1X52A

Solution structures of the c-terminal domain of the human pelota homolog (cgi-17)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pelota homolog
molecule tags Protein binding
source organism Homo sapiens
publication title Solution structures of the C-terminal domain of the human Pelota homolog (CGI-17)
rcsb
total genus 40
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1x52A01
2KTVA 3CC2F 2LBXA 3E20B 3PAFA 3CCLF 1JJ2F 2AIFA 3CPQA 5GINC 4BW0B 1GO0A 1NJIH 1NMUB 2QEXF 3CCUF 5EWRA 1DT9A 1E7KA 5GIOC 3JCMM 3LWVC 3I56F 3HAXD 1CK2A 3CMEF 1QVGF 1YJWF 1K73H 2QA4F 3LFOA 3CCSF 3CG6A 1M90H 1X7OA 5G4VC 5EO3A 3O85A 1Q81H 1M1KH 3V7EA 1VQOF 3HJWC 2OZBA 2HVYD 3OBWA 1X52A 3NVKE 2ALEA 1XBIA 2FC3A 1Q86H 1IPAA 3CCRF 2KTUA 1VQPF 3FFMA 3LWQC 1VQLF 1N8RH 1W40A 3CCQF 3OBYA 2LBWA 3LWPC 3G71F 2CZWA 2OTJF 3CMAF 2OHWA 1X7PA 1T0KB 1VQ9F 1YJNF 1W41A 1S72F 5A2QM 3IR9A 5FLXM 3G6EF 1VQ6F 3J80M 3NK7A 3CPWF 3J7AR 1K9MH 1VQ8F 3SIUA 3VI6A 1YIJF 3CCEF 1Q82H 1H7MA 3CD6F 2BO1A 3CCMF 5FJ4C 5GANK 1VQKF 5IT9M 3J81M 3NK6A 3AGKA 4BY9D 2KG4A 2QI2A 2VGMA 1RA4A 4NUTA 1VQ4F 4X3MA 3JAMM 3V7QA 1SDSA 3LWRC 3SIVA 5G4UC 2VGNA 1PXWA 1GO1A 1W42A 3CC7F 2I6DA 2WALA 3RA5A 3NMUC 4C4WC 5GIPC 3CXCF 3OW2F 5GAPK 3E1YA 4LCKA 1CN7A 3LWOC 1QVFF 1GZ0A 3RA6A 1RLGA 1VQNF 3PLAC 1W3EX 1YITF 1YJ9F 1Q7YH 4TZZA 3WXMB 3GYQA 3G4SF 1W2BF 3CCJF 1K8AH 3I55F 4X3LA 3MCAB 1VQ5F 2JNBA 1YI2F 3VMFB 1KQSF 1YHQF 3CCVF 1VQ7F 2OTLF 3CC4F 1KC8H 3N4YA 3N4ZA 3ON1A 1KD1H 1ZWZA 3NVIB 5DCVA 1VQMF
chains in the Genus database with same CATH superfamily
2KTVA 2ZOVA 3E20B 1JJ2F 3F0DA 2AIFA 1SA0A 3S03A 1NMUB 1DT9A 2AIZP 1E7KA 4G88A 4O2AB 3I56F 4X1IB 3JARA 4EI7A 3LYBA 5EB0A 1XHOA 2Z01A 3R0PA 1VH8A 3P10A 1M90H 5LP6C 1W59A 1VQOF 3S0HA 4YJ3A 2OZBA 4BVSA 4X1YA 4B46A 2Z1EA 3OBWA 2CHTA 5ITZA 2FC3A 4NQ3A 5IYZB 4BVTA 2BTQB 1UI9A 2Z1UA 4EI9A 4DRXA 4G4ZA 4EI8A 3UT5B 1TUBB 3KE1A 4O4JB 1YGYA 2YXZA 1JFFA 1N8RH 3OBYA 3LWPC 3HKCB 1COMA 2OHWA 5JQGA 3IMPA 5A2QM 3S0WA 3ELCA 2VXYA 1VQ6F 1Q8RA 3BYQA 4LNUA 3SIUA 3VI6A 3HKDA 3F0GA 3HKEA 1VQKF 2RHHA 3J81M 3D00A 2HP3A 3E22A 