1X52A

Solution structures of the c-terminal domain of the human pelota homolog (cgi-17)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pelota homolog
publication title Solution structures of the C-terminal domain of the human Pelota homolog (CGI-17)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 40
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1x52A01
5IT9M 3CCEF 1YJWF 1YJNF 3CG6A 3O85A 3CC4F 3FFMA 1VQ4F 1VQ5F 3CCSF 3VMFB 1YITF 3E20B 3V7EA 5GAPK 3SIVA 3LFOA 1JJ2F 3NVKE 1VQLF 3JAMM 2FC3A 1ZWZA 1RA4A 3N4YA 5GIPC 1VQ6F 3I55F 5A2QM 2QI2A 3MCAB 1VQ8F 2QEXF 2CZWA 1M1KH 3HAXD 3CCJF 1X7PA 3CCMF 1S72F 1K73H 1SDSA 2JNBA 3ON1A 1H7MA 5EWRA 3CXCF 3SIUA 1GO0A 1VQPF 3LWOC 1VQ9F 4LCKA 4TZZA 3WXMB 3CD6F 3CMAF 3CCVF 1KD1H 1K8AH 2OTLF 1CN7A 1YJ9F 3E1YA 3VI6A 1Q81H 3NK7A 3LWVC 1YHQF 2KG4A 1T0KB 1GO1A 3J80M 3NMUC 1VQOF 1X52A 5DCVA 3HJWC 5GANK 3N4ZA 3JCMM 2LBXA 3NK6A 1W2BF 1VQNF 4X3LA 3G6EF 1W3EX 1PXWA 1IPAA 3LWRC 1W42A 2I6DA 4BW0B 1VQ7F 3CCLF 1X7OA 3LWQC 2ALEA 5G4VC 1GZ0A 2QA4F 5GIOC 3GYQA 2LBWA 2AIFA 3CCQF 2WALA 4NUTA 2KTUA 3PAFA 3V7QA 3G4SF 1N8RH 1NJIH 1M90H 2OZBA 1XBIA 1KC8H 1Q82H 5EO3A 3AGKA 1NMUB 3RA5A 1QVFF 3J7AR 5GINC 3CPQA 3CCRF 1E7KA 2OTJF 1YIJF 3G71F 1DT9A 2OHWA 3NVIB 3OBYA 1VQMF 1Q86H 1W40A 3CC7F 4X3MA 3LWPC 3I56F 1QVGF 4C4WC 2VGMA 5G4UC 2BO1A 3CCUF 5FJ4C 4BY9D 3IR9A 1K9MH 3OBWA 3J81M 2KTVA 3RA6A 3CMEF 3CPWF 1RLGA 1CK2A 5FLXM 2VGNA 2HVYD 3CC2F 1YI2F 3PLAC 1KQSF 1VQKF 1Q7YH 3OW2F 1W41A
chains in the Genus database with same CATH superfamily
3HKCA 3ZO8A 2Q1XA 4NQ3A 5JCOA 5C8YA 3RYFA 3CYPB 4BT5A 3S02A 2L26A 5MN6A 3CCSF 3ELCA 1FNKA 5MN5A 3E20B 3V7EA 2HRUA 5GAPK 5JH7B 3LFOA 5JVDB 3RYHB 3NVKE 4I50B 4O4IB 1IV2A 1IV3A 2HP0B 1W5FA 1VQ6F 2YXZA 2QI2A 3F0DA 3WGNA 2ZODA 3MCAB 3JARB 1FSZA 4C81A 2YYEA 2CZWA 1X7PA 3QHDA 1K73H 2JNBA 5EWRA 3LMEA 3QUWA 4TV8B 2ZF8A 2PHNA 4F6RA 1QAHA 1JFFA 2CWJA 3P4EA 4O4JA 3IKEA 1FNJA 3WXMB 2RB9A 3CD6F 1W59A 2HS4A 1W5BA 4YJ2B 5J2UB 3CCVF 4WBNA 2RHLA 1CN7A 1IV1A 2ZOVA 3RYIA 1T0AA 1Q81H 3NK7A 3HKBA 3J80M 4DXDA 4B62A 5GONB 4I4TA 1W581 4EI9A 4TV9B 