1X52A

Solution structures of the c-terminal domain of the human pelota homolog (cgi-17)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pelota homolog
publication title Solution structures of the C-terminal domain of the human Pelota homolog (CGI-17)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 40
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1x52A01
1GO0A 1M1KH 5FJ4C 1VQPF 3J80M 3NK7A 3I56F 4BW0B 4TZZA 5IT9M 1QVGF 3CMEF 3G71F 3CCSF 3CC4F 3GYQA 5GIOC 1Q81H 2KG4A 5EO3A 3CCEF 2I6DA 3CPQA 3G4SF 1W2BF 1W3EX 1YHQF 3LWQC 3JCMM 3CCQF 1IPAA 1RA4A 1K73H 1K8AH 4LCKA 1Q82H 3LWRC 1PXWA 1VQ5F 3CCMF 2KTVA 3ON1A 3CMAF 1GO1A 1VQ6F 1VQKF 1Q7YH 1CK2A 1GZ0A 5EWRA 3AGKA 3FFMA 1YI2F 3NK6A 3V7QA 3LWPC 4BY9D 1DT9A 1KC8H 3SIUA 3LFOA 3OBYA 3MCAB 1VQLF 3CCRF 3NVKE 2LBXA 3LWOC 1ZWZA 5GINC 4NUTA 3CCLF 1VQ7F 1VQNF 5GAPK 3SIVA 3HAXD 2FC3A 3J7AR 3CC2F 5G4UC 2QA4F 3CC7F 3PLAC 3CCJF 1S72F 1X7PA 3LWVC 5GIPC 1YJWF 1JJ2F 3N4YA 1YIJF 1YJ9F 2QEXF 1T0KB 1KQSF 3WXMB 1X52A 3CD6F 1VQ8F 1N8RH 1SDSA 2JNBA 2OTLF 1K9MH 3RA6A 4X3LA 2KTUA 1W40A 4X3MA 3G6EF 3RA5A 3CPWF 1VQOF 3O85A 2VGNA 3JAMM 2VGMA 1Q86H 1VQ4F 1QVFF 3HJWC 2AIFA 1VQ9F 3I55F 1NMUB 1NJIH 1X7OA 3CXCF 1YJNF 2HVYD 3CCUF 5FLXM 1KD1H 1YITF 3E1YA 3J81M 3OW2F 3NVIB 3PAFA 1W41A 3VMFB 3CCVF 2OZBA 2ALEA 3VI6A 5GANK 3NMUC 3V7EA 2BO1A 1H7MA 3E20B 1M90H 5A2QM 3CG6A 3N4ZA 2QI2A 2OTJF 3OBWA 2CZWA 2OHWA 5DCVA 1XBIA 1RLGA 1VQMF 2LBWA 1E7KA 1W42A 1CN7A 3IR9A 4C4WC 2WALA 5G4VC
chains in the Genus database with same CATH superfamily
4O4IB 3HKEA 4DXDA 2P6YA 5FJ4C 3J80M 2YXZA 3WJPA 2R6R1 4TZZA 2Q1XA 3JAKA 1QVGF 5HY0A 2IAFA 2HS0A 5JVDA 3GHZA 5GIOC 3F6MA 1Q81H 1IV3A 4M8IA 3G4SF 5LYJB 3C9RA 2OTMA 3JCMM 3P0ZA 4ERHA 3CCQF 1J7HA 1FNKA 3R0PA 4BT4A 4XCQA 3CCMF 2Z1EA 2KTVA 3ON1A 1GO1A 5KX5A 1VQKF 3S03A 5EWRA 3IKEA 3FFMA 3I3FA 3NK6A 4X1YB 3LWPC 5IYZA 5GONA 5LXTA 5JQGA 3LFOA 3JARA 1VQLF 3MDOA 3NVKE 1ZWZA 3CCLF 4TUYB 3SIVA 4IHJA 2Z01A 4FFBA 2CVLA 1W55A 4O4JB 5HY1A 5EYPA 4X1KA 4EI7A 1QU9A 1ODEA 1X7PA 1YJWF 3N4YA 1YIJF 3JALA 3F0DA 1T0KB 4BT2A 3ELCA 1X52A 3WXMB 1DBFA 