1X48A

Solution structure of the second dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
GSSGSSGYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
publication title Solution structure of the second DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x48A00
2UXDE 2DB2A 4GKKE 4DR5E 1T4LB 4JI7E 3VYXA 2LTRA 2RTXA 2EZ6A 1XMOE 2N3GA 5CFFE 4DR4E 1HNXE 4NXME 1X49A 4DV4E 4B3ME 2L2NA 1X47A 2RSMA 2E5LE 2CPNA 2B3TB 1T4OA 1WHQA 4X64E 2NUGA 4DV5E 4DR6E 3ADGA 1N34E 4DR3E 4B3TE 2IHR1 4JI2E 4X8WA 3J7Yp 1EKZA 2NA2A 4X65E 4GKJE 4JI3E 5IWAE 4LF4E 3T1HE 1X48A 1IBKE 1YYWA 4LFAE 4LF7E 2ZM6E 2YT4A 2LUPB 2JVAA 4DV1E 1GQEA 2LTSA 4X62E 3ADIA 4DV0E 4JI1E 4KHPE 1RQ0A 4WFTA 2JY9A 1PKPA 1ZBTA 1UILA 5LMNE 1T4NA 2LJHA 1XMQE 1WHNA 2RS7A 4DUYE 2MDRA 4DV3E 4JI4E 2B7TA 4JYAE 1J5EE 4JI8E 1I94E 4B3SE 1STUA 1YYKA 5BR8E 4AQYE 3P1XA 1N32E 2F4VE 4LFBE 2UUCE 3OTOE 4LF9E 3T1YE 2L3JA 4DV6E 1HR0E 4LF6E 4DKKA 3C4TA 1HNWE 4X66E 4JI0E 3VYYA 2LRSA 1YYOA 5LMUE 4YY3E 2UUAE 1N33E 3LLHA 2HHHE 4OX9E 1J26A 2NUEA 2RS6A 1QU6A 2N3HA 2L2MA 2B7VA 1XNQE 1XNRE 1N36E 4OOGC 4M2ZA 1UHZA 4YHHE 2L33A 3HTXA 3ADJA 2NUFA 2DMYA 4DR2E 1IBLE 4K0KE 3C4BA 4JV5E 4WYQB 1FKAE 4LF8E 4NXNE 4DV2E 4DV7E 1RC7A 4JI6E 1O0WA 2VQEE 2DIXA 2LUQA 2LBSB 2UUBE 4LFCE 1HNZE 4B3RE 2VQFE 4JI5E 1IBME 2UXCE 1YZ9A 1DI2A 2UU9E 2L3CA 2L2KB 3ADLA 1FJGE 2KHXA 4LF5E 2UXBE 4DUZE 4DR1E 4DR7E 4M30A
chains in the Genus database with same CATH superfamily
1A1JA 5A6AA 2L92A 4DR5E 2EOJA 2WZOA 4JI7E 1EH8A 4X9JA 1XMOE 2CTDA 2VF1A 2KONA 4WXCA 2WCC3 5LLQA 4WSPA 3IWCA 3EPKA 1WJPA 2E5LE 1T4OA 2ENCA 2KOUA 1Z1BA 4R8OA 1N34E 4X8WA 4MLVA 3THNA 2JR1A 1ZR9A 1IBKE 3BF2A 1YYWA 2YRKA 2ZM6E 1X6EA 1GQEA 1F2IG 1YPNA 2EE8A 2YTDA 2EQ0A 2EOHA 4JI1E 1G2FC 2EJ4A 2V8QB 2FV4B 3TQMA 1UILA 2MDGA 2LJUA 3AUZA 1JK1A 2EPAA 4BS9A 1T39A 4F2JC 4BCAA 2EOQA 5AE3A 2Q8UA 4HTGA 2GLIA 1YYKA 4BMJA 4IS1C 2EL4A 4F9CB 2R76A 2UUCE 2JWOA 4LF6E 2YTPA 4RHBB 2EM7A 4YY3E 1X5WA 2UUAE 1KYQA 1A1GA 1QU6A 2L2MA 2I13A 2H36X 1XNQE 1N36E 4OOGC 1A1LA 2YTEA 1BBOA 4DR2E 1IBLE 4JV5E 3BGHA 1BBGA 5KL7A 2EN3A 1TF6A 4R2RA 4DV2E 1RC7A 1O0WA 2UUBE 4LFCE 1DGCA 4JI5E 