4ZHWA 1NQ3A 3HKEA 4ERHA 1Z5WA 2OTMA 2UYKA 3WGKA 1VK3A 1W2BF 2VAPA 4U3JB 2DT4A 5KX5B 4C8GA 3GTZA 4X20B 2UYPA 3V4DA 2HX0A 3UT5A 3RYHA 1TVKB 5JH7A 3E22A 4O4IA 2HP0A 3KJKA 4KWEA 2LBWA 1XRGA 3IKFA 2AIFA 5FNVA 2KTUA 1M90H 4I55B 3VYSC 1NMUB 3HKCB 5GINC 3CPQA 1E7KA 4TV8A 1U3PA 1DT9A 3WJQA 5HXZA 3HTNA 4FFBB 2OHWA 3OONA 5HP8A 5J2UA 2ZAUA 3CCUF 5FJ4C 5HY2A 2P6YA 3MCQA 3WGLA 4B46A 3CMEF 2KTVA 3RA6A 5FLXM 2ZVZA 1YI2F 3PLAC 1VQKF 2LBTA 4BT7A 3OW2F 4TV9A 1YJWF 5LXTA 2AMTA 1RQ7A 2V9YA 3P0ZA 4O4LB 3FFMA 3VMFB 3MDOA 3C9TA 3SIVA 3IMPA 5HXUA 2CVLA 1UFYA 1RA4A 5GIPC 1SZQA 3I55F 1JN1A 4G4ZA 2K1SA 4I55A 1W57A 3P10A 3RYIB 1VQ8F 5LP6C 2QEXF 1M1KH 4G4VA 2H8CA 3TD3A 1SDSA 4I4TB 2R751 3S06A 1H7MA 1RLUA 3CXCF 4FFBA 3JAKA 4ZHQB 3HKEB 1GO0A 1H48A 1VQ9F 2UYNA 4TZZA 3FD5A 5EZYB 4BVSA 3CMAF 1W5AA 2BTQB 5IJ0A 4TUYA 3UT5B 1KD1H 4LNUB 1K8AH 2OTLF 3E22B 3VCZA 3MQWA 1VHAA 3LDTA 3N2GB 3ESJA 2HS0A 3RYCB 5FNVB 1GO1A 1ODEA 4YJ3B 1QU9A 4IIJA 2CSLA 2HP3A 1VQOF 2VXYA 2VAWA 3QTYA 4O4LA 5J2TA 1W55A 3N2KA 1ONIA 4EI8A 3U0OA 3FBAA 3KHNA 2EWCA 3DC2A 3LWRC 1IPAA 1X25A 3ZP4A 3C8LA 2Z1UA 3KJJA 3S03A 2QTPA 1U3LA 2Z1TA 3FPIA 5B8FA 2I6RA 3GYQA 5CB4A 3JAWB 2WALA 5EB0A 3C9UA 5EYPB 3V7QA 3I3FA 1XBIA 1SA0B 1Q82H 2RHHA 5EO3A 2R6R1 3EORA 2HQSC 3AGKA 5CA0B 4ZHQA 2OTJF 3K0TA 3D01A 5LA6B 5LXTB 4G4XA 3JATA 3Q8HA 1W40A 5EIBD 5EZYA 5HWEA 4C4WC 1KNKA 3L7QA 4LNUA 4R40B 5KMGB 1W5EA 1K9MH 4G88A 2CHTA 2IG8A 3N2GA 4M8IA 4ZK7A 4O2BA 2RHJA 1GX1A 5CA1A 3RYCA 4YJ3A 5IT9M 3CCEF 1YJNF 3WGMA 3CG6A 3O85A 3CC4F 2IQQA 3JAKB 5ITZA 1YITF 1KNJA 3VOAA 2UYNB 5BMVB 3BYQA 1VQLF 4C8IA 3T80A 3JAMM 1ZWZA 4IHJB 5IJ0B 5IYZB 4TUYB 3JAWA 1JD1A 5EYPA 5AVMA 3D54A 1SA0A 3I7TA 3HAXD 5HY1A 4ZOLA 5CA0A 3CCJF 2GZLA 3CCMF 1Q8RA 1Z5VA 2MQEA 4IIJB 3ON1A 5LA6A 1YGYA 2Z1FA 3LWOC 5MN4A 5J2TB 4LCKA 1DBFA 3N2KB 1OAPA 3R0PA 3F0GA 4BT4A 1CLIA 5KMGA 1TUBA 4U39A 4X1IA 3ERNA 2W8BC 3S0WA 1H47A 1VQVA 4EI7A 1YJ9F 4BVQA 3S0HA 3VI6A 3LWVC 5CB4B 2KG4A 4BT3A 2BTUA 1T0KB 3VYTC 2Z1EA 1X52A 4DRXA 1FFXB 5DCVA 4O4HA 1JY8A 5GANK 3N4ZA 3JCMM 3CYQA 3M1XA 1OFUA 2LBXA 3IEWA 2BTOA 3G6EF 2KGWA 1W3EX 