5IJ9B 3WPXA 5HWEA 3KIZA 1IV4A 4I4TA 3IEWA 4C8EA 1YQNA 2UYJA 4PWTA 1W5AA 4B62A 1VQ4F 1SDSA 1W57A 3RYFA 1PXWA 3RYHB 3CC7F 3TD5A 5CA1B 4TV8B 3VCZA 3OW2F 5GAPK 4LCKA 3QUWA 1VQVA 3VOBA 4HNAA 1TVKA 1Z5VA 3QHDA 5KMGA 2DT4A 1W55A 5J2UB 4O4HB 1RLGA 1JFFB 1YITF 3WXMB 3GYQA 3FD5A 1VQ5F 2JNBA 1QD9A 3P4EA 3ZP7A 1W5EA 1FFXA 5C8YA 4ZHYB 2P6YA 3CCVF 3JAWA 2OTLF 1KC8H 1FSZA 3WGLA 1R1MA 2VAMA 3N2GA 4X20B 5IT9M 2CSLA 3RYCA 3K2XA 3I3FA 3F6MA 5CB4A 3VIUA 4O4LA 3S06A 4F6RB 1TVKB 4TUYB 3M4SA 4O2AA 5JH7A 1UFYA 3CCUF 2HS3A 4E6EA 5CA1A 3C8LA 2N48A 1CK2A 1QVGF 1YJWF 2IQQA 3CG6A 2PHNA 1X7OA 2RHOA 3E22B 1FFXB 3IKEA 3JASA 5C8YB 1M1KH 3FBAA 2HRYA 2OTMA 2W8BC 3HJWC 2CVLA 2F9ZC 1X52A 4TV9A 5AVMA 2LBTA 3NVKE 3VYTC 3C9TA 2CW4A 1OAPA 3I7TA 4EB6B 5JVDB 1IPAA 4O4HA 2H6LA 5JQGB 1KNJA 4G4WA 3C9SA 3FFMA 2FGYA 3HKCA 5FNVB 3JVHA 1VQLF 4R40B 3CYQA 1XRGA 4BT7A 1W40A 3CCQF 2LBWA 1FNKA 3UT5A 2Z1TA 2Q1YA 2OTJF 4ZOLB 3CMAF 3IEQA 1YJNF 4I4TB 1S72F 5HP8A 4ZI7B 3G6EF 5ITZB 2HS0A 3JAKA 3NK7A 3CPWF 3J7AR 4XCQA 1JY8A 3HKDB 1U40A 2BO1A 1W581 4O2BB 4O4IB 1CLIA 5IJ0B 5GANK 5HY0A 3S02A 3CCMF 4IIJB 3AGKA 4U3JB 2QI2A 4TUYA 1VK3A 4NUTA 3S0YA 4F6RA 5JH7B 1Z5WA 4X3MA 3SIVA 3V7QA 4BT3A 5G4UC 2VGNA 1GO1A 1W42A 3MCQA 5B8FA 3VYUC 1GX1A 3NMUC 5GIPC 3E1YA 3ESJA 4G4YA 1QVFF 3CYPB 5HXUA 3K0TA 1W3EX 3D01A 5JCOA 2ZF8A 1K8AH 1IV3A 2Z1FA 3I55F 3MCAB 4YJ3B 4G4VA 4I50B 3QTYA 2CHSA 1RQ7A 3WGJA 5BMVA 5HY2A 5J2UA 3ON1A 4HNAB 4G4XA 5KMGB 1KD1H 1ZWZA 2DYYA 1PF5A 2V9YA 2UYPA 5LP6B 4U3JA 1FNJA 5MN5A 3TD4A 5LOVA 3CC2F 4O2BA 4O4IA 2LBXA 3VO8A 3RYFB 5EIBC 5GINC 4BW0B 1GO0A 1NJIH 3D54A 3CB2A 5GIOC 2VAWA 3DC2A 4ZI7A 4C8GA 3HTNA 3VOAA 3LWVC 3C9RA 3ZO8A 2GVIA 3CMEF 4LNUB 3HKBA 1DBFA 3K14A 3LFOA 3CCSF 1IV1A 2G9IA 2ZVZA 5LA6B 3L7QA 3TD3A 3O85A 5LP6A 3V7EA 5KX5B 1SZQA 4ZHQB 4O4LB 2L26A 2UYNA 3WGMA 2NMUA 2ALEA 5JVDA 3C9UA 1Q86H 2I6RA 3LDTA 3JATB 4O4JA 4TV9B 2UYKA 4YJ2B 3P0ZA 5EAZA 2GLZA 1VQPF 3V4DA 3LWQC 4B5CA 3F0FA 3KJJA 3ZP4A 3G71F 2CZWA 4X1YB 3VTIC 2H8CA 3ERNA 4ZK7A 1T0KB 3WJQA 5LYJB 3MQWA 3GTZA 1J7HA 1ONIA 5FLXM 5HY4A 5HXZA 5J2TA 1K9MH 4WBNB 1U3LA 3CCEF 4X1IA 