3KWRA 1IBME 2ADRA 1YZ9A 1DI2A 4KWYA 2YTJA 5KL4A 2L2KB 3MHSC 4LF5E 2EOMA 4R2QA 4DUZE 1QNTA 2G7HA 2ODRD 2K7IA 4R03A 2YPNA 2DB2A 2DMIA 1T4LB 3C6KA 3MSWA 3J7AG 3VYXA 1BB8A 2EZ6A 4R2CA 4RH8A 4DR4E 4NXME 5AE1A 5T6JA 2EM6A 4B3ME 1X6HA 1WHQA 2EPPA 5F3WA 1YFHA 4DR6E 4L8NA 1A1KA 4DR3E 1L4SA 3EPLA 3UK3C 5KL6A 4JI2E 2CSHA 3J7Yp 3THOB 4GKJE 4JI3E 3EPHA 2EM0A 3L00A 5KL3A 1X48A 4LF7E 3ZOQB 2LUPB 2ENAA 2EN6A 4DV1E 2LTSA 3KZYA 4ZYDA 3IWDA 2V89A 4DV0E 2VE7C 2EMFA 2EPXA 2V87A 2EWLA 2JY9A 4WFTA 2RQLA 4J8ZA 1LLMC 5LMNE 4F54A 3HPZA 2LO3A 2YTGA 4FK5C 1ZBQA 3VHTB 2RS7A 2MDRA 4DV3E 4JI4E 2RSIA 4KZSA 2EM8A 1G2DC 1I94E 4Q28A 2V86A 4B3SE 1STUA 4O24A 4AQYE 3AV0A 1N3GA 2GHFA 2F4VE 4LFBE 4O5GA 2EN4A 3OTOE 4LF9E 2LCEA 3T1YE 4GEQB 2L3JA 3F6HA 2EMKA 2YSPA 1HNWE 4X66E 2WBSA 2ELYA 2YWQA 1N33E 3LLHA 4ZYEA 3M99B 1J26A 2NUEA 2RS6A 1IQSA 2EM2A 1KJKA 2LT7A 1XNRE 3HPSA 1GZ6A 4BC9A 1UHZA 2BBGA 3HTXA 2DMYA 2R1FA 4L5NC 4K0KE 2EOFA 1FKAE 2RPCA 4NXNE 2EP3A 2F8BA 5A69A 4DV7E 2YRMA 3HXLA 1GTKA 5A6KA 3F6GA 2ENHA 2J7JA 5TSEA 2EN1A 2YU8A 2WBUA 2HJJA 3ADLA 4WPYA 2EMCA 2EMBA 4TUGA 5IXMB 1PJQA 4DR7E 1MEYC 2DGCA 2UXDE 2YTIA 4N4RB 2DLQA 2EM9A 2DLKA 3C6MA 4DV4E 2EL6A 4IJDA 2NUGA 4P7DA 2M4IA 3KZZA 2EORA 2D9HA 1EKZA 2YRHA 4F9AB 3K6QA 3EPJA 4R2SA 1P47A 5A2QC 2YT4A 1MGTA 1ZAAC 4X62E 3FIGA 4WSGA 3JAMC 2EOIA 1UBDC 2EN2A 2EMLA 5A6JA 3ADIA 1B69A 2DRPA 4KHPE 1RQ0A 1WXRA 2EPRA 1PKPA 1YSAC 4LTYA 1T4NA 5AASA 1WHNA 3BIDA 3VK6A 4R2DA 2B7TA 2EOOA 2L6MA 2EMAA 1SFEA 5ADZA 2V88A 2EM4A 4I8OA 2B9DA 5BR8E 1A1IA 1HR0E 4DV6E 2MKNA 4JI0E 2EN7A 1YYOA 1JK2A 1NCSA 2JXPA 2JOXA 4OX9E 1RMDA 4Q35B 2A25A 1SR9A 2PRTA 2EPNA 3OMLA 2M7QA 1WRJA 2EOEA 1ZU1A 4F6NA 4YHHE 3ADJA 2EOXA 2JPAA 5KL2A 3C4BA 3DF6A 2EN8A 5AC4A 4LF8E 5A6BD 1T38A 2EPLX 2K4VA 1TN9A 4LU9A 4ZYGA 2MC6A 4JI6E 2LMZA 2DIXA 2LUQA 5KL5A 1HNZE 2HGHA 2DSYA 5A6BA 2EQ3A 4MLQA 2UU9E 5AC5A 1FJGE 2KHXA 3J81C 2VRDA 4DR1E 4BHBA 4M30A 3IWBA 2HHHE 4O4KA 3J80C 4GKKE 2EMZA 2HC5A 4WXDA 2LTRA 2RTXA 2V83A 4R2EA 2N3GA 5CFFE 3JU0A 2EMXA 3MHHC 1HNXE 1YUJA 1X49A 2L2NA 1X47A 2EPMX 2RSMA 2CPNA 2B3TB 4X64E 4DV5E 1PJTA 2MKDA 2E1MA 3ADGA 1YUIA 2EL5A 4B3TE 2IHR1 