1PXWA 5BMVA 3JATB 1W42A 1COMA 1VQ7F 3C9RA 2H8EA 2Z01A 2ALEA 4IHJA 5IYZA 3KIZA 3C9SA 1NJIH 3G4SF 1N8RH 3VOBA 4G4YA 4O2BB 2N48A 5CA1B 3KE1A 2B33A 1XV2A 3HKDB 3RA5A 3RE3A 2AIZP 3J7AR 3WPXA 1YIJF 3G71F 5JCOC 2PMPA 1U43A 3WPWA 3NVIB 3OBYA 3K12A 4ZHYB 4X3MA 3LWPC 5ITZB 1QVGF 4EB6A 2BO1A 4RQOA 2HRYA 3OBWA 1XHOA 4X1KB 4PWTA 1CK2A 2HVYD 5LOVA 3GHZA 1KQSF 1Q7YH 2GVIA 5LYJA 5IJ9B 2VAMA 3JASB 2FGYA 4HNAB 1FFXA 1IV4A 4ZOLB 3VIUA 3WGJA 2UYJA 1U40A 1VQ5F 1VQ4F 2G9IA 1R1MA 5HY0A 2CW4A 3D00A 5EB1B 3ZP7A 5HY4A 4O2AB 3M84A 4B45A 1JJ2F 3F0EA 3K14A 2Q1YA 2FC3A 3JALA 4X1YB 4ZI7A 1TUBB 3N4YA 4X1IB 3ZOPA 3S0YA 5A2QM 2ZVYA 3JVHA 5EIBC 3HKDA 5LP6B 5HP7A 2HS3A 1S72F 1YQNA 3SIUA 4DRXB 2DYYA 1RQ2A 4BVRA 1VQPF 3IEQA 4O4HB 4BVTA 3LYBA 4ZHVA 5JVDA 3MBMA 4I50A 4C82A 4X1KA 3FD6A 1VH8A 4G4WA 2LCAA 4XCQA 4B5CA 3E1YA 3JARA 3B6NA 3HWUA 5JQGB 4BT6A 1YHQF 4E6EA 5IJ9A 3NMUC 3JASA 3V3TA 3DDNA 4HNAA 3HJWC 5C8YB 2NMUA 2UZHA 3RYFB 3NK6A 1VQNF 1PF5A 4X3LA 4YJ2A 2GLZA 4BT2A 3WJRA 4O2AA 2I6DA 4BW0B 3CCLF 1X7OA 3LWQC 1UI9A 3CB2A 4X1YA 3VO8A 3VTIC 4EB6B 2RHOA 1GZ0A 5G4VC 2QA4F 3K2XA 5GIOC 3TD4A 3CCQF 4NUTA 3F0FA 3PAFA 5GONA 5LOVB 2OZBA 4NWOB 5LP6A 2H6LA 2IAFA 1KC8H 1QD9A 5LYJB 4RHAA 3TD5A 1QVFF 3CCRF 2CHSA 4U3JA 5KX5A 4F6RB 3VYUC 1VQMF 1Q86H 4X20A 1JFFB 3CC7F 4O4JB 3M4SA 1TVKA 3I56F 3WJPA 2VGMA 5G4UC 1J7HA 4BY9D 3IR9A 2F9ZC 4WBNB 3F6MA 5EAZA 3J81M 3CPWF 4ZI7B 3JALB 1RLGA 2VGNA 5JQGA 3CC2F 4C8EA 1W41A 3HKBB
chains in the Genus database with same CATH topology
5IT9M 3CCEF 2FGYA 1YJWF 1YJNF 4NQ3A 3CG6A 3O85A 3CC4F 3FFMA 1VQ4F 1VQ5F 3CCSF 3VMFB 1YITF 3E20B 5HY0A 3V7EA 3D00A 5GAPK 5HY4A 3SIVA 3LFOA 1JJ2F 5HXUA 3NVKE 1VQLF 3JAMM 2FC3A 1ZWZA 1RA4A 3N4YA 5GIPC 1VQ6F 3I55F 5A2QM 2QI2A 3MCAB 1VQ8F 2QEXF 2CZWA 1M1KH 3HAXD 5HY1A 1X7PA 3CCJF 3CCMF 1S72F 1K73H 1SDSA 2JNBA 3ON1A 1H7MA 5EWRA 3CXCF 3SIUA 4BVRA 1GO0A 1VQPF 3LWOC 1VQ9F 4BVTA 4LCKA 4TZZA 3WXMB 3CD6F 4BVSA 3CMAF 3CCVF 1KD1H 1K8AH 2OTLF 1CN7A 4EI7A 1YJ9F 4XCQA 4BVQA 3E1YA 3VI6A 1Q81H 3NK7A 3LWVC 1YHQF 2KG4A 1T0KB 1GO1A 3J80M 3NMUC 3V3TA 1VQOF 1X52A 4EI9A 5DCVA 3HJWC 