1X48A

Solution structure of the second dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
GSSGSSGYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x48A00
2B7VA 4X62E 1T4OA 1XMOE 2DB2A 1X49A 1N34E 1O0WA 2DMYA 1T4LB 2UU9E 3ADLA 2HHHE 3J7Yp 3ADJA 2VQEE 3C4BA 1YYWA 2YT4A 2B3TB 4AQYE 4X8WA 4LF8E 2F4VE 1RC7A 4DR7E 4JV5E 4DUYE 4B3ME 4DV7E 1IBME 1PKPA 1UILA 3T1YE 4NXME 2DIXA 5IWAE 5CFFE 1XNQE 2RTXA 4JI6E 2NUEA 1RQ0A 4LFBE 2LBSB 1N33E 2LTRA 4OOGC 1J26A 2LRSA 2VQFE 3P1XA 4KHPE 2EZ6A 2UXCE 4YHHE 2B7TA 1HR0E 1WHQA 2LUQA 4DV3E 4DV1E 2UUCE 4LF4E 1HNWE 2JVAA 2L2KB 1STUA 2KHXA 4YY3E 1I94E 4X65E 3C4TA 2UUBE 4DR5E 4LF5E 4DV6E 2RS7A 4JI4E 4LF9E 1XNRE 3ADIA 3HTXA 1EKZA 1DI2A 4WYQB 4DR3E 5LMNE 2N3HA 3T1HE 4DUZE 3VYXA 4GKKE 4M30A 2RSMA 1J5EE 2NUFA 2NUGA 1IBKE 4JI0E 4X64E 4M2ZA 2RS6A 2ZM6E 5BR8E 1T4NA 4JI5E 1XMQE 2UUAE 2JY9A 2L2MA 4LF6E 2L33A 2L2NA 4OX9E 1YZ9A 4DV4E 2L3JA 4DV0E 4JI1E 2LUPB 4WFTA 3OTOE 4JI2E 1X47A 4DR4E 1IBLE 2CPNA 1HNXE 3ADGA 1WHNA 4DR6E 4LFAE 5LMUE 1FKAE 4DR2E 2MDRA 4GKJE 2LTSA 4DR1E 2LJHA 3LLHA 1ZBTA 2UXBE 1UHZA 2IHR1 4NXNE 4B3SE 2NA2A 1N32E 4DV2E 1QU6A 2L3CA 1YYOA 4B3TE 4X66E 3VYYA 4B3RE 2E5LE 4LF7E 1X48A 4DV5E 1YYKA 1N36E 1HNZE 1FJGE 4JI7E 4JI3E 4JI8E 4LFCE 4DKKA 4JYAE 1GQEA 4K0KE 2N3GA 2UXDE
chains in the Genus database with same CATH superfamily
2B7VA 2EMBA 2MKNA 4X62E 4HTGA 3F6GA 1DQ3A 3OMLA 1T4LB 3THNA 2LMZA 2YTEA 3J7Yp 3C4BA 4MLVA 3DJWA 4N4RB 2YT4A 2B3TB 2EOOA 1A1HA 5A6JA 2YRMA 4JV5E 2EOEA 1UBDC 4B3ME 2ELZA 4BC9A 2DLQA 2EMCA 2EPMX 1F2IG 2V87A 5CFFE 5IWAE 1G2FC 5AE3A 2RTXA 1UN6B 3KZZA 2EOXA 2GPIA 2NUEA 5IXMB 2EPAA 2EOMA 2EORA 2M1SA 2LRSA 2J7JA 2V86A 1X6HA 2EQ0A 2LVHA 4WSPA 1EH6A 3P1XA 2EOYA 4YHHE 4F9CB 4Q28A 1SR9A 1YUIA 4LF4E 1BBGA 2EOIA 4IJDA 3BIDA 4YY3E 1A1LA 4R2CA 1I94E 2EMHA 3C4TA 2F8BA 1DGCA 2UUBE 5A6KA 3MHSC 4L8NA 1PJSA 2GLIA 2EPPA 1X6EA 1EKZA 2EM0A 1RMDA 4R2QA 2BB8A 2JOBA 3EQ1A 5LMNE 2R1FA 1X5WA 2RSMA 1NEIA 4P7DA 2NUFA 1IBKE 4JI0E 2YZTA 2YTOA 2EN6A 2L2NA 4OX9E 2LUPB 5KL6A 1Z1BA 3BF2A 3OTOE 1IQOA 1HNXE 2FGGA 4DR6E 5LMUE 4O24A 2MDRA 3BGHA 4DR1E 2DRPA 1UHZA 2EPZA 2LV2A 2L3CA 