  4JZ3 A;  4C8Q F;  4M77 E;  3RES A;  4DBH A;  1TXQ A;  1B07 A;  2EPD A;  1RAG B;  5GAO p;  2EWN A;  1JEG A;  2DZC A;  1T3S A;  1FXX A;  1N9R A;  1M3B A;  2KEA A;  3NFC A;  3RNJ A;  1NE8 A;  2JJ9 A;  1NLP C;  3HRT A;  3JCM J;  1WDX A;  1GL5 A;  3OS1 A;  1Y0M A;  1IO6 A;  1X6G A;  2B8A A;  3MEW A;  2RJD A;  3OS2 A;  2KBT A;  4OMP A;  1WQW A;  2H3E B;  1VYT A;  1D3B B;  3VS0 A;  2FO0 A;  1BI1 A;  3X26 B;  1KD1 C;  5LJ5 g;  5EC7 A;  2A3L A;  2O4X B;  1UB4 A;  2XD0 A;  3H41 A;  3CD6 A;  2YUQ A;  3CPF A;  1G3Y A;  1BCM A;  5AYF A;  1IRX A;  3NPF A;  5HY6 A;  2DL5 A;  2K5L A;  2ZPF B;  4MZT A;  4C8Q C;  2ECZ A;  1P92 A;  2ED0 A;  2OTJ T;  2DVJ A;  3VS1 A;  1QLY A;  1I07 A;  4OGE A;  3KFV A;  2DXC A;  1YCY A;  3A8O B;  2A28 A;  2QQ9 A;  4YTL A;  3OYC A;  2FPD A;  4X34 A;  4CI0 C;  2H3J A;  2DXU A;  2O01 E;  3CCQ A;  2XG8 D;  3LYI A;  2KQW A;  4F14 A;  1NEB A;  3TVT A;  1WI7 A;  4A53 A;  3S3O A;  4XQ3 A;  5FWC A;  4BE2 A;  1VQ7 A;  4EPC A;  2L3R A;  2YRC A;  4E7Z A;  5D6X A;  2RK1 A;  5J26 A;  1YP5 A;  2DTO A;  1UGS B;  4Y91 A;  1M3A A;  4C5I A;  3CCU A;  3CCQ Q;  1JXO A;  3M0S A;  2I2L A;  3CMA A;  2EQM A;  3WXM B;  1SHG A;  4LUD A;  3OYI A;  2RQW A;  1Q81 U;  4M7D C;  3L2W A;  1RAB B;  3LLR A;  2D6F A;  5CKH A;  3I55 A;  1PWT A;  2HSE B;  2EAY A;  4OB3 B;  3DLM A;  4DA4 A;  2RJF A;  4QVC A;  1D1A A;  3JCM d;  2VWF A;  3REB B;  1W70 A;  2FB7 A;  2L2P A;  1YJW A;  4IUQ A;  1K9M C;  2E65 A;  4FM4 B;  2RM4 A;  5CKE A;  3THK A;  3UT1 A;  1K73 U;  3L2Z A;  3SDZ A;  1VQK A;  1X69 A;  3OYA A;  3CC4 T;  4F7U E;  4L59 A;  1Z9Z A;  4P5N A;  1RAE B;  3UAT A;  3I9Q A;  3I56 Q;  2E10 A;  4CRI A;  3LX7 A;  3EAE A;  1Q95 G;  2E12 A;  1ARK A;  2RMO A;  1VQ8 Q;  3JCM g;  2LQK A;  2JOY A;  1O75 A;  2LNH B;  4F04 B;  4HCZ A;  1HD3 A;  2CUD A;  1R0C B;  3SEM A;  4EMK A;  4LUE A;  2EGE A;  1IXD A;  2LJ0 A;  2XI9 A;  1BIA A;  4OMO A;  3QUI A;  1TU0 B;  2ED1 A;  1H8K A;  5LJ5 h;  1OX8 A;  2C0O A;  2DL3 A;  1RLP C;  2IVW A;  2YLB A;  5IHK A;  1VQ8 A;  4BI3 A;  3OS0 A;  5DY9 A;  1GFD A;  1PKS A;  4RTY A;  3FJ5 A;  1Q86 U;  3BDL A;  3JCM f;  2MOX A;  1WPY A;  2ZZD A;  