1SDSA 3HKBA 2OTLF 3JASA 2Z1TA 1K9MH 5MN5A 5KMGA 1W5AA 1COMA 2VGNA 3JAMM 5AVMA 3U0OA 4BVQA 2AIFA 2RHHA 3CB2A 2H8EA 5ITZA 1VQ9F 2QTPA 1T0AA 2UYNA 5CA0B 1NJIH 4O4HA 3WJQA 3CXCF 1YJNF 1KNJA 3CCUF 5FLXM 1JFFA 1Z5WA 3F0FA 4LNUB 3PAFA 4EI9A 1W41A 4RHAA 3ERNA 3D01A 3HKDA 3DC2A 3VO8A 4DRXA 4I50A 3N2KB 1H7MA 4ZI7A 3IEQA 2H8CA 4ZHVA 2I6RA 3CG6A 4C82A 3S0YA 3ZP4A 5C8YA 5DCVA 1W581 2PHNA 3C8LA 1VQMF 3VYSC 4G4VA 3RYFB 4IIJB 4BT6A 3N2GB 1IV2A 4ZHQB 5IJ9B 1W42A 3FPIA 2HQSC 4I55B 1Q8RA 1CN7A 4C8IA 4C4WC 4G4ZA 3I7TA 1TVKA 4TV9B 5JVDB 1KNKA 3UT5B 1GO0A 1M1KH 1SA0B 2RHLA 5LP6C 4RQOA 3QTYA 1W59A 2HP3A 4TV8B 1FFXB 2HP0A 2HRYA 5J2TA 3G71F 3CCSF 3IMPA 3F0EA 5JCOC 3GYQA 1JD1A 2I6DA 5EZYA 3JAWA 4U3JB 3TD5A 1W2BF 3HKCA 5IJ0B 5JH7A 3JVHA 2B33A 3WGJA 2ZOVA 4X20B 1RA4A 1K73H 1K8AH 4ZHYB 2H6LA 3MBMA 3S0WA 1VK3A 2UYJA 3VCZA 3CMAF 5LOVA 4F6RB 1XHOA 3HWUA 3RYHB 2VXYA 1ONIA 3CYPB 4G4YA 3D54A 3F0GA 4G4WA 1DT9A 5FNVA 3JATB 3RYIB 2VAWA 1W5BA 3MCAB 3S06A 4I4TB 3CCRF 3LWOC 1VQ7F 5GAPK 3M4SA 3RYCA 2Q1YA 2G9IA 4ZK7A 3HAXD 5LA6A 4B5CA 3E22A 3CC7F 3CCJF 1S72F 3LWVC 3ZO8A 4X1IB 2KGWA 3CD6F 1N8RH 2JNBA 3KJKA 3WJRA 5HWEA 1SZQA 3FBAA 1RLUA 4X3LA 2KTUA 4YJ2A 2F9ZC 1JY8A 3CPWF 3KE1A 3O85A 1VQOF 2VGMA 1VQ4F 5LP6B 3HJWC 3S0HA 1H47A 2AIZP 4B46A 4DRXB 1NMUB 2CW4A 4EB6A 2GVIA 3VOBA 1OFUA 2HVYD 5HY2A 1KD1H 3K14A 5BMVB 3E1YA 1YITF 3NVIB 1RQ7A 2RB9A 3VI6A 1CLIA 5GANK 1U3PA 2LCAA 2V9YA 4HNAA 3CYQA 2QI2A 3OBWA 4BVTA 1W5FA 2CZWA 4O4IA 1RLGA 2AMTA 4O4LB 4O2BB 2HS4A 2UYKA 5CA1B 3P4EA 3IEWA 2IQQA 4O2AB 5CB4B 5G4VC 1U40A 5LYJA 4C8GA 1TUBB 5HP8A 3NK7A 3K12A 3P10A 3HTNA 5J2UB 3D00A 3M84A 5IT9M 3CMEF 2FGYA 4WBNB 2GLZA 5EIBC 5LOVB 1QAHA 5HP7A 2GZLA 4E6EA 3CCEF 3CPQA 2EWCA 3HKEB 3EORA 4R40B 2Z1FA 1W3EX 1YHQF 4X1YA 3LWQC 3VYTC 3JAKB 4LCKA 1Q82H 1VQ5F 2BTQB 4BVRA 4TUYA 4PWTA 1CK2A 1GZ0A 3K0TA 4O4JA 1XV2A 1YI2F 3QHDA 1R1MA 4BY9D 2MQEA 1YGYA 3K2XA 4BT5A 1VHAA 2L26A 3OONA 1X25A 1U43A 5KX5B 3MCQA 2HRUA 3L7QA 3CC2F 2QA4F 3VOAA 5IYZB 1IV4A 5GONB 5LXTB 5GIPC 5JQGB 1JJ2F 3JARB 3M1XA 2QEXF 1H48A 2ZF8A 5CA0A 1VQ8F 3WGKA 4IHJB 3DDNA 3G6EF 4FFBB 