1X48A

Solution structure of the second dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
publication title Solution structure of the second DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x48A00
2F4VE 1XNQE 4JI7E 5LMNE 2LTRA 4M2ZA 4DV4E 1QU6A 2MDRA 2L2KB 4DV6E 3ADIA 2LJHA 3C4BA 4JI3E 4JI0E 2ZM6E 2DB2A 2RS6A 1YYWA 4X66E 1UHZA 4DV1E 1I94E 1IBLE 4KHPE 4DR5E 2CPNA 1X47A 4LFBE 4NXME 2NUFA 4DR1E 1HNZE 4WYQB 4JV5E 5CFFE 4DV3E 2DIXA 4X8WA 2L2MA 4DR6E 3C4TA 4LF5E 1PKPA 4LF7E 3OTOE 2L3CA 3HTXA 4LF6E 4DR2E 1N33E 2LUQA 4X65E 4DUZE 4GKJE 4X62E 4X64E 4M30A 1FKAE 1XMQE 4DV7E 4DR3E 2HHHE 1RQ0A 1J5EE 4JYAE 4WFTA 3T1HE 1IBKE 2RS7A 4AQYE 4YY3E 4DKKA 4DR7E 3LLHA 4JI6E 5BR8E 2LRSA 1FJGE 2EZ6A 2DMYA 1WHQA 1YYOA 1HNXE 1X48A 3J7Yp 2JVAA 2UXDE 1N34E 3ADJA 2L2NA 1N36E 1IBME 4LF4E 4LF9E 4JI8E 1T4OA 1N32E 2UXCE 2N3HA 2UU9E 1T4NA 4LF8E 2L33A 1DI2A 1YZ9A 1O0WA 2UUBE 4OX9E 4B3SE 1XNRE 1STUA 1T4LB 3VYXA 4YHHE 2YT4A 2VQEE 4JI4E 3ADGA 1WHNA 3P1XA 4B3ME 1UILA 2B3TB 4LFCE 4GKKE 2UXBE 2UUAE 2B7VA 3VYYA 4DV2E 2B7TA 2KHXA 4OOGC 4JI1E 4JI2E 4JI5E 2LUPB 5IWAE 4LFAE 2LTSA 2L3JA 2NUEA 4K0KE 1ZBTA 4NXNE 1XMOE 1YYKA 2E5LE 1HR0E 4DR4E 2IHR1 4B3RE 1EKZA 2RSMA 2N3GA 1X49A 2NUGA 1RC7A 2JY9A 3T1YE 5LMUE 4DV5E 2LBSB 4B3TE 1GQEA 1J26A 2VQFE 4DV0E 2UUCE 3ADLA 4DUYE 1HNWE 2RTXA 2NA2A
chains in the Genus database with same CATH superfamily
2F4VE 1XNQE 3KWRA 4JI7E 5LMNE 2LTRA 1WRJA 2L2KB 2EPRA 2EPKX 4WPYA 2MKDA 2JR1A 3C4BA 3ECRA 3VHTB 4JI3E 2ZM6E 2LVHA 2EL5A 3BIDA 1YYWA 4BHBA 5DNYA 1JK2A 4KHPE 2CPNA 2KOUA 2V83A 4LFBE 4BMJA 1HNZE 1ZU1A 4ZYEA 2NABA 3KZZA 4DR6E 3C4TA 5A69A 2LE2A 1PKPA 2EMIA 4MLQA 4M0VA 4ZYHA 4ZYDA 1YUJA 4F2JC 4DV7E 1A1HA 3J7AG 3BF2A 2JYAA 1RQ0A 5A6BD 2EMZA 4F9CB 2DRPA 2K4VA 2EM8A 4LTYA 2YRKA 3H09A 1TF6A 5BR8E 1SFEA 1FJGE 3AUZA 2V86A 1T39A 1X5WA 4N4RB 3ADJA 1KJKA 4LF4E 2YTNA 5AE3A 2H36X 2JWOA 1N32E 2UXCE 1L4SA 3LMLA 2UU9E 4LF8E 2L33A 2EOOA 1O0WA 2YU5A 4B3SE 3TQMA 1T4LB 1A1LA 2EPCA 4L5NC 3OMLA 4YHHE 1PDAA 4O4KA 2VQEE 3ADGA 3P1XA 1IQSA 2YTIA 2FTXB 4KZSA 2B7TA 2YTGA 3HXLA 1A1FA 4LFAE 2V89A 1KYQA 4P78A 1TN9A 1DQ3A 3RMPA 2EPUA 