5GAO m;  4C92 D;  1QVG A;  3M55 A;  1NM7 A;  4LDY A;  3ZL7 C;  5LJ5 d;  3G4S A;  2QA4 Q;  1XNI A;  4DBQ A;  1KC8 U;  1VQK Q;  2WSC E;  2Y4X A;  3CC7 A;  3E19 A;  3HRU A;  3DB3 A;  3VJP A;  1M9S A;  1VQN A;  1BB9 A;  4KRT A;  5LL6 S;  2QGF B;  1PKT A;  2WAC A;  5I2S A;  1V76 A;  5GAM j;  3NTH A;  1UTI A;  4XTV A;  1Q81 C;  2OTL T;  2BZ8 A;  1WHM A;  4HT9 A;  1QCF A;  5GMK h;  5GAO l;  2R58 A;  7AT1 B;  3TEE A;  1WLP B;  2RI2 A;  2NUZ A;  5FLX E;  4BI4 A;  2DEQ A;  1QW1 A;  3EFO A;  5CVI A;  2AKL A;  3X20 B;  1AWW A;  2JS0 A;  1QP3 A;  2XKO C;  4RG2 A;  4M7D D;  5GAM e;  1GXI E;  2QXF A;  3DB4 A;  4IUU A;  1FYN A;  1ZHI A;  4RTV A;  3GNG A;  1EIF A;  4HA8 A;  1AD5 A;  2KXC A;  2ZCF B;  4FT4 A;  4Z89 A;  3A98 A;  3FIF A;  1YFN A;  3M53 A;  1S72 T;  4EDU A;  2OTL A;  3I35 A;  1VQ4 T;  2VXF A;  4DEX A;  4LDV A;  3NHN A;  2NYS A;  3QKJ A;  1K9A A;  4OVA A;  1U3O A;  4ZTF A;  1A0N B;  2NUT A;  3CCE A;  2F2X A;  3JB9 J;  3E9G A;  4E7I A;  4ZGJ B;  2M0Y A;  4L6V 5;  2PVG B;  2BUD A;  2E70 A;  1Q7Y U;  3SWN A;  1QVG P;  1BBZ A;  4BAC A;  2DTH A;  4EMG A;  1NJI C;  1KQS S;  3FJP A;  2A36 A;  3SWN B;  1JO8 A;  2D8J A;  5HCK A;  1SRL A;  1TWB A;  2CUB A;  1QCN A;  1PRL C;  2XK0 A;  1AHJ B;  1OOT A;  3CBM A;  3OY9 A;  4KH1 B;  4KGX B;  3CD6 Q;  4LN2 A;  2O31 A;  1VQO T;  1TSF A;  2LQW A;  2YHT A;  3P8H A;  3OBY A;  4HVU A;  1YJ9 T;  4MML A;  1V1C A;  1BI2 A;  1YIT A;  1VQ7 T;  1HSQ A;  2F69 A;  1VQM A;  1S72 A;  1ZUY A;  2JZ2 A;  2QTV A;  3RR6 A;  4M75 E;  1YHQ T;  3RIR A;  4C92 E;  2HBW A;  3JB9 F;  1X6O A;  4HT8 A;  1VQ8 T;  3RKX A;  5CK9 A;  1GCP A;  1SSH A;  4C5G A;  4M77 D;  5IT9 E;  3EFR A;  3EGX B;  1MV3 A;  3V8J A;  1PSE A;  3OYK A;  4JS5 A;  1KFZ A;  2KT8 A;  3MP1 A;  1K1Z A;  3UA6 A;  1VYU A;  3OYL A;  2D9T A;  1HYO A;  5CO7 A;  1WX6 A;  4IIO A;  3CXC A;  3MP8 A;  3MO8 A;  3NGP A;  3QDR B;  3CC2 Q;  1I5L A;  5GMK j;  2YUP A;  2RQR A;  3SHW A;  1W1F A;  3CC4 A;  1D0Y A;  2EBP A;  3JCM e;  2DET A;  2LX7 A;  4L5G A;  1ZA1 B;  2D0N A;  5A2Q E;  2KDS A;  2RA2 A;  1ZX6 A;  3L2Q A;  1G8X A;  4M77 G;  1WGS A;  3V8L A;  1ZUU A;  1Z9Q A;  2BTT A;  