1Q82H 3CD6F 5FJ4C 1H48A 3JARB 4ERHA 3RYCB 3NK6A 3B6NA 2VGMA 5JCOC 4X20A 4B45A 1RA4A 1RQ2A 3N2GB 2B33A 1SA0B 3ZOPA 4M8IA 2KGWA 5IJ0A 4BT5A 2EWCA 3LWRC 3MDOA 2HS4A 2I6DA 5EYPB 2RHLA 2CWJA 1IV2A 2WALA 3F0EA 4IHJA 3RA5A 3WGKA 5LYJA 3VYSC 3CXCF 2IG8A 1CN7A 2HP0B 3U0OA 3HWUA 1GZ0A 4ZOLA 3RA6A 2ZVYA 5HP7A 1VQNF 1QAHA 4C82A 3PLAC 4TZZA 1OFUA 2VAPA 3CCJF 3FPIA 4RHAA 3RYIB 3JALA 1YI2F 3VMFB 5EIBD 1YHQF 3K12A 3RYHA 4BT6A 4BVQA 3WJRA 4DRXB 3WGNA 4X1KA 2HRUA 4C81A 3V3TA 5DCVA 5IJ9A 3JASB 2BTUA 2ZAUA 2R751 3PAFA 3WJPA 3CCLF 3CPQA 1H47A 4NWOB 5CA0B 5GONB 2QEXF 1VHAA 5EWRA 3JCMM 4C8IA 1T0AA 3RE3A 3HAXD 1U43A 2R6R1 1K73H 2QA4F 5CB4B 2AMTA 4RQOA 1W5BA 5G4VC 5EO3A 1JN1A 1Q81H 1RLUA 4KWEA 3JALB 3T80A 3RYIA 2HVYD 2MQEA 4FFBB 5MN4A 1NQ3A 5BMVB 1JD1A 2QTPA 5J2TB 3JAWB 5IYZA 4I55A 1XBIA 3EORA 2GZLA 4I50A 4BVRA 3CCRF 2KTUA 2K1SA 2HQSC 1U3PA 3DDNA 4ZHWA 4IHJB 3KHNA 4I55B 4U39A 3KJKA 2YYEA 4FFBA 1X7PA 1VQ9F 1W41A 5EB1B 3WPWA 3IR9A 4TV8A 2HX0A 3J80M 4ZHVA 2BTOA 2UYNB 1VQ8F 1YIJF 1H7MA 2ZODA 4WBNA 5EZYA 5HY1A 1KNKA 1X25A 5KX5A 4BY9D 1XV2A 2KG4A 4IIJA 5GONA 3HKEB 5CA0A 4DXDA 3JAMM 4BT4A 2RB9A 3N2KA 3JAKB 3MBMA 5LXTB 3GHZA 1QU9A 4C4WC 5EZYB 2H8EA 1W5FA 4X1KB 3LWOC 4BT2A 2UZHA 4YJ2A 2IAFA 3JATA 5LOVB 2LCAA 1YJ9F 5FNVA 3M84A 1Q7YH 3G4SF 1W2BF 1TUBA 1ODEA 3LMEA 4X3LA 4ZHQA 2PMPA 4EB6A 5LA6A 1KQSF 3M1XA 3N2KB 5LXTA 2RHJA 1VQ7F 3HKBB 3CC4F 3N4YA 3FD6A 2Q1XA 3N4ZA 5MN6A 2HP0A 3Q8HA 3IKFA 3NVIB 1VQMF 3OONA 5EYPA
chains in the Genus database with same CATH topology
2KTVA 3CC2F 2LBXA 3E20B 3PAFA 3CCLF 1JJ2F 2AIFA 3CPQA 5GINC 4BW0B 1GO0A 1NJIH 1NMUB 2QEXF 3CCUF 5EWRA 1DT9A 1E7KA 5GIOC 3JCMM 3LWVC 3I56F 3HAXD 1CK2A 4EI7A 3CMEF 1QVGF 1YJWF 1K73H 2QA4F 3LFOA 3CCSF 3CG6A 1M90H 1X7OA 5G4VC 5EO3A 3O85A 1Q81H 1M1KH 3V7EA 1VQOF 3HJWC 2OZBA 4BVSA 2HVYD 2F9ZC 3OBWA 1X52A 3NVKE 2ALEA 1XBIA 2FC3A 4NQ3A 1Q86H 1IPAA 4BVTA 4BVRA 3CCRF 2KTUA 4EI9A 2GLZA 1VQPF 3FFMA 4EI8A 2FGYA 3LWQC 1VQLF 1N8RH 1W40A 3CCQF 3OBYA 2LBWA 3LWPC 3G71F 2CZWA 2OTJF 3CMAF 2OHWA 1X7PA 1T0KB 1VQ9F 1YJNF 1W41A 1S72F 5A2QM 3IR9A 5FLXM 3G6EF 1VQ6F 5HY4A 