2EOSA 1AAYA 2E5LE 4LF7E 4O4KA 2HC5A 1N36E 1FJGE 3K6QA 2EM5A 4JI8E 4KWYA 4JYAE 4IS1C 2N8XA 1QNTA 4K0KE 2N3GA 5A69A 2EN4A 1T4OA 2VE7C 1X49A 2DB2A 1N34E 1O0WA 2DMYA 3ADLA 3J81C 3ADJA 2VQEE 4AQYE 1RC7A 1AH5A 1EH7A 3AV0A 2YTGA 4L5NC 4MLQA 4O43A 5AC5A 1BBOA 1UILA 4WXCA 3THOB 2MKDA 2YU5A 1XNQE 2WZOA 1ZR9A 1GTKA 3FIGA 2RPCA 2HJJA 3J80C 2EM8A 2EN7A 2K7IA 3C6MA 4OOGC 5F3WA 5KL7A 2EM3A 1TF3A 5LLQA 4R2DA 1JK2A 2M7QA 1NCSA 2B7TA 4F6NA 1A1FA 4O5GA 2EPUA 2RSIA 2LJUA 4BS9A 2EM6A 1LLMC 2EPOA 1STUA 2B9DA 2KOUA 2BBGA 2KHXA 3JTZA 5A6BD 4X65E 4R2PA 2JXPA 3HPZA 2EOJA 2EMAA 2EMYA 5KL2A 5IT9C 2RS7A 1MGTA 1XNRE 2L8TA 2LCEA 4WYQB 3JU0A 2JWOA 2YSOA 4GEQB 4BBYA 1WJPA 2EOHA 4Q35B 1J5EE 3J7AG 1X6FA 4R2AA 2FTXB 2EM2A 3L00A 1WXRA 4X64E 4P78A 5DNYA 2YTNA 4M2ZA 2KONA 2EN8A 2R76A 2JR1A 1T4NA 1KYQA 5A6BA 2DLKA 2L2MA 4LF6E 1X3CA 2WBTA 2ENHA 2YWQA 3MHHC 4WFTA 4JI2E 1X47A 2CSHA 2EMKA 4R2EA 4DR4E 4RHBB 2EMWA 1FKAE 4M9VC 2YRHA 2EM7A 2G7HA 2LTSA 4GZNC 2VRDA 3LLHA 3EPLA 4LU9A 2VF1A 2IHR1 4WXDA 2YTDA 1QU6A 2Q8UA 4DV2E 1YYOA 2M4IA 1PJQA 4DV5E 2EN2A 1T39A 4JI3E 4LFCE 3HQ1A 3QG5C 3C6KA 1EH8A 4ZYHA 2JP9A 1G2DC 4BHBA 2EPKX 2DMIA 5KL3A 3TQMA 5KL4A 3UK3C 5T6JA 2GHFA 3IWCA 4X8WA 2HGHA 2F4VE 1IBME 1PKPA 2V88A 3T1YE 2I13A 2DIXA 3JAMC 4R03A 1ZU1A 2ODRD 5AC4A 1RQ0A 2JOXA 2LBSB 1N33E 2YTQA 1P47A 2YTJA 2VQFE 2EMIA 4R2RA 5AE2A 1T38A 2WCC3 2E72A 2YTPA 2EN1A 2EMZA 1YPNA 4R8OA 1A1JA 2H36X 1WHQA 5TSEA 1HR0E 2EQ3A 1BB8A 2I9IA 4DV1E 2UUCE 2EOZA 1HNWE 2JVAA 2L2KB 1WRJA 3H09A 2EPLX 4LF5E 4DV6E 2MC6A 2ADRA 2YRKA 4I8OA 3DF6A 4JI4E 4LF9E 3ADIA 4F6MA 1DI2A 4DR3E 2A25A 3VK6A 2EPCA 4DUZE 4M30A 1A1GA 2L92A 1TF6A 2ENAA 4X9JA 4F54A 2NUGA 1TN9A 2PRTA 2ODRC 2YSPA 2RS6A 2ZM6E 5BR8E 3RMPA 4FK5C 1XMQE 2EL4A 2EMLA 2EOFA 2DSYA 1YZ9A 1MEYC 4DV4E 2WBSA 4DV0E 1PDAA 1PJTA 3EPJA 2EL6A 2DGCA 2V83A 1SFEA 2LE2A 4WX9A 3ADGA 2EM4A 1KJKA 4DR2E 2K4VA 3KZYA 4LTYA 4WPYA 2LJHA 2UXBE 2JYAA 4NXNE 1A1KA 1N32E 4WSGA 3ZOQB 4X66E 3F6HA 1X48A 3ECRA 2L6MA 2EMGA 2EM9A 1A1IA 1GQEA 1IQSA 1IMUA 5LL6R 2UXDE 2V89A 3M99B 2MC5A 4TUGA 1XMOE 1L4SA 2UU9E 2HHHE 1YYWA 2EMFA 2EN3A 2FV4B 4LF8E 4DR7E 4DUYE 