2EPZA 2J7JA 1MEYC 2E5LE 1HR0E 4DR4E 5AE1A 2NUGA 2R1FA 1EH6A 2YTOA 4R2EA 1RC7A 4M9VC 5KL3A 2EMFA 5LMUE 3EPHA 4B3TE 1GQEA 4O5GA 2LT7A 2ODRD 1PJTA 4F6MA 3EPKA 4NHRA 4RH8A 1PJQA 2WCC3 5AE2A 2EM2A 2M9AA 4WSGA 2EQ0A 3J80C 4M2ZA 4DV4E 2DLQA 3ADIA 2LJHA 5A2QC 2DB2A 2E1MA 4BHCA 2RS6A 2EE8A 4BBYA 4R2PA 4DR5E 2RPCA 2EN2A 4HTGA 1T38A 4WYQB 3QG5C 4JV5E 5CFFE 2EL4A 2DGCA 4DV3E 3MSWA 2EM4A 3F6HA 4LF5E 2EPNA 2YPNA 4R8OA 4GEQB 4MLVA 1WJPA 5KL7A 4X65E 2EM7A 4DUZE 1N3GA 4X62E 4X64E 4GKJE 2JOBA 1X6FA 2EMKA 1YUIA 1UN6B 3M99B 2EM5A 4F6NA 2HGHA 5A6KA 4BS9A 1JK1A 4JYAE 4WFTA 4TUGA 4AQYE 2EOZA 4DKKA 3ZOQB 2EOMA 3DJWA 2R76A 2BB8A 2LRSA 2EZ6A 4Q35B 3THNA 1UBDC 1YYOA 1HNXE 1IMUA 4R2AA 3J7Yp 2JVAA 2EMXA 1N36E 1IBME 4R2SA 2EL6A 5AC4A 1T4OA 2Q8UA 4ZYGA 2V87A 4OX9E 2LMZA 2EN1A 2EOEA 4JI4E 1P47A 2EPMX 4B3ME 2EMBA 2B3TB 2ADRA 2D9HA 1X6HA 2EMHA 2EP3A 2GPIA 2I9IA 4OOGC 2EN4A 1A1GA 4JI2E 2LUPB 2LJUA 2EOJA 2NUEA 4L8NA 1YYKA 4I8OA 2WZOA 4P7DA 4WXDA 1ZR9A 2K7IA 4DMIA 2EOFA 1EKZA 1X6EA 2N3GA 2EOIA 2JY9A 1F2IG 1J26A 2EOHA 2VQFE 1HNWE 4WXCA 1GZ6A 1MGTA 2G7HA 4F9BB 5KL5A 5TSEA 1G2FC 2YRMA 4BC7A 2DSYA 4JI0E 2MDGA 2VE7C 2DMIA 1IBLE 2ELYA 4RHBB 1GTKA 2EMWA 4NXME 2NUFA 3C6KA 3JTZA 4DR1E 1A1JA 2EORA 4TUIA 2DLKA 2EN7A 3JAMC 4IS1C 2DIXA 2FV4B 2L2MA 5F3WA 2ENAA 3C6MA 2JOXA 4LU9A 1NEIA 2L3CA 2EN3A 3HTXA 1EH8A 4LF6E 3IWDA 3J81C 2CTDA 2LUQA 4O43A 1AAYA 2HC5A 4FK5C 1DGCA 2N8XA 4M30A 5A6BA 1FKAE 2M7QA 2HHHE 5IT9C 2MKNA 4WSPA 2RS7A 4YY3E 4DR7E 2RSIA 3LLHA 2I13A 4JI6E 2ENCA 2EJ4A 3MHSC 1YFHA 2DMYA 4R2CA 1LLMC 2EQ1A 2YSPA 2CSHA 1N34E 2L2NA 5ADZA 3KZYA 2YTQA 4IJDA 3IWCA 4LF9E 4JI8E 2E72A 4X9JA 2RQLA 3EPLA 2EPAA 1DI2A 2YTJA 1XNRE 1X3CA 2V8QB 2MC6A 2EOSA 2YT4A 3UK3C 2V88A 1IQOA 1TF3A 2A25A 1UILA 2UXBE 4GKKE 2WBTA 3HPSA 5A6AA 2YTEA 2UUAE 2B7VA 1PJSA 5LLQA 4DV2E 5IXMB 2KHXA 1SR9A 1AH5A 2BBGA 4F9AB 2L3JA 2EMCA 2YWQA 4NXNE 1XMOE 2EMAA 1BBGA 2IHR1 2MC5A 5AC5A 2EOQA 4R2RA 2ODRC 2WBUA 3FIGA 2EM6A 2M4IA 4R2DA 2UUCE 1BB8A 2EOYA 2NA2A 1STUA 5KL2A 1G2DC 3IWBA 1Z1BA 1QU6A 2MDRA 4DV6E 4BC9A 2M1SA 2EPPA 4X66E 1UHZA 4F54A 4DV1E 1WXRA 1I94E 2JPAA 2EPOA 2YRHA 1X47A 4Q28A 