5HXZA 3J80M 3NK7A 3CPWF 3J7AR 4XCQA 1K9MH 1VQ8F 3SIUA 3VI6A 1YIJF 3CCEF 1Q82H 1H7MA 3CD6F 2BO1A 3CCMF 5FJ4C 5HY1A 5GANK 1VQKF 5HY0A 5IT9M 3J81M 3NK6A 3AGKA 3D00A 4BY9D 2KG4A 2QI2A 2VGMA 5HWEA 1RA4A 4NUTA 1VQ4F 4X3MA 3JAMM 3V7QA 1SDSA 3LWRC 3SIVA 5G4UC 2VGNA 1PXWA 1GO1A 1W42A 3CC7F 2I6DA 2WALA 3RA5A 3NMUC 4C4WC 5GIPC 3CXCF 3OW2F 5GAPK 3E1YA 4LCKA 1CN7A 3LWOC 1QVFF 1GZ0A 3RA6A 1RLGA 1VQNF 5HXUA 3PLAC 1W3EX 1YITF 1YJ9F 1Q7YH 4TZZA 3WXMB 3GYQA 3G4SF 1W2BF 3CCJF 1K8AH 3I55F 4X3LA 3MCAB 1VQ5F 2JNBA 1YI2F 3VMFB 1KQSF 1YHQF 3CCVF 1VQ7F 5HY2A 2OTLF 4BVQA 3CC4F 1KC8H 3N4YA 3N4ZA 3ON1A 1KD1H 1ZWZA 3NVIB 3V3TA 5DCVA 1VQMF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KTV A;  3CC2 F;  2LBX A;  3E20 B;  3PAF A;  3CCL F;  1JJ2 F;  2AIF A;  3CPQ A;  5GIN C;  4BW0 B;  1GO0 A;  1NJI H;  1NMU B;  2QEX F;  3CCU F;  5EWR A;  1DT9 A;  1E7K A;  5GIO C;  3JCM M;  3LWV C;  3I56 F;  3HAX D;  1CK2 A;  3CME F;  1QVG F;  1YJW F;  1K73 H;  2QA4 F;  3LFO A;  3CCS F;  3CG6 A;  1M90 H;  1X7O A;  5G4V C;  5EO3 A;  3O85 A;  1Q81 H;  1M1K H;  3V7E A;  1VQO F;  3HJW C;  2OZB A;  2HVY D;  3OBW A;  1X52 A;  3NVK E;  2ALE A;  1XBI A;  2FC3 A;  1Q86 H;  1IPA A;  3CCR F;  2KTU A;  1VQP F;  3FFM A;  3LWQ C;  1VQL F;  1N8R H;  1W40 A;  3CCQ F;  3OBY A;  2LBW A;  3LWP C;  3G71 F;  2CZW A;  2OTJ F;  3CMA F;  2OHW A;  1X7P A;  1T0K B;  1VQ9 F;  1YJN F;  1W41 A;  1S72 F;  5A2Q M;  3IR9 A;  5FLX M;  3G6E F;  1VQ6 F;  3J80 M;  3NK7 A;  3CPW F;  3J7A R;  1K9M H;  1VQ8 F;  3SIU A;  3VI6 A;  1YIJ F;  3CCE F;  1Q82 H;  1H7M A;  3CD6 F;  2BO1 A;  3CCM F;  5FJ4 C;  5GAN K;  1VQK F;  5IT9 M;  3J81 M;  3NK6 A;  3AGK A;  4BY9 D;  2KG4 A;  2QI2 A;  2VGM A;  1RA4 A;  4NUT A;  1VQ4 F;  4X3M A;  3JAM M;  3V7Q A;  1SDS A;  3LWR C;  3SIV A;  5G4U C;  2VGN A;  1PXW A;  1GO1 A;  1W42 A;  3CC7 F;  2I6D A;  2WAL A;  3RA5 A;  3NMU C;  4C4W C;  5GIP C;  3CXC F;  3OW2 F;  5GAP K;  3E1Y A;  4LCK A;  1CN7 A;  3LWO C;  1QVF F;  1GZ0 A;  3RA6 A;  1RLG A;  1VQN F;  3PLA C;  1W3E X;  1YIT F;  1YJ9 F;  1Q7Y H;  4TZZ A;  3WXM B;  3GYQ A;  3G4S F;  1W2B F;  3CCJ F;  1K8A H;  3I55 F;  4X3L A;  3MCA B;  1VQ5 F;  2JNB A;  1YI2 F;  3VMF B;  1KQS F;  1YHQ F;  3CCV F;  1VQ7 F;  2OTL F;  3CC4 F;  1KC8 H;  3N4Y A;  3N4Z A;  3ON1 A;  1KD1 H;  1ZWZ A;  3NVI B;  5DCV A;  1VQM F; 
