1X48A

Solution structure of the second dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
GSSGSSGYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
publication title Solution structure of the second DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x48A00
3VYYA 1STUA 1QU6A 4GKJE 4JI0E 3T1HE 1O0WA 1RQ0A 4LF4E 3ADLA 1X49A 1N36E 1HNXE 1IBME 2UU9E 4JI2E 2L3JA 3T1YE 4DR7E 4B3TE 1DI2A 2F4VE 3C4BA 4JI1E 1XMOE 2YT4A 3ADGA 1YZ9A 2L3CA 4DV0E 2NA2A 4OX9E 4WFTA 4DV7E 3C4TA 2N3HA 1WHNA 1X48A 4GKKE 4X64E 4DV6E 4DV3E 2UXCE 3ADJA 4X8WA 2LUQA 1FJGE 2NUGA 4DV4E 2UUCE 5IWAE 2LJHA 4WYQB 4JI6E 1I94E 4B3RE 4LFAE 4JI7E 5LMUE 4LFCE 2IHR1 1N33E 2RSMA 1N34E 4DKKA 4DV1E 1N32E 1ZBTA 2MDRA 5BR8E 1YYOA 2JY9A 2LTSA 4NXNE 1IBLE 4M30A 4X65E 2VQFE 1IBKE 2B7VA 4X66E 1WHQA 1XMQE 2NUEA 3J7Yp 1UILA 3VYXA 4JI3E 4LFBE 2L2KB 4DV2E 4KHPE 2DIXA 1X47A 2N3GA 2CPNA 4DR1E 4DUYE 1RC7A 3OTOE 4DR3E 4DV5E 1FKAE 4LF5E 4LF6E 4AQYE 2L2MA 2LUPB 4JV5E 1YYWA 2LRSA 4JI4E 2LBSB 2RS6A 4B3SE 2EZ6A 2UXDE 4LF9E 5CFFE 1T4OA 2RS7A 1XNRE 1UHZA 1GQEA 4DUZE 1J26A 2ZM6E 2HHHE 1EKZA 1T4NA 2E5LE 4DR6E 2JVAA 4DR5E 4DR2E 2UXBE 4YHHE 1YYKA 1HNWE 1HR0E 2VQEE 2RTXA 2DMYA 1T4LB 2UUAE 3P1XA 4YY3E 4LF8E 4JYAE 4LF7E 3LLHA 3HTXA 4DR4E 4B3ME 4JI8E 2B3TB 2B7TA 4X62E 1PKPA 2UUBE 4K0KE 2DB2A 1XNQE 1J5EE 4NXME 4JI5E 3ADIA 2L2NA 2L33A 2KHXA 5LMNE 4M2ZA 2NUFA 2LTRA 1HNZE 4OOGC
chains in the Genus database with same CATH superfamily
2EN3A 4R8OA 4LF4E 1RQ0A 1AH5A 1X6HA 5FLXC 2YTOA 3VHTB 1IBME 2EOEA 4J8ZA 2EPRA 3HPZA 4F2JC 1MGTA 1KJKA 2YRKA 1XMOE 3KZZA 2NA2A 4WFTA 3THOB 4L8NA 4KZSA 1X6EA 4Q35B 4X64E 2EM2A 5KL4A 1JK2A 1IQSA 2JP9A 3C6KA 2LO3A 2DGCA 4IJDA 1G2DC 1FJGE 1YUJA 2NUGA 2UUCE 4M9VC 2EMIA 2LJHA 4O24A 4JI6E 2L6MA 2RPCA 4WXCA 5LMUE 4LFCE 2EQ1A 2IHR1 2EMCA 1A1IA 1Z1BA 4L5NC 4NZVA 4DKKA 4O5GA 2YRMA 2R76A 5T6JA 2EMKA 2YTPA 2JWOA 2VF1A 2JY9A 2LTSA 2MKDA 3AV0A 5AE2A 2G7HA 2N8XA 3VK6A 1A1GA 1WHQA 4R2RA 5IXMB 2LJUA 1UILA 3VYXA 1GTKA 2M7QA 4DV2E 4KHPE 2N3GA 2EMBA 4DR1E 1RC7A 4DR3E 3BIDA 3LMLA 1FKAE 2HJJA 4AQYE 2LUPB 4JV5E 2YTIA 2LBSB 2RS6A 2K4VA 4LF9E 5CFFE 1TF3A 2EWLA 3JU0A 2WCC3 