1EH6A 2NA2A 2YU5A 4X65E 2FGGA 2EMIA 2LV2A 5IWAE 5DNYA 2EOZA 4LF4E 2EPCA 2CT1A 1TF3A 1IMUA 3RMPA 3T1HE 3BBGA 4M9VC 2EOYA 4BHCA 4LFAE 2JVAA 2ODRC 2YTOA 4WX9A 3LMLA 2FTXB 2I9IA 4P78A 1AH5A 2M9AA 2EPUA 3HQ1A 1ZBTA 2E72A 4NZVA 4R2AA 2EQ1A 2LJHA 1XMQE 5LL6R 2YZTA 4NHRA 4DUYE 4JYAE 2LVHA 1J5EE 4JI8E 2EMHA 1DQ3A 3ECRA 2JP9A 2ELZA 2N8XA 2EPOA 3P1XA 1N32E 4BC7A 2YSOA 2EOSA 1UN6B 1NEIA 3C4TA 4DKKA 2BB8A 2YTQA 2MC5A 3VYYA 2LRSA 5LMUE 2GPIA 4TUIA 1A1HA 1EH7A 3H09A 1A1FA 2EMYA 3EQ1A 4O43A 1AAYA 2N3HA 4F6MA 2WBTA 2B7VA 1X3CA 4M2ZA 2LE2A 5AE2A 2M1SA 2L33A 2EM5A 2NUFA 4R2PA 5IT9C 2L8TA 4DMIA 2JOBA 5IV8B 4WYQB 2EMGA 3DJWA 1IQOA 4F9BB 2EPKX 2VQEE 2EM3A 2LBSB 2EMWA 4B3RE 4ZYHA 2VQFE 2YTNA 3QG5C 1PJSA 5FLXC 4GZNC 2UXCE 2JYAA 2L3CA 4HEIA 4BBYA 2EPZA 1PDAA 1X6FA 3JTZA 2YTFA 2NABA 4M0VA 2UXBE 2V85A
chains in the Genus database with same CATH topology
4R03A 2UXDE 2DB2A 2L92A 3J80C 4GKKE 4DR5E 1T4LB 2WZOA 3MSWA 4JI7E 3J7AG 3VYXA 2LTRA 2RTXA 2EZ6A 2V83A 1XMOE 2N3GA 5CFFE 3JU0A 2VF1A 4DR4E 2KONA 1HNXE 4NXME 5AE1A 5T6JA 1X49A 4DV4E 4B3ME 2L2NA 1X47A 2RSMA 3IWCA 4WSPA 2E5LE 2CPNA 2B3TB 1T4OA 1WHQA 4X64E 2KOUA 4DV5E 4P7DA 5F3WA 2M4IA 2E1MA 2NUGA 4DR6E 3ADGA 4L8NA 4R8OA 4DR3E 1N34E 4B3TE 2IHR1 4JI2E 4X8WA 3J7Yp 1EKZA 2NA2A 4F9AB 3K6QA 4X65E 4GKJE 4JI3E 2FGGA 5IWAE 2JR1A 5DNYA 4LF4E 3RMPA 3T1HE 1X48A 1IBKE 1YYWA 5A2QC 4LFAE 4LF7E 3ZOQB 2YT4A 2ZM6E 2LUPB 2JVAA 4DV1E 2ODRC 1GQEA 2LTSA 4X62E 3FIGA 3JAMC 3IWDA 2V89A 3ADIA 4DV0E 4JI1E 2VE7C 4KHPE 1RQ0A 3LMLA 1WXRA 2FTXB 2V87A 4WFTA 2EWLA 2JY9A 2V8QB 1PKPA 2FV4B 4P78A 3HQ1A 4J8ZA 1ZBTA 1UILA 4F54A 5LMNE 3HPZA 3AUZA 4LTYA 1T4NA 2LJHA 5AASA 1XMQE 5LL6R 1WHNA 2YZTA 1ZBQA 2RS7A 4BS9A 2MDRA 3VK6A 4DUYE 4DV3E 4JI4E 2B7TA 4BCAA 4JYAE 4KZSA 2L6MA 1J5EE 5AE3A 4JI8E 1I94E 5ADZA 2V88A 4Q28A 1DQ3A 2V86A 4B3SE 1STUA 1YYKA 4I8OA 4BMJA 2B9DA 5BR8E 4AQYE 3AV0A 3P1XA 4F9CB 1N32E 2F4VE 4LFBE 4BC7A 2UUCE 3OTOE 2JWOA 4LF9E 3T1YE 4GEQB 2L3JA 3F6HA 4DV6E 1HR0E 3C4TA 4DKKA 4LF6E 1HNWE 2MC5A 4X66E 4JI0E 3VYYA 2LRSA 1YYOA 5LMUE 4YY3E 4TUIA 2JOXA 2UUAE 1N33E 3LLHA 3H09A 2HHHE 4OX9E 1J26A 2NUEA 2RS6A 1QU6A 1SR9A 