2F8BA 1QNTA 2JP9A 4X8WA 4HEIA 2LCEA 2EWLA 4LF7E 1A1KA 3OTOE 5KL4A 2KONA 4DR2E 1N33E 2EN8A 3K6QA 5A6JA 4KWYA 3THOB 1YSAC 2ELZA 1XMQE 4NZVA 4DR3E 2YSOA 2EPXA 1J5EE 3T1HE 2EN6A 1IBKE 2LO3A 2V85A 5AASA 3BGHA 4BCAA 1A1IA 2HJJA 4R2QA 2GLIA 3F6GA 1B69A 1WHQA 3EQ1A 1X48A 2EOXA 2UXDE 3JU0A 4GZNC 5KL6A 2PRTA 2VRDA 4O24A 2N3HA 1ZBQA 2EQ3A 1T4NA 1YPNA 3L00A 5T6JA 1YZ9A 2L8TA 2UUBE 3HPZA 3VYXA 3VK6A 1RMDA 2EMLA 4R03A 2YTPA 1WHNA 2VF1A 4LFCE 2YTFA 2EPLX 1BBOA 3BBGA 5LL6R 3VYYA 3DF6A 4J8ZA 4JI1E 4JI5E 2B9DA 5IWAE 2FGGA 2WBSA 2LTSA 1EH7A 3AV0A 4K0KE 1ZBTA 5IV8B 2EMYA 3HQ1A 3EPJA 2L6MA 2EM9A 2YU8A 2YTDA 2LV2A 2EM0A 2ENHA 2EMGA 4B3RE 2L92A 2RSMA 3MHHC 1X49A 1NCSA 4WX9A 3T1YE 2GHFA 2CT1A 2YZTA 5FLXC 4DV5E 2LBSB 1ZAAC 2JXPA 4DV0E 3ADLA 4DUYE 2RTXA 2EM3A
chains in the Genus database with same CATH topology
5AE2A 2F4VE 1XNQE 3KWRA 4JI7E 5LMNE 3IWBA 2LTRA 3J80C 2G7HA 4DV4E 4M2ZA 1QU6A 2MDRA 4F9BB 2L2KB 4DV6E 3ADIA 4WPYA 2DSYA 4BC7A 2LJHA 3C4BA 2JR1A 4BC9A 5A2QC 4JI0E 4JI3E 2ZM6E 2DB2A 2M1SA 2E1MA 2VE7C 2RS6A 1YYWA 4X66E 5DNYA 1UHZA 4F54A 4DV1E 4BBYA 1WXRA 1I94E 1IBLE 4KHPE 4DR5E 2CPNA 2KOUA 1X47A 2V83A 4Q28A 4LFBE 2F8BA 4NXME 2NUFA 4BMJA 3JTZA 4DR1E 4WYQB 1HNZE 4JV5E 5CFFE 4TUIA 3JAMC 4DV3E 2DIXA 3MSWA 4X8WA 2FV4B 2L2MA 3F6HA 3C4TA 5F3WA 4DR6E 4LF5E 2LE2A 2EWLA 2JOXA 4LU9A 1PKPA 4LF7E 2L3CA 3OTOE 4R8OA 2KONA 4GEQB 3HTXA 4LF6E 3IWDA 3J81C 4DR2E 1N33E 2LUQA 3K6QA 4X65E 4M0VA 4DUZE 4GKJE 4X62E 4X64E 4M30A 2JOBA 1FKAE 1XMQE 4DV7E 2M7QA 4DR3E 2HHHE 3J7AG 1RQ0A 4BS9A 1J5EE 4JYAE 4WFTA 4F9CB 4TUGA 3T1HE 2K4VA 4LTYA 2RS7A 4WSPA 4AQYE 2V85A 4YY3E 1IBKE 4DKKA 3ZOQB 4DR7E 5AASA 3H09A 3LLHA 4BCAA 4JI6E 3DJWA 5BR8E 2LRSA 3F6GA 1FJGE 2EZ6A 2DMYA 1WHQA 1YYOA 3AUZA 2V86A 1HNXE 1X48A 3J7Yp 2JVAA 2UXDE 1N34E 3ADJA 3JU0A 2L2NA 5ADZA 1N36E 1IBME 3IWCA 4LF4E 4LF9E 5AE3A 2H36X 4JI8E 2JWOA 1T4OA 1N32E 2UXCE 2N3HA 1ZBQA 3LMLA 1T4NA 2UU9E 2L33A 4LF8E 5T6JA 1DI2A 1YZ9A 1O0WA 2L8TA 2V87A 2UUBE 4OX9E 3HPZA 4B3SE 1XNRE 1STUA 3VK6A 1T4LB 4L5NC 2LMZA 3OMLA 3VYXA 4YHHE 4R03A 2V8QB 2MC6A 2YT4A 2VQEE 4JI4E 3ADGA 1WHNA 3P1XA 4B3ME 2V88A 2VF1A 1UILA 2B3TB 