5GANK 3N4ZA 3JCMM 2LBXA 3NK6A 1W2BF 1VQNF 4X3LA 4EI8A 3G6EF 1W3EX 1PXWA 1IPAA 2GLZA 3LWRC 1W42A 2I6DA 4BW0B 1VQ7F 3CCLF 1X7OA 3LWQC 2ALEA 5G4VC 1GZ0A 2QA4F 5GIOC 3GYQA 2LBWA 2AIFA 3CCQF 2WALA 4NUTA 2KTUA 3PAFA 3V7QA 3G4SF 1N8RH 1NJIH 1M90H 2OZBA 1XBIA 1KC8H 1Q82H 5EO3A 3AGKA 1NMUB 3RA5A 1QVFF 3J7AR 5GINC 3CPQA 3CCRF 1E7KA 2OTJF 1YIJF 3G71F 1DT9A 5HXZA 2OHWA 3NVIB 3OBYA 1VQMF 1Q86H 1W40A 3CC7F 4X3MA 3LWPC 3I56F 5HWEA 1QVGF 4C4WC 2VGMA 5G4UC 2BO1A 3CCUF 5FJ4C 5HY2A 4BY9D 3IR9A 1K9MH 3OBWA 2F9ZC 3J81M 2KTVA 3RA6A 3CMEF 3CPWF 1RLGA 1CK2A 5FLXM 2VGNA 2HVYD 3CC2F 1YI2F 3PLAC 1KQSF 1VQKF 1Q7YH 3OW2F 1W41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 M;  3CCE F;  1YJW F;  1YJN F;  3CG6 A;  3O85 A;  3CC4 F;  3FFM A;  1VQ4 F;  1VQ5 F;  3CCS F;  3VMF B;  1YIT F;  3E20 B;  3V7E A;  5GAP K;  3SIV A;  3LFO A;  1JJ2 F;  3NVK E;  1VQL F;  3JAM M;  2FC3 A;  1ZWZ A;  1RA4 A;  3N4Y A;  5GIP C;  1VQ6 F;  3I55 F;  5A2Q M;  2QI2 A;  3MCA B;  1VQ8 F;  2QEX F;  2CZW A;  1M1K H;  3HAX D;  3CCJ F;  1X7P A;  3CCM F;  1S72 F;  1K73 H;  1SDS A;  2JNB A;  3ON1 A;  1H7M A;  5EWR A;  3CXC F;  3SIU A;  1GO0 A;  1VQP F;  3LWO C;  1VQ9 F;  4LCK A;  4TZZ A;  3WXM B;  3CD6 F;  3CMA F;  3CCV F;  1KD1 H;  1K8A H;  2OTL F;  1CN7 A;  1YJ9 F;  3E1Y A;  3VI6 A;  1Q81 H;  3NK7 A;  3LWV C;  1YHQ F;  2KG4 A;  1T0K B;  1GO1 A;  3J80 M;  3NMU C;  1VQO F;  1X52 A;  5DCV A;  3HJW C;  5GAN K;  3N4Z A;  3JCM M;  2LBX A;  3NK6 A;  1W2B F;  1VQN F;  4X3L A;  3G6E F;  1W3E X;  1PXW A;  1IPA A;  3LWR C;  1W42 A;  2I6D A;  4BW0 B;  1VQ7 F;  3CCL F;  1X7O A;  3LWQ C;  2ALE A;  5G4V C;  1GZ0 A;  2QA4 F;  5GIO C;  3GYQ A;  2LBW A;  2AIF A;  3CCQ F;  2WAL A;  4NUT A;  2KTU A;  3PAF A;  3V7Q A;  3G4S F;  1N8R H;  1NJI H;  1M90 H;  2OZB A;  1XBI A;  1KC8 H;  1Q82 H;  5EO3 A;  3AGK A;  1NMU B;  3RA5 A;  1QVF F;  3J7A R;  5GIN C;  3CPQ A;  3CCR F;  1E7K A;  2OTJ F;  1YIJ F;  3G71 F;  1DT9 A;  2OHW A;  3NVI B;  3OBY A;  1VQM F;  1Q86 H;  1W40 A;  3CC7 F;  4X3M A;  3LWP C;  3I56 F;  1QVG F;  4C4W C;  2VGM A;  5G4U C;  2BO1 A;  3CCU F;  5FJ4 C;  4BY9 D;  3IR9 A;  1K9M H;  3OBW A;  3J81 M;  2KTV A;  3RA6 A;  3CME F;  3CPW F;  1RLG A;  1CK2 A;  5FLX M;  2VGN A;  2HVY D;  3CC2 F;  1YI2 F;  3PLA C;  1KQS F;  1VQK F;  1Q7Y H;  3OW2 F;  1W41 A; 