4DV7E 2YTIA 4NXME 2WBUA 3IWBA 5FLXC 3KWRA 4JI6E 2EOQA 4F2JC 2V8QB 4M0VA 4LFBE 2LO3A 2LTRA 4BMJA 1J26A 2EMXA 5IV8B 5AASA 1N3GA 2YU8A 1GZ6A 4F9BB 4KHPE 4R2SA 3HPSA 4BC7A 2EZ6A 2UXCE 2ELYA 3HXLA 2LUQA 2EL5A 3AUZA 4TUIA 4DV3E 3MSWA 4KZSA 1YUJA 1ZBQA 2EE8A 4BCAA 5KL5A 4DR5E 4HEIA 2CT1A 3LMLA 2RQLA 2YTFA 3HTXA 2LT7A 2MDGA 1ZAAC 1JK1A 2N3HA 3T1HE 3VYXA 4GKKE 3BBGA 3EPHA 4ZYGA 5A2QC 2E1MA 2EWLA 4DMIA 4JI5E 2UUAE 2EPRA 5AE1A 2JY9A 2EPXA 4J8ZA 2L33A 4ZYEA 2D9HA 2L3JA 1YFHA 5A6AA 4JI1E 4ZYDA 2EPNA 2EQ1A 1IBLE 2CPNA 1WHNA 4LFAE 2YPNA 2EJ4A 4RH8A 4GKJE 2V85A 2JPAA 5ADZA 1ZBTA 3EPKA 4NZVA 2EP3A 2NABA 1B69A 2ENCA 4B3SE 2NA2A 4B3TE 4B3RE 4BHCA 3VYYA 2CTDA 1YSAC 1YYKA 1HNZE 4JI7E 3IWDA 3VHTB 4DKKA 4F9AB 4NHRA 2M9AA
chains in the Genus database with same CATH topology
2B7VA 2V89A 4X62E 1T4OA 2VE7C 2MC5A 3F6GA 4TUGA 1XMOE 1X49A 2DB2A 1N34E 1O0WA 2DMYA 1DQ3A 3OMLA 1T4LB 2UU9E 2HHHE 3J81C 2LMZA 5T6JA 3J7Yp 3ADLA 3ADJA 2VQEE 3C4BA 3DJWA 3IWCA 1YYWA 2YT4A 2B3TB 4AQYE 4X8WA 2FV4B 4LF8E 2F4VE 1RC7A 4DR7E 3AV0A 4JV5E 4L5NC 4DUYE 4B3ME 4DV7E 1IBME 1PKPA 2V88A 1UILA 4BC9A 3T1YE 4NXME 2DIXA 3IWBA 3JAMC 4R03A 2V87A 5CFFE 5IWAE 5AE3A 2ODRD 2RTXA 2WZOA 5FLXC 3KWRA 4JI6E 3FIGA 1XNQE 2NUEA 1RQ0A 2JOXA 2V8QB 4M0VA 2LBSB 4LFBE 1N33E 2LTRA 3J80C 4OOGC 5F3WA 4BMJA 2M1SA 1J26A 2LRSA 2VQFE 2V86A 5AE2A 5AASA 2M7QA 1GZ6A 4WSPA 3P1XA 4F9BB 4KHPE 3HPSA 4R8OA 4BC7A 2EZ6A 4YHHE 2UXCE 2B7TA 4F9CB 2H36X 1WHQA 1HR0E 3HXLA 2LUQA 3AUZA 4TUIA 4DV3E 4Q28A 4BS9A 4DV1E 3MSWA 1SR9A 2UUCE 4KZSA 4LF4E 1HNWE 2JVAA 2L2KB 1ZBQA 1STUA 2B9DA 2KOUA 3H09A 2KHXA 3JTZA 4YY3E 4BCAA 4X65E 3C4TA 2F8BA 4DR5E 1I94E 2UUBE 4LF5E 4DV6E 3HPZA 2MC6A 4L8NA 4I8OA 3LMLA 5IT9C 2RS7A 3DF6A 4JI4E 4LF9E 1XNRE 3ADIA 3HTXA 1EKZA 2L8TA 1DI2A 4WYQB 4DR3E 3JU0A 2JWOA 2JOBA 4GEQB 5LMNE 4BBYA 3VK6A 2N3HA 3T1HE 4DUZE 3VYXA 4GKKE 4M30A 2RSMA 2L92A 1J5EE 3J7AG 2FTXB 4F54A 4P7DA 2NUFA 2NUGA 1WXRA 5A2QC 2E1MA 2EWLA 4DMIA 1IBKE 4X64E 4JI0E 4P78A 5DNYA 2ODRC 4M2ZA 2RS6A 2ZM6E 2KONA 2YZTA 5BR8E 2JR1A 1T4NA 3RMPA 1XMQE 5AE1A 2UUAE 4JI5E 2JY9A 2L2MA 4J8ZA 2L33A 2L2NA 4LF6E 2DSYA 4OX9E 1YZ9A 