4LFCE 4GKKE 2UXBE 3HPSA 2UUAE 2B7VA 2FTXB 5LL6R 4KZSA 3VYYA 3DF6A 4J8ZA 4DV2E 2B7TA 3HXLA 2KHXA 1SR9A 4OOGC 4JI1E 4JI2E 4JI5E 2LUPB 2B9DA 5IWAE 2FGGA 4LFAE 2V89A 2LTSA 3AV0A 4F9AB 2L3JA 2NUEA 4K0KE 1ZBTA 4L8NA 4P78A 3HQ1A 1XMOE 4NXNE 1YYKA 1DQ3A 2L6MA 4I8OA 3RMPA 2WZOA 4P7DA 2E5LE 1HR0E 4DMIA 4DR4E 2IHR1 2MC5A 5AE1A 1EKZA 4B3RE 2L92A 2N3GA 2RSMA 1X49A 2NUGA 1RC7A 2JY9A 3T1YE 5IT9C 2YZTA 2ODRC 5LMUE 5FLXC 4DV5E 2LBSB 4B3TE 1GQEA 3FIGA 1J26A 2ODRD 2M4IA 2VQFE 4DV0E 2UUCE 3ADLA 4DUYE 1HNWE 2RTXA 2NA2A 1GZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V E;  1XNQ E;  4JI7 E;  5LMN E;  2LTR A;  4M2Z A;  4DV4 E;  1QU6 A;  2MDR A;  2L2K B;  4DV6 E;  3ADI A;  2LJH A;  3C4B A;  4JI3 E;  4JI0 E;  2ZM6 E;  2DB2 A;  2RS6 A;  1YYW A;  4X66 E;  1UHZ A;  4DV1 E;  1I94 E;  1IBL E;  4KHP E;  4DR5 E;  2CPN A;  1X47 A;  4LFB E;  4NXM E;  2NUF A;  4DR1 E;  1HNZ E;  4WYQ B;  4JV5 E;  5CFF E;  4DV3 E;  2DIX A;  4X8W A;  2L2M A;  4DR6 E;  3C4T A;  4LF5 E;  1PKP A;  4LF7 E;  3OTO E;  2L3C A;  3HTX A;  4LF6 E;  4DR2 E;  1N33 E;  2LUQ A;  4X65 E;  4DUZ E;  4GKJ E;  4X62 E;  4X64 E;  4M30 A;  1FKA E;  1XMQ E;  4DV7 E;  4DR3 E;  2HHH E;  1RQ0 A;  1J5E E;  4JYA E;  4WFT A;  3T1H E;  1IBK E;  2RS7 A;  4AQY E;  4YY3 E;  4DKK A;  4DR7 E;  3LLH A;  4JI6 E;  5BR8 E;  2LRS A;  1FJG E;  2EZ6 A;  2DMY A;  1WHQ A;  1YYO A;  1HNX E;  1X48 A;  3J7Y p;  2JVA A;  2UXD E;  1N34 E;  3ADJ A;  2L2N A;  1N36 E;  1IBM E;  4LF4 E;  4LF9 E;  4JI8 E;  1T4O A;  1N32 E;  2UXC E;  2N3H A;  2UU9 E;  1T4N A;  4LF8 E;  2L33 A;  1DI2 A;  1YZ9 A;  1O0W A;  2UUB E;  4OX9 E;  4B3S E;  1XNR E;  1STU A;  1T4L B;  3VYX A;  4YHH E;  2YT4 A;  2VQE E;  4JI4 E;  3ADG A;  1WHN A;  3P1X A;  4B3M E;  1UIL A;  2B3T B;  4LFC E;  4GKK E;  2UXB E;  2UUA E;  2B7V A;  3VYY A;  4DV2 E;  2B7T A;  2KHX A;  4OOG C;  4JI1 E;  4JI2 E;  4JI5 E;  2LUP B;  5IWA E;  4LFA E;  2LTS A;  2L3J A;  2NUE A;  4K0K E;  1ZBT A;  4NXN E;  1XMO E;  1YYK A;  2E5L E;  1HR0 E;  4DR4 E;  2IHR 1;  4B3R E;  1EKZ A;  2RSM A;  2N3G A;  1X49 A;  2NUG A;  1RC7 A;  2JY9 A;  3T1Y E;  5LMU E;  4DV5 E;  2LBS B;  4B3T E;  1GQE A;  1J26 A;  2VQF E;  4DV0 E;  2UUC E;  3ADL A;  4DUY E;  1HNW E;  2RTX A;  2NA2 A; 