3QYG B;  2LX9 A;  3CCS A;  1ABO A;  5GAN g;  2RD1 A;  4N4I A;  1PD0 A;  3VYG A;  3JB9 I;  3M4G A;  1YHQ Q;  4FL6 A;  2C0T A;  5I11 A;  1K8A R;  2DZ9 A;  1MMD A;  2OTJ A;  3JCM c;  1MHN A;  1HXD A;  4LDW A;  2JW4 A;  4ZNX A;  4XK8 E;  3KUF A;  2K3Y A;  3JB9 G;  5GAN 3;  3MCA B;  3MP6 A;  5CKD A;  4JJD A;  2E5K A;  2DIG A;  1AEY A;  2F2W A;  4PKC C;  1X27 A;  1U5S A;  4C5E A;  2MMP A;  1UGQ B;  2VGM A;  2HBP A;  2K3X A;  1OEB A;  2HKN A;  5LJ3 j;  3EG1 A;  2DXT A;  2RHU A;  2QGG A;  2VXE A;  3FEO A;  5LJ3 h;  3V7S A;  2O88 A;  1SSF A;  3RUX A;  3CC4 Q;  4F7U A;  4C92 A;  3G4S Q;  2YLC A;  2RNA A;  3X28 B;  1M2O A;  2J6F A;  2E4H A;  1YJW T;  4C92 B;  2DLP A;  2ZPH B;  2RB6 A;  4IUR A;  2CH4 W;  3I56 A;  2FG0 A;  1VIF A;  1AZG B;  3EHQ A;  5GMK l;  4M75 D;  2LCS A;  1T3L A;  1PC0 A;  2WSF E;  3BFM A;  3ZEH A;  4ELZ C;  1CKB A;  3CC7 Q;  3OSV A;  2KRO A;  4C8Q A;  3TQ7 P;  2CS7 A;  3OW2 P;  3O8V A;  4C0F A;  4PL6 A;  1HJD A;  3M0T A;  1BCO A;  2ATC B;  4NL2 A;  3G6E A;  2FYK A;  2HZY A;  2RHI A;  3GPL A;  2JNG A;  9ATC B;  1J3T A;  3TRE A;  1NLO C;  3RMQ A;  3M0Q A;  1VQ4 A;  4UC4 A;  4A4K A;  4JRQ A;  1WZO A;  5GJV B;  4WF2 A;  1EZZ B;  2J6K A;  3MJX A;  1T0J A;  2DYB A;  2OI3 A;  3VUB A;  5GMK e;  2YRD A;  1VQP Q;  2EYX A;  1PSF A;  5GAN 2;  4M78 G;  2KMT A;  4M77 B;  4JJB A;  2CYZ B;  1KQS A;  3CPW A;  3VS6 A;  1RAH B;  2KE9 A;  1XTD A;  2PQW A;  4PJO G;  4OMQ A;  2X4J A;  3LW5 E;  3TCJ A;  2AZS A;  2CRE A;  2F5K A;  5GAO q;  1TUG B;  3HHT B;  3FB9 A;  2V1Q A;  3M57 A;  3I56 T;  2X4X A;  3C0C A;  4Y28 E;  2HCK A;  1VQL A;  2IG0 A;  1K73 C;  1X43 A;  2RJE A;  3H0H A;  3D7S B;  2DA9 A;  4PJO C;  3M5A A;  1K9M R;  3CCU Q;  3X25 B;  4WCI A;  1U06 A;  3JV3 A;  5KYY B;  4JJC A;  5FRM A;  2DRM A;  4KUD K;  2CH4 A;  3H6Z A;  3QSU A;  4M7A C;  4A4H A;  2M0O A;  2LQ8 A;  3U23 A;  1Y7X A;  2YXY A;  4C8Q B;  1VQ9 T;  1S72 Q;  3GIB A;  3ULR B;  1G3T A;  2GFU A;  3OYY A;  1JU5 C;  3UF4 A;  5LJ3 f;  1VQ4 Q;  1MMN A;  2L3Q A;  1TUC A;  1ZA2 B;  3OYB A;  4FSX A;  4J9I A;  5C6S A;  2K5F A;  1X6B A;  1WA7 A;  1K76 A;  1TG0 A;  5FU7 C;  4C92 F;  5A0G A;  