4DUZE 4MLVA 1WRJA 2ZM6E 2EPCA 1PJTA 4F6NA 2EM4A 1T4NA 2JVAA 2UXBE 2FV4B 2EOSA 3OMLA 1N3GA 2EPKX 1X5WA 2ADRA 2DMYA 2GHFA 3MSWA 4YY3E 3C6MA 3LLHA 2EN6A 2CTDA 2EQ3A 4B3ME 2B7TA 2EMLA 2UUBE 3AUZA 2DLQA 1J5EE 3THNA 2L2NA 2EMZA 2FGGA 2V83A 1MEYC 1HNZE 2WBSA 1EH7A 4I8OA 1YPNA 3VYYA 5A2QC 2EMHA 2EL4A 4WSPA 4M0VA 2YU8A 2J7JA 1O0WA 4BCAA 2DRPA 2EN1A 2BBGA 2M9AA 1PJQA 4F9CB 2EQ0A 4JI2E 4DR7E 5A6JA 1X6FA 2F4VE 4O4KA 1YZ9A 2EMXA 1PDAA 2EOZA 3ECRA 4DV0E 4OX9E 3BGHA 4DV7E 2V8QB 2H36X 2N3HA 2YTJA 4R2QA 2EM9A 1WHNA 2JOBA 2LE2A 4WPYA 2RSIA 4GEQB 2EN2A 4X8WA 2ENHA 2EM3A 4WYQB 5AASA 4R2SA 5KL2A 2R1FA 2A25A 2EM8A 3M99B 1T38A 4DV1E 2I13A 2MDRA 4IS1C 3JTZA 4LTYA 5IT9C 2EM0A 1UN6B 2YTGA 2EORA 1YYOA 4F54A 2RQLA 1NCSA 2LMZA 1NEIA 2EPUA 2HC5A 4X65E 1IBKE 5KL6A 2JOXA 2EMYA 1F2IG 2EN4A 2HGHA 3KZYA 1T39A 4LFBE 4R2EA 2L2KB 3BF2A 4N4RB 1G2FC 2CPNA 3OTOE 2EPMX 1B69A 2Q8UA 2L2MA 2I9IA 1YUIA 4JI4E 2V89A 5AC5A 2V85A 2EZ6A 2EM6A 1XNRE 1UHZA 2DLKA 3DF6A 2YWQA 2VRDA 2MC5A 2YPNA 2E1MA 3EPKA 2LV2A 4YHHE 3BBGA 1YYKA 2YTFA 1HNWE 3K6QA 2EMAA 1TF6A 1YFHA 4BS9A 1T4LB 4LF8E 3P1XA 3J80C 4X62E 3EPJA 2MC6A 4K0KE 1XNQE 4DMIA 4JI5E 2EPLX 2L33A 1ZU1A 2NUFA 4ZYGA 2YSPA 3TQMA 5F3WA 2MDGA 4GKJE 2B9DA 5TSEA 3T1HE 3HPSA 2EL5A 5LL6R 1N36E 4F9BB 2UU9E 1EH8A 2L3JA 3T1YE 1PJSA 2YTQA 4B3TE 1DI2A 2DSYA 3HXLA 4F9AB 2EP3A 4JI1E 5AE3A 1WJPA 4FK5C 2L3CA 2JXPA 5ADZA 2GLIA 2EM7A 2V87A 2EJ4A 3IWBA 4P7DA 1IMUA 5KL5A 1BB8A 3ADJA 2L8TA 4BMJA 2LUQA 5LLQA 4OOGC 2EOQA 1A1KA 2MKNA 3H09A 3DJWA 4HTGA 4B3RE 4JI7E 5A6AA 1N33E 2ELZA 5KL3A 2K7IA 3ZOQB 1N32E 2JYAA 5BR8E 4KWYA 2EOFA 4NXNE 1A1FA 2EOOA 2VQFE 4X66E 2VE7C 1ZAAC 3J7Yp 1EH6A 4O43A 1X47A 1YSAC 5DNYA 4DUYE 3KWRA 2M1SA 2V86A 2EPAA 4BC9A 2CT1A 2CSHA 2EOMA 2LRSA 4NHRA 2UXDE 2PRTA 4ZYHA 4F6MA 1GQEA 2EN7A 4LU9A 4GZNC 2WZOA 1DGCA 2EL6A 1EKZA 4P78A 4DR2E 4RH8A 4TUIA 4R2AA 2EOXA 2EOHA 2KOUA 1HR0E 1ZR9A 2VQEE 2LVHA 1DQ3A 2L92A 1ZBQA 2UUAE 4X9JA 4WSGA 1IQOA 2YRHA 3EPLA 4HEIA 4NXME 3J7AG 3QG5C 3ADIA 3JAMC 3MHSC 1BBOA 2KONA 2KHXA 5AC4A 5LMNE 5A6KA 1AAYA 1STUA 1TN9A 1QU6A 2DMIA 2YZTA 2EM5A 4JI0E 3RMPA 4BHBA 4WX9A 3ADLA 1X49A 1X3CA 2V88A 2LT7A 