2N3HA 2L2MA 2B7VA 2H36X 1XNQE 3OMLA 1XNRE 3HPSA 2M7QA 1N36E 1GZ6A 4OOGC 4BC9A 4M2ZA 2LE2A 4DR7E 5AE2A 1UHZA 2M1SA 4YHHE 2L33A 3HTXA 3ADJA 2NUFA 5IT9C 2DMYA 2L8TA 4DMIA 4L5NC 4DR2E 2JOBA 1IBLE 4K0KE 3C4BA 4JV5E 4WYQB 3DF6A 1FKAE 4LF8E 4NXNE 2F8BA 2K4VA 4LU9A 3DJWA 4DV2E 2MC6A 4DV7E 3HXLA 4F9BB 1RC7A 4JI6E 1O0WA 2VQEE 2LMZA 2DIXA 2LUQA 2LBSB 2UUBE 4LFCE 1HNZE 4B3RE 3F6GA 2VQFE 4JI5E 3KWRA 5FLXC 2DSYA 1IBME 1YZ9A 1DI2A 2UXCE 2UU9E 2L3CA 4BBYA 2L2KB 3ADLA 4WPYA 1FJGE 3JTZA 2KHXA 3J81C 4LF5E 4TUGA 2UXBE 4M0VA 4DUZE 4DR1E 2G7HA 2ODRD 2V85A 4M30A 3IWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD E;  2DB2 A;  4GKK E;  4DR5 E;  1T4L B;  4JI7 E;  3VYX A;  2LTR A;  2RTX A;  2EZ6 A;  1XMO E;  2N3G A;  5CFF E;  4DR4 E;  1HNX E;  4NXM E;  1X49 A;  4DV4 E;  4B3M E;  2L2N A;  1X47 A;  2RSM A;  2E5L E;  2CPN A;  2B3T B;  1T4O A;  1WHQ A;  4X64 E;  2NUG A;  4DV5 E;  4DR6 E;  3ADG A;  1N34 E;  4DR3 E;  4B3T E;  2IHR 1;  4JI2 E;  4X8W A;  3J7Y p;  1EKZ A;  2NA2 A;  4X65 E;  4GKJ E;  4JI3 E;  5IWA E;  4LF4 E;  3T1H E;  1X48 A;  1IBK E;  1YYW A;  4LFA E;  4LF7 E;  2ZM6 E;  2YT4 A;  2LUP B;  2JVA A;  4DV1 E;  1GQE A;  2LTS A;  4X62 E;  3ADI A;  4DV0 E;  4JI1 E;  4KHP E;  1RQ0 A;  4WFT A;  2JY9 A;  1PKP A;  1ZBT A;  1UIL A;  5LMN E;  1T4N A;  2LJH A;  1XMQ E;  1WHN A;  2RS7 A;  4DUY E;  2MDR A;  4DV3 E;  4JI4 E;  2B7T A;  4JYA E;  1J5E E;  4JI8 E;  1I94 E;  4B3S E;  1STU A;  1YYK A;  5BR8 E;  4AQY E;  3P1X A;  1N32 E;  2F4V E;  4LFB E;  2UUC E;  3OTO E;  4LF9 E;  3T1Y E;  2L3J A;  4DV6 E;  1HR0 E;  4LF6 E;  4DKK A;  3C4T A;  1HNW E;  4X66 E;  4JI0 E;  3VYY A;  2LRS A;  1YYO A;  5LMU E;  4YY3 E;  2UUA E;  1N33 E;  3LLH A;  2HHH E;  4OX9 E;  1J26 A;  2NUE A;  2RS6 A;  1QU6 A;  2N3H A;  2L2M A;  2B7V A;  1XNQ E;  1XNR E;  1N36 E;  4OOG C;  4M2Z A;  1UHZ A;  4YHH E;  2L33 A;  3HTX A;  3ADJ A;  2NUF A;  2DMY A;  4DR2 E;  1IBL E;  4K0K E;  3C4B A;  4JV5 E;  4WYQ B;  1FKA E;  4LF8 E;  4NXN E;  4DV2 E;  4DV7 E;  1RC7 A;  4JI6 E;  1O0W A;  2VQE E;  2DIX A;  2LUQ A;  2LBS B;  2UUB E;  4LFC E;  1HNZ E;  4B3R E;  2VQF E;  4JI5 E;  1IBM E;  2UXC E;  1YZ9 A;  1DI2 A;  2UU9 E;  2L3C A;  2L2K B;  3ADL A;  1FJG E;  2KHX A;  4LF5 E;  2UXB E;  4DUZ E;  4DR1 E;  4DR7 E;  4M30 A; 