4DV4E 4B3TE 2L3JA 4DV0E 4JI1E 2LUPB 4WFTA 3OTOE 4JI2E 1X47A 2V83A 4DR4E 1IBLE 2CPNA 2LE2A 1HNXE 2FGGA 1WHNA 3ADGA 4LFAE 4DR6E 5LMUE 1FKAE 4DR2E 2MDRA 4GKJE 2G7HA 2K4VA 2V85A 2LTSA 4LTYA 4WPYA 2LJHA 5ADZA 3LLHA 1ZBTA 4LU9A 4DR1E 2UXBE 2VF1A 1UHZA 2IHR1 4NXNE 4B3SE 2NA2A 1N32E 1QU6A 4DV2E 2L3CA 1YYOA 2M4IA 3ZOQB 4X66E 3VYYA 2E5LE 3F6HA 5LL6R 4LF7E 4B3RE 1X48A 4DV5E 1YYKA 2L6MA 1N36E 1HNZE 1FJGE 3K6QA 4JI7E 4JI3E 4JI8E 3IWDA 3HQ1A 4DKKA 4LFCE 4JYAE 1GQEA 4F9AB 4K0KE 2N3GA 2UXDE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7V A;  4X62 E;  1T4O A;  1XMO E;  2DB2 A;  1X49 A;  1N34 E;  1O0W A;  2DMY A;  1T4L B;  2UU9 E;  3ADL A;  2HHH E;  3J7Y p;  3ADJ A;  2VQE E;  3C4B A;  1YYW A;  2YT4 A;  2B3T B;  4AQY E;  4X8W A;  4LF8 E;  2F4V E;  1RC7 A;  4DR7 E;  4JV5 E;  4DUY E;  4B3M E;  4DV7 E;  1IBM E;  1PKP A;  1UIL A;  3T1Y E;  4NXM E;  2DIX A;  5IWA E;  5CFF E;  1XNQ E;  2RTX A;  4JI6 E;  2NUE A;  1RQ0 A;  4LFB E;  2LBS B;  1N33 E;  2LTR A;  4OOG C;  1J26 A;  2LRS A;  2VQF E;  3P1X A;  4KHP E;  2EZ6 A;  2UXC E;  4YHH E;  2B7T A;  1HR0 E;  1WHQ A;  2LUQ A;  4DV3 E;  4DV1 E;  2UUC E;  4LF4 E;  1HNW E;  2JVA A;  2L2K B;  1STU A;  2KHX A;  4YY3 E;  1I94 E;  4X65 E;  3C4T A;  2UUB E;  4DR5 E;  4LF5 E;  4DV6 E;  2RS7 A;  4JI4 E;  4LF9 E;  1XNR E;  3ADI A;  3HTX A;  1EKZ A;  1DI2 A;  4WYQ B;  4DR3 E;  5LMN E;  2N3H A;  3T1H E;  4DUZ E;  3VYX A;  4GKK E;  4M30 A;  2RSM A;  1J5E E;  2NUF A;  2NUG A;  1IBK E;  4JI0 E;  4X64 E;  4M2Z A;  2RS6 A;  2ZM6 E;  5BR8 E;  1T4N A;  4JI5 E;  1XMQ E;  2UUA E;  2JY9 A;  2L2M A;  4LF6 E;  2L33 A;  2L2N A;  4OX9 E;  1YZ9 A;  4DV4 E;  2L3J A;  4DV0 E;  4JI1 E;  2LUP B;  4WFT A;  3OTO E;  4JI2 E;  1X47 A;  4DR4 E;  1IBL E;  2CPN A;  1HNX E;  3ADG A;  1WHN A;  4DR6 E;  4LFA E;  5LMU E;  1FKA E;  4DR2 E;  2MDR A;  4GKJ E;  2LTS A;  4DR1 E;  2LJH A;  3LLH A;  1ZBT A;  2UXB E;  1UHZ A;  2IHR 1;  4NXN E;  4B3S E;  2NA2 A;  1N32 E;  4DV2 E;  1QU6 A;  2L3C A;  1YYO A;  4B3T E;  4X66 E;  3VYY A;  4B3R E;  2E5L E;  4LF7 E;  1X48 A;  4DV5 E;  1YYK A;  1N36 E;  1HNZ E;  1FJG E;  4JI7 E;  4JI3 E;  4JI8 E;  4LFC E;  4DKK A;  4JYA E;  1GQE A;  4K0K E;  2N3G A;  2UXD E; 
