1X48A

Solution structure of the second dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
GSSGSSGYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x48A00
2UUCE 2EZ6A 5IWAE 2IHR1 3P1XA 4X65E 1J26A 4JI5E 1HNZE 2B3TB 4B3TE 1J5EE 1N33E 4GKKE 2LRSA 1XNQE 1O0WA 4DR2E 3ADLA 2UXCE 2UUAE 2NUFA 1YZ9A 5BR8E 4LF9E 2NUEA 4X66E 1STUA 1X49A 4M30A 1FKAE 4DUZE 4WFTA 4AQYE 2B7TA 2LTSA 4NXME 4K0KE 1X47A 1YYOA 1X48A 5CFFE 4DR6E 2L2NA 3VYYA 1XMQE 4DR7E 4LF7E 4LFCE 2DB2A 4JI0E 4JI2E 1YYKA 1UHZA 1GQEA 4YHHE 1T4OA 2LBSB 1N34E 4DR1E 3OTOE 2UXDE 1UILA 3ADGA 4DUYE 3J7Yp 1IBLE 4JI6E 4DV0E 1DI2A 2B7VA 1IBME 1N32E 2CPNA 2MDRA 2UUBE 4LFAE 1I94E 2NA2A 3ADJA 4DR5E 4DV2E 1T4LB 1IBKE 1WHNA 4JI7E 1WHQA 2LUQA 4YY3E 2F4VE 1YYWA 2RTXA 3HTXA 2RS6A 2L2MA 4GKJE 4DV7E 2JVAA 4DV6E 1N36E 4X8WA 4JI8E 4DV3E 1FJGE 2N3HA 2LUPB 4LF6E 4DV1E 4NXNE 2DMYA 4OX9E 1HNXE 2E5LE 4JI3E 2L3JA 3LLHA 4WYQB 5LMUE 4DR3E 2NUGA 4DKKA 1HNWE 1EKZA 4JV5E 2YT4A 5LMNE 3T1HE 2RS7A 2VQFE 2DIXA 3T1YE 1PKPA 1ZBTA 3ADIA 2HHHE 2KHXA 2UXBE 1XMOE 2ZM6E 1QU6A 3VYXA 2N3GA 4DR4E 4DV4E 4KHPE 3C4TA 2RSMA 4M2ZA 3C4BA 2VQEE 2LJHA 4LF5E 4B3ME 4JI4E 4B3SE 2L33A 2LTRA 4LFBE 2JY9A 4JI1E 1XNRE 1T4NA 2L2KB 4LF4E 4X62E 4OOGC 4X64E 4LF8E 4JYAE 1HR0E 4B3RE 1RQ0A 4DV5E 2UU9E 2L3CA 1RC7A
chains in the Genus database with same CATH superfamily
2EN8A 3AUZA 5AASA 5A6BD 1A1JA 2EM7A 1X6FA 3HPSA 1SR9A 3EQ1A 2EPLX 2V89A 2EN1A 1X3CA 1MEYC 1HNZE 5A6KA 2M7QA 2EJ4A 4GKKE 2EOZA 1XNQE 4O24A 2YSOA 4DR2E 3BIDA 4R2CA 2NUEA 4LF9E 1STUA 4X66E 4M30A 1FKAE 2V85A 4AQYE 2M9AA 4ZYDA 2DRPA 5A69A 2WBSA 2L2NA 3VYYA 2YTJA 2EPOA 2WCC3 3L00A 3DJWA 4LF7E 1EH8A 2EE8A 4R2PA 2LBSB 4R2AA 3OTOE 3ADGA 3J7Yp 1QNTA 2EQ3A 1DI2A 5KL5A 1BB8A 2EOYA 3ECRA 2YRMA 2UUBE 4IJDA 2EL5A 3ADJA 4LTYA 4DR5E 2GLIA 1WHNA 4JI7E 2L8TA 2EN7A 2MKDA 4DV7E 2YRHA 3M99B 2ADRA 5IXMB 1N36E 4BMJA 4DV3E 2K4VA 1BBOA 2NABA 2YTNA 2YSPA 4WXDA 2EOXA 4OX9E 1HNXE 2YWQA 2L3JA 4MLVA 2YTQA 4DR3E 4DKKA 4X9JA 2JWOA 5LL6R 2JYAA 1WJPA 2EM0A 3KZZA 2VQFE 2ENCA 4ZYGA 3ADIA 2EOSA 2KHXA 4WXCA 2ZM6E 2YU5A 2YTDA 2E1MA 2I9IA 4DR4E 2JPAA 4KHPE 4RHBB 2DLKA 4BC7A 4TUGA 