#chains in the Genus database with same CATH topology
 2KTV A;  2ZOV A;  3E20 B;  1JJ2 F;  3F0D A;  2AIF A;  1SA0 A;  3S03 A;  1NMU B;  1DT9 A;  2AIZ P;  1E7K A;  4G88 A;  4O2A B;  3I56 F;  4X1I B;  3JAR A;  4EI7 A;  3LYB A;  5EB0 A;  1XHO A;  2Z01 A;  3R0P A;  1VH8 A;  3P10 A;  1M90 H;  5LP6 C;  1W59 A;  1VQO F;  3S0H A;  4YJ3 A;  2OZB A;  4BVS A;  4X1Y A;  4B46 A;  2Z1E A;  3OBW A;  2CHT A;  5ITZ A;  2FC3 A;  4NQ3 A;  5IYZ B;  4BVT A;  2BTQ B;  1UI9 A;  2Z1U A;  4EI9 A;  4DRX A;  4G4Z A;  4EI8 A;  3UT5 B;  1TUB B;  3KE1 A;  4O4J B;  1YGY A;  2YXZ A;  1JFF A;  1N8R H;  3OBY A;  3LWP C;  3HKC B;  1COM A;  2OHW A;  5JQG A;  3IMP A;  5A2Q M;  3S0W A;  3ELC A;  2VXY A;  1VQ6 F;  1Q8R A;  3BYQ A;  4LNU A;  3SIU A;  3VI6 A;  3HKD A;  3F0G A;  3HKE A;  1VQK F;  2RHH A;  3J81 M;  3D00 A;  2HP3 A;  3E22 A;  5IJ9 B;  3WPX A;  5HWE A;  3KIZ A;  1IV4 A;  4I4T A;  3IEW A;  4C8E A;  1YQN A;  2UYJ A;  4PWT A;  1W5A A;  4B62 A;  1VQ4 F;  1SDS A;  1W57 A;  3RYF A;  1PXW A;  3RYH B;  3CC7 F;  3TD5 A;  5CA1 B;  4TV8 B;  3VCZ A;  3OW2 F;  5GAP K;  4LCK A;  3QUW A;  1VQV A;  3VOB A;  4HNA A;  1TVK A;  1Z5V A;  3QHD A;  5KMG A;  2DT4 A;  1W55 A;  5J2U B;  4O4H B;  1RLG A;  1JFF B;  1YIT F;  3WXM B;  3GYQ A;  3FD5 A;  1VQ5 F;  2JNB A;  1QD9 A;  3P4E A;  3ZP7 A;  1W5E A;  1FFX A;  5C8Y A;  4ZHY B;  2P6Y A;  3CCV F;  3JAW A;  2OTL F;  1KC8 H;  1FSZ A;  3WGL A;  1R1M A;  2VAM A;  3N2G A;  4X20 B;  5IT9 M;  2CSL A;  3RYC A;  3K2X A;  3I3F A;  3F6M A;  5CB4 A;  3VIU A;  4O4L A;  3S06 A;  4F6R B;  1TVK B;  4TUY B;  3M4S A;  4O2A A;  5JH7 A;  1UFY A;  3CCU F;  2HS3 A;  4E6E A;  5CA1 A;  3C8L A;  2N48 A;  1CK2 A;  1QVG F;  1YJW F;  2IQQ A;  3CG6 A;  2PHN A;  1X7O A;  2RHO A;  3E22 B;  1FFX B;  3IKE A;  3JAS A;  5C8Y B;  1M1K H;  3FBA A;  2HRY A;  2OTM A;  2W8B C;  3HJW