1W40A 4X3MA 3WGNA 3RA5A 5EYPB 2RHOA 1W5EA 4LNUA 1OAPA 4X1KB 1VH8A 3JALB 2W8BC 3C9UA 3N2KA 3HKBB 2ZAUA 1UFYA 3JASB 2PMPA 5KMGB 1JN1A 2N48A 1QD9A 2CWJA 3C9SA 5B8FA 3BYQA 3CCVF 2BTUA 4ZHWA 5ITZB 2UYNB 3RYFA 3LYBA 4IIJA 4O4HB 2BO1A 3E20B 3N2GA 4ZHQA 5MN4A 5IJ9A 3VYUC 2BTOA 1VQVA 3IKFA 1JFFB 5A2QM 4I55A 2OTJF 3WGMA 2Z1UA 4TV9A 2OHWA 4EI8A 1PF5A 1XBIA 3UT5A 3HKDB 3ESJA 1SA0A 2LBWA 3KIZA 4I50B 1E7KA 1YQNA 4ZI7B 4TV8A 4YJ3A 5EIBD 1RQ2A 4ZOLA 1FFXA 4NWOB 2UZHA 3VTIC 3TD3A 5C8YB 3B6NA 5EB1B 4U3JA 2DYYA 1UI9A 5IJ0A 1VQPF 3I56F 2ZVYA 4X20A 4BW0B 1FSZA 4BVSA 1TVKB 3CC4F 3S02A 4F6RA 2KG4A 2VAPA 5EO3A 3QUWA 3RYHA 3FD5A 4G4XA 2K1SA 1IPAA 3RYIA 3JATA 2CHSA 2DT4A 1FNJA 1PXWA 1Z5VA 2HP0B 4I4TA 4C81A 5J2TB 3LWRC 3C9TA 1U3LA 1VQ6F 3MQWA 5EB0A 2YYEA 1Q7YH 5EZYB 3JAWB 3AGKA 3HKCB 2ZODA 5JH7B 3V7QA 1KC8H 3RE3A 3KJJA 3SIUA 3WPXA 2ZVZA 3OBYA 4X1IA 3FD6A 3Q8HA 4G88A 2LBXA 3T80A 4NUTA 5GINC 1VQNF 4B45A 2LBTA 1XRGA 3TD4A 2FC3A 3J7AR 5G4UC 4NQ3A 3PLAC 4BT3A 5FNVB 5MN6A 2NMUA 5LP6A 2R751 1YJ9F 1KQSF 3RYCB 3RA6A 5LA6B 2UYPA 5BMVA 3E22B 5JCOA 3GTZA 3WPWA 2IG8A 1Q86H 3WGLA 1QVFF 3V3TA 2HS3A 3I55F 1X7OA 5HXZA 4BT7A 4YJ2B 3VIUA 3J81M 3OW2F 1IV1A 3KHNA 3VMFB 2OZBA 4KWEA 2ALEA 5EAZA 1GX1A 4O4LA 3V4DA 3NMUC 1NQ3A 3V7EA 4B62A 4EB6B 1M90H 4O2BA 2CHTA 4YJ3B 4ZOLB 5CA1A 3LMEA 3N4ZA 3ZP7A 1W57A 4O2AA 5CB4A 5HXUA 4C8EA 3ZOPA 4U39A 2HX0A 1TUBA 4HNAB 2VAMA 2CSLA 5J2UA 5HY4A 3IR9A 3LDTA 2RHJA 2WALA 4WBNA
chains in the Genus database with same CATH topology
1GO0A 1M1KH 5FJ4C 1VQPF 3J80M 3NK7A 3I56F 4BW0B 3D00A 4TZZA 5IT9M 1QVGF 5HY0A 4BVSA 3CMEF 3G71F 3CCSF 2FGYA 3CC4F 2GLZA 3GYQA 5GIOC 1Q81H 2KG4A 5EO3A 3CCEF 2I6DA 3CPQA 3G4SF 1W2BF 1W3EX 1YHQF 3LWQC 3JCMM 3CCQF 1IPAA 1RA4A 1K73H 1K8AH 4LCKA 1Q82H 3LWRC 1PXWA 4XCQA 3CCMF 1VQ5F 2KTVA 3ON1A 4BVRA 3CMAF 1GO1A 1VQ6F 1VQKF 1Q7YH 1CK2A 1GZ0A 5EWRA 3AGKA 3FFMA 1YI2F 3NK6A 3V7QA 3LWPC 4BY9D 1DT9A 1KC8H 3SIUA 3LFOA 3OBYA 3MCAB 1VQLF 3CCRF 3NVKE 2LBXA 3LWOC 1ZWZA 5GINC 4NUTA 3CCLF 1VQ7F 1VQNF 5GAPK 3SIVA 3HAXD 2FC3A 3J7AR 5HY1A 3CC2F 4EI7A 4NQ3A 2QA4F 3CC7F 3PLAC 3CCJF 