3AV0A 1ZR9A 3RMPA 2F8BA 4ZYEA 2EPAA 1JK1A 4F9AB 3HPZA 4O5GA 1A1KA 4LF8E 2EORA 1HR0E 2BBGA 1PJSA 2L3CA 2LO3A 1UBDC 4BBYA 2FGGA 2EPPA 2HC5A 4L5NC 4P7DA 2EZ6A 2DMIA 2EPRA 3HXLA 1X5WA 3C6MA 3MHSC 5IT9C 2EMCA 4M9VC 2HGHA 2LVHA 3LMLA 1TN9A 1N33E 2BB8A 1DGCA 2WZOA 3TQMA 2NUFA 5FLXC 2LTSA 4HTGA 1N3GA 4NXME 1X47A 2EM4A 1X48A 2EN3A 1YUJA 3KZYA 2YPNA 4DR7E 4LFCE 3OMLA 5A6JA 2EOIA 2RQLA 4N4RB 1T4OA 3EPHA 4DR1E 4RH8A 2EN4A 2EL4A 1IBLE 4DV0E 4KZSA 1ZAAC 3J81C 2CPNA 5IV8B 2ODRD 4F2JC 2NA2A 2CSHA 2H36X 4NHRA 4GZNC 1UN6B 1IBKE 1PJQA 2YTFA 2MC5A 1G2DC 1WHQA 2LUQA 4L8NA 4YY3E 3F6GA 2EN6A 4F9CB 1SFEA 3HTXA 2L2MA 4F6NA 1X6EA 4DV6E 3JU0A 1FJGE 4KWYA 2EMXA 1TF6A 2GPIA 3EPJA 2EOQA 1WXRA 1A1LA 2DLQA 2DSYA 5KL7A 2NUGA 1HNWE 2EMLA 1MGTA 2LJUA 2EPMX 2G7HA 3JAMC 4WX9A 3T1YE 1PKPA 5T6JA 1RMDA 2YU8A 1P47A 1XMOE 4R03A 2EM2A 1X6HA 3VYXA 2N3GA 3IWDA 5A6BA 2RSMA 2YZTA 2VQEE 2LJHA 2RSIA 3KWRA 1B69A 2DGCA 4JI4E 2EQ1A 4R8OA 2N8XA 2EMAA 2YTEA 2LTRA 3MHHC 2EOOA 3THOB 2GHFA 1XNRE 1G2FC 1T4NA 2M1SA 4X62E 1A1GA 2FTXB 3F6HA 2KOUA 2JP9A 4B3RE 1RQ0A 3VHTB 2V88A 2ELZA 4I8OA 2LMZA 3EPKA 4FK5C 2IHR1 4X65E 2EMIA 4JI5E 5AC4A 2YTOA 1J5EE 2KONA 1EH6A 2EOJA 2UUAE 1YZ9A 2LT7A 1EH7A 5AC5A 2B7TA 3THNA 4K0KE 5CFFE 1T38A 4R2QA 4F6MA 2DB2A 4HEIA 4JI2E 2VRDA 1YYKA 1GQEA 4YHHE 1BBGA 4LU9A 1TF3A 4P78A 2EMBA 4F9BB 2EOEA 5KL6A 1UILA 2VF1A 4NZVA 4M0VA 4JI6E 5LLQA 1IBME 2E72A 1N32E 4MLQA 2EMFA 2EP3A 4BS9A 1GTKA 2V86A 2F4VE 2EOMA 3J7AG 2RTXA 3VK6A 1AAYA 3JTZA 2EPZA 4O43A 2CTDA 3EPLA 2V8QB 5ADZA 1PJTA 5DNYA 2N3HA 2LUPB 4R2EA 4DV1E 3J80C 2LE2A 4NXNE 2YTPA 3LLHA 4WYQB 5LMUE 1L4SA 2JOXA 1PDAA 4JV5E 2YT4A 2EPNA 2RPCA 2DIXA 1KYQA 2EMZA 1WRJA 3DF6A 5KL3A 4IS1C 1QU6A 2EOFA 1IQOA 2EMHA 3IWBA 4DV4E 2V83A 2WBTA 3C4BA 2EMYA 1A1FA 2EWLA 4LF5E 4B3SE 4BHBA 1A1IA 3H09A 2L33A 2EPUA 4WPYA 2YRKA 2A25A 2EM6A 4LFBE 2JY9A 4JI1E 5F3WA 2L2KB 4LF4E 4X64E 4F54A 5KL2A 4TUIA 4JYAE 3C6KA 2EM8A 2L92A 5TSEA 4DMIA 3MSWA 1RC7A 2UUCE 2YTGA 1LLMC 2B9DA 5IWAE 3P1XA 2L6MA 1J26A 2B3TB 4B3TE 2LRSA 1O0WA 3ADLA 2UXCE 2VE7C 5BR8E 4BC9A 4ZYHA 1X49A 5A6AA 3HQ1A 4DUZE 4WFTA 2EL6A 2HJJA 1YYOA 1KJKA 