C;  2CVL A;  2F9Z C;  1X52 A;  4TV9 A;  5AVM A;  2LBT A;  3NVK E;  3VYT C;  3C9T A;  2CW4 A;  1OAP A;  3I7T A;  4EB6 B;  5JVD B;  1IPA A;  4O4H A;  2H6L A;  5JQG B;  1KNJ A;  4G4W A;  3C9S A;  3FFM A;  2FGY A;  3HKC A;  5FNV B;  3JVH A;  1VQL F;  4R40 B;  3CYQ A;  1XRG A;  4BT7 A;  1W40 A;  3CCQ F;  2LBW A;  1FNK A;  3UT5 A;  2Z1T A;  2Q1Y A;  2OTJ F;  4ZOL B;  3CMA F;  3IEQ A;  1YJN F;  4I4T B;  1S72 F;  5HP8 A;  4ZI7 B;  3G6E F;  5ITZ B;  2HS0 A;  3JAK A;  3NK7 A;  3CPW F;  3J7A R;  4XCQ A;  1JY8 A;  3HKD B;  1U40 A;  2BO1 A;  1W58 1;  4O2B B;  4O4I B;  1CLI A;  5IJ0 B;  5GAN K;  5HY0 A;  3S02 A;  3CCM F;  4IIJ B;  3AGK A;  4U3J B;  2QI2 A;  4TUY A;  1VK3 A;  4NUT A;  3S0Y A;  4F6R A;  5JH7 B;  1Z5W A;  4X3M A;  3SIV A;  3V7Q A;  4BT3 A;  5G4U C;  2VGN A;  1GO1 A;  1W42 A;  3MCQ A;  5B8F A;  3VYU C;  1GX1 A;  3NMU C;  5GIP C;  3E1Y A;  3ESJ A;  4G4Y A;  1QVF F;  3CYP B;  5HXU A;  3K0T A;  1W3E X;  3D01 A;  5JCO A;  2ZF8 A;  1K8A H;  1IV3 A;  2Z1F A;  3I55 F;  3MCA B;  4YJ3 B;  4G4V A;  4I50 B;  3QTY A;  2CHS A;  1RQ7 A;  3WGJ A;  5BMV A;  5HY2 A;  5J2U A;  3ON1 A;  4HNA B;  4G4X A;  5KMG B;  1KD1 H;  1ZWZ A;  2DYY A;  1PF5 A;  2V9Y A;  2UYP A;  5LP6 B;  4U3J A;  1FNJ A;  5MN5 A;  3TD4 A;  5LOV A;  3CC2 F;  4O2B A;  4O4I A;  2LBX A;  3VO8 A;  3RYF B;  5EIB C;  5GIN C;  4BW0 B;  1GO0 A;  1NJI H;  3D54 A;  3CB2 A;  5GIO C;  2VAW A;  3DC2 A;  4ZI7 A;  4C8G A;  3HTN A;  3VOA A;  3LWV C;  3C9R A;  3ZO8 A;  2GVI A;  3CME F;  4LNU B;  3HKB A;  1DBF A;  3K14 A;  3LFO A;  3CCS F;  1IV1 A;  2G9I A;  2ZVZ A;  5LA6 B;  3L7Q A;  3TD3 A;  3O85 A;  5LP6 A;  3V7E A;  5KX5 B;  1SZQ A;  4ZHQ B;  4O4L B;  2L26 A;  2UYN A;  3WGM A;  2NMU A;  2ALE A;  5JVD A;  3C9U A;  1Q86 H;  2I6R A;  3LDT A;  3JAT B;  4O4J A;  4TV9 B;  2UYK A;  4YJ2 B;  3P0Z A;  5EAZ A;  2GLZ A;  1VQP F;  3V4D A;  3LWQ C;  4B5C A;  3F0F A;  3KJJ A;  3ZP4 A;  3G71 F;  2CZW A;  4X1Y B;  3VTI C;  2H8C A;  3ERN A;  4ZK7 A;  1T0K B;  3WJQ A;  5LYJ B;  3MQW A;  3GTZ A;  1J7H A;  1ONI A;  5FLX M;  5HY4 A;  5HXZ A;  5J2T A;  