1S72F 5G4UC 1X7PA 3LWVC 5GIPC 1YJWF 1JJ2F 3N4YA 1YIJF 1YJ9F 2QEXF 1T0KB 1KQSF 3WXMB 1X52A 3CD6F 1VQ8F 1N8RH 1SDSA 2JNBA 5HWEA 2OTLF 1K9MH 3RA6A 4X3LA 2KTUA 1W40A 4X3MA 3G6EF 2F9ZC 3RA5A 3CPWF 1VQOF 3O85A 2VGNA 3JAMM 2VGMA 1Q86H 1VQ4F 1QVFF 3HJWC 3V3TA 4BVQA 2AIFA 1VQ9F 3I55F 1NMUB 1NJIH 1X7OA 5HXZA 3CXCF 1YJNF 2HVYD 5HY2A 5FLXM 3CCUF 1KD1H 1YITF 3E1YA 3J81M 3OW2F 3NVIB 3PAFA 4EI9A 1W41A 3VMFB 3CCVF 2OZBA 2ALEA 3VI6A 5GANK 3NMUC 3V7EA 2BO1A 1H7MA 3E20B 1M90H 5A2QM 3CG6A 3N4ZA 2QI2A 2OTJF 3OBWA 4BVTA 2CZWA 2OHWA 5HXUA 4EI8A 5DCVA 1XBIA 1RLGA 1VQMF 2LBWA 1E7KA 1W42A 5HY4A 1CN7A 3IR9A 4C4WC 2WALA 5G4VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO0 A;  1M1K H;  5FJ4 C;  1VQP F;  3J80 M;  3NK7 A;  3I56 F;  4BW0 B;  4TZZ A;  5IT9 M;  1QVG F;  3CME F;  3G71 F;  3CCS F;  3CC4 F;  3GYQ A;  5GIO C;  1Q81 H;  2KG4 A;  5EO3 A;  3CCE F;  2I6D A;  3CPQ A;  3G4S F;  1W2B F;  1W3E X;  1YHQ F;  3LWQ C;  3JCM M;  3CCQ F;  1IPA A;  1RA4 A;  1K73 H;  1K8A H;  4LCK A;  1Q82 H;  3LWR C;  1PXW A;  1VQ5 F;  3CCM F;  2KTV A;  3ON1 A;  3CMA F;  1GO1 A;  1VQ6 F;  1VQK F;  1Q7Y H;  1CK2 A;  1GZ0 A;  5EWR A;  3AGK A;  3FFM A;  1YI2 F;  3NK6 A;  3V7Q A;  3LWP C;  4BY9 D;  1DT9 A;  1KC8 H;  3SIU A;  3LFO A;  3OBY A;  3MCA B;  1VQL F;  3CCR F;  3NVK E;  2LBX A;  3LWO C;  1ZWZ A;  5GIN C;  4NUT A;  3CCL F;  1VQ7 F;  1VQN F;  5GAP K;  3SIV A;  3HAX D;  2FC3 A;  3J7A R;  3CC2 F;  5G4U C;  2QA4 F;  3CC7 F;  3PLA C;  3CCJ F;  1S72 F;  1X7P A;  3LWV C;  5GIP C;  1YJW F;  1JJ2 F;  3N4Y A;  1YIJ F;  1YJ9 F;  2QEX F;  1T0K B;  1KQS F;  3WXM B;  1X52 A;  3CD6 F;  1VQ8 F;  1N8R H;  1SDS A;  2JNB A;  2OTL F;  1K9M H;  3RA6 A;  4X3L A;  2KTU A;  1W40 A;  4X3M A;  3G6E F;  3RA5 A;  3CPW F;  1VQO F;  3O85 A;  2VGN A;  3JAM M;  2VGM A;  1Q86 H;  1VQ4 F;  1QVF F;  3HJW C;  2AIF A;  1VQ9 F;  3I55 F;  1NMU B;  1NJI H;  1X7O A;  3CXC F;  1YJN F;  2HVY D;  3CCU F;  5FLX M;  1KD1 H;  1YIT F;  3E1Y A;  3J81 M;  3OW2 F;  3NVI B;  3PAF A;  1W41 A;  3VMF B;  3CCV F;  2OZB A;  2ALE A;  3VI6 A;  5GAN K;  3NMU C;  3V7E A;  2BO1 A;  1H7M A;  3E20 B;  1M90 H;  5A2Q M;  3CG6 A;  3N4Z A;  2QI2 A;  2OTJ F;  3OBW A;  2CZW A;  2OHW A;  5DCV A;  1XBI A;  1RLG A;  1VQM F;  2LBW A;  1E7K A;  1W42 A;  1CN7 A;  3IR9 A;  4C4W C;  2WAL A;  5G4V C; 