4DR6E 1XMQE 2EM5A 4GEQB 3QG5C 1ZBQA 1YSAC 4R2SA 2J7JA 4JI0E 1A1HA 2EMGA 2JXPA 1UHZA 1YFHA 5A2QC 2MKNA 4WSPA 2EMWA 1N34E 2UXDE 2CT1A 4DUYE 2Q8UA 2B7VA 2EPXA 1T39A 2YTIA 5AE2A 2EMKA 1YUIA 2MDRA 4LFAE 1I94E 1F2IG 4DV2E 4Q35B 1T4LB 3BF2A 2I13A 2R1FA 2ENHA 2V87A 1YYWA 4BHCA 2JOBA 3BBGA 2LV2A 4Q28A 2RS6A 2EQ0A 4GKJE 3BGHA 3K6QA 2EN2A 1IQSA 2JVAA 4X8WA 2ENAA 2LCEA 4JI8E 1GZ6A 2R76A 4LF6E 5AE3A 2DMYA 2PRTA 5AE1A 2E5LE 4JI3E 2MDGA 4R2RA 1EKZA 5LMNE 3T1HE 2RS7A 1JK2A 1IMUA 1ZBTA 1ZU1A 1Z1BA 1YPNA 2HHHE 2UXBE 2JR1A 5KL4A 3UK3C 2D9HA 1DQ3A 2WBUA 3C4TA 2K7IA 4M2ZA 1NCSA 1NEIA 4WSGA 2FV4B 2ODRC 3FIGA 4B3ME 3ZOQB 2MC6A 2EM3A 4J8ZA 4BCAA 4OOGC 4R2DA 2ELYA 3IWCA 2EPCA 4DV5E 2UU9E 1AH5A 2EOHA 2M4IA 4O4KA 2EM9A 2EPKX
chains in the Genus database with same CATH topology
2LMZA 4L5NC 2UUCE 4P7DA 2EZ6A 3AUZA 2B9DA 5IWAE 3HXLA 5AASA 3HPSA 2IHR1 1SR9A 3P1XA 5IT9C 2L6MA 4X65E 1J26A 2V89A 1RC7A 4JI5E 1HNZE 2B3TB 4B3TE 2M7QA 3LMLA 1J5EE 1N33E 4GKKE 2LRSA 2KONA 1XNQE 1O0WA 2WZOA 4DR2E 3ADLA 2UXCE 2UUAE 2VE7C 2NUFA 1YZ9A 5BR8E 4BC9A 4LF9E 1STUA 4X66E 1X49A 4DMIA 5FLXC 4M30A 1FKAE 2NUEA 3HQ1A 4DUZE 4WFTA 2V85A 4AQYE 2B7TA 2LTSA 4NXME 4K0KE 1X47A 1YYOA 1X48A 5CFFE 4DR6E 2L2NA 3VYYA 1XMQE 4DR7E 4GEQB 3DJWA 1ZBQA 4LF7E 4LFCE 2DB2A 3OMLA 4JI0E 4JI2E 1YYKA 1UHZA 1GQEA 4YHHE 5A2QC 4LU9A 4WSPA 1T4OA 4P78A 2LBSB 1N34E 4F9BB 3OTOE 4DR1E 2UXDE 1UILA 2VF1A 3ADGA 3J7Yp 4M0VA 4DUYE 1IBLE 4JI6E 4DV0E 1DI2A 4KZSA 2B7VA 1IBME 3J81C 5AE2A 1N32E 2CPNA 2MDRA 2UUBE 4LFAE 2ODRD 1I94E 2NA2A 3ADJA 2H36X 4LTYA 4DV2E 4DR5E 1T4LB 4BS9A 1IBKE 1WHNA 2MC5A 4JI7E 1WHQA 2L8TA 2LUQA 2V86A 3F6GA 2V87A 4L8NA 4YY3E 2F4VE 1YYWA 2JOBA 4F9CB 3J7AG 2RTXA 3VK6A 4Q28A 3HTXA 2RS6A 2L2MA 4GKJE 4DV7E 3K6QA 3JTZA 2JVAA 4DV6E 1N36E 4X8WA 4JI8E 4BMJA 3JU0A 1GZ6A 2K4VA 2V8QB 5ADZA 5DNYA 2N3HA 4DV3E 2LUPB 1FJGE 4LF6E 4DV1E 3J80C 2LE2A 2DMYA 5AE3A 4NXNE 5AE1A 1HNXE 2E5LE 4JI3E 4OX9E 2L3JA 3LLHA 4WYQB 1WXRA 5LMUE 4DR3E 2JOXA 2DSYA 2NUGA 4DKKA 2JWOA 1HNWE 1EKZA 4JV5E 2YT4A 5LL6R 5LMNE 2RS7A 3T1HE 2G7HA 2VQFE 2DIXA 3JAMC 3T1YE 1PKPA 1ZBTA 5T6JA 3ADIA 3DF6A 2HHHE 2KHXA 