1X4SA

Solution structure of zinc finger hit domain in protein fon
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
GSSGSSGMEPAGPCGFCPAGEVQPARYTCPRCNAPYCSLRCYRTHGTCAENFYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger HIT domain containing protein 2
publication title Solution structure of the zinc finger HIT domain in protein FON
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04438 zf-HIT HIT zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.190 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1x4sA00
1X4SA
chains in the Genus database with same CATH superfamily
2K9HA 2OZUA 2SGQI 1SGDI 1CGII 2KCXA 1Q9BA 2L7XA 1H0ZA 5FUWA 1UHAA 2JZMA 1BMOA 1UVGA 1TBQR 2ODDA 2RC4A 4A24A 1P9GA 1TBNA 1P9ZA 2LUYA 3E59A 2SGDI 1MJ9A 5HI7A 3R5CA 1PPFI 3QTLD 1SGRI 2PQ8A 2F3CI 7WGAA 2E73A 3RU0A 5CCMA 1SGNI 2M5XA 3OL0A 3UOEA 1XA6A 1ULMA 2GKVA 3R5BA 2NU3I 1HEVA 3CXLA 1X74A 1TGSI 2JXDA 2SGEI 3FSXA 1OVOA 2X3TA 3OXGA 3R5DA 4SGBI 3SGQI 4E1PA 1Z2IA 5HQ8A 1CE3A 1OYVI 2GKTI 2ORWA 3BJIA 4JCVE 2XRCA 1MJAA 4UXIA 3UGLA 3OXLA 2QQDA 1V1IA 1HPTA 5FUVA 1PTRA 1WGTA 2N52A 1Y8FA 3QAHA 1IY5A 2OVOA 3SGBI 2X52A 2KMQA 1HJAI 1CHOI 1NXUA 3HH2C 4OVOA 2ARPF 2UVOA 3UGIA 2QPOA 1DS2I 2QQCA 4MPIA 1BUSA 1CGJI 1XX6A 1LR9A 2J9RA 1YTPA 2B0UC 3D00A 9WGAA 3GOXA 1FYBA 1R0RI 2DIPA 2L8EA 2E5RA 1PTQA 1CT0I 4HGUA 2V53A 1K7VA 1WTJA 2ERWA 2WVJA 3MEKA 1KMAA 2CJSC 5J8FA 1K7TA 1MJBA 2YUUA 1CT2I 5J8CA 3FSYA 1PCEA 2ROWA 1K7UA 2WCYA 1IY6A 2JW6A 2CWGA 1CSOI 2CWFA 1WKXA 3UEJA 2W0TA 2OD1A 5JHWC 2UZ3A 4FKDA 3SEKC 5EX0A 3B4VC 1Y1BA 5DAEA 1V1HA 2YQPA 1SGPI 2ELIA 2SGPI 1FARA 2JA1A 2RIJA 2J87A 1X4SA 1TURA 4L9MA 4DNCA 2N71A 1FY7A 3UEYA 2V1CC 2DB6A 1ULKA 1M8CA 2B8TA 2LB7A 3TO7A 1LR8A 2BUSA 3FC3A 1VDDA 1ULNA 1OMUA 1SGEI 1XBTA 4GI3C 2A20A 2N17A 3KY9A 2NU2I 3OVOA 4AMLA 2DKVA 2KMOA 4B6DA 1FAQA 1HDLA 1WGCA 1R79A 3VDUA 2FNFX 2KMPA 1TIHA 1SGQI 1OMTA 5E3PA 3R5AA 1IW4A 1KBEA 4WP4A 1UUCA 3TJQA 2SGFI 3VDPA 1RFHA 1UVFA 2KMRA 2N1AB 5E3RA 3VE5A 1Z7KB 3UGDA 1KBFA 2GIVA 2Y0MA 2VRWB 3UFFA 2LEOA 2NU0I 4UXHA 3TOBA 2ENNA 1W4RA 1NUBA 1W3SA 2OU2A 5EX3A 5CCLA 1N13A 2JYYA 4E1RA 3TOAA 1Y1CA 1YU6C 3OXFA 2QQ0A 5FUXA 3TO6A 1M8BA 2CWHA 1SGYI 2GVIA 2V1CA 2GKRI 5FUYA 3PDNA 2ENZA 1MT1A 1TUSA 1TBOA 1AN1I 1CT4I 5E3QA 4UXJA 2ORVA 3QWPA 1S20A 2P6AC 1U5KA 1PJUA 1LR7A 1TOTA 2NU4I 2WGCA 2QQEA 3TO9A 2NU1I 1DS3I 3E2IA 1TBRR