2LP5 A;  4M75 F;  4C0G A;  5KYN A;  1RAA B;  3ASK A;  2MI6 A;  2JVV A;  1MUZ A;  3CCM Q;  1M8M A;  4PK4 A;  4B9W A;  1QP2 A;  2QTX A;  4KT0 E;  2MPX C;  1VQ6 T;  4M78 F;  1Y96 A;  3HTR A;  1UUE A;  1QVF P;  1OU8 A;  3L2U A;  2EQJ A;  1RAF B;  2DF6 A;  3H0F A;  3PMT A;  1H92 A;  3G71 A;  5IHN A;  5GMK i;  5LJ5 e;  1X01 A;  3R6O A;  2PVD B;  2VAS A;  2FPF A;  1M90 R;  2J06 A;  3SB2 A;  2MWP A;  3BDU A;  3QO3 A;  1B7T A;  5HKC A;  3OYE A;  1UJ0 A;  4MZP A;  4OMM A;  3CME Q;  5GAO n;  4AMC A;  3CCJ T;  5I21 A;  1VA7 A;  3EH1 A;  1KQS P;  4JS4 A;  3PGG A;  4BY6 B;  2LVM A;  2W10 A;  2CZ0 B;  4ZGD B;  2BZX A;  2CP2 A;  3FDR A;  5L8R E;  4BDZ A;  3L1A A;  3EGX A;  1OUL A;  2L3P A;  5IH2 A;  4ELY C;  3GOX A;  1KQ2 A;  4BB7 A;  3J7A F;  4M7D A;  3QZ5 B;  4F7U F;  1YIT T;  3M59 A;  2KI7 A;  4XTW A;  2E1H A;  3QWY A;  1VQ5 A;  2CGH A;  3CME A;  1D1C A;  1E7O A;  1N6A A;  4PJJ A;  4MZM A;  3QJY A;  4PJO D;  2GQV A;  2OAW A;  1SEM A;  2PUO B;  1GBR A;  5J3B A;  4EMH A;  1M4Z A;  3PIP A;  2HL5 C;  3GF5 A;  5GAM f;  1RI0 A;  4XTX A;  4KBM B;  1X75 C;  5AT1 B;  5D6Y A;  4II1 A;  4VUB A;  3H8Z A;  1D3B A;  1SHF A;  3SWN C;  4XTU A;  3CCM A;  1VQL T;  2KGT A;  4AFU C;  1IGU A;  2KK4 A; 
#chains in the Genus database with same CATH homology
 1RLQ C;  3EGU A;  5FWB A;  2A36 A;  2JT4 A;  3QWX X;  1WFW A;  1JO8 A;  2D8J A;  1YNZ A;  2M51 A;  2YT6 A;  5HCK A;  4ESR A;  2FPE A;  2DL8 A;  1SRL A;  1ZLM A;  2B86 A;  2CUB A;  1W6X A;  2SRC A;  1PRL C;  2L3S A;  5IXF A;  4K11 A;  1OOT A;  3R6N A;  1AWJ A;  4AFZ C;  4LN2 A;  1ZUK A;  2O31 A;  1UGV A;  2GGR A;  2LQW A;  2RPN A;  4R0K A;  2DJQ A;  4FSS A;  2JS2 A;  2KRN A;  2DL4 A;  1AWX A;  4HVU A;  4M4Z A;  1T0H A;  2MCN A;  1ABQ A;  1V1C A;  4DEY A;  1M27 C;  1HSQ A;  1ZUY A;  3PE0 A;  1K0S A;  2EGA A;  2JMA A;  3VS2 A;  2HBW A;  2ABL A;  4JZ4 A;  2LQN A;  2LJ1 A;  1MV0 B;  1ZSG A;  1GCP A;  1SSH A;  2CSQ A;  1MV3 A;  4A63 B;  1WXB A;  1OV3 A;  4OMN A;  4LNP A;  2GBQ A;  4OML A;  2KT8 A;  1KFZ A;  1K1Z A;  3UA6 A;  4D8D A;  1KIK A;  1VYU A;  2H8H A;  2K7A A;  1G83 A;  1UEC A;  2P4R A;  1WX6 A;  4J9B A;  4IIO A;  