#chains in the Genus database with same CATH topology
 3HKC A;  3ZO8 A;  2Q1X A;  4NQ3 A;  5JCO A;  5C8Y A;  3RYF A;  3CYP B;  4BT5 A;  3S02 A;  2L26 A;  5MN6 A;  3CCS F;  3ELC A;  1FNK A;  5MN5 A;  3E20 B;  3V7E A;  2HRU A;  5GAP K;  5JH7 B;  3LFO A;  5JVD B;  3RYH B;  3NVK E;  4I50 B;  4O4I B;  1IV2 A;  1IV3 A;  2HP0 B;  1W5F A;  1VQ6 F;  2YXZ A;  2QI2 A;  3F0D A;  3WGN A;  2ZOD A;  3MCA B;  3JAR B;  1FSZ A;  4C81 A;  2YYE A;  2CZW A;  1X7P A;  3QHD A;  1K73 H;  2JNB A;  5EWR A;  3LME A;  3QUW A;  4TV8 B;  2ZF8 A;  2PHN A;  4F6R A;  1QAH A;  1JFF A;  2CWJ A;  3P4E A;  4O4J A;  3IKE A;  1FNJ A;  3WXM B;  2RB9 A;  3CD6 F;  1W59 A;  2HS4 A;  1W5B A;  4YJ2 B;  5J2U B;  3CCV F;  4WBN A;  2RHL A;  1CN7 A;  1IV1 A;  2ZOV A;  3RYI A;  1T0A A;  1Q81 H;  3NK7 A;  3HKB A;  3J80 M;  4DXD A;  4B62 A;  5GON B;  4I4T A;  1W58 1;  4EI9 A;  4TV9 B;  4ZHW A;  1NQ3 A;  3HKE A;  4ERH A;  1Z5W A;  2OTM A;  2UYK A;  3WGK A;  1VK3 A;  1W2B F;  2VAP A;  4U3J B;  2DT4 A;  5KX5 B;  4C8G A;  3GTZ A;  4X20 B;  2UYP A;  3V4D A;  2HX0 A;  3UT5 A;  3RYH A;  1TVK B;  5JH7 A;  3E22 A;  4O4I A;  2HP0 A;  3KJK A;  4KWE A;  2LBW A;  1XRG A;  3IKF A;  2AIF A;  5FNV A;  2KTU A;  1M90 H;  4I55 B;  3VYS C;  1NMU B;  3HKC B;  5GIN C;  3CPQ A;  1E7K A;  4TV8 A;  1U3P A;  1DT9 A;  3WJQ A;  5HXZ A;  3HTN A;  4FFB B;  2OHW A;  3OON A;  5HP8 A;  5J2U A;  2ZAU A;  3CCU F;  5FJ4 C;  5HY2 A;  2P6Y A;  3MCQ A;  3WGL A;  4B46 A;  3CME F;  2KTV A;  3RA6 A;  5FLX M;  2ZVZ A;  1YI2 F;  3PLA C;  1VQK F;  2LBT A;  4BT7 A;  3OW2 F;  4TV9 A;  1YJW F;  5LXT A;  2AMT A;  1RQ7 A;  2V9Y A;  3P0Z A;  4O4L B;  3FFM A;  3VMF B;  3MDO A;  3C9T A;  3SIV A;  3IMP A;  5HXU A;  2CVL A;  1UFY A;  1RA4 A;  5GIP C;  1SZQ A;  3I55 F;  1JN1 A;  4G4Z A;  2K1S A;  4I55 A;  1W57 A;  3P10 A;  3RYI B;  1VQ8 F;  5LP6 C;  2QEX