chains in the Genus database with same CATH topology
2K9HA 2SGQI 1SGDI 1CGII 2KCXA 2L7XA 1H0ZA 5FUWA 2JZMA 1BMOA 1UVGA 1TBQR 2ODDA 4A24A 1TBNA 2LUYA 3E59A 2SGDI 5HI7A 1PPFI 3QTLD 1SGRI 2F3CI 2E73A 3RU0A 5CCMA 1SGNI 2M5XA 3OL0A 1XA6A 2GKVA 2NU3I 3CXLA 1X74A 1TGSI 2JXDA 2SGEI 4SGBI 1OVOA 3SGQI 3OXGA 3UEYA 4E1PA 5HQ8A 1CE3A 1OYVI 2GKTI 2ORWA 3BJIA 4JCVE 2XRCA 4UXIA 3UGLA 3OXLA 2QQDA 1V1IA 1HPTA 5FUVA 1PTRA 2N52A 1Y8FA 1IY5A 2OVOA 3SGBI 2KMQA 1HJAI 1CHOI 3HH2C 4OVOA 2ARPF 3UGIA 2QPOA 1DS2I 2QQCA 1BUSA 1CGJI 1XX6A 1LR9A 2J9RA 1YTPA 2B0UC 3D00A 3GOXA 1FYBA 1R0RI 2DIPA 2L8EA 2E5RA 1PTQA 1CT0I 4HGUA 2V53A 2WVJA 2ERWA 3MEKA 1KMAA 2CJSC 2YUUA 1CT2I 1PCEA 2ROWA 2WCYA 1IY6A 2JW6A 1CSOI 3UEJA 2W0TA 2OD1A 5JHWC 2UZ3A 4FKDA 3SEKC 5EX0A 3B4VC 1Y1BA 5DAEA 1V1HA 2YQPA 1SGPI 2ELIA 2SGPI 1FARA 2JA1A 2J87A 1X4SA 1TURA 4L9MA 2N71A 2V1CC 2DB6A 1M8CA 2B8TA 1LR8A 2BUSA 3FC3A 1VDDA 1OMUA 1SGEI 1XBTA 4GI3C 2A20A 2N17A 3KY9A 2NU2I 3OVOA 4B6DA 2KMOA 1HDLA 1FAQA 1R79A 3VDUA 2FNFX 2KMPA 1TIHA 1SGQI 1OMTA 1IW4A 1KBEA 1UUCA 3TJQA 2SGFI 3VDPA 1RFHA 1UVFA 2KMRA 2N1AB 3VE5A 1Z7KB 3UGDA 1KBFA 2VRWB 3UFFA 2LEOA 2NU0I 4UXHA 2ENNA 1W4RA 1NUBA 1W3SA 5CCLA 5EX3A 1N13A 2JYYA 4E1RA 1Y1CA 1YU6C 3OXFA 2QQ0A 5FUXA 1M8BA 2GVIA 1SGYI 2V1CA 5FUYA 2GKRI 3PDNA 2ENZA 1MT1A 1TUSA 1TBOA 1AN1I 1CT4I 4UXJA 2ORVA 3QWPA 2P6AC 1U5KA 1PJUA 1LR7A 1TOTA 2NU4I 2QQEA 2NU1I 1DS3I 3E2IA 1TBRR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4S A; 
#chains in the Genus database with same CATH topology
 2K9H A;  2OZU A;  2SGQ I;  1SGD I;  1CGI I;  2KCX A;  1Q9B A;  2L7X A;  1H0Z A;  5FUW A;  1UHA A;  2JZM A;  1BMO A;  1UVG A;  1TBQ R;  2ODD A;  2RC4 A;  4A24 A;  1P9G A;  1TBN A;  1P9Z A;  2LUY A;  3E59 A;  2SGD I;  1MJ9 A;  5HI7 A;  3R5C A;  1PPF I;  3QTL D;  1SGR I;  2PQ8 A;  2F3C I;  7WGA A;  2E73 A;  3RU0 A;  5CCM A;  1SGN I;  2M5X A;  3OL0 A;  3UOE A;  1XA6 A;  1ULM A;  2GKV A;  3R5B A;  2NU3 I;  1HEV A;  