#chains in the Genus database with same CATH topology
 2B7V A;  2EMB A;  2MKN A;  4X62 E;  4HTG A;  3F6G A;  1DQ3 A;  3OML A;  1T4L B;  3THN A;  2LMZ A;  2YTE A;  3J7Y p;  3C4B A;  4MLV A;  3DJW A;  4N4R B;  2YT4 A;  2B3T B;  2EOO A;  1A1H A;  5A6J A;  2YRM A;  4JV5 E;  2EOE A;  1UBD C;  4B3M E;  2ELZ A;  4BC9 A;  2DLQ A;  2EMC A;  2EPM X;  1F2I G;  2V87 A;  5CFF E;  5IWA E;  1G2F C;  5AE3 A;  2RTX A;  1UN6 B;  3KZZ A;  2EOX A;  2GPI A;  2NUE A;  5IXM B;  2EPA A;  2EOM A;  2EOR A;  2M1S A;  2LRS A;  2J7J A;  2V86 A;  1X6H A;  2EQ0 A;  2LVH A;  4WSP A;  1EH6 A;  3P1X A;  2EOY A;  4YHH E;  4F9C B;  4Q28 A;  1SR9 A;  1YUI A;  4LF4 E;  1BBG A;  2EOI A;  4IJD A;  3BID A;  4YY3 E;  1A1L A;  4R2C A;  1I94 E;  2EMH A;  3C4T A;  2F8B A;  1DGC A;  2UUB E;  5A6K A;  3MHS C;  4L8N A;  1PJS A;  2GLI A;  2EPP A;  1X6E A;  1EKZ A;  2EM0 A;  1RMD A;  4R2Q A;  2BB8 A;  2JOB A;  3EQ1 A;  5LMN E;  2R1F A;  1X5W A;  2RSM A;  1NEI A;  4P7D A;  2NUF A;  1IBK E;  4JI0 E;  2YZT A;  2YTO A;  2EN6 A;  2L2N A;  4OX9 E;  2LUP B;  5KL6 A;  1Z1B A;  3BF2 A;  3OTO E;  1IQO A;  1HNX E;  2FGG A;  4DR6 E;  5LMU E;  4O24 A;  2MDR A;  3BGH A;  4DR1 E;  2DRP A;  1UHZ A;  2EPZ A;  2LV2 A;  2L3C A;  2EOS A;  1AAY A;  2E5L E;  4LF7 E;  4O4K A;  2HC5 A;  1N36 E;  1FJG E;  3K6Q A;  2EM5 A;  4JI8 E;  4KWY A;  4JYA E;  4IS1 C;  2N8X A;  1QNT A;  4K0K E;  2N3G A;  5A69 A;  2EN4 A;  1T4O A;  2VE7 C;  1X49 A;  2DB2 A;  1N34 E;  1O0W A;  2DMY A;  3ADL A;  3J81 C;  3ADJ A;  2VQE E;  4AQY E;  1RC7 A;  1AH5 A;  1EH7 A;  3AV0 A;  2YTG A;  4L5N C;  4MLQ A;  4O43 A;  5AC5 A;  1BBO A;  1UIL A;  4WXC A;  3THO B;  2MKD A;  2YU5 A;  1XNQ E;  2WZO A;  1ZR9 A;  1GTK A;  3FIG A;  2RPC A;  2HJJ A;  3J80 C;  2EM8 A;  2EN7 A;  2K7I A;  3C6M A;  4OOG C;  5F3W A;  5KL7 A;  2EM3 A;  1TF3 A;  5LLQ A;  4R2D A;  1JK2 A;  2M7Q A;  1NCS A;  2B7T A;  4F6N A;  1A1F A;  4O5G A;  2EPU A;  2RSI A;  2LJU A;  4BS9 A;  2EM6 A;  1LLM C;  2EPO A;  1STU A;  2B9D A;  2KOU A;  2BBG