F;  1M1K H;  4G4V A;  2H8C A;  3TD3 A;  1SDS A;  4I4T B;  2R75 1;  3S06 A;  1H7M A;  1RLU A;  3CXC F;  4FFB A;  3JAK A;  4ZHQ B;  3HKE B;  1GO0 A;  1H48 A;  1VQ9 F;  2UYN A;  4TZZ A;  3FD5 A;  5EZY B;  4BVS A;  3CMA F;  1W5A A;  2BTQ B;  5IJ0 A;  4TUY A;  3UT5 B;  1KD1 H;  4LNU B;  1K8A H;  2OTL F;  3E22 B;  3VCZ A;  3MQW A;  1VHA A;  3LDT A;  3N2G B;  3ESJ A;  2HS0 A;  3RYC B;  5FNV B;  1GO1 A;  1ODE A;  4YJ3 B;  1QU9 A;  4IIJ A;  2CSL A;  2HP3 A;  1VQO F;  2VXY A;  2VAW A;  3QTY A;  4O4L A;  5J2T A;  1W55 A;  3N2K A;  1ONI A;  4EI8 A;  3U0O A;  3FBA A;  3KHN A;  2EWC A;  3DC2 A;  3LWR C;  1IPA A;  1X25 A;  3ZP4 A;  3C8L A;  2Z1U A;  3KJJ A;  3S03 A;  2QTP A;  1U3L A;  2Z1T A;  3FPI A;  5B8F A;  2I6R A;  3GYQ A;  5CB4 A;  3JAW B;  2WAL A;  5EB0 A;  3C9U A;  5EYP B;  3V7Q A;  3I3F A;  1XBI A;  1SA0 B;  1Q82 H;  2RHH A;  5EO3 A;  2R6R 1;  3EOR A;  2HQS C;  3AGK A;  5CA0 B;  4ZHQ A;  2OTJ F;  3K0T A;  3D01 A;  5LA6 B;  5LXT B;  4G4X A;  3JAT A;  3Q8H A;  1W40 A;  5EIB D;  5EZY A;  5HWE A;  4C4W C;  1KNK A;  3L7Q A;  4LNU A;  4R40 B;  5KMG B;  1W5E A;  1K9M H;  4G88 A;  2CHT A;  2IG8 A;  3N2G A;  4M8I A;  4ZK7 A;  4O2B A;  2RHJ A;  1GX1 A;  5CA1 A;  3RYC A;  4YJ3 A;  5IT9 M;  3CCE F;  1YJN F;  3WGM A;  3CG6 A;  3O85 A;  3CC4 F;  2IQQ A;  3JAK B;  5ITZ A;  1YIT F;  1KNJ A;  3VOA A;  2UYN B;  5BMV B;  3BYQ A;  1VQL F;  4C8I A;  3T80 A;  3JAM M;  1ZWZ A;  4IHJ B;  5IJ0 B;  5IYZ B;  4TUY B;  3JAW A;  1JD1 A;  5EYP A;  5AVM A;  3D54 A;  1SA0 A;  3I7T A;  3HAX D;  5HY1 A;  4ZOL A;  5CA0 A;  3CCJ F;  2GZL A;  3CCM F;  1Q8R A;  1Z5V A;  2MQE A;  4IIJ B;  3ON1 A;  5LA6 A;  1YGY A;  2Z1F A;  3LWO C;  5MN4 A;  5J2T B;  4LCK A;  1DBF A;  3N2K B;  1OAP A;  3R0P A;  3F0G A;  4BT4 A;  1CLI A;  5KMG A;  1TUB A;  4U39 A;  4X1I A;  3ERN A;  2W8B C;  3S0W A;  1H47 A;  1VQV A;  4EI7 A;  1YJ9 F;  4BVQ A;  3S0H A;  3VI6 A;  3LWV C;  5CB4 B;  2KG4 A;  4BT3 A;  2BTU A;  1T0K B;  3VYT C;  2Z1E A;  1X52 A;  4DRX A;  1FFX B;  5DCV A;  4O4H A;  1JY8 A;  5GAN K;  3N4Z A;  3JCM M;  3CYQ A;  3M1X