1HNXE 4WXDA 2GPIA 3EQ1A 2WBTA 2E72A 2YSOA 2F8BA 3HQ1A 4ZYEA 3C4BA 2NABA 2YT4A 3ADGA 3UK3C 2YTEA 1JK1A 3C4TA 3IWDA 3F6GA 5IV8B 2EOIA 2EOJA 1X48A 3F6HA 3EPHA 4GKKE 2EMGA 2EE8A 3L00A 4DV6E 4DV3E 5AE1A 2UXCE 2EPPA 2ENCA 2FTXB 3FIGA 4MLQA 4DV4E 5IWAE 5A69A 1I94E 4LFAE 2JR1A 1LLMC 3J81C 1BBGA 2RSMA 5KL7A 4TUGA 1N34E 4R2DA 1ZBTA 4R03A 1L4SA 4ZYDA 4Q28A 1P47A 5A6BA 2YTNA 2YTDA 1IBLE 4M30A 2JPAA 2EPXA 2B7VA 2EPNA 1XMQE 2NUEA 1A1HA 1A1LA 4JI3E 4BC7A 2DIXA 2EN8A 2EOYA 2YU5A 1A1JA 4DV5E 4LF5E 4R2CA 1RMDA 4LF6E 1WXRA 2ENAA 1YYWA 4B3SE 1SFEA 1T4OA 2ELYA 2RS7A 3IWCA 1GZ6A 2EMWA 2ODRD 4RHBB 1QNTA 1J26A 2D9HA 1UBDC 2HHHE 1KYQA 4R2PA 3MHHC 2E5LE 4DR6E 4DR5E 1SR9A 2ODRC 2BB8A 2RTXA 4JYAE 2EMFA 4LF7E 3HTXA 4DR4E 4BHCA 4JI8E 2B3TB 2EPZA 1PKPA 2DB2A 2WBUA 4BBYA 2EPOA 2M4IA 4M2ZA 2LTRA 2LCEA 5A6BD
chains in the Genus database with same CATH topology
3VYYA 1STUA 4R8OA 1QU6A 2B9DA 5A2QC 4GKJE 2YZTA 4WSPA 4JI0E 3RMPA 4M0VA 3T1HE 1O0WA 1RQ0A 4BCAA 4LF4E 3ADLA 1X49A 2V88A 3HPSA 5FLXC 5LL6R 4F9CB 1N36E 4F9BB 1HNXE 1IBME 2UU9E 4J8ZA 2L3JA 3T1YE 4JI2E 4B3TE 4DR7E 1DI2A 2DSYA 3HPZA 3HXLA 2F8BA 3HQ1A 4F9AB 2F4VE 3C4BA 4JI1E 5AE3A 1XMOE 2YT4A 3ADGA 1YZ9A 2L3CA 4DV0E 2NA2A 5ADZA 4OX9E 4WFTA 4DV7E 2V8QB 2H36X 3C4TA 3IWDA 2V87A 3F6GA 4L8NA 2N3HA 4KZSA 1WHNA 3IWBA 2JOBA 1X48A 2LE2A 3F6HA 4WPYA 4P7DA 4GKKE 4X64E 4DV6E 4GEQB 4DV3E 5AE1A 4JYAE 2UXCE 3ADJA 4X8WA 2L8TA 4BMJA 2LUQA 2FTXB 3FIGA 1FJGE 2NUGA 3H09A 4DV4E 2UUCE 5IWAE 2LJHA 4WYQB 5AASA 1I94E 3DJWA 4JI6E 4B3RE 4LFAE 2JR1A 2L6MA 4JI7E 5LMUE 3J81C 4LFCE 2IHR1 1N33E 2RSMA 4TUGA 1N34E 4L5NC 3ZOQB 4DKKA 4DV1E 1N32E 1ZBTA 2MDRA 3JTZA 4LTYA 4R03A 5IT9C 5BR8E 5T6JA 4Q28A 2JWOA 2VF1A 1YYOA 2JY9A 2LTSA 4F54A 1IBLE 4NXNE 4M30A 2LMZA 3AV0A 5AE2A 4X65E 2G7HA 2VQFE 1IBKE 3VK6A 2B7VA 4X66E 1WHQA 1XMQE 2JOXA 2VE7C 2NUEA 3J7Yp 1UILA 3VYXA 4JI3E 4LFBE 2M7QA 2L2KB 4BC7A 4DV2E 2DIXA 4KHPE 1X47A 2N3GA 2CPNA 5DNYA 4DR1E 4DUYE 1RC7A 3KWRA 3OTOE 4DR3E 4DV5E 3LMLA 1FKAE 4LF5E 2M1SA 2V86A 4AQYE 2L2MA 1WXRA 2LUPB 4LF6E 1YYWA 4JV5E 4BC9A 2LRSA 4JI4E 2LBSB 2RS6A 4B3SE 2V89A 2K4VA 2EZ6A 2V85A 4LF9E 5CFFE 2UXDE 