#chains in the Genus database with same CATH topology
 1A1J A;  5A6A A;  2L92 A;  4DR5 E;  2EOJ A;  2WZO A;  4JI7 E;  1EH8 A;  4X9J A;  1XMO E;  2CTD A;  2VF1 A;  2KON A;  4WXC A;  2WCC 3;  5LLQ A;  4WSP A;  3IWC A;  3EPK A;  1WJP A;  2E5L E;  1T4O A;  2ENC A;  2KOU A;  1Z1B A;  4R8O A;  1N34 E;  4X8W A;  4MLV A;  3THN A;  2JR1 A;  1ZR9 A;  1IBK E;  3BF2 A;  1YYW A;  2YRK A;  2ZM6 E;  1X6E A;  1GQE A;  1F2I G;  1YPN A;  2EE8 A;  2YTD A;  2EQ0 A;  2EOH A;  4JI1 E;  1G2F C;  2EJ4 A;  2V8Q B;  2FV4 B;  3TQM A;  1UIL A;  2MDG A;  2LJU A;  3AUZ A;  1JK1 A;  2EPA A;  4BS9 A;  1T39 A;  4F2J C;  4BCA A;  2EOQ A;  5AE3 A;  2Q8U A;  4HTG A;  2GLI A;  1YYK A;  4BMJ A;  4IS1 C;  2EL4 A;  4F9C B;  2R76 A;  2UUC E;  2JWO A;  4LF6 E;  2YTP A;  4RHB B;  2EM7 A;  4YY3 E;  1X5W A;  2UUA E;  1KYQ A;  1A1G A;  1QU6 A;  2L2M A;  2I13 A;  2H36 X;  1XNQ E;  1N36 E;  4OOG C;  1A1L A;  2YTE A;  1BBO A;  4DR2 E;  1IBL E;  4JV5 E;  3BGH A;  1BBG A;  5KL7 A;  2EN3 A;  1TF6 A;  4R2R A;  4DV2 E;  1RC7 A;  1O0W A;  2UUB E;  4LFC E;  1DGC A;  4JI5 E;  3KWR A;  1IBM E;  2ADR A;  1YZ9 A;  1DI2 A;  4KWY A;  2YTJ A;  5KL4 A;  2L2K B;  3MHS C;  4LF5 E;  2EOM A;  4R2Q A;  4DUZ E;  1QNT A;  2G7H A;  2ODR D;  2K7I A;  4R03 A;  2YPN A;  2DB2 A;  2DMI A;  1T4L B;  3C6K A;  3MSW A;  3J7A G;  3VYX A;  1BB8 A;  2EZ6 A;  4R2C A;  4RH8 A;  4DR4 E;  4NXM E;  5AE1 A;  5T6J A;  2EM6 A;  4B3M E;  1X6H A;  1WHQ A;  2EPP A;  5F3W A;  1YFH A;  4DR6 E;  4L8N A;  1A1K A;  4DR3 E;  1L4S A;  3EPL A;  3UK3 C;  5KL6 A;  4JI2 E;  2CSH A;  3J7Y p;  3THO B;  4GKJ E;  4JI3 E;  3EPH A;  2EM0 A;  3L00 A;  5KL3 A;  1X48 A;  4LF7 E;  3ZOQ B;  2LUP B;  2ENA A;  2EN6 A;  4DV1 E;  2LTS A;  3KZY A;  4ZYD A;  3IWD A;  2V89 A;  4DV0 E;  2VE7 C;  2EMF A;  2EPX A;  2V87 A;  2EWL A;  2JY9 A;  4WFT A;  2RQL A;  4J8Z A;  1LLM C;  5LMN E;  4F54 A;  3HPZ A;  2LO3 A;  2YTG A;  4FK5 C;  1ZBQ A;  3VHT B;  2RS7 A;  2MDR A;  4DV3 E;  4JI4 E;  