#chains in the Genus database with same CATH topology
 2F4V E;  1XNQ E;  3KWR A;  4JI7 E;  5LMN E;  2LTR A;  1WRJ A;  2L2K B;  2EPR A;  2EPK X;  4WPY A;  2MKD A;  2JR1 A;  3C4B A;  3ECR A;  3VHT B;  4JI3 E;  2ZM6 E;  2LVH A;  2EL5 A;  3BID A;  1YYW A;  4BHB A;  5DNY A;  1JK2 A;  4KHP E;  2CPN A;  2KOU A;  2V83 A;  4LFB E;  4BMJ A;  1HNZ E;  1ZU1 A;  4ZYE A;  2NAB A;  3KZZ A;  4DR6 E;  3C4T A;  5A69 A;  2LE2 A;  1PKP A;  2EMI A;  4MLQ A;  4M0V A;  4ZYH A;  4ZYD A;  1YUJ A;  4F2J C;  4DV7 E;  1A1H A;  3J7A G;  3BF2 A;  2JYA A;  1RQ0 A;  5A6B D;  2EMZ A;  4F9C B;  2DRP A;  2K4V A;  2EM8 A;  4LTY A;  2YRK A;  3H09 A;  1TF6 A;  5BR8 E;  1SFE A;  1FJG E;  3AUZ A;  2V86 A;  1T39 A;  1X5W A;  4N4R B;  3ADJ A;  1KJK A;  4LF4 E;  2YTN A;  5AE3 A;  2H36 X;  2JWO A;  1N32 E;  2UXC E;  1L4S A;  3LML A;  2UU9 E;  4LF8 E;  2L33 A;  2EOO A;  1O0W A;  2YU5 A;  4B3S E;  3TQM A;  1T4L B;  1A1L A;  2EPC A;  4L5N C;  3OML A;  4YHH E;  1PDA A;  4O4K A;  2VQE E;  3ADG A;  3P1X A;  1IQS A;  2YTI A;  2FTX B;  4KZS A;  2B7T A;  2YTG A;  3HXL A;  1A1F A;  4LFA E;  2V89 A;  1KYQ A;  4P78 A;  1TN9 A;  1DQ3 A;  3RMP A;  2EPU A;  2EPZ A;  2J7J A;  1MEY C;  2E5L E;  1HR0 E;  4DR4 E;  5AE1 A;  2NUG A;  2R1F A;  1EH6 A;  2YTO A;  4R2E A;  1RC7 A;  4M9V C;  5KL3 A;  2EMF A;  5LMU E;  3EPH A;  4B3T E;  1GQE A;  4O5G A;  2LT7 A;  2ODR D;  1PJT A;  4F6M A;  3EPK A;  4NHR A;  4RH8 A;  1PJQ A;  2WCC 3;  5AE2 A;  2EM2 A;  2M9A A;  4WSG A;  2EQ0 A;  3J80 C;  4M2Z A;  4DV4 E;  2DLQ A;  3ADI A;  2LJH A;  5A2Q C;  2DB2 A;  2E1M A;  4BHC A;  2RS6 A;  2EE8 A;  4BBY A;  4R2P A;  4DR5 E;  2RPC A;  2EN2 A;  4HTG A;  1T38 A;  4WYQ B;  3QG5 C;  4JV5 E;  5CFF E;  2EL4 A;  2DGC A;  4DV3 E;  3MSW A;  2EM4 A;  3F6H A;  4LF5 E;  2EPN A;  2YPN A;  4R8O A;  4GEQ B;  4MLV A;  1WJP A;  5KL7 A;  4X65 E;  2EM7 A;  4DUZ E;  1N3G A;  4X62 E;  4X64 E;  4GKJ E;  2JOB A;  1X6F A;  2EMK A;  1YUI A;  1UN6 B;  3M99 B;  2EM5 A;  4F6N A;  2HGH A;  5A6K