2UXBE 2JR1A 1XMOE 4R03A 2ZM6E 1QU6A 3VYXA 2N3GA 2E1MA 3IWDA 1DQ3A 4DR4E 4DV4E 3IWBA 4KHPE 2V83A 3C4TA 2RSMA 4BC7A 4TUGA 2YZTA 4M2ZA 3C4BA 2VQEE 3AV0A 2EWLA 2FV4B 2LJHA 2ODRC 3FIGA 3KWRA 3RMPA 4B3ME 2F8BA 4JI4E 4LF5E 3ZOQB 4B3SE 4R8OA 3H09A 2L33A 2LTRA 2MC6A 4WPYA 4F9AB 4J8ZA 4LFBE 2JY9A 4JI1E 1XNRE 5F3WA 1T4NA 3HPZA 4BCAA 2L2KB 4LF4E 2M1SA 4OOGC 4X62E 2FTXB 3F6HA 2KOUA 4F54A 4X64E 4LF8E 3IWCA 4TUIA 1HR0E 4B3RE 1RQ0A 4DV5E 2UU9E 4JYAE 2L3CA 2M4IA 2L92A 2V88A 4BBYA 2FGGA 3MSWA 4I8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC E;  2EZ6 A;  5IWA E;  2IHR 1;  3P1X A;  4X65 E;  1J26 A;  4JI5 E;  1HNZ E;  2B3T B;  4B3T E;  1J5E E;  1N33 E;  4GKK E;  2LRS A;  1XNQ E;  1O0W A;  4DR2 E;  3ADL A;  2UXC E;  2UUA E;  2NUF A;  1YZ9 A;  5BR8 E;  4LF9 E;  2NUE A;  4X66 E;  1STU A;  1X49 A;  4M30 A;  1FKA E;  4DUZ E;  4WFT A;  4AQY E;  2B7T A;  2LTS A;  4NXM E;  4K0K E;  1X47 A;  1YYO A;  1X48 A;  5CFF E;  4DR6 E;  2L2N A;  3VYY A;  1XMQ E;  4DR7 E;  4LF7 E;  4LFC E;  2DB2 A;  4JI0 E;  4JI2 E;  1YYK A;  1UHZ A;  1GQE A;  4YHH E;  1T4O A;  2LBS B;  1N34 E;  4DR1 E;  3OTO E;  2UXD E;  1UIL A;  3ADG A;  4DUY E;  3J7Y p;  1IBL E;  4JI6 E;  4DV0 E;  1DI2 A;  2B7V A;  1IBM E;  1N32 E;  2CPN A;  2MDR A;  2UUB E;  4LFA E;  1I94 E;  2NA2 A;  3ADJ A;  4DR5 E;  4DV2 E;  1T4L B;  1IBK E;  1WHN A;  4JI7 E;  1WHQ A;  2LUQ A;  4YY3 E;  2F4V E;  1YYW A;  2RTX A;  3HTX A;  2RS6 A;  2L2M A;  4GKJ E;  4DV7 E;  2JVA A;  4DV6 E;  1N36 E;  4X8W A;  4JI8 E;  4DV3 E;  1FJG E;  2N3H A;  2LUP B;  4LF6 E;  4DV1 E;  4NXN E;  2DMY A;  4OX9 E;  1HNX E;  2E5L E;  4JI3 E;  2L3J A;  3LLH A;  4WYQ B;  5LMU E;  4DR3 E;  2NUG A;  4DKK A;  1HNW E;  1EKZ A;  4JV5 E;  2YT4 A;  5LMN E;  3T1H E;  2RS7 A;  2VQF E;  2DIX A;  3T1Y E;  1PKP A;  1ZBT A;  3ADI A;  2HHH E;  2KHX A;  2UXB E;  1XMO E;  2ZM6 E;  1QU6 A;  3VYX A;  2N3G A;  4DR4 E;  4DV4 E;  4KHP E;  3C4T A;  2RSM A;  4M2Z A;  3C4B A;  2VQE E;  2LJH A;  4LF5 E;  4B3M E;  4JI4 E;  4B3S E;  2L33 A;  2LTR A;  4LFB E;  2JY9 A;  4JI1 E;  1XNR E;  1T4N A;  2L2K B;  4LF4 E;  4X62 E;  4OOG C;  4X64 E;  4LF8 E;  4JYA E;  1HR0 E;  4B3R E;  1RQ0 A;  4DV5 E;  2UU9 E;  2L3C A;  1RC7 A; 