#chains in the Genus database with same CATH topology
 4O4I B;  3HKE A;  4DXD A;  2P6Y A;  5FJ4 C;  3J80 M;  2YXZ A;  3WJP A;  2R6R 1;  4TZZ A;  2Q1X A;  3JAK A;  1QVG F;  5HY0 A;  2IAF A;  2HS0 A;  5JVD A;  3GHZ A;  5GIO C;  3F6M A;  1Q81 H;  1IV3 A;  4M8I A;  3G4S F;  5LYJ B;  3C9R A;  2OTM A;  3JCM M;  3P0Z A;  4ERH A;  3CCQ F;  1J7H A;  1FNK A;  3R0P A;  4BT4 A;  4XCQ A;  3CCM F;  2Z1E A;  2KTV A;  3ON1 A;  1GO1 A;  5KX5 A;  1VQK F;  3S03 A;  5EWR A;  3IKE A;  3FFM A;  3I3F A;  3NK6 A;  4X1Y B;  3LWP C;  5IYZ A;  5GON A;  5LXT A;  5JQG A;  3LFO A;  3JAR A;  1VQL F;  3MDO A;  3NVK E;  1ZWZ A;  3CCL F;  4TUY B;  3SIV A;  4IHJ A;  2Z01 A;  4FFB A;  2CVL A;  1W55 A;  4O4J B;  5HY1 A;  5EYP A;  4X1K A;  4EI7 A;  1QU9 A;  1ODE A;  1X7P A;  1YJW F;  3N4Y A;  1YIJ F;  3JAL A;  3F0D A;  1T0K B;  4BT2 A;  3ELC A;  1X52 A;  3WXM B;  1DBF A;  1SDS A;  3HKB A;  2OTL F;  3JAS A;  2Z1T A;  1K9M H;  5MN5 A;  5KMG A;  1W5A A;  1COM A;  2VGN A;  3JAM M;  5AVM A;  3U0O A;  4BVQ A;  2AIF A;  2RHH A;  3CB2 A;  2H8E A;  5ITZ A;  1VQ9 F;  2QTP A;  1T0A A;  2UYN A;  5CA0 B;  1NJI H;  4O4H A;  3WJQ A;  3CXC F;  1YJN F;  1KNJ A;  3CCU F;  5FLX M;  1JFF A;  1Z5W A;  3F0F A;  4LNU B;  3PAF A;  4EI9 A;  1W41 A;  4RHA A;  3ERN A;  3D01 A;  3HKD A;  3DC2 A;  3VO8 A;  4DRX A;  4I50 A;  3N2K B;  1H7M A;  4ZI7 A;  3IEQ A;  2H8C A;  4ZHV A;  2I6R A;  3CG6 A;  4C82 A;  3S0Y A;  3ZP4 A;  5C8Y A;  5DCV A;  1W58 1;  2PHN A;  3C8L A;  1VQM F;  3VYS C;  4G4V A;  3RYF B;  4IIJ B;  4BT6 A;  3N2G B;  1IV2 A;  4ZHQ B;  5IJ9 B;  1W42 A;  3FPI A;  2HQS C;  4I55 B;  1Q8R A;  1CN7 A;  4C8I A;  4C4W C;  4G4Z A;  3I7T A;  1TVK A;  4TV9 B;  5JVD B;  1KNK A;  3UT5 B;  1GO0 A;  1M1K H;  1SA0 B;  2RHL A;  5LP6 C;  4RQO A;  3QTY A;  1W59 A;  2HP3 A;  4TV8 B;  1FFX B;  2HP0 A;  2HRY A;  5J2T A;  3G71 