A;  2KHX A;  3JTZ A;  5A6B D;  4X65 E;  4R2P A;  2JXP A;  3HPZ A;  2EOJ A;  2EMA A;  2EMY A;  5KL2 A;  5IT9 C;  2RS7 A;  1MGT A;  1XNR E;  2L8T A;  2LCE A;  4WYQ B;  3JU0 A;  2JWO A;  2YSO A;  4GEQ B;  4BBY A;  1WJP A;  2EOH A;  4Q35 B;  1J5E E;  3J7A G;  1X6F A;  4R2A A;  2FTX B;  2EM2 A;  3L00 A;  1WXR A;  4X64 E;  4P78 A;  5DNY A;  2YTN A;  4M2Z A;  2KON A;  2EN8 A;  2R76 A;  2JR1 A;  1T4N A;  1KYQ A;  5A6B A;  2DLK A;  2L2M A;  4LF6 E;  1X3C A;  2WBT A;  2ENH A;  2YWQ A;  3MHH C;  4WFT A;  4JI2 E;  1X47 A;  2CSH A;  2EMK A;  4R2E A;  4DR4 E;  4RHB B;  2EMW A;  1FKA E;  4M9V C;  2YRH A;  2EM7 A;  2G7H A;  2LTS A;  4GZN C;  2VRD A;  3LLH A;  3EPL A;  4LU9 A;  2VF1 A;  2IHR 1;  4WXD A;  2YTD A;  1QU6 A;  2Q8U A;  4DV2 E;  1YYO A;  2M4I A;  1PJQ A;  4DV5 E;  2EN2 A;  1T39 A;  4JI3 E;  4LFC E;  3HQ1 A;  3QG5 C;  3C6K A;  1EH8 A;  4ZYH A;  2JP9 A;  1G2D C;  4BHB A;  2EPK X;  2DMI A;  5KL3 A;  3TQM A;  5KL4 A;  3UK3 C;  5T6J A;  2GHF A;  3IWC A;  4X8W A;  2HGH A;  2F4V E;  1IBM E;  1PKP A;  2V88 A;  3T1Y E;  2I13 A;  2DIX A;  3JAM C;  4R03 A;  1ZU1 A;  2ODR D;  5AC4 A;  1RQ0 A;  2JOX A;  2LBS B;  1N33 E;  2YTQ A;  1P47 A;  2YTJ A;  2VQF E;  2EMI A;  4R2R A;  5AE2 A;  1T38 A;  2WCC 3;  2E72 A;  2YTP A;  2EN1 A;  2EMZ A;  1YPN A;  4R8O A;  1A1J A;  2H36 X;  1WHQ A;  5TSE A;  1HR0 E;  2EQ3 A;  1BB8 A;  2I9I A;  4DV1 E;  2UUC E;  2EOZ A;  1HNW E;  2JVA A;  2L2K B;  1WRJ A;  3H09 A;  2EPL X;  4LF5 E;  4DV6 E;  2MC6 A;  2ADR A;  2YRK A;  4I8O A;  3DF6 A;  4JI4 E;  4LF9 E;  3ADI A;  4F6M A;  1DI2 A;  4DR3 E;  2A25 A;  3VK6 A;  2EPC A;  4DUZ E;  4M30 A;  1A1G A;  2L92 A;  1TF6 A;  2ENA A;  4X9J A;  4F54 A;  2NUG A;  1TN9 A;  2PRT A;  2ODR C;  2YSP A;  2RS6 A;  2ZM6 E;  5BR8 E;  3RMP A;  4FK5 C;  1XMQ E;  2EL4 A;  2EML A;  2EOF A;  2DSY A;  1YZ9 A;  1MEY C;  4DV4 E;  2WBS A;  4DV0 E;  1PDA A;  1PJT A;  3EPJ A;  2EL6 A;  2DGC A;  2V83 A;  1SFE A;  2LE2 A;  4WX9 A;  3ADG A;  2EM4 A;  1KJK A;  4DR2 E;  2K4V A;  3KZY A;  4LTY A;  4WPY A;  2LJH A;  2UXB E;  2JYA A;  4NXN E;  1A1K A;  1N32 E;  4WSG A;  3ZOQ B;  4X66 E;  3F6H A;  1X48 A;  3ECR A;  2L6M A;  2EMG A;  2EM9 A;  1A1I A;  1GQE A;  1IQS A;  1IMU A;  5LL6 R;  2UXD E;  2V89 A;  3M99 B;  2MC5 A;  4TUG A;  1XMO E;  1L4S A;  2UU9 E;  2HHH E;  1YYW A;  2EMF A;  2EN3 A;  2FV4 B;  4LF8 E;  4DR7 E;  4DUY E;  4DV7 E;  2YTI A;  4NXM E;  2WBU A;  3IWB A;  5FLX C;  3KWR A;  4JI6 E;  2EOQ A;  4F2J C;  2V8Q B;  4M0V A;  4LFB E;  2LO3 A;  2LTR A;  4BMJ A;  1J26 A;  2EMX A;  5IV8 B;  5AAS A;  1N3G A;  2YU8 A;  1GZ6 A;  4F9B B;  4KHP E;  4R2S A;  3HPS A;  4BC7 A;  2EZ6 A;  2UXC E;  2ELY A;  3HXL A;  2LUQ A;  2EL5 A;  3AUZ A;  4TUI A;  4DV3 E;  3MSW A;  4KZS A;  1YUJ A;  1ZBQ A;  2EE8 A;  4BCA A;  5KL5 A;  4DR5 E;  4HEI A;  2CT1 A;  3LML A;  2RQL A;  2YTF A;  3HTX A;  2LT7 A;  2MDG A;  1ZAA C;  1JK1 A;  2N3H A;  3T1H E;  3VYX A;  4GKK E;  3BBG A;  3EPH A;  4ZYG A;  5A2Q C;  2E1M A;  2EWL A;  4DMI A;  4JI5 E;  2UUA E;  2EPR A;  5AE1 A;  2JY9 A;  2EPX A;  4J8Z A;  2L33 A;  4ZYE A;  2D9H A;  2L3J A;  1YFH A;  5A6A A;  4JI1 E;  4ZYD A;  2EPN A;  2EQ1 A;  1IBL E;  2CPN A;  1WHN A;  4LFA E;  2YPN A;  2EJ4 A;  4RH8 A;  4GKJ E;  2V85 A;  2JPA A;  5ADZ A;  1ZBT A;  3EPK A;  4NZV A;  2EP3 A;  2NAB A;  1B69 A;  2ENC A;  4B3S E;  2NA2 A;  4B3T E;  4B3R E;  4BHC A;  3VYY A;  2CTD A;  1YSA C;  1YYK A;  1HNZ E;  4JI7 E;  3IWD A;  3VHT B;  4DKK A;  4F9A B;  4NHR A;  2M9A A; 
#chains in the Genus database with same CATH homology
 2B7V A;  2V89 A;  4X62 E;  1T4O A;  2VE7 C;  2MC5 A;  3F6G A;  4TUG A;  1XMO E;  1X49 A;  2DB2 A;  1N34 E;  1O0W A;  2DMY A;  1DQ3 A;  3OML A;  1T4L B;  2UU9 E;  2HHH E;  3J81 C;  2LMZ A;  5T6J A;  3J7Y p;  3ADL A;  3ADJ A;  2VQE E;  3C4B A;  3DJW A;  3IWC A;  1YYW A;  2YT4 A;  2B3T B;  4AQY E;  4X8W A;  2FV4 B;  4LF8 E;  2F4V E;  1RC7 A;  4DR7 E;  3AV0 A;  4JV5 E;  4L5N C;  4DUY E;  4B3M E;  4DV7 E;  1IBM E;  1PKP A;  2V88 A;  1UIL A;  4BC9 A;  3T1Y E;  4NXM E;  2DIX A;  3IWB A;  3JAM C;  4R03 A;  2V87 A;  5CFF E;  5IWA E;  5AE3 A;  2ODR D;  2RTX A;  2WZO A;  5FLX C;  3KWR A;  4JI6 E;  3FIG A;  1XNQ E;  2NUE A;  1RQ0 A;  2JOX A;  2V8Q B;  