#chains in the Genus database with same CATH topology
 2EN8 A;  3AUZ A;  5AAS A;  5A6B D;  1A1J A;  2EM7 A;  1X6F A;  3HPS A;  1SR9 A;  3EQ1 A;  2EPL X;  2V89 A;  2EN1 A;  1X3C A;  1MEY C;  1HNZ E;  5A6K A;  2M7Q A;  2EJ4 A;  4GKK E;  2EOZ A;  1XNQ E;  4O24 A;  2YSO A;  4DR2 E;  3BID A;  4R2C A;  2NUE A;  4LF9 E;  1STU A;  4X66 E;  4M30 A;  1FKA E;  2V85 A;  4AQY E;  2M9A A;  4ZYD A;  2DRP A;  5A69 A;  2WBS A;  2L2N A;  3VYY A;  2YTJ A;  2EPO A;  2WCC 3;  3L00 A;  3DJW A;  4LF7 E;  1EH8 A;  2EE8 A;  4R2P A;  2LBS B;  4R2A A;  3OTO E;  3ADG A;  3J7Y p;  1QNT A;  2EQ3 A;  1DI2 A;  5KL5 A;  1BB8 A;  2EOY A;  3ECR A;  2YRM A;  2UUB E;  4IJD A;  2EL5 A;  3ADJ A;  4LTY A;  4DR5 E;  2GLI A;  1WHN A;  4JI7 E;  2L8T A;  2EN7 A;  2MKD A;  4DV7 E;  2YRH A;  3M99 B;  2ADR A;  5IXM B;  1N36 E;  4BMJ A;  4DV3 E;  2K4V A;  1BBO A;  2NAB A;  2YTN A;  2YSP A;  4WXD A;  2EOX A;  4OX9 E;  1HNX E;  2YWQ A;  2L3J A;  4MLV A;  2YTQ A;  4DR3 E;  4DKK A;  4X9J A;  2JWO A;  5LL6 R;  2JYA A;  1WJP A;  2EM0 A;  3KZZ A;  2VQF E;  2ENC A;  4ZYG A;  3ADI A;  2EOS A;  2KHX A;  4WXC A;  2ZM6 E;  2YU5 A;  2YTD A;  2E1M A;  2I9I A;  4DR4 E;  2JPA A;  4KHP E;  4RHB B;  2DLK A;  4BC7 A;  4TUG A;  3AV0 A;  1ZR9 A;  3RMP A;  2F8B A;  4ZYE A;  2EPA A;  1JK1 A;  4F9A B;  3HPZ A;  4O5G A;  1A1K A;  4LF8 E;  2EOR A;  1HR0 E;  2BBG A;  1PJS A;  2L3C A;  2LO3 A;  1UBD C;  4BBY A;  2FGG A;  2EPP A;  2HC5 A;  4L5N C;  4P7D A;  2EZ6 A;  2DMI A;  2EPR A;  3HXL A;  1X5W A;  3C6M A;  3MHS C;  5IT9 C;  2EMC A;  4M9V C;  2HGH A;  2LVH A;  3LML A;  1TN9 A;  1N33 E;  2BB8 A;  1DGC A;  2WZO A;  3TQM A;  2NUF A;  5FLX C;  2LTS A;  4HTG A;  1N3G A;  4NXM E;  1X47 A;  2EM4 A;  1X48 A;  2EN3 A;  1YUJ A;  3KZY A;  2YPN A;  4DR7 E;  4LFC E;  3OML A;  5A6J A;  2EOI A;  2RQL A;  4N4R B;  1T4O A;  3EPH A;  4DR1 E;  4RH8 A;  2EN4 A;  2EL4 A;  1IBL E;  4DV0 E;  4KZS A;  1ZAA C;  3J81 C;  2CPN A;  5IV8 B;  2ODR D;  4F2J C;  2NA2 A;  2CSH A;  2H36 X;  4NHR A;  4GZN