F;  3CCS F;  3IMP A;  3F0E A;  5JCO C;  3GYQ A;  1JD1 A;  2I6D A;  5EZY A;  3JAW A;  4U3J B;  3TD5 A;  1W2B F;  3HKC A;  5IJ0 B;  5JH7 A;  3JVH A;  2B33 A;  3WGJ A;  2ZOV A;  4X20 B;  1RA4 A;  1K73 H;  1K8A H;  4ZHY B;  2H6L A;  3MBM A;  3S0W A;  1VK3 A;  2UYJ A;  3VCZ A;  3CMA F;  5LOV A;  4F6R B;  1XHO A;  3HWU A;  3RYH B;  2VXY A;  1ONI A;  3CYP B;  4G4Y A;  3D54 A;  3F0G A;  4G4W A;  1DT9 A;  5FNV A;  3JAT B;  3RYI B;  2VAW A;  1W5B A;  3MCA B;  3S06 A;  4I4T B;  3CCR F;  3LWO C;  1VQ7 F;  5GAP K;  3M4S A;  3RYC A;  2Q1Y A;  2G9I A;  4ZK7 A;  3HAX D;  5LA6 A;  4B5C A;  3E22 A;  3CC7 F;  3CCJ F;  1S72 F;  3LWV C;  3ZO8 A;  4X1I B;  2KGW A;  3CD6 F;  1N8R H;  2JNB A;  3KJK A;  3WJR A;  5HWE A;  1SZQ A;  3FBA A;  1RLU A;  4X3L A;  2KTU A;  4YJ2 A;  2F9Z C;  1JY8 A;  3CPW F;  3KE1 A;  3O85 A;  1VQO F;  2VGM A;  1VQ4 F;  5LP6 B;  3HJW C;  3S0H A;  1H47 A;  2AIZ P;  4B46 A;  4DRX B;  1NMU B;  2CW4 A;  4EB6 A;  2GVI A;  3VOB A;  1OFU A;  2HVY D;  5HY2 A;  1KD1 H;  3K14 A;  5BMV B;  3E1Y A;  1YIT F;  3NVI B;  1RQ7 A;  2RB9 A;  3VI6 A;  1CLI A;  5GAN K;  1U3P A;  2LCA A;  2V9Y A;  4HNA A;  3CYQ A;  2QI2 A;  3OBW A;  4BVT A;  1W5F A;  2CZW A;  4O4I A;  1RLG A;  2AMT A;  4O4L B;  4O2B B;  2HS4 A;  2UYK A;  5CA1 B;  3P4E A;  3IEW A;  2IQQ A;  4O2A B;  5CB4 B;  5G4V C;  1U40 A;  5LYJ A;  4C8G A;  1TUB B;  5HP8 A;  3NK7 A;  3K12 A;  3P10 A;  3HTN A;  5J2U B;  3D00 A;  3M84 A;  5IT9 M;  3CME F;  2FGY A;  4WBN B;  2GLZ A;  5EIB C;  5LOV B;  1QAH A;  5HP7 A;  2GZL A;  4E6E A;  3CCE F;  3CPQ A;  2EWC A;  3HKE B;  3EOR A;  4R40 B;  2Z1F A;  1W3E X;  1YHQ F;  4X1Y A;  3LWQ C;  3VYT C;  3JAK B;  4LCK A;  1Q82 H;  1VQ5 F;  2BTQ B;  4BVR A;  4TUY A;  4PWT A;  1CK2 A;  1GZ0 A;  3K0T A;  4O4J A;  1XV2 A;  1YI2 F;  3QHD A;  1R1M A;  4BY9 D;  2MQE A;  1YGY A;  3K2X A;  4BT5 A;  1VHA A;  2L26 A;  3OON A;  1X25 A;  1U43 A;  5KX5 B;  3MCQ A;  2HRU A;  3L7Q A;  3CC2 F;  2QA4 F;  3VOA A;  5IYZ B;  1IV4 A;  5GON B;  5LXT B;  5GIP C;  5JQG B;  1JJ2 F;  3JAR B;  3M1X A;  2QEX F;  1H48 A;  2ZF8 