A;  4BS9 A;  1JK1 A;  4JYA E;  4WFT A;  4TUG A;  4AQY E;  2EOZ A;  4DKK A;  3ZOQ B;  2EOM A;  3DJW A;  2R76 A;  2BB8 A;  2LRS A;  2EZ6 A;  4Q35 B;  3THN A;  1UBD C;  1YYO A;  1HNX E;  1IMU A;  4R2A A;  3J7Y p;  2JVA A;  2EMX A;  1N36 E;  1IBM E;  4R2S A;  2EL6 A;  5AC4 A;  1T4O A;  2Q8U A;  4ZYG A;  2V87 A;  4OX9 E;  2LMZ A;  2EN1 A;  2EOE A;  4JI4 E;  1P47 A;  2EPM X;  4B3M E;  2EMB A;  2B3T B;  2ADR A;  2D9H A;  1X6H A;  2EMH A;  2EP3 A;  2GPI A;  2I9I A;  4OOG C;  2EN4 A;  1A1G A;  4JI2 E;  2LUP B;  2LJU A;  2EOJ A;  2NUE A;  4L8N A;  1YYK A;  4I8O A;  2WZO A;  4P7D A;  4WXD A;  1ZR9 A;  2K7I A;  4DMI A;  2EOF A;  1EKZ A;  1X6E A;  2N3G A;  2EOI A;  2JY9 A;  1F2I G;  1J26 A;  2EOH A;  2VQF E;  1HNW E;  4WXC A;  1GZ6 A;  1MGT A;  2G7H A;  4F9B B;  5KL5 A;  5TSE A;  1G2F C;  2YRM A;  4BC7 A;  2DSY A;  4JI0 E;  2MDG A;  2VE7 C;  2DMI A;  1IBL E;  2ELY A;  4RHB B;  1GTK A;  2EMW A;  4NXM E;  2NUF A;  3C6K A;  3JTZ A;  4DR1 E;  1A1J A;  2EOR A;  4TUI A;  2DLK A;  2EN7 A;  3JAM C;  4IS1 C;  2DIX A;  2FV4 B;  2L2M A;  5F3W A;  2ENA A;  3C6M A;  2JOX A;  4LU9 A;  1NEI A;  2L3C A;  2EN3 A;  3HTX A;  1EH8 A;  4LF6 E;  3IWD A;  3J81 C;  2CTD A;  2LUQ A;  4O43 A;  1AAY A;  2HC5 A;  4FK5 C;  1DGC A;  2N8X A;  4M30 A;  5A6B A;  1FKA E;  2M7Q A;  2HHH E;  5IT9 C;  2MKN A;  4WSP A;  2RS7 A;  4YY3 E;  4DR7 E;  2RSI A;  3LLH A;  2I13 A;  4JI6 E;  2ENC A;  2EJ4 A;  3MHS C;  1YFH A;  2DMY A;  4R2C A;  1LLM C;  2EQ1 A;  2YSP A;  2CSH A;  1N34 E;  2L2N A;  5ADZ A;  3KZY A;  2YTQ A;  4IJD A;  3IWC A;  4LF9 E;  4JI8 E;  2E72 A;  4X9J A;  2RQL A;  3EPL A;  2EPA A;  1DI2 A;  2YTJ A;  1XNR E;  1X3C A;  2V8Q B;  2MC6 A;  2EOS A;  2YT4 A;  3UK3 C;  2V88 A;  1IQO A;  1TF3 A;  2A25 A;  1UIL A;  2UXB E;  4GKK E;  2WBT A;  3HPS A;  5A6A A;  2YTE A;  2UUA E;  2B7V A;  1PJS A;  5LLQ A;  4DV2 E;  5IXM B;  2KHX A;  1SR9 A;  1AH5 A;  2BBG A;  4F9A B;  2L3J A;  2EMC A;  2YWQ A;  4NXN E;  1XMO E;  2EMA A;  1BBG A;  2IHR 1;  2MC5 A;  5AC5 A;  2EOQ A;  4R2R A;  2ODR C;  2WBU A;  3FIG A;  2EM6 A;  2M4I A;  4R2D A;  2UUC E;  1BB8 A;  