2RSI A;  4KZS A;  2EM8 A;  1G2D C;  1I94 E;  4Q28 A;  2V86 A;  4B3S E;  1STU A;  4O24 A;  4AQY E;  3AV0 A;  1N3G A;  2GHF A;  2F4V E;  4LFB E;  4O5G A;  2EN4 A;  3OTO E;  4LF9 E;  2LCE A;  3T1Y E;  4GEQ B;  2L3J A;  3F6H A;  2EMK A;  2YSP A;  1HNW E;  4X66 E;  2WBS A;  2ELY A;  2YWQ A;  1N33 E;  3LLH A;  4ZYE A;  3M99 B;  1J26 A;  2NUE A;  2RS6 A;  1IQS A;  2EM2 A;  1KJK A;  2LT7 A;  1XNR E;  3HPS A;  1GZ6 A;  4BC9 A;  1UHZ A;  2BBG A;  3HTX A;  2DMY A;  2R1F A;  4L5N C;  4K0K E;  2EOF A;  1FKA E;  2RPC A;  4NXN E;  2EP3 A;  2F8B A;  5A69 A;  4DV7 E;  2YRM A;  3HXL A;  1GTK A;  5A6K A;  3F6G A;  2ENH A;  2J7J A;  5TSE A;  2EN1 A;  2YU8 A;  2WBU A;  2HJJ A;  3ADL A;  4WPY A;  2EMC A;  2EMB A;  4TUG A;  5IXM B;  1PJQ A;  4DR7 E;  1MEY C;  2DGC A;  2UXD E;  2YTI A;  4N4R B;  2DLQ A;  2EM9 A;  2DLK A;  3C6M A;  4DV4 E;  2EL6 A;  4IJD A;  2NUG A;  4P7D A;  2M4I A;  3KZZ A;  2EOR A;  2D9H A;  1EKZ A;  2YRH A;  4F9A B;  3K6Q A;  3EPJ A;  4R2S A;  1P47 A;  5A2Q C;  2YT4 A;  1MGT A;  1ZAA C;  4X62 E;  3FIG A;  4WSG A;  3JAM C;  2EOI A;  1UBD C;  2EN2 A;  2EML A;  5A6J A;  3ADI A;  1B69 A;  2DRP A;  4KHP E;  1RQ0 A;  1WXR A;  2EPR A;  1PKP A;  1YSA C;  4LTY A;  1T4N A;  5AAS A;  1WHN A;  3BID A;  3VK6 A;  4R2D A;  2B7T A;  2EOO A;  2L6M A;  2EMA A;  1SFE A;  5ADZ A;  2V88 A;  2EM4 A;  4I8O A;  2B9D A;  5BR8 E;  1A1I A;  1HR0 E;  4DV6 E;  2MKN A;  4JI0 E;  2EN7 A;  1YYO A;  1JK2 A;  1NCS A;  2JXP A;  2JOX A;  4OX9 E;  1RMD A;  4Q35 B;  2A25 A;  1SR9 A;  2PRT A;  2EPN A;  3OML A;  2M7Q A;  1WRJ A;  2EOE A;  1ZU1 A;  4F6N A;  4YHH E;  3ADJ A;  2EOX A;  2JPA A;  5KL2 A;  3C4B A;  3DF6 A;  2EN8 A;  5AC4 A;  4LF8 E;  5A6B D;  1T38 A;  2EPL X;  2K4V A;  1TN9 A;  4LU9 A;  4ZYG A;  2MC6 A;  4JI6 E;  2LMZ A;  2DIX A;  2LUQ A;  5KL5 A;  1HNZ E;  2HGH A;  2DSY A;  5A6B A;  2EQ3 A;  4MLQ A;  2UU9 E;  5AC5 A;  1FJG E;  2KHX A;  3J81 C;  2VRD A;  4DR1 E;  4BHB A;  4M30 A;  3IWB A;  2HHH E;  4O4K A;  3J80 C;  4GKK E;  2EMZ A;  2HC5 A;  4WXD A;  2LTR A;  2RTX A;  2V83 A;  4R2E A;  2N3G A;  5CFF E;  3JU0 A;  2EMX A;  3MHH C;  