3EG3 A;  2EYZ A;  2AK5 A;  4J9C A;  1YWO A;  3NGP A;  1FMK A;  1SRM A;  3I5S A;  2X3W D;  1NEG A;  2D1X A;  4J9E A;  5L23 A;  2K79 A;  4J9H A;  2VVK A;  4F16 A;  1WIE A;  2YUP A;  2DMO A;  2RQR A;  2A37 A;  3SHW A;  1I0C A;  2DRK A;  4JPB W;  1GRI A;  1K4U S;  2X3X D;  1W1F A;  2EBP A;  2LX7 A;  2D0N A;  2ENM A;  2YSQ A;  1VYV A;  1G2B A;  1ZX6 A;  3LH5 A;  1QWE A;  1Y57 A;  1WXT A;  2KT1 A;  1ZUU A;  1Z9Q A;  2BTT A;  2EW3 A;  4Z88 A;  1ABO A;  1UE9 A;  4CC7 A;  4GBQ A;  3REA B;  4AG2 C;  2F2V A;  1KSW A;  2C0I A;  1ZBJ A;  2YUO A;  3VS5 A;  3TSZ A;  2KR3 A;  4X1V A;  2K2M A;  5I22 A;  2C0T A;  3EHR A;  2RQU A;  5I11 A;  4HCK A;  2W0Z A;  1GFC A;  4HVW A;  4RTU A;  5GJW B;  1UFF A;  1X2K A;  2YUN A;  3NMZ C;  2DBK A;  2CT4 A;  4JZ3 A;  4RTW A;  4Y92 A;  3VS7 A;  2JW4 A;  4ZNX A;  2EGC A;  4GLM A;  2VKN A;  1E6H A;  1B07 A;  1XOV A;  2EPD A;  1JEG A;  1N5Z A;  1T3S A;  3M0U A;  2KEA A;  1M3B A;  4F17 A;  3RNJ A;  4Z8A A;  1NLP C;  2JM9 A;  1E6G A;  1WDX A;  1GL5 A;  4JJD A;  1Y0M A;  2E5K A;  1IO6 A;  1AEY A;  2DBM A;  2O2O A;  4CC4 B;  2F2W A;  1QKW A;  1X27 A;  3PVQ A;  1U5S A;  1X6G A;  2KBT A;  3TSW A;  4OMP A;  1OEB A;  1VYT A;  1PNJ A;  1WXU A;  3EG1 A;  3VS0 A;  3VRZ A;  2FO0 A;  2JXB A;  5EC7 A;  2O88 A;  1JQQ A;  1KJW A;  4HXJ A;  3H41 A;  2V1R A;  1YN8 A;  2YUQ A;  2RNA A;  3NPF A;  2A08 A;  2J6F A;  3IQL A;  1GBQ A;  2DL5 A;  2DLP A;  2CH4 W;  2DX1 A;  2ECZ A;  2FG0 A;  1H3H A;  4LE9 A;  1AZG B;  1AVZ C;  2ED0 A;  3EHQ A;  2DVJ A;  3VS1 A;  1QLY A;  1I07 A;  2GNC A;  1M3C A;  1CSK A;  3M0P A;  2LCS A;  3KFV A;  1T3L A;  3H0I A;  2G6F X;  1CKB A;  2A28 A;  2KRO A;  2FPD A;  1B3Q A;  4IIM A;  1AZE A;  2RN8 A;  1EFN A;  3I5R A;  1HJD A;  3M0T A;  4CC2 A;  1UG1 A;  1UJY A;  4F14 A;  1NEB A;  1WI7 A;  3TVT A;  2RF0 A;  5FWC A;  2DL7 A;  1J3T A;  1NLO C;  2FEI A;  1RUW A;  3M0Q A;  1UDL A;  2EQI A;  5GJV B;  1YP5 A;  2J6K A;  1T0J A;  4J9D A;  2DYB A;  1M3A A;  2OI3 A;  1JXO A;  4AG1 C;  2PZ1 A;  3M0S A;  2K3B A;  2EVR A;  2EYX A;  1QKX A;  1SHG A;  4LUD A;  1YWP A;  4JJB A;  2RQW A;  2DM1 A;  1PWT A;  3VS6 A;  2KE9 A;  2I0N A;  4OMQ A;  3EG0 A;  2CT3 A;  2AZS A;  1GCQ A;  2CRE A;  2XMF A;  2VWF A;  4HVV A;  3REB B;  1W70 A;  2J7I A;  2L2P A;  1PRM C;  3RBB B;  2V1Q A;  2CDT A;  2J6O A;  4RUG A;  2LZ6 B;  4RTT A;  2KRM A;  3C0C A;  3THK A;  4E6R A;  4EIK A;  2DIL A;  2HCK A;  2KXD A;  1X43 A;  1X69 A;  1TUD A;  3H0H A;  4J9G A;  2O9S A;  2DA9 A;  1RI9 A;  5ECA A;  4WCI A;  1NYG A;  1U06 A;  2K6D A;  1Z9Z A;  3JV3 A;  1BK2 A;  3I9Q A;  3UAT A;  2BZY A;  2GQI A;  1AWO A;  5FW9 A;  4JJC A;  2DRM A;  1ARK A;  2ROL A;  2RMO A;  2OJ2 A;  2CH4 A;  2RQT A;  1JXM A;  1QWF A;  2ESW A;  1SPK A;  2LNH B;  2KYB A;  1HD3 A;  2CUD A;  3U23 A;  3SEM A;  4QT7 A;  4LUE A;  2EGE A;  2LJ0 A;  4RTX A;  2J05 A;  2JTE A;  4OMO A;  2JMC A;  1GCQ C;  2FRY A;  2ED1 A;  1S1N A;  1H8K A;  3ULR B;  1LCK A;  2C0O A;  1JU5 C;  2DL3 A;  3EG2 A;  3CQT A;  3UF4 A;  4AFS C;  2HEQ A;  1RLP C;  3VRY A;  2HSP A;  5IHK A;  2L3Q A;  1TUC A;  2HDA A;  4J9I A;  1OPK A;  1X6B A;  1WA7 A;  1GFD A;  1PKS A;  4RTY A;  3FJ5 A;  1K76 A;  4CC3 A;  1TG0 A;  2DE0 X;  2LP5 A;  2MOX A;  4AFQ C;  1NM7 A;  3ZL7 C;  2L0A A;  2PNI A;  2IIM A;  1MUZ A;  2JM8 A;  1M8M A;  2LMJ A;  5IXB A;  1CKA A;  1UUE A;  1BU1 A;  1BB9 A;  4KRT A;  2CSI A;  1PKT A;  4J9F A;  2DF6 A;  3H0F A;  3UA7 A;  1UTI A;  2QDL A;  1H92 A;  2KNB B;  2O9V A;  5IHN A;  2BZ8 A;  2FPF A;  2J06 A;  1QCF A;  2DNU A;  1UJ0 A;  2EKH A;  4OMM A;  1I1J A;  1M30 A;  5IHI A;  4ORZ A;  1WLP B;  2NUZ A;  1VA7 A;  3GBQ A;  2SEM A;  2YDL A;  3O5Z A;  2AKL A;  1UHF A;  1AWW A;  2W10 A;  2JS0 A;  1UHC A;  3VS4 A;  2BZX A;  2AKK A;  2EYY A;  2L3P A;  5IH2 A;  1FYN A;  4RTZ A;  4RTV A;  2NWM A;  1WYX A;  2EYW A;  1AD5 A;  2ROT A;  2KXC A;  4Z89 A;  3A98 A;  1X2Q A;  3I35 A;  3QWY A;  4DEX A;  1E7O A;  2GTJ A;  3NHN A;  2LJ3 A;  1K9A A;  2FRW A;  1U3O A;  1A0N B;  1OPL A;  2AZV A;  2OAW A;  2KYM A;  1SEM A;  1GBR A;  2F2X A;  3VS3 A;  1K0X A;  1YCS B;  2M0Y A;  3PVL A;  2K9G A;  1AOJ A;  2GTO A;  1PHT A;  1NG2 A;  2D8H A;  2RQV A;  3M0R A;  1BBZ A;  2PTK A;  2MIO A;  1SHF A;  2KRS A;  2KGT A;  4AFU C;  1NYF A;  4D8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...