3CXL A;  1X74 A;  1TGS I;  2JXD A;  2SGE I;  3FSX A;  1OVO A;  2X3T A;  3OXG A;  3R5D A;  4SGB I;  3SGQ I;  4E1P A;  1Z2I A;  5HQ8 A;  1CE3 A;  1OYV I;  2GKT I;  2ORW A;  3BJI A;  4JCV E;  2XRC A;  1MJA A;  4UXI A;  3UGL A;  3OXL A;  2QQD A;  1V1I A;  1HPT A;  5FUV A;  1PTR A;  1WGT A;  2N52 A;  1Y8F A;  3QAH A;  1IY5 A;  2OVO A;  3SGB I;  2X52 A;  2KMQ A;  1HJA I;  1CHO I;  1NXU A;  3HH2 C;  4OVO A;  2ARP F;  2UVO A;  3UGI A;  2QPO A;  1DS2 I;  2QQC A;  4MPI A;  1BUS A;  1CGJ I;  1XX6 A;  1LR9 A;  2J9R A;  1YTP A;  2B0U C;  3D00 A;  9WGA A;  3GOX A;  1FYB A;  1R0R I;  2DIP A;  2L8E A;  2E5R A;  1PTQ A;  1CT0 I;  4HGU A;  2V53 A;  1K7V A;  1WTJ A;  2ERW A;  2WVJ A;  3MEK A;  1KMA A;  2CJS C;  5J8F A;  1K7T A;  1MJB A;  2YUU A;  1CT2 I;  5J8C A;  3FSY A;  1PCE A;  2ROW A;  1K7U A;  2WCY A;  1IY6 A;  2JW6 A;  2CWG A;  1CSO I;  2CWF A;  1WKX A;  3UEJ A;  2W0T A;  2OD1 A;  5JHW C;  2UZ3 A;  4FKD A;  3SEK C;  5EX0 A;  3B4V C;  1Y1B A;  5DAE A;  1V1H A;  2YQP A;  1SGP I;  2ELI A;  2SGP I;  1FAR A;  2JA1 A;  2RIJ A;  2J87 A;  1X4S A;  1TUR A;  4L9M A;  4DNC A;  2N71 A;  1FY7 A;  3UEY A;  2V1C C;  2DB6 A;  1ULK A;  1M8C A;  2B8T A;  2LB7 A;  3TO7 A;  1LR8 A;  2BUS A;  3FC3 A;  1VDD A;  1ULN A;  1OMU A;  1SGE I;  1XBT A;  4GI3 C;  2A20 A;  2N17 A;  3KY9 A;  2NU2 I;  3OVO A;  4AML A;  2DKV A;  2KMO A;  4B6D A;  1FAQ A;  1HDL A;  1WGC A;  1R79 A;  3VDU A;  2FNF X;  2KMP A;  1TIH A;  1SGQ I;  1OMT A;  5E3P A;  3R5A A;  1IW4 A;  1KBE A;  4WP4 A;  1UUC A;  3TJQ A;  2SGF I;  3VDP A;  1RFH A;  1UVF A;  2KMR A;  2N1A B;  5E3R A;  3VE5 A;  1Z7K B;  3UGD A;  1KBF A;  2GIV A;  2Y0M A;  2VRW B;  3UFF A;  2LEO A;  2NU0 I;  4UXH A;  3TOB A;  2ENN A;  1W4R A;  1NUB A;  1W3S A;  2OU2 A;  5EX3 A;  5CCL A;  1N13 A;  2JYY A;  4E1R A;  3TOA A;  1Y1C A;  1YU6 C;  3OXF A;  2QQ0 A;  5FUX A;  3TO6 A;  1M8B A;  2CWH A;  1SGY I;  2GVI A;  2V1C A;  2GKR I;  5FUY A;  3PDN A;  2ENZ A;  1MT1 A;  1TUS A;  1TBO A;  1AN1 I;  1CT4 I;  5E3Q A;  4UXJ A;  2ORV A;  3QWP A;  1S20 A;  2P6A C;  1U5K A;  1PJU A;  1LR7 A;  1TOT A;  2NU4 I;  2WGC A;  2QQE A;  3TO9 A;  2NU1 I;  1DS3 I;  3E2I A;  1TBR R; 