C;  1UN6 B;  1IBK E;  1PJQ A;  2YTF A;  2MC5 A;  1G2D C;  1WHQ A;  2LUQ A;  4L8N A;  4YY3 E;  3F6G A;  2EN6 A;  4F9C B;  1SFE A;  3HTX A;  2L2M A;  4F6N A;  1X6E A;  4DV6 E;  3JU0 A;  1FJG E;  4KWY A;  2EMX A;  1TF6 A;  2GPI A;  3EPJ A;  2EOQ A;  1WXR A;  1A1L A;  2DLQ A;  2DSY A;  5KL7 A;  2NUG A;  1HNW E;  2EML A;  1MGT A;  2LJU A;  2EPM X;  2G7H A;  3JAM C;  4WX9 A;  3T1Y E;  1PKP A;  5T6J A;  1RMD A;  2YU8 A;  1P47 A;  1XMO E;  4R03 A;  2EM2 A;  1X6H A;  3VYX A;  2N3G A;  3IWD A;  5A6B A;  2RSM A;  2YZT A;  2VQE E;  2LJH A;  2RSI A;  3KWR A;  1B69 A;  2DGC A;  4JI4 E;  2EQ1 A;  4R8O A;  2N8X A;  2EMA A;  2YTE A;  2LTR A;  3MHH C;  2EOO A;  3THO B;  2GHF A;  1XNR E;  1G2F C;  1T4N A;  2M1S A;  4X62 E;  1A1G A;  2FTX B;  3F6H A;  2KOU A;  2JP9 A;  4B3R E;  1RQ0 A;  3VHT B;  2V88 A;  2ELZ A;  4I8O A;  2LMZ A;  3EPK A;  4FK5 C;  2IHR 1;  4X65 E;  2EMI A;  4JI5 E;  5AC4 A;  2YTO A;  1J5E E;  2KON A;  1EH6 A;  2EOJ A;  2UUA E;  1YZ9 A;  2LT7 A;  1EH7 A;  5AC5 A;  2B7T A;  3THN A;  4K0K E;  5CFF E;  1T38 A;  4R2Q A;  4F6M A;  2DB2 A;  4HEI A;  4JI2 E;  2VRD A;  1YYK A;  1GQE A;  4YHH E;  1BBG A;  4LU9 A;  1TF3 A;  4P78 A;  2EMB A;  4F9B B;  2EOE A;  5KL6 A;  1UIL A;  2VF1 A;  4NZV A;  4M0V A;  4JI6 E;  5LLQ A;  1IBM E;  2E72 A;  1N32 E;  4MLQ A;  2EMF A;  2EP3 A;  4BS9 A;  1GTK A;  2V86 A;  2F4V E;  2EOM A;  3J7A G;  2RTX A;  3VK6 A;  1AAY A;  3JTZ A;  2EPZ A;  4O43 A;  2CTD A;  3EPL A;  2V8Q B;  5ADZ A;  1PJT A;  5DNY A;  2N3H A;  2LUP B;  4R2E A;  4DV1 E;  3J80 C;  2LE2 A;  4NXN E;  2YTP A;  3LLH A;  4WYQ B;  5LMU E;  1L4S A;  2JOX A;  1PDA A;  4JV5 E;  2YT4 A;  2EPN A;  2RPC A;  2DIX A;  1KYQ A;  2EMZ A;  1WRJ A;  3DF6 A;  5KL3 A;  4IS1 C;  1QU6 A;  2EOF A;  1IQO A;  2EMH A;  3IWB A;  4DV4 E;  2V83 A;  2WBT A;  3C4B A;  2EMY A;  1A1F A;  2EWL A;  4LF5 E;  4B3S E;  4BHB A;  1A1I A;  3H09 A;  2L33 A;  2EPU A;  4WPY A;  2YRK A;  2A25 A;  2EM6 A;  4LFB E;  2JY9 A;  4JI1 E;  5F3W A;  2L2K B;  4LF4 E;  4X64 E;  4F54 A;  5KL2 A;  4TUI A;  4JYA E;  3C6K A;  2EM8 A;  2L92 A;  5TSE A;  4DMI A;  