1K9M H;  4WBN B;  1U3L A;  3CCE F;  4X1I A;  1Q82 H;  3CD6 F;  5FJ4 C;  1H48 A;  3JAR B;  4ERH A;  3RYC B;  3NK6 A;  3B6N A;  2VGM A;  5JCO C;  4X20 A;  4B45 A;  1RA4 A;  1RQ2 A;  3N2G B;  2B33 A;  1SA0 B;  3ZOP A;  4M8I A;  2KGW A;  5IJ0 A;  4BT5 A;  2EWC A;  3LWR C;  3MDO A;  2HS4 A;  2I6D A;  5EYP B;  2RHL A;  2CWJ A;  1IV2 A;  2WAL A;  3F0E A;  4IHJ A;  3RA5 A;  3WGK A;  5LYJ A;  3VYS C;  3CXC F;  2IG8 A;  1CN7 A;  2HP0 B;  3U0O A;  3HWU A;  1GZ0 A;  4ZOL A;  3RA6 A;  2ZVY A;  5HP7 A;  1VQN F;  1QAH A;  4C82 A;  3PLA C;  4TZZ A;  1OFU A;  2VAP A;  3CCJ F;  3FPI A;  4RHA A;  3RYI B;  3JAL A;  1YI2 F;  3VMF B;  5EIB D;  1YHQ F;  3K12 A;  3RYH A;  4BT6 A;  4BVQ A;  3WJR A;  4DRX B;  3WGN A;  4X1K A;  2HRU A;  4C81 A;  3V3T A;  5DCV A;  5IJ9 A;  3JAS B;  2BTU A;  2ZAU A;  2R75 1;  3PAF A;  3WJP A;  3CCL F;  3CPQ A;  1H47 A;  4NWO B;  5CA0 B;  5GON B;  2QEX F;  1VHA A;  5EWR A;  3JCM M;  4C8I A;  1T0A A;  3RE3 A;  3HAX D;  1U43 A;  2R6R 1;  1K73 H;  2QA4 F;  5CB4 B;  2AMT A;  4RQO A;  1W5B A;  5G4V C;  5EO3 A;  1JN1 A;  1Q81 H;  1RLU A;  4KWE A;  3JAL B;  3T80 A;  3RYI A;  2HVY D;  2MQE A;  4FFB B;  5MN4 A;  1NQ3 A;  5BMV B;  1JD1 A;  2QTP A;  5J2T B;  3JAW B;  5IYZ A;  4I55 A;  1XBI A;  3EOR A;  2GZL A;  4I50 A;  4BVR A;  3CCR F;  2KTU A;  2K1S A;  2HQS C;  1U3P A;  3DDN A;  4ZHW A;  4IHJ B;  3KHN A;  4I55 B;  4U39 A;  3KJK A;  2YYE A;  4FFB A;  1X7P A;  1VQ9 F;  1W41 A;  5EB1 B;  3WPW A;  3IR9 A;  4TV8 A;  2HX0 A;  3J80 M;  4ZHV A;  2BTO A;  2UYN B;  1VQ8 F;  1YIJ F;  1H7M A;  2ZOD A;  4WBN A;  5EZY A;  5HY1 A;  1KNK A;  1X25 A;  5KX5 A;  4BY9 D;  1XV2 A;  2KG4 A;  4IIJ A;  5GON A;  3HKE B;  5CA0 A;  4DXD A;  3JAM M;  4BT4 A;  2RB9 A;  3N2K A;  3JAK B;  3MBM A;  5LXT B;  3GHZ A;  1QU9 A;  4C4W C;  5EZY B;  2H8E A;  1W5F A;  4X1K B;  3LWO C;  4BT2 A;  2UZH A;  4YJ2 A;  2IAF A;  3JAT A;  5LOV B;  2LCA A;  1YJ9 F;  5FNV A;  3M84 A;  1Q7Y H;  3G4S F;  1W2B F;  1TUB A;  1ODE A;  3LME A;  4X3L A;  4ZHQ A;  2PMP A;  4EB6 A;  5LA6 A;  1KQS F;  3M1X A;  3N2K B;  5LXT A;  2RHJ A;  1VQ7 F;  3HKB B;  3CC4 F;  3N4Y A;  3FD6 A;  2Q1X A;  3N4Z A;  5MN6 A;  2HP0 A;  3Q8H A;  3IKF A;  3NVI B;  1VQM F;  3OON A;  5EYP A; 