A;  5CA0 A;  1VQ8 F;  3WGK A;  4IHJ B;  3DDN A;  3G6E F;  4FFB B;  1W40 A;  4X3M A;  3WGN A;  3RA5 A;  5EYP B;  2RHO A;  1W5E A;  4LNU A;  1OAP A;  4X1K B;  1VH8 A;  3JAL B;  2W8B C;  3C9U A;  3N2K A;  3HKB B;  2ZAU A;  1UFY A;  3JAS B;  2PMP A;  5KMG B;  1JN1 A;  2N48 A;  1QD9 A;  2CWJ A;  3C9S A;  5B8F A;  3BYQ A;  3CCV F;  2BTU A;  4ZHW A;  5ITZ B;  2UYN B;  3RYF A;  3LYB A;  4IIJ A;  4O4H B;  2BO1 A;  3E20 B;  3N2G A;  4ZHQ A;  5MN4 A;  5IJ9 A;  3VYU C;  2BTO A;  1VQV A;  3IKF A;  1JFF B;  5A2Q M;  4I55 A;  2OTJ F;  3WGM A;  2Z1U A;  4TV9 A;  2OHW A;  4EI8 A;  1PF5 A;  1XBI A;  3UT5 A;  3HKD B;  3ESJ A;  1SA0 A;  2LBW A;  3KIZ A;  4I50 B;  1E7K A;  1YQN A;  4ZI7 B;  4TV8 A;  4YJ3 A;  5EIB D;  1RQ2 A;  4ZOL A;  1FFX A;  4NWO B;  2UZH A;  3VTI C;  3TD3 A;  5C8Y B;  3B6N A;  5EB1 B;  4U3J A;  2DYY A;  1UI9 A;  5IJ0 A;  1VQP F;  3I56 F;  2ZVY A;  4X20 A;  4BW0 B;  1FSZ A;  4BVS A;  1TVK B;  3CC4 F;  3S02 A;  4F6R A;  2KG4 A;  2VAP A;  5EO3 A;  3QUW A;  3RYH A;  3FD5 A;  4G4X A;  2K1S A;  1IPA A;  3RYI A;  3JAT A;  2CHS A;  2DT4 A;  1FNJ A;  1PXW A;  1Z5V A;  2HP0 B;  4I4T A;  4C81 A;  5J2T B;  3LWR C;  3C9T A;  1U3L A;  1VQ6 F;  3MQW A;  5EB0 A;  2YYE A;  1Q7Y H;  5EZY B;  3JAW B;  3AGK A;  3HKC B;  2ZOD A;  5JH7 B;  3V7Q A;  1KC8 H;  3RE3 A;  3KJJ A;  3SIU A;  3WPX A;  2ZVZ A;  3OBY A;  4X1I A;  3FD6 A;  3Q8H A;  4G88 A;  2LBX A;  3T80 A;  4NUT A;  5GIN C;  1VQN F;  4B45 A;  2LBT A;  1XRG A;  3TD4 A;  2FC3 A;  3J7A R;  5G4U C;  4NQ3 A;  3PLA C;  4BT3 A;  5FNV B;  5MN6 A;  2NMU A;  5LP6 A;  2R75 1;  1YJ9 F;  1KQS F;  3RYC B;  3RA6 A;  5LA6 B;  2UYP A;  5BMV A;  3E22 B;  5JCO A;  3GTZ A;  3WPW A;  2IG8 A;  1Q86 H;  3WGL A;  1QVF F;  3V3T A;  2HS3 A;  3I55 F;  1X7O A;  5HXZ A;  4BT7 A;  4YJ2 B;  3VIU A;  3J81 M;  3OW2 F;  1IV1 A;  3KHN A;  3VMF B;  2OZB A;  4KWE A;  2ALE A;  5EAZ A;  1GX1 A;  4O4L A;  3V4D A;  3NMU C;  1NQ3 A;  3V7E A;  4B62 A;  4EB6 B;  1M90 H;  4O2B A;  2CHT A;  4YJ3 B;  4ZOL B;  5CA1 A;  3LME A;  3N4Z A;  3ZP7 A;  1W57 A;  4O2A A;  5CB4 A;  5HXU A;  4C8E A;  3ZOP A;  4U39 A;  2HX0 A;  1TUB A;  4HNA B;  2VAM A;  2CSL A;  5J2U A;  5HY4 A;  3IR9 A;  3LDT A;  2RHJ A;  2WAL A;  4WBN A; 