2EOY A;  2NA2 A;  1STU A;  5KL2 A;  1G2D C;  3IWB A;  1Z1B A;  1QU6 A;  2MDR A;  4DV6 E;  4BC9 A;  2M1S A;  2EPP A;  4X66 E;  1UHZ A;  4F54 A;  4DV1 E;  1WXR A;  1I94 E;  2JPA A;  2EPO A;  2YRH A;  1X47 A;  4Q28 A;  2F8B A;  1QNT A;  2JP9 A;  4X8W A;  4HEI A;  2LCE A;  2EWL A;  4LF7 E;  1A1K A;  3OTO E;  5KL4 A;  2KON A;  4DR2 E;  1N33 E;  2EN8 A;  3K6Q A;  5A6J A;  4KWY A;  3THO B;  1YSA C;  2ELZ A;  1XMQ E;  4NZV A;  4DR3 E;  2YSO A;  2EPX A;  1J5E E;  3T1H E;  2EN6 A;  1IBK E;  2LO3 A;  2V85 A;  5AAS A;  3BGH A;  4BCA A;  1A1I A;  2HJJ A;  4R2Q A;  2GLI A;  3F6G A;  1B69 A;  1WHQ A;  3EQ1 A;  1X48 A;  2EOX A;  2UXD E;  3JU0 A;  4GZN C;  5KL6 A;  2PRT A;  2VRD A;  4O24 A;  2N3H A;  1ZBQ A;  2EQ3 A;  1T4N A;  1YPN A;  3L00 A;  5T6J A;  1YZ9 A;  2L8T A;  2UUB E;  3HPZ A;  3VYX A;  3VK6 A;  1RMD A;  2EML A;  4R03 A;  2YTP A;  1WHN A;  2VF1 A;  4LFC E;  2YTF A;  2EPL X;  1BBO A;  3BBG A;  5LL6 R;  3VYY A;  3DF6 A;  4J8Z A;  4JI1 E;  4JI5 E;  2B9D A;  5IWA E;  2FGG A;  2WBS A;  2LTS A;  1EH7 A;  3AV0 A;  4K0K E;  1ZBT A;  5IV8 B;  2EMY A;  3HQ1 A;  3EPJ A;  2L6M A;  2EM9 A;  2YU8 A;  2YTD A;  2LV2 A;  2EM0 A;  2ENH A;  2EMG A;  4B3R E;  2L92 A;  2RSM A;  3MHH C;  1X49 A;  1NCS A;  4WX9 A;  3T1Y E;  2GHF A;  2CT1 A;  2YZT A;  5FLX C;  4DV5 E;  2LBS B;  1ZAA C;  2JXP A;  4DV0 E;  3ADL A;  4DUY E;  2RTX A;  2EM3 A; 
#chains in the Genus database with same CATH homology
 5AE2 A;  2F4V E;  1XNQ E;  3KWR A;  4JI7 E;  5LMN E;  3IWB A;  2LTR A;  3J80 C;  2G7H A;  4DV4 E;  4M2Z A;  1QU6 A;  2MDR A;  4F9B B;  2L2K B;  4DV6 E;  3ADI A;  4WPY A;  2DSY A;  4BC7 A;  2LJH A;  3C4B A;  2JR1 A;  4BC9 A;  5A2Q C;  4JI0 E;  4JI3 E;  2ZM6 E;  2DB2 A;  2M1S A;  2E1M A;  2VE7 C;  2RS6 A;  1YYW A;  4X66 E;  5DNY A;  1UHZ A;  4F54 A;  4DV1 E;  4BBY A;  1WXR A;  1I94 E;  1IBL E;  4KHP E;  4DR5 E;  2CPN A;  2KOU A;  1X47 A;  2V83 A;  4Q28 A;  4LFB E;  2F8B A;  4NXM E;  2NUF A;  4BMJ A;  3JTZ A;  4DR1 E;  4WYQ B;  1HNZ E;  4JV5 E;  5CFF E;  4TUI A;  3JAM C;  4DV3 E;  2DIX A;  3MSW A;  4X8W A;  2FV4 B;  2L2M A;  3F6H A;  