#chains in the Genus database with same CATH homology
 2KTV A;  3CC2 F;  2LBX A;  3E20 B;  3PAF A;  3CCL F;  1JJ2 F;  2AIF A;  3CPQ A;  5GIN C;  4BW0 B;  1GO0 A;  1NJI H;  1NMU B;  2QEX F;  3CCU F;  5EWR A;  1DT9 A;  1E7K A;  5GIO C;  3JCM M;  3LWV C;  3I56 F;  3HAX D;  1CK2 A;  4EI7 A;  3CME F;  1QVG F;  1YJW F;  1K73 H;  2QA4 F;  3LFO A;  3CCS F;  3CG6 A;  1M90 H;  1X7O A;  5G4V C;  5EO3 A;  3O85 A;  1Q81 H;  1M1K H;  3V7E A;  1VQO F;  3HJW C;  2OZB A;  4BVS A;  2HVY D;  2F9Z C;  3OBW A;  1X52 A;  3NVK E;  2ALE A;  1XBI A;  2FC3 A;  4NQ3 A;  1Q86 H;  1IPA A;  4BVT A;  4BVR A;  3CCR F;  2KTU A;  4EI9 A;  2GLZ A;  1VQP F;  3FFM A;  4EI8 A;  2FGY A;  3LWQ C;  1VQL F;  1N8R H;  1W40 A;  3CCQ F;  3OBY A;  2LBW A;  3LWP C;  3G71 F;  2CZW A;  2OTJ F;  3CMA F;  2OHW A;  1X7P A;  1T0K B;  1VQ9 F;  1YJN F;  1W41 A;  1S72 F;  5A2Q M;  3IR9 A;  5FLX M;  3G6E F;  1VQ6 F;  5HY4 A;  5HXZ A;  3J80 M;  3NK7 A;  3CPW F;  3J7A R;  4XCQ A;  1K9M H;  1VQ8 F;  3SIU A;  3VI6 A;  1YIJ F;  3CCE F;  1Q82 H;  1H7M A;  3CD6 F;  2BO1 A;  3CCM F;  5FJ4 C;  5HY1 A;  5GAN K;  1VQK F;  5HY0 A;  5IT9 M;  3J81 M;  3NK6 A;  3AGK A;  3D00 A;  4BY9 D;  2KG4 A;  2QI2 A;  2VGM A;  5HWE A;  1RA4 A;  4NUT A;  1VQ4 F;  4X3M A;  3JAM M;  3V7Q A;  1SDS A;  3LWR C;  3SIV A;  5G4U C;  2VGN A;  1PXW A;  1GO1 A;  1W42 A;  3CC7 F;  2I6D A;  2WAL A;  3RA5 A;  3NMU C;  4C4W C;  5GIP C;  3CXC F;  3OW2 F;  5GAP K;  3E1Y A;  4LCK A;  1CN7 A;  3LWO C;  1QVF F;  1GZ0 A;  3RA6 A;  1RLG A;  1VQN F;  5HXU A;  3PLA C;  1W3E X;  1YIT F;  1YJ9 F;  1Q7Y H;  4TZZ A;  3WXM B;  3GYQ A;  3G4S F;  1W2B F;  3CCJ F;  1K8A H;  3I55 F;  4X3L A;  3MCA B;  1VQ5 F;  2JNB A;  1YI2 F;  3VMF B;  1KQS F;  1YHQ F;  3CCV F;  1VQ7 F;  5HY2 A;  2OTL F;  4BVQ A;  3CC4 F;  1KC8 H;  3N4Y A;  3N4Z A;  3ON1 A;  1KD1 H;  1ZWZ A;  3NVI B;  3V3T A;  5DCV A;  1VQM F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...