1T4OA 3IWCA 2RS7A 2EWLA 1GZ6A 2ODRD 1XNRE 3JU0A 1UHZA 1GQEA 3DF6A 4LU9A 4DUZE 1J26A 2WZOA 2ZM6E 2HHHE 1EKZA 1T4NA 2MC5A 4P78A 2E5LE 4DR6E 2E1MA 2JVAA 4DR5E 1SR9A 4DR2E 2UXBE 4YHHE 2FV4B 4TUIA 1YYKA 1HNWE 3OMLA 2ODRC 2KOUA 3K6QA 1HR0E 2VQEE 2RTXA 1DQ3A 2DMYA 2L92A 1ZBQA 3MSWA 3P1XA 4BS9A 4YY3E 1T4LB 2UUAE 4LF8E 4LF7E 3LLHA 3J80C 3HTXA 4DR4E 4B3ME 4JI8E 2B3TB 2B7TA 4X62E 1PKPA 2MC6A 3AUZA 2DB2A 2UUBE 1XNQE 4K0KE 4DMIA 1J5EE 4BBYA 4JI5E 4NXME 3J7AG 3ADIA 2L2NA 3JAMC 2M4IA 2L33A 2FGGA 2V83A 2KONA 2KHXA 5LMNE 4M2ZA 2NUFA 2LTRA 1HNZE 4OOGC 4I8OA 5F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYY A;  1STU A;  1QU6 A;  4GKJ E;  4JI0 E;  3T1H E;  1O0W A;  1RQ0 A;  4LF4 E;  3ADL A;  1X49 A;  1N36 E;  1HNX E;  1IBM E;  2UU9 E;  4JI2 E;  2L3J A;  3T1Y E;  4DR7 E;  4B3T E;  1DI2 A;  2F4V E;  3C4B A;  4JI1 E;  1XMO E;  2YT4 A;  3ADG A;  1YZ9 A;  2L3C A;  4DV0 E;  2NA2 A;  4OX9 E;  4WFT A;  4DV7 E;  3C4T A;  2N3H A;  1WHN A;  1X48 A;  4GKK E;  4X64 E;  4DV6 E;  4DV3 E;  2UXC E;  3ADJ A;  4X8W A;  2LUQ A;  1FJG E;  2NUG A;  4DV4 E;  2UUC E;  5IWA E;  2LJH A;  4WYQ B;  4JI6 E;  1I94 E;  4B3R E;  4LFA E;  4JI7 E;  5LMU E;  4LFC E;  2IHR 1;  1N33 E;  2RSM A;  1N34 E;  4DKK A;  4DV1 E;  1N32 E;  1ZBT A;  2MDR A;  5BR8 E;  1YYO A;  2JY9 A;  2LTS A;  4NXN E;  1IBL E;  4M30 A;  4X65 E;  2VQF E;  1IBK E;  2B7V A;  4X66 E;  1WHQ A;  1XMQ E;  2NUE A;  3J7Y p;  1UIL A;  3VYX A;  4JI3 E;  4LFB E;  2L2K B;  4DV2 E;  4KHP E;  2DIX A;  1X47 A;  2N3G A;  2CPN A;  4DR1 E;  4DUY E;  1RC7 A;  3OTO E;  4DR3 E;  4DV5 E;  1FKA E;  4LF5 E;  4LF6 E;  4AQY E;  2L2M A;  2LUP B;  4JV5 E;  1YYW A;  2LRS A;  4JI4 E;  2LBS B;  2RS6 A;  4B3S E;  2EZ6 A;  2UXD E;  4LF9 E;  5CFF E;  1T4O A;  2RS7 A;  1XNR E;  1UHZ A;  1GQE A;  4DUZ E;  1J26 A;  2ZM6 E;  2HHH E;  1EKZ A;  1T4N A;  2E5L E;  4DR6 E;  2JVA A;  4DR5 E;  4DR2 E;  2UXB E;  4YHH E;  1YYK A;  1HNW E;  1HR0 E;  2VQE E;  2RTX A;  2DMY A;  1T4L B;  2UUA E;  3P1X A;  4YY3 E;  4LF8 E;  4JYA E;  4LF7 E;  3LLH A;  3HTX A;  4DR4 E;  4B3M E;  4JI8 E;  2B3T B;  2B7T A;  4X62 E;  1PKP A;  2UUB E;  4K0K E;  2DB2 A;  1XNQ E;  1J5E E;  4NXM E;  4JI5 E;  3ADI A;  2L2N A;  2L33 A;  2KHX A;  5LMN E;  4M2Z A;  2NUF A;  2LTR A;  1HNZ E;  4OOG C; 