1HNX E;  1YUJ A;  1X49 A;  2L2N A;  1X47 A;  2EPM X;  2RSM A;  2CPN A;  2B3T B;  4X64 E;  4DV5 E;  1PJT A;  2MKD A;  2E1M A;  3ADG A;  1YUI A;  2EL5 A;  4B3T E;  2IHR 1;  1EH6 A;  2NA2 A;  2YU5 A;  4X65 E;  2FGG A;  2EMI A;  2LV2 A;  5IWA E;  5DNY A;  2EOZ A;  4LF4 E;  2EPC A;  2CT1 A;  1TF3 A;  1IMU A;  3RMP A;  3T1H E;  3BBG A;  4M9V C;  2EOY A;  4BHC A;  4LFA E;  2JVA A;  2ODR C;  2YTO A;  4WX9 A;  3LML A;  2FTX B;  2I9I A;  4P78 A;  1AH5 A;  2M9A A;  2EPU A;  3HQ1 A;  1ZBT A;  2E72 A;  4NZV A;  4R2A A;  2EQ1 A;  2LJH A;  1XMQ E;  5LL6 R;  2YZT A;  4NHR A;  4DUY E;  4JYA E;  2LVH A;  1J5E E;  4JI8 E;  2EMH A;  1DQ3 A;  3ECR A;  2JP9 A;  2ELZ A;  2N8X A;  2EPO A;  3P1X A;  1N32 E;  4BC7 A;  2YSO A;  2EOS A;  1UN6 B;  1NEI A;  3C4T A;  4DKK A;  2BB8 A;  2YTQ A;  2MC5 A;  3VYY A;  2LRS A;  5LMU E;  2GPI A;  4TUI A;  1A1H A;  1EH7 A;  3H09 A;  1A1F A;  2EMY A;  3EQ1 A;  4O43 A;  1AAY A;  2N3H A;  4F6M A;  2WBT A;  2B7V A;  1X3C A;  4M2Z A;  2LE2 A;  5AE2 A;  2M1S A;  2L33 A;  2EM5 A;  2NUF A;  4R2P A;  5IT9 C;  2L8T A;  4DMI A;  2JOB A;  5IV8 B;  4WYQ B;  2EMG A;  3DJW A;  1IQO A;  4F9B B;  2EPK X;  2VQE E;  2EM3 A;  2LBS B;  2EMW A;  4B3R E;  4ZYH A;  2VQF E;  2YTN A;  3QG5 C;  1PJS A;  5FLX C;  4GZN C;  2UXC E;  2JYA A;  2L3C A;  4HEI A;  4BBY A;  2EPZ A;  1PDA A;  1X6F A;  3JTZ A;  2YTF A;  2NAB A;  4M0V A;  2UXB E;  2V85 A; 
#chains in the Genus database with same CATH homology
 4R03 A;  2UXD E;  2DB2 A;  2L92 A;  3J80 C;  4GKK E;  4DR5 E;  1T4L B;  2WZO A;  3MSW A;  4JI7 E;  3J7A G;  3VYX A;  2LTR A;  2RTX A;  2EZ6 A;  2V83 A;  1XMO E;  2N3G A;  5CFF E;  3JU0 A;  2VF1 A;  4DR4 E;  2KON A;  1HNX E;  4NXM E;  5AE1 A;  5T6J A;  1X49 A;  4DV4 E;  4B3M E;  2L2N A;  1X47 A;  2RSM A;  3IWC A;  4WSP A;  2E5L E;  2CPN A;  2B3T B;  1T4O A;  1WHQ A;  4X64 E;  2KOU A;  4DV5 E;  4P7D A;  5F3W A;  2M4I A;  2E1M A;  2NUG A;  4DR6 E;  3ADG A;  4L8N A;  4R8O A;  4DR3 E;  1N34 E;  4B3T E;  2IHR 1;  4JI2 E;  4X8W A;  3J7Y p;  1EKZ A;  2NA2 A;  4F9A B;  3K6Q A;  4X65 E;  4GKJ E;  4JI3 E;  2FGG A;  5IWA E;  2JR1 A;  5DNY