3C4T A;  5F3W A;  4DR6 E;  4LF5 E;  2LE2 A;  2EWL A;  2JOX A;  4LU9 A;  1PKP A;  4LF7 E;  2L3C A;  3OTO E;  4R8O A;  2KON A;  4GEQ B;  3HTX A;  4LF6 E;  3IWD A;  3J81 C;  4DR2 E;  1N33 E;  2LUQ A;  3K6Q A;  4X65 E;  4M0V A;  4DUZ E;  4GKJ E;  4X62 E;  4X64 E;  4M30 A;  2JOB A;  1FKA E;  1XMQ E;  4DV7 E;  2M7Q A;  4DR3 E;  2HHH E;  3J7A G;  1RQ0 A;  4BS9 A;  1J5E E;  4JYA E;  4WFT A;  4F9C B;  4TUG A;  3T1H E;  2K4V A;  4LTY A;  2RS7 A;  4WSP A;  4AQY E;  2V85 A;  4YY3 E;  1IBK E;  4DKK A;  3ZOQ B;  4DR7 E;  5AAS A;  3H09 A;  3LLH A;  4BCA A;  4JI6 E;  3DJW A;  5BR8 E;  2LRS A;  3F6G A;  1FJG E;  2EZ6 A;  2DMY A;  1WHQ A;  1YYO A;  3AUZ A;  2V86 A;  1HNX E;  1X48 A;  3J7Y p;  2JVA A;  2UXD E;  1N34 E;  3ADJ A;  3JU0 A;  2L2N A;  5ADZ A;  1N36 E;  1IBM E;  3IWC A;  4LF4 E;  4LF9 E;  5AE3 A;  2H36 X;  4JI8 E;  2JWO A;  1T4O A;  1N32 E;  2UXC E;  2N3H A;  1ZBQ A;  3LML A;  1T4N A;  2UU9 E;  2L33 A;  4LF8 E;  5T6J A;  1DI2 A;  1YZ9 A;  1O0W A;  2L8T A;  2V87 A;  2UUB E;  4OX9 E;  3HPZ A;  4B3S E;  1XNR E;  1STU A;  3VK6 A;  1T4L B;  4L5N C;  2LMZ A;  3OML A;  3VYX A;  4YHH E;  4R03 A;  2V8Q B;  2MC6 A;  2YT4 A;  2VQE E;  4JI4 E;  3ADG A;  1WHN A;  3P1X A;  4B3M E;  2V88 A;  2VF1 A;  1UIL A;  2B3T B;  4LFC E;  4GKK E;  2UXB E;  3HPS A;  2UUA E;  2B7V A;  2FTX B;  5LL6 R;  4KZS A;  3VYY A;  3DF6 A;  4J8Z A;  4DV2 E;  2B7T A;  3HXL A;  2KHX A;  1SR9 A;  4OOG C;  4JI1 E;  4JI2 E;  4JI5 E;  2LUP B;  2B9D A;  5IWA E;  2FGG A;  4LFA E;  2V89 A;  2LTS A;  3AV0 A;  4F9A B;  2L3J A;  2NUE A;  4K0K E;  1ZBT A;  4L8N A;  4P78 A;  3HQ1 A;  1XMO E;  4NXN E;  1YYK A;  1DQ3 A;  2L6M A;  4I8O A;  3RMP A;  2WZO A;  4P7D A;  2E5L E;  1HR0 E;  4DMI A;  4DR4 E;  2IHR 1;  2MC5 A;  5AE1 A;  1EKZ A;  4B3R E;  2L92 A;  2N3G A;  2RSM A;  1X49 A;  2NUG A;  1RC7 A;  2JY9 A;  3T1Y E;  5IT9 C;  2YZT A;  2ODR C;  5LMU E;  5FLX C;  4DV5 E;  2LBS B;  4B3T E;  1GQE A;  3FIG A;  1J26 A;  2ODR D;  2M4I A;  2VQF E;  4DV0 E;  2UUC E;  3ADL A;  4DUY E;  1HNW E;  2RTX A;  2NA2 A;  1GZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...