#chains in the Genus database with same CATH topology
 2EN3 A;  4R8O A;  4LF4 E;  1RQ0 A;  1AH5 A;  1X6H A;  5FLX C;  2YTO A;  3VHT B;  1IBM E;  2EOE A;  4J8Z A;  2EPR A;  3HPZ A;  4F2J C;  1MGT A;  1KJK A;  2YRK A;  1XMO E;  3KZZ A;  2NA2 A;  4WFT A;  3THO B;  4L8N A;  4KZS A;  1X6E A;  4Q35 B;  4X64 E;  2EM2 A;  5KL4 A;  1JK2 A;  1IQS A;  2JP9 A;  3C6K A;  2LO3 A;  2DGC A;  4IJD A;  1G2D C;  1FJG E;  1YUJ A;  2NUG A;  2UUC E;  4M9V C;  2EMI A;  2LJH A;  4O24 A;  4JI6 E;  2L6M A;  2RPC A;  4WXC A;  5LMU E;  4LFC E;  2EQ1 A;  2IHR 1;  2EMC A;  1A1I A;  1Z1B A;  4L5N C;  4NZV A;  4DKK A;  4O5G A;  2YRM A;  2R76 A;  5T6J A;  2EMK A;  2YTP A;  2JWO A;  2VF1 A;  2JY9 A;  2LTS A;  2MKD A;  3AV0 A;  5AE2 A;  2G7H A;  2N8X A;  3VK6 A;  1A1G A;  1WHQ A;  4R2R A;  5IXM B;  2LJU A;  1UIL A;  3VYX A;  1GTK A;  2M7Q A;  4DV2 E;  4KHP E;  2N3G A;  2EMB A;  4DR1 E;  1RC7 A;  4DR3 E;  3BID A;  3LML A;  1FKA E;  2HJJ A;  4AQY E;  2LUP B;  4JV5 E;  2YTI A;  2LBS B;  2RS6 A;  2K4V A;  4LF9 E;  5CFF E;  1TF3 A;  2EWL A;  3JU0 A;  2WCC 3;  4DUZ E;  4MLV A;  1WRJ A;  2ZM6 E;  2EPC A;  1PJT A;  4F6N A;  2EM4 A;  1T4N A;  2JVA A;  2UXB E;  2FV4 B;  2EOS A;  3OML A;  1N3G A;  2EPK X;  1X5W A;  2ADR A;  2DMY A;  2GHF A;  3MSW A;  4YY3 E;  3C6M A;  3LLH A;  2EN6 A;  2CTD A;  2EQ3 A;  4B3M E;  2B7T A;  2EML A;  2UUB E;  3AUZ A;  2DLQ A;  1J5E E;  3THN A;  2L2N A;  2EMZ A;  2FGG A;  2V83 A;  1MEY C;  1HNZ E;  2WBS A;  1EH7 A;  4I8O A;  1YPN A;  3VYY A;  5A2Q C;  2EMH A;  2EL4 A;  4WSP A;  4M0V A;  2YU8 A;  2J7J A;  1O0W A;  4BCA A;  2DRP A;  2EN1 A;  2BBG A;  2M9A A;  1PJQ A;  4F9C B;  2EQ0 A;  4JI2 E;  4DR7 E;  5A6J A;  1X6F A;  2F4V E;  4O4K A;  1YZ9 A;  2EMX A;  1PDA A;  2EOZ A;  3ECR A;  4DV0 E;  4OX9 E;  3BGH A;  4DV7 E;  2V8Q B;  2H36 X;  2N3H A;  2YTJ A;  4R2Q A;  2EM9 A;  1WHN A;  2JOB A;  2LE2 A;  4WPY A;  2RSI A;  4GEQ B;  2EN2 A;  4X8W A;  2ENH A;  2EM3 A;  4WYQ B;  5AAS A;  