A;  1OFU A;  2LBX A;  3IEW A;  2BTO A;  3G6E F;  2KGW A;  1W3E X;  1PXW A;  5BMV A;  3JAT B;  1W42 A;  1COM A;  1VQ7 F;  3C9R A;  2H8E A;  2Z01 A;  2ALE A;  4IHJ A;  5IYZ A;  3KIZ A;  3C9S A;  1NJI H;  3G4S F;  1N8R H;  3VOB A;  4G4Y A;  4O2B B;  2N48 A;  5CA1 B;  3KE1 A;  2B33 A;  1XV2 A;  3HKD B;  3RA5 A;  3RE3 A;  2AIZ P;  3J7A R;  3WPX A;  1YIJ F;  3G71 F;  5JCO C;  2PMP A;  1U43 A;  3WPW A;  3NVI B;  3OBY A;  3K12 A;  4ZHY B;  4X3M A;  3LWP C;  5ITZ B;  1QVG F;  4EB6 A;  2BO1 A;  4RQO A;  2HRY A;  3OBW A;  1XHO A;  4X1K B;  4PWT A;  1CK2 A;  2HVY D;  5LOV A;  3GHZ A;  1KQS F;  1Q7Y H;  2GVI A;  5LYJ A;  5IJ9 B;  2VAM A;  3JAS B;  2FGY A;  4HNA B;  1FFX A;  1IV4 A;  4ZOL B;  3VIU A;  3WGJ A;  2UYJ A;  1U40 A;  1VQ5 F;  1VQ4 F;  2G9I A;  1R1M A;  5HY0 A;  2CW4 A;  3D00 A;  5EB1 B;  3ZP7 A;  5HY4 A;  4O2A B;  3M84 A;  4B45 A;  1JJ2 F;  3F0E A;  3K14 A;  2Q1Y A;  2FC3 A;  3JAL A;  4X1Y B;  4ZI7 A;  1TUB B;  3N4Y A;  4X1I B;  3ZOP A;  3S0Y A;  5A2Q M;  2ZVY A;  3JVH A;  5EIB C;  3HKD A;  5LP6 B;  5HP7 A;  2HS3 A;  1S72 F;  1YQN A;  3SIU A;  4DRX B;  2DYY A;  1RQ2 A;  4BVR A;  1VQP F;  3IEQ A;  4O4H B;  4BVT A;  3LYB A;  4ZHV A;  5JVD A;  3MBM A;  4I50 A;  4C82 A;  4X1K A;  3FD6 A;  1VH8 A;  4G4W A;  2LCA A;  4XCQ A;  4B5C A;  3E1Y A;  3JAR A;  3B6N A;  3HWU A;  5JQG B;  4BT6 A;  1YHQ F;  4E6E A;  5IJ9 A;  3NMU C;  3JAS A;  3V3T A;  3DDN A;  4HNA A;  3HJW C;  5C8Y B;  2NMU A;  2UZH A;  3RYF B;  3NK6 A;  1VQN F;  1PF5 A;  4X3L A;  4YJ2 A;  2GLZ A;  4BT2 A;  3WJR A;  4O2A A;  2I6D A;  4BW0 B;  3CCL F;  1X7O A;  3LWQ C;  1UI9 A;  3CB2 A;  4X1Y A;  3VO8 A;  3VTI C;  4EB6 B;  2RHO A;  1GZ0 A;  5G4V C;  2QA4 F;  3K2X A;  5GIO C;  3TD4 A;  3CCQ F;  4NUT A;  3F0F A;  3PAF A;  5GON A;  5LOV B;  2OZB A;  4NWO B;  5LP6 A;  2H6L A;  2IAF A;  1KC8 H;  1QD9 A;  5LYJ B;  4RHA A;  3TD5 A;  1QVF F;  3CCR F;  2CHS A;  4U3J A;  5KX5 A;  4F6R B;  3VYU C;  1VQM F;  1Q86 H;  4X20 A;  1JFF B;  3CC7 F;  4O4J B;  3M4S A;  1TVK A;  3I56 F;  3WJP A;  2VGM A;  5G4U C;  1J7H A;  4BY9 D;  3IR9 A;  2F9Z C;  4WBN B;  3F6M A;  5EAZ A;  3J81 M;  3CPW F;  4ZI7 B;  3JAL B;  1RLG A;  2VGN A;  5JQG A;  3CC2 F;  4C8E A;  1W41 A;  3HKB B; 