3MSW A;  1RC7 A;  2UUC E;  2YTG A;  1LLM C;  2B9D A;  5IWA E;  3P1X A;  2L6M A;  1J26 A;  2B3T B;  4B3T E;  2LRS A;  1O0W A;  3ADL A;  2UXC E;  2VE7 C;  5BR8 E;  4BC9 A;  4ZYH A;  1X49 A;  5A6A A;  3HQ1 A;  4DUZ E;  4WFT A;  2EL6 A;  2HJJ A;  1YYO A;  1KJK A;  4DR6 E;  1XMQ E;  2EM5 A;  4GEQ B;  3QG5 C;  1ZBQ A;  1YSA C;  4R2S A;  2J7J A;  4JI0 E;  1A1H A;  2EMG A;  2JXP A;  1UHZ A;  1YFH A;  5A2Q C;  2MKN A;  4WSP A;  2EMW A;  1N34 E;  2UXD E;  2CT1 A;  4DUY E;  2Q8U A;  2B7V A;  2EPX A;  1T39 A;  2YTI A;  5AE2 A;  2EMK A;  1YUI A;  2MDR A;  4LFA E;  1I94 E;  1F2I G;  4DV2 E;  4Q35 B;  1T4L B;  3BF2 A;  2I13 A;  2R1F A;  2ENH A;  2V87 A;  1YYW A;  4BHC A;  2JOB A;  3BBG A;  2LV2 A;  4Q28 A;  2RS6 A;  2EQ0 A;  4GKJ E;  3BGH A;  3K6Q A;  2EN2 A;  1IQS A;  2JVA A;  4X8W A;  2ENA A;  2LCE A;  4JI8 E;  1GZ6 A;  2R76 A;  4LF6 E;  5AE3 A;  2DMY A;  2PRT A;  5AE1 A;  2E5L E;  4JI3 E;  2MDG A;  4R2R A;  1EKZ A;  5LMN E;  3T1H E;  2RS7 A;  1JK2 A;  1IMU A;  1ZBT A;  1ZU1 A;  1Z1B A;  1YPN A;  2HHH E;  2UXB E;  2JR1 A;  5KL4 A;  3UK3 C;  2D9H A;  1DQ3 A;  2WBU A;  3C4T A;  2K7I A;  4M2Z A;  1NCS A;  1NEI A;  4WSG A;  2FV4 B;  2ODR C;  3FIG A;  4B3M E;  3ZOQ B;  2MC6 A;  2EM3 A;  4J8Z A;  4BCA A;  4OOG C;  4R2D A;  2ELY A;  3IWC A;  2EPC A;  4DV5 E;  2UU9 E;  1AH5 A;  2EOH A;  2M4I A;  4O4K A;  2EM9 A;  2EPK X; 
#chains in the Genus database with same CATH homology
 2LMZ A;  4L5N C;  2UUC E;  4P7D A;  2EZ6 A;  3AUZ A;  2B9D A;  5IWA E;  3HXL A;  5AAS A;  3HPS A;  2IHR 1;  1SR9 A;  3P1X A;  5IT9 C;  2L6M A;  4X65 E;  1J26 A;  2V89 A;  1RC7 A;  4JI5 E;  1HNZ E;  2B3T B;  4B3T E;  2M7Q A;  3LML A;  1J5E E;  1N33 E;  4GKK E;  2LRS A;  2KON A;  1XNQ E;  1O0W A;  2WZO A;  4DR2 E;  3ADL A;  2UXC E;  2UUA E;  2VE7 C;  2NUF A;  1YZ9 A;  5BR8 E;  4BC9 A;  4LF9 E;  1STU A;  4X66 E;  1X49 A;  4DMI A;  5FLX C;  4M30 A;  1FKA E;  2NUE A;  3HQ1 A;  4DUZ E;  4WFT A;  2V85 A;  4AQY E;  2B7T A;  2LTS A;  4NXM E;  4K0K E;  1X47 A;  1YYO A;  1X48 A;  5CFF E;  4DR6 E;  2L2N A;  3VYY A;  1XMQ E;  4DR7 E;  4GEQ B;  3DJW