4R2S A;  5KL2 A;  2R1F A;  2A25 A;  2EM8 A;  3M99 B;  1T38 A;  4DV1 E;  2I13 A;  2MDR A;  4IS1 C;  3JTZ A;  4LTY A;  5IT9 C;  2EM0 A;  1UN6 B;  2YTG A;  2EOR A;  1YYO A;  4F54 A;  2RQL A;  1NCS A;  2LMZ A;  1NEI A;  2EPU A;  2HC5 A;  4X65 E;  1IBK E;  5KL6 A;  2JOX A;  2EMY A;  1F2I G;  2EN4 A;  2HGH A;  3KZY A;  1T39 A;  4LFB E;  4R2E A;  2L2K B;  3BF2 A;  4N4R B;  1G2F C;  2CPN A;  3OTO E;  2EPM X;  1B69 A;  2Q8U A;  2L2M A;  2I9I A;  1YUI A;  4JI4 E;  2V89 A;  5AC5 A;  2V85 A;  2EZ6 A;  2EM6 A;  1XNR E;  1UHZ A;  2DLK A;  3DF6 A;  2YWQ A;  2VRD A;  2MC5 A;  2YPN A;  2E1M A;  3EPK A;  2LV2 A;  4YHH E;  3BBG A;  1YYK A;  2YTF A;  1HNW E;  3K6Q A;  2EMA A;  1TF6 A;  1YFH A;  4BS9 A;  1T4L B;  4LF8 E;  3P1X A;  3J80 C;  4X62 E;  3EPJ A;  2MC6 A;  4K0K E;  1XNQ E;  4DMI A;  4JI5 E;  2EPL X;  2L33 A;  1ZU1 A;  2NUF A;  4ZYG A;  2YSP A;  3TQM A;  5F3W A;  2MDG A;  4GKJ E;  2B9D A;  5TSE A;  3T1H E;  3HPS A;  2EL5 A;  5LL6 R;  1N36 E;  4F9B B;  2UU9 E;  1EH8 A;  2L3J A;  3T1Y E;  1PJS A;  2YTQ A;  4B3T E;  1DI2 A;  2DSY A;  3HXL A;  4F9A B;  2EP3 A;  4JI1 E;  5AE3 A;  1WJP A;  4FK5 C;  2L3C A;  2JXP A;  5ADZ A;  2GLI A;  2EM7 A;  2V87 A;  2EJ4 A;  3IWB A;  4P7D A;  1IMU A;  5KL5 A;  1BB8 A;  3ADJ A;  2L8T A;  4BMJ A;  2LUQ A;  5LLQ A;  4OOG C;  2EOQ A;  1A1K A;  2MKN A;  3H09 A;  3DJW A;  4HTG A;  4B3R E;  4JI7 E;  5A6A A;  1N33 E;  2ELZ A;  5KL3 A;  2K7I A;  3ZOQ B;  1N32 E;  2JYA A;  5BR8 E;  4KWY A;  2EOF A;  4NXN E;  1A1F A;  2EOO A;  2VQF E;  4X66 E;  2VE7 C;  1ZAA C;  3J7Y p;  1EH6 A;  4O43 A;  1X47 A;  1YSA C;  5DNY A;  4DUY E;  3KWR A;  2M1S A;  2V86 A;  2EPA A;  4BC9 A;  2CT1 A;  2CSH A;  2EOM A;  2LRS A;  4NHR A;  2UXD E;  2PRT A;  4ZYH A;  4F6M A;  1GQE A;  2EN7 A;  4LU9 A;  4GZN C;  2WZO A;  1DGC A;  2EL6 A;  1EKZ A;  4P78 A;  4DR2 E;  4RH8 A;  4TUI A;  4R2A A;  2EOX A;  2EOH A;  2KOU A;  1HR0 E;  1ZR9 A;  2VQE E;  2LVH A;  1DQ3 A;  2L92 A;  1ZBQ A;  2UUA E;  4X9J A;  4WSG A;  1IQO A;  2YRH A;  3EPL A;  4HEI A;  4NXM E;  3J7A G;  3QG5 C;  3ADI A;  3JAM C;  3MHS C;  1BBO A;  2KON A;  2KHX A;  