4M0V A;  2LBS B;  4LFB E;  1N33 E;  2LTR A;  3J80 C;  4OOG C;  5F3W A;  4BMJ A;  2M1S A;  1J26 A;  2LRS A;  2VQF E;  2V86 A;  5AE2 A;  5AAS A;  2M7Q A;  1GZ6 A;  4WSP A;  3P1X A;  4F9B B;  4KHP E;  3HPS A;  4R8O A;  4BC7 A;  2EZ6 A;  4YHH E;  2UXC E;  2B7T A;  4F9C B;  2H36 X;  1WHQ A;  1HR0 E;  3HXL A;  2LUQ A;  3AUZ A;  4TUI A;  4DV3 E;  4Q28 A;  4BS9 A;  4DV1 E;  3MSW A;  1SR9 A;  2UUC E;  4KZS A;  4LF4 E;  1HNW E;  2JVA A;  2L2K B;  1ZBQ A;  1STU A;  2B9D A;  2KOU A;  3H09 A;  2KHX A;  3JTZ A;  4YY3 E;  4BCA A;  4X65 E;  3C4T A;  2F8B A;  4DR5 E;  1I94 E;  2UUB E;  4LF5 E;  4DV6 E;  3HPZ A;  2MC6 A;  4L8N A;  4I8O A;  3LML A;  5IT9 C;  2RS7 A;  3DF6 A;  4JI4 E;  4LF9 E;  1XNR E;  3ADI A;  3HTX A;  1EKZ A;  2L8T A;  1DI2 A;  4WYQ B;  4DR3 E;  3JU0 A;  2JWO A;  2JOB A;  4GEQ B;  5LMN E;  4BBY A;  3VK6 A;  2N3H A;  3T1H E;  4DUZ E;  3VYX A;  4GKK E;  4M30 A;  2RSM A;  2L92 A;  1J5E E;  3J7A G;  2FTX B;  4F54 A;  4P7D A;  2NUF A;  2NUG A;  1WXR A;  5A2Q C;  2E1M A;  2EWL A;  4DMI A;  1IBK E;  4X64 E;  4JI0 E;  4P78 A;  5DNY A;  2ODR C;  4M2Z A;  2RS6 A;  2ZM6 E;  2KON A;  2YZT A;  5BR8 E;  2JR1 A;  1T4N A;  3RMP A;  1XMQ E;  5AE1 A;  2UUA E;  4JI5 E;  2JY9 A;  2L2M A;  4J8Z A;  2L33 A;  2L2N A;  4LF6 E;  2DSY A;  4OX9 E;  1YZ9 A;  4DV4 E;  4B3T E;  2L3J A;  4DV0 E;  4JI1 E;  2LUP B;  4WFT A;  3OTO E;  4JI2 E;  1X47 A;  2V83 A;  4DR4 E;  1IBL E;  2CPN A;  2LE2 A;  1HNX E;  2FGG A;  1WHN A;  3ADG A;  4LFA E;  4DR6 E;  5LMU E;  1FKA E;  4DR2 E;  2MDR A;  4GKJ E;  2G7H A;  2K4V A;  2V85 A;  2LTS A;  4LTY A;  4WPY A;  2LJH A;  5ADZ A;  3LLH A;  1ZBT A;  4LU9 A;  4DR1 E;  2UXB E;  2VF1 A;  1UHZ A;  2IHR 1;  4NXN E;  4B3S E;  2NA2 A;  1N32 E;  1QU6 A;  4DV2 E;  2L3C A;  1YYO A;  2M4I A;  3ZOQ B;  4X66 E;  3VYY A;  2E5L E;  3F6H A;  5LL6 R;  4LF7 E;  4B3R E;  1X48 A;  4DV5 E;  1YYK A;  2L6M A;  1N36 E;  1HNZ E;  1FJG E;  3K6Q A;  4JI7 E;  4JI3 E;  4JI8 E;  3IWD A;  3HQ1 A;  4DKK A;  4LFC E;  4JYA E;  1GQE A;  4F9A B;  4K0K E;  2N3G A;  2UXD E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...