#chains in the Genus database with same CATH homology
 1GO0 A;  1M1K H;  5FJ4 C;  1VQP F;  3J80 M;  3NK7 A;  3I56 F;  4BW0 B;  3D00 A;  4TZZ A;  5IT9 M;  1QVG F;  5HY0 A;  4BVS A;  3CME F;  3G71 F;  3CCS F;  2FGY A;  3CC4 F;  2GLZ A;  3GYQ A;  5GIO C;  1Q81 H;  2KG4 A;  5EO3 A;  3CCE F;  2I6D A;  3CPQ A;  3G4S F;  1W2B F;  1W3E X;  1YHQ F;  3LWQ C;  3JCM M;  3CCQ F;  1IPA A;  1RA4 A;  1K73 H;  1K8A H;  4LCK A;  1Q82 H;  3LWR C;  1PXW A;  4XCQ A;  3CCM F;  1VQ5 F;  2KTV A;  3ON1 A;  4BVR A;  3CMA F;  1GO1 A;  1VQ6 F;  1VQK F;  1Q7Y H;  1CK2 A;  1GZ0 A;  5EWR A;  3AGK A;  3FFM A;  1YI2 F;  3NK6 A;  3V7Q A;  3LWP C;  4BY9 D;  1DT9 A;  1KC8 H;  3SIU A;  3LFO A;  3OBY A;  3MCA B;  1VQL F;  3CCR F;  3NVK E;  2LBX A;  3LWO C;  1ZWZ A;  5GIN C;  4NUT A;  3CCL F;  1VQ7 F;  1VQN F;  5GAP K;  3SIV A;  3HAX D;  2FC3 A;  3J7A R;  5HY1 A;  3CC2 F;  4EI7 A;  4NQ3 A;  2QA4 F;  3CC7 F;  3PLA C;  3CCJ F;  1S72 F;  5G4U C;  1X7P A;  3LWV C;  5GIP C;  1YJW F;  1JJ2 F;  3N4Y A;  1YIJ F;  1YJ9 F;  2QEX F;  1T0K B;  1KQS F;  3WXM B;  1X52 A;  3CD6 F;  1VQ8 F;  1N8R H;  1SDS A;  2JNB A;  5HWE A;  2OTL F;  1K9M H;  3RA6 A;  4X3L A;  2KTU A;  1W40 A;  4X3M A;  3G6E F;  2F9Z C;  3RA5 A;  3CPW F;  1VQO F;  3O85 A;  2VGN A;  3JAM M;  2VGM A;  1Q86 H;  1VQ4 F;  1QVF F;  3HJW C;  3V3T A;  4BVQ A;  2AIF A;  1VQ9 F;  3I55 F;  1NMU B;  1NJI H;  1X7O A;  5HXZ A;  3CXC F;  1YJN F;  2HVY D;  5HY2 A;  5FLX M;  3CCU F;  1KD1 H;  1YIT F;  3E1Y A;  3J81 M;  3OW2 F;  3NVI B;  3PAF A;  4EI9 A;  1W41 A;  3VMF B;  3CCV F;  2OZB A;  2ALE A;  3VI6 A;  5GAN K;  3NMU C;  3V7E A;  2BO1 A;  1H7M A;  3E20 B;  1M90 H;  5A2Q M;  3CG6 A;  3N4Z A;  2QI2 A;  2OTJ F;  3OBW A;  4BVT A;  2CZW A;  2OHW A;  5HXU A;  4EI8 A;  5DCV A;  1XBI A;  1RLG A;  1VQM F;  2LBW A;  1E7K A;  1W42 A;  5HY4 A;  1CN7 A;  3IR9 A;  4C4W C;  2WAL A;  5G4V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...