5AC4 A;  5LMN E;  5A6K A;  1AAY A;  1STU A;  1TN9 A;  1QU6 A;  2DMI A;  2YZT A;  2EM5 A;  4JI0 E;  3RMP A;  4BHB A;  4WX9 A;  3ADL A;  1X49 A;  1X3C A;  2V88 A;  2LT7 A;  1HNX E;  4WXD A;  2GPI A;  3EQ1 A;  2WBT A;  2E72 A;  2YSO A;  2F8B A;  3HQ1 A;  4ZYE A;  3C4B A;  2NAB A;  2YT4 A;  3ADG A;  3UK3 C;  2YTE A;  1JK1 A;  3C4T A;  3IWD A;  3F6G A;  5IV8 B;  2EOI A;  2EOJ A;  1X48 A;  3F6H A;  3EPH A;  4GKK E;  2EMG A;  2EE8 A;  3L00 A;  4DV6 E;  4DV3 E;  5AE1 A;  2UXC E;  2EPP A;  2ENC A;  2FTX B;  3FIG A;  4MLQ A;  4DV4 E;  5IWA E;  5A69 A;  1I94 E;  4LFA E;  2JR1 A;  1LLM C;  3J81 C;  1BBG A;  2RSM A;  5KL7 A;  4TUG A;  1N34 E;  4R2D A;  1ZBT A;  4R03 A;  1L4S A;  4ZYD A;  4Q28 A;  1P47 A;  5A6B A;  2YTN A;  2YTD A;  1IBL E;  4M30 A;  2JPA A;  2EPX A;  2B7V A;  2EPN A;  1XMQ E;  2NUE A;  1A1H A;  1A1L A;  4JI3 E;  4BC7 A;  2DIX A;  2EN8 A;  2EOY A;  2YU5 A;  1A1J A;  4DV5 E;  4LF5 E;  4R2C A;  1RMD A;  4LF6 E;  1WXR A;  2ENA A;  1YYW A;  4B3S E;  1SFE A;  1T4O A;  2ELY A;  2RS7 A;  3IWC A;  1GZ6 A;  2EMW A;  2ODR D;  4RHB B;  1QNT A;  1J26 A;  2D9H A;  1UBD C;  2HHH E;  1KYQ A;  4R2P A;  3MHH C;  2E5L E;  4DR6 E;  4DR5 E;  1SR9 A;  2ODR C;  2BB8 A;  2RTX A;  4JYA E;  2EMF A;  4LF7 E;  3HTX A;  4DR4 E;  4BHC A;  4JI8 E;  2B3T B;  2EPZ A;  1PKP A;  2DB2 A;  2WBU A;  4BBY A;  2EPO A;  2M4I A;  4M2Z A;  2LTR A;  2LCE A;  5A6B D; 
#chains in the Genus database with same CATH homology
 3VYY A;  1STU A;  4R8O A;  1QU6 A;  2B9D A;  5A2Q C;  4GKJ E;  2YZT A;  4WSP A;  4JI0 E;  3RMP A;  4M0V A;  3T1H E;  1O0W A;  1RQ0 A;  4BCA A;  4LF4 E;  3ADL A;  1X49 A;  2V88 A;  3HPS A;  5FLX C;  5LL6 R;  4F9C B;  1N36 E;  4F9B B;  1HNX E;  1IBM E;  2UU9 E;  4J8Z A;  2L3J A;  3T1Y E;  4JI2 E;  4B3T E;  4DR7 E;  1DI2 A;  2DSY A;  3HPZ A;  3HXL A;  2F8B A;  3HQ1 A;  4F9A B;  2F4V E;  3C4B A;  4JI1 E;  5AE3 A;  1XMO E;  2YT4 A;  3ADG A;  1YZ9 A;  2L3C A;  4DV0 E;  2NA2 A;  5ADZ A;  4OX9 E;  4WFT A;  4DV7 E;  2V8Q B;  2H36 X;  3C4T A;  3IWD A;  2V87 A;  3F6G A;  4L8N A;  2N3H A;  4KZS A;  1WHN A;  3IWB A;  2JOB A;  1X48 A;  