A;  4LF4 E;  3RMP A;  3T1H E;  1X48 A;  1IBK E;  1YYW A;  5A2Q C;  4LFA E;  4LF7 E;  3ZOQ B;  2YT4 A;  2ZM6 E;  2LUP B;  2JVA A;  4DV1 E;  2ODR C;  1GQE A;  2LTS A;  4X62 E;  3FIG A;  3JAM C;  3IWD A;  2V89 A;  3ADI A;  4DV0 E;  4JI1 E;  2VE7 C;  4KHP E;  1RQ0 A;  3LML A;  1WXR A;  2FTX B;  2V87 A;  4WFT A;  2EWL A;  2JY9 A;  2V8Q B;  1PKP A;  2FV4 B;  4P78 A;  3HQ1 A;  4J8Z A;  1ZBT A;  1UIL A;  4F54 A;  5LMN E;  3HPZ A;  3AUZ A;  4LTY A;  1T4N A;  2LJH A;  5AAS A;  1XMQ E;  5LL6 R;  1WHN A;  2YZT A;  1ZBQ A;  2RS7 A;  4BS9 A;  2MDR A;  3VK6 A;  4DUY E;  4DV3 E;  4JI4 E;  2B7T A;  4BCA A;  4JYA E;  4KZS A;  2L6M A;  1J5E E;  5AE3 A;  4JI8 E;  1I94 E;  5ADZ A;  2V88 A;  4Q28 A;  1DQ3 A;  2V86 A;  4B3S E;  1STU A;  1YYK A;  4I8O A;  4BMJ A;  2B9D A;  5BR8 E;  4AQY E;  3AV0 A;  3P1X A;  4F9C B;  1N32 E;  2F4V E;  4LFB E;  4BC7 A;  2UUC E;  3OTO E;  2JWO A;  4LF9 E;  3T1Y E;  4GEQ B;  2L3J A;  3F6H A;  4DV6 E;  1HR0 E;  3C4T A;  4DKK A;  4LF6 E;  1HNW E;  2MC5 A;  4X66 E;  4JI0 E;  3VYY A;  2LRS A;  1YYO A;  5LMU E;  4YY3 E;  4TUI A;  2JOX A;  2UUA E;  1N33 E;  3LLH A;  3H09 A;  2HHH E;  4OX9 E;  1J26 A;  2NUE A;  2RS6 A;  1QU6 A;  1SR9 A;  2N3H A;  2L2M A;  2B7V A;  2H36 X;  1XNQ E;  3OML A;  1XNR E;  3HPS A;  2M7Q A;  1N36 E;  1GZ6 A;  4OOG C;  4BC9 A;  4M2Z A;  2LE2 A;  4DR7 E;  5AE2 A;  1UHZ A;  2M1S A;  4YHH E;  2L33 A;  3HTX A;  3ADJ A;  2NUF A;  5IT9 C;  2DMY A;  2L8T A;  4DMI A;  4L5N C;  4DR2 E;  2JOB A;  1IBL E;  4K0K E;  3C4B A;  4JV5 E;  4WYQ B;  3DF6 A;  1FKA E;  4LF8 E;  4NXN E;  2F8B A;  2K4V A;  4LU9 A;  3DJW A;  4DV2 E;  2MC6 A;  4DV7 E;  3HXL A;  4F9B B;  1RC7 A;  4JI6 E;  1O0W A;  2VQE E;  2LMZ A;  2DIX A;  2LUQ A;  2LBS B;  2UUB E;  4LFC E;  1HNZ E;  4B3R E;  3F6G A;  2VQF E;  4JI5 E;  3KWR A;  5FLX C;  2DSY A;  1IBM E;  1YZ9 A;  1DI2 A;  2UXC E;  2UU9 E;  2L3C A;  4BBY A;  2L2K B;  3ADL A;  4WPY A;  1FJG E;  3JTZ A;  2KHX A;  3J81 C;  4LF5 E;  4TUG A;  2UXB E;  4M0V A;  4DUZ E;  4DR1 E;  2G7H A;  2ODR D;  2V85 A;  4M30 A;  3IWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...