A;  1ZBQ A;  4LF7 E;  4LFC E;  2DB2 A;  3OML A;  4JI0 E;  4JI2 E;  1YYK A;  1UHZ A;  1GQE A;  4YHH E;  5A2Q C;  4LU9 A;  4WSP A;  1T4O A;  4P78 A;  2LBS B;  1N34 E;  4F9B B;  3OTO E;  4DR1 E;  2UXD E;  1UIL A;  2VF1 A;  3ADG A;  3J7Y p;  4M0V A;  4DUY E;  1IBL E;  4JI6 E;  4DV0 E;  1DI2 A;  4KZS A;  2B7V A;  1IBM E;  3J81 C;  5AE2 A;  1N32 E;  2CPN A;  2MDR A;  2UUB E;  4LFA E;  2ODR D;  1I94 E;  2NA2 A;  3ADJ A;  2H36 X;  4LTY A;  4DV2 E;  4DR5 E;  1T4L B;  4BS9 A;  1IBK E;  1WHN A;  2MC5 A;  4JI7 E;  1WHQ A;  2L8T A;  2LUQ A;  2V86 A;  3F6G A;  2V87 A;  4L8N A;  4YY3 E;  2F4V E;  1YYW A;  2JOB A;  4F9C B;  3J7A G;  2RTX A;  3VK6 A;  4Q28 A;  3HTX A;  2RS6 A;  2L2M A;  4GKJ E;  4DV7 E;  3K6Q A;  3JTZ A;  2JVA A;  4DV6 E;  1N36 E;  4X8W A;  4JI8 E;  4BMJ A;  3JU0 A;  1GZ6 A;  2K4V A;  2V8Q B;  5ADZ A;  5DNY A;  2N3H A;  4DV3 E;  2LUP B;  1FJG E;  4LF6 E;  4DV1 E;  3J80 C;  2LE2 A;  2DMY A;  5AE3 A;  4NXN E;  5AE1 A;  1HNX E;  2E5L E;  4JI3 E;  4OX9 E;  2L3J A;  3LLH A;  4WYQ B;  1WXR A;  5LMU E;  4DR3 E;  2JOX A;  2DSY A;  2NUG A;  4DKK A;  2JWO A;  1HNW E;  1EKZ A;  4JV5 E;  2YT4 A;  5LL6 R;  5LMN E;  2RS7 A;  3T1H E;  2G7H A;  2VQF E;  2DIX A;  3JAM C;  3T1Y E;  1PKP A;  1ZBT A;  5T6J A;  3ADI A;  3DF6 A;  2HHH E;  2KHX A;  2UXB E;  2JR1 A;  1XMO E;  4R03 A;  2ZM6 E;  1QU6 A;  3VYX A;  2N3G A;  2E1M A;  3IWD A;  1DQ3 A;  4DR4 E;  4DV4 E;  3IWB A;  4KHP E;  2V83 A;  3C4T A;  2RSM A;  4BC7 A;  4TUG A;  2YZT A;  4M2Z A;  3C4B A;  2VQE E;  3AV0 A;  2EWL A;  2FV4 B;  2LJH A;  2ODR C;  3FIG A;  3KWR A;  3RMP A;  4B3M E;  2F8B A;  4JI4 E;  4LF5 E;  3ZOQ B;  4B3S E;  4R8O A;  3H09 A;  2L33 A;  2LTR A;  2MC6 A;  4WPY A;  4F9A B;  4J8Z A;  4LFB E;  2JY9 A;  4JI1 E;  1XNR E;  5F3W A;  1T4N A;  3HPZ A;  4BCA A;  2L2K B;  4LF4 E;  2M1S A;  4OOG C;  4X62 E;  2FTX B;  3F6H A;  2KOU A;  4F54 A;  4X64 E;  4LF8 E;  3IWC A;  4TUI A;  1HR0 E;  4B3R E;  1RQ0 A;  4DV5 E;  2UU9 E;  4JYA E;  2L3C A;  2M4I A;  2L92 A;  2V88 A;  4BBY A;  2FGG A;  3MSW A;  4I8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...