2LE2 A;  3F6H A;  4WPY A;  4P7D A;  4GKK E;  4X64 E;  4DV6 E;  4GEQ B;  4DV3 E;  5AE1 A;  4JYA E;  2UXC E;  3ADJ A;  4X8W A;  2L8T A;  4BMJ A;  2LUQ A;  2FTX B;  3FIG A;  1FJG E;  2NUG A;  3H09 A;  4DV4 E;  2UUC E;  5IWA E;  2LJH A;  4WYQ B;  5AAS A;  1I94 E;  3DJW A;  4JI6 E;  4B3R E;  4LFA E;  2JR1 A;  2L6M A;  4JI7 E;  5LMU E;  3J81 C;  4LFC E;  2IHR 1;  1N33 E;  2RSM A;  4TUG A;  1N34 E;  4L5N C;  3ZOQ B;  4DKK A;  4DV1 E;  1N32 E;  1ZBT A;  2MDR A;  3JTZ A;  4LTY A;  4R03 A;  5IT9 C;  5BR8 E;  5T6J A;  4Q28 A;  2JWO A;  2VF1 A;  1YYO A;  2JY9 A;  2LTS A;  4F54 A;  1IBL E;  4NXN E;  4M30 A;  2LMZ A;  3AV0 A;  5AE2 A;  4X65 E;  2G7H A;  2VQF E;  1IBK E;  3VK6 A;  2B7V A;  4X66 E;  1WHQ A;  1XMQ E;  2JOX A;  2VE7 C;  2NUE A;  3J7Y p;  1UIL A;  3VYX A;  4JI3 E;  4LFB E;  2M7Q A;  2L2K B;  4BC7 A;  4DV2 E;  2DIX A;  4KHP E;  1X47 A;  2N3G A;  2CPN A;  5DNY A;  4DR1 E;  4DUY E;  1RC7 A;  3KWR A;  3OTO E;  4DR3 E;  4DV5 E;  3LML A;  1FKA E;  4LF5 E;  2M1S A;  2V86 A;  4AQY E;  2L2M A;  1WXR A;  2LUP B;  4LF6 E;  1YYW A;  4JV5 E;  4BC9 A;  2LRS A;  4JI4 E;  2LBS B;  2RS6 A;  4B3S E;  2V89 A;  2K4V A;  2EZ6 A;  2V85 A;  4LF9 E;  5CFF E;  2UXD E;  1T4O A;  3IWC A;  2RS7 A;  2EWL A;  1GZ6 A;  2ODR D;  1XNR E;  3JU0 A;  1UHZ A;  1GQE A;  3DF6 A;  4LU9 A;  4DUZ E;  1J26 A;  2WZO A;  2ZM6 E;  2HHH E;  1EKZ A;  1T4N A;  2MC5 A;  4P78 A;  2E5L E;  4DR6 E;  2E1M A;  2JVA A;  4DR5 E;  1SR9 A;  4DR2 E;  2UXB E;  4YHH E;  2FV4 B;  4TUI A;  1YYK A;  1HNW E;  3OML A;  2ODR C;  2KOU A;  3K6Q A;  1HR0 E;  2VQE E;  2RTX A;  1DQ3 A;  2DMY A;  2L92 A;  1ZBQ A;  3MSW A;  3P1X A;  4BS9 A;  4YY3 E;  1T4L B;  2UUA E;  4LF8 E;  4LF7 E;  3LLH A;  3J80 C;  3HTX A;  4DR4 E;  4B3M E;  4JI8 E;  2B3T B;  2B7T A;  4X62 E;  1PKP A;  2MC6 A;  3AUZ A;  2DB2 A;  2UUB E;  1XNQ E;  4K0K E;  4DMI A;  1J5E E;  4BBY A;  4JI5 E;  4NXM E;  3J7A G;  3ADI A;  2L2N A;  3JAM C;  2M4I A;  2L33 A;  2FGG A;  2V83 A;  2KON A;  2KHX A;  5LMN E;  4M2Z A;  2NUF A;  2LTR A;  1HNZ E;  4OOG C;  4I8O A;  5F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...