#chains in the Genus database with same CATH homology
 5IT9 M;  3CCE F;  2FGY A;  1YJW F;  1YJN F;  4NQ3 A;  3CG6 A;  3O85 A;  3CC4 F;  3FFM A;  1VQ4 F;  1VQ5 F;  3CCS F;  3VMF B;  1YIT F;  3E20 B;  5HY0 A;  3V7E A;  3D00 A;  5GAP K;  5HY4 A;  3SIV A;  3LFO A;  1JJ2 F;  5HXU A;  3NVK E;  1VQL F;  3JAM M;  2FC3 A;  1ZWZ A;  1RA4 A;  3N4Y A;  5GIP C;  1VQ6 F;  3I55 F;  5A2Q M;  2QI2 A;  3MCA B;  1VQ8 F;  2QEX F;  2CZW A;  1M1K H;  3HAX D;  5HY1 A;  1X7P A;  3CCJ F;  3CCM F;  1S72 F;  1K73 H;  1SDS A;  2JNB A;  3ON1 A;  1H7M A;  5EWR A;  3CXC F;  3SIU A;  4BVR A;  1GO0 A;  1VQP F;  3LWO C;  1VQ9 F;  4BVT A;  4LCK A;  4TZZ A;  3WXM B;  3CD6 F;  4BVS A;  3CMA F;  3CCV F;  1KD1 H;  1K8A H;  2OTL F;  1CN7 A;  4EI7 A;  1YJ9 F;  4XCQ A;  4BVQ A;  3E1Y A;  3VI6 A;  1Q81 H;  3NK7 A;  3LWV C;  1YHQ F;  2KG4 A;  1T0K B;  1GO1 A;  3J80 M;  3NMU C;  3V3T A;  1VQO F;  1X52 A;  4EI9 A;  5DCV A;  3HJW C;  5GAN K;  3N4Z A;  3JCM M;  2LBX A;  3NK6 A;  1W2B F;  1VQN F;  4X3L A;  4EI8 A;  3G6E F;  1W3E X;  1PXW A;  1IPA A;  2GLZ A;  3LWR C;  1W42 A;  2I6D A;  4BW0 B;  1VQ7 F;  3CCL F;  1X7O A;  3LWQ C;  2ALE A;  5G4V C;  1GZ0 A;  2QA4 F;  5GIO C;  3GYQ A;  2LBW A;  2AIF A;  3CCQ F;  2WAL A;  4NUT A;  2KTU A;  3PAF A;  3V7Q A;  3G4S F;  1N8R H;  1NJI H;  1M90 H;  2OZB A;  1XBI A;  1KC8 H;  1Q82 H;  5EO3 A;  3AGK A;  1NMU B;  3RA5 A;  1QVF F;  3J7A R;  5GIN C;  3CPQ A;  3CCR F;  1E7K A;  2OTJ F;  1YIJ F;  3G71 F;  1DT9 A;  5HXZ A;  2OHW A;  3NVI B;  3OBY A;  1VQM F;  1Q86 H;  1W40 A;  3CC7 F;  4X3M A;  3LWP C;  3I56 F;  5HWE A;  1QVG F;  4C4W C;  2VGM A;  5G4U C;  2BO1 A;  3CCU F;  5FJ4 C;  5HY2 A;  4BY9 D;  3IR9 A;  1K9M H;  3OBW A;  2F9Z C;  3J81 M;  2KTV A;  3RA6 A;  3CME F;  3CPW F;  1RLG A;  1CK2 A;  5FLX M;  2VGN A;  2HVY D;  3CC2 F;  1YI2 F;  3PLA C;  1KQS F;  1VQK F;  1Q7Y H;  3OW2 F;  1W41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...