#chains in the Genus database with same CATH homology
 2K9H A;  2SGQ I;  1SGD I;  1CGI I;  2KCX A;  2L7X A;  1H0Z A;  5FUW A;  2JZM A;  1BMO A;  1UVG A;  1TBQ R;  2ODD A;  4A24 A;  1TBN A;  2LUY A;  3E59 A;  2SGD I;  5HI7 A;  1PPF I;  3QTL D;  1SGR I;  2F3C I;  2E73 A;  3RU0 A;  5CCM A;  1SGN I;  2M5X A;  3OL0 A;  1XA6 A;  2GKV A;  2NU3 I;  3CXL A;  1X74 A;  1TGS I;  2JXD A;  2SGE I;  4SGB I;  1OVO A;  3SGQ I;  3OXG A;  3UEY A;  4E1P A;  5HQ8 A;  1CE3 A;  1OYV I;  2GKT I;  2ORW A;  3BJI A;  4JCV E;  2XRC A;  4UXI A;  3UGL A;  3OXL A;  2QQD A;  1V1I A;  1HPT A;  5FUV A;  1PTR A;  2N52 A;  1Y8F A;  1IY5 A;  2OVO A;  3SGB I;  2KMQ A;  1HJA I;  1CHO I;  3HH2 C;  4OVO A;  2ARP F;  3UGI A;  2QPO A;  1DS2 I;  2QQC A;  1BUS A;  1CGJ I;  1XX6 A;  1LR9 A;  2J9R A;  1YTP A;  2B0U C;  3D00 A;  3GOX A;  1FYB A;  1R0R I;  2DIP A;  2L8E A;  2E5R A;  1PTQ A;  1CT0 I;  4HGU A;  2V53 A;  2WVJ A;  2ERW A;  3MEK A;  1KMA A;  2CJS C;  2YUU A;  1CT2 I;  1PCE A;  2ROW A;  2WCY A;  1IY6 A;  2JW6 A;  1CSO I;  3UEJ A;  2W0T A;  2OD1 A;  5JHW C;  2UZ3 A;  4FKD A;  3SEK C;  5EX0 A;  3B4V C;  1Y1B A;  5DAE A;  1V1H A;  2YQP A;  1SGP I;  2ELI A;  2SGP I;  1FAR A;  2JA1 A;  2J87 A;  1X4S A;  1TUR A;  4L9M A;  2N71 A;  2V1C C;  2DB6 A;  1M8C A;  2B8T A;  1LR8 A;  2BUS A;  3FC3 A;  1VDD A;  1OMU A;  1SGE I;  1XBT A;  4GI3 C;  2A20 A;  2N17 A;  3KY9 A;  2NU2 I;  3OVO A;  4B6D A;  2KMO A;  1HDL A;  1FAQ A;  1R79 A;  3VDU A;  2FNF X;  2KMP A;  1TIH A;  1SGQ I;  1OMT A;  1IW4 A;  1KBE A;  1UUC A;  3TJQ A;  2SGF I;  3VDP A;  1RFH A;  1UVF A;  2KMR A;  2N1A B;  3VE5 A;  1Z7K B;  3UGD A;  1KBF A;  2VRW B;  3UFF A;  2LEO A;  2NU0 I;  4UXH A;  2ENN A;  1W4R A;  1NUB A;  1W3S A;  5CCL A;  5EX3 A;  1N13 A;  2JYY A;  4E1R A;  1Y1C A;  1YU6 C;  3OXF A;  2QQ0 A;  5FUX A;  1M8B A;  2GVI A;  1SGY I;  2V1C A;  5FUY A;  2GKR I;  3PDN A;  2ENZ A;  1MT1 A;  1TUS A;  1TBO A;  1AN1 I;  1CT4 I;  4UXJ A;  2ORV A;  3QWP A;  2P6A C;  1U5K A;  1PJU A;  1LR7 A;  1TOT A;  2NU4 I;  2QQE A;  2NU1 I;  1DS3 I;  3E2I A;  1TBR R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...