1X59A

Solution structures of the whep-trs domain of human histidyl-trna synthetase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
b'GSSGSSGMAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidyl-tRNA synthetase
publication title Solution structures of the WHEP-TRS domain of human histidyl-tRNA synthetase
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 73
sequence length 73
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1x59A00
1HNZO 2DOSA 4LF6O 1F7YA 4LF7O 4LF8O 4AQYO 3J7AU 5FLXN 4NXNO 1J5EO 1FJGO 2FKXA 1A32A 4DV4O 4LF9O 4JI5O 1XMOO 3RT3C 2UUBO 2F4VO 1IBMO 4JI7O 5BR8O 4JI3O 4GKJO 2ZKOA 4DR6O 3R66A 1IBKO 2N74A 1AILA 1XNRO 3M8AA 5A2QN 3OTOO 4X66O 5IWAO 1DK1A 1N33O 4DR5O 4DV3O 1IBLO 4DR7O 2DJVA 1NS1A 2UXCO 4DR3O 3F5TA 1R1BA 5LL6Y 4JI0O 4X64O 3JAMN 3T1HO 1FYJA 4NXMO 4DV6O 4YHHO 4B3TO 1XEQA 4KHPO 1FKAO 2JRIA 4B3RO 1G1XB 4DR4O 3J81N 1XMQO 2E5LO 3J80N 4B3SO 3T1YO 1XNQO 4JI6O 4JI8O 4DV1O 2UUAO 2AGAA 1HR0O 1AB3A 4DV5O 4JI2O 4X65O 4JYAO 4K0KO 4DR2O 4JI4O 4JI1O 4LF5O 2UXBO 1D2DA 1YZBA 2VQFO 1I94O 4A5UB 5LMUO 4LFBO 1N36O 4LF4O 1KUQA 4X62O 1R6TA 1X59A 2UUCO 1N32O 4LFCO 2UXDO 5BXZA 4GKKO 4DUYO 1HNWO 4YY3O 4DV7O 2Z0AA 5BY1A 4OX9O 3SDLA 4OPHA 4DV0O 5IT9N 4OPAA 4B3MO 2LW7A 2HHHO 4DR1O 4DV2O 1HNXO 5H5NA 2ZM6O 2UU9O 1N34O 5LMNO 4DUZO 4LFAO 4JV5O 2VQEO 3O65A
chains in the Genus database with same CATH superfamily
1GN3A 1BGYH 1G6UA 4PA9A 2DYRC 3JD3A 4PDRA 4GUNA 1R3KC 1SQFA 2FB5A 2CK3G 1THZA 3DXRA 3F5WC 2YIDA 3LSSA 1JR9A 3D36A 3W7WA 4E4EA 3UO3A 1ZX3A 4JI3O 1EZVH 1RSOB 3CSXA 4FLYA 2YS8A 3JSNA 3L74H 1NU1H 2HP8A 1S3JA 3A2FA 1XUQA 4FFBA 3ZHUA 2HJDA 4N21A 3X2QB 3B8MA 4IHJA 4X88A 1S0VA 2IW5A 5KLVH 1EN6A 2A9HA 3SJCC 4B3TO 3SYPA 2CAZC 3ICXA 1FKAO 4DV6B 4MTOA 3ZRWB 3S3XA 2X7RB 3U10A 1NTMH 4K35A 3ABKB 1M4UA 5H6QA 4X62B 4LP8A 1XNQO 5C8YB 3QTCA 4NVPA 3RYCA 1EFRG 4U7NA 5E79Z 1AB3A 1RPRA 5JCOA 4XBFA 2QEXV 2CTWA 4DUZB 3LNMB 3PJSK 3WB0A 4BIOA 1R6TA 4ZKIA 2GTAA 3W7UA 3QVNA 3RYIB 3CEIA 2EJ7A 1S5LZ 1V55C 3UM7A 1P4RA 3EVKA 4JPRA 1Q7YW 2JJ2G 4B3MB 3AK3A 1OZ0A 1N0NA 5LHGA 1US6A 4LFAO 2VQEO 5EBWC 1FPOA 4O2AA 1NVPD 4J42A 1BL8A 3ABLC 4JI5O 1ZWIC 2EINB 1SC5B 3RYFB 2YEVB 4JI7O 5KX5B 2KKWA 3LDEA 5LP6A 2YXHA 2QDOA 3CX5F 1MZFA 4WFAV 5LA6B 3CHXA 3WB2A 1HP8A 4MW3A 3SGIA 1K92A 3E8FA 5FL7G 2WLLB 5B1OA 2LQTA 4TQFA 3BFRA 1N33O 4ZHQA 3UKMA 1GRJA 1GN4A 4PI2A 1RP3B 1KB9F 1QHTA 4JAAA 4CH6A 4I4TB 4X64O 2LO1A 1KMIZ 3VQXA 2LP7A 3ZMSA 2B5UA 4UXNA 4KXRA 1ORQC 2HKOA 4ZOLA 1XL6A 5D5PA 4JASA 1SQPH 4JI6O 3EFFK 1Q8IA 4PELA 1OHHG 4DV1B 4O4JB 3N2KB 5DECA 2GUZB 2QA4V 2ZT9B 1TVKA 5KUKA 4NTWA 4K0KO 2R9IA 5IYCO 4DR2O 4Z1VA 3K0DA 4U3FH 4RWUA 2ZE7A 4PDMA 3WG7B 5JVDB 1Q43A 5J2UB 1WA8B 4LFBO 2YIAA 1KUQA 2Q0AA 4UFZA 1IURA 3HKCA 2KG7A 2UUCB 4HNAA 4FFKA 1AP6A 2A3QA 1JX9A 1HDJA 3K9AA 3K5LA 3E83A 5TISZ 2XAGA 2QM8A 2WLHA 3WU2Z 4JV5O 2XTAA 1QBZA 1CXZB 1L8DA 4GX5A 3OR7C 3X2QC 3CPWU 4LF7O 3J7AU 1N0JA 1K4CC 2AXTZ 1AVMA 3FD9A 1O9GA 1PL4A 2ZIOA 1GTOA 1F51A 1XMOO 2ZIMA 3RT3C 2EZOA 4O4LA 3AG3C 3ZHTA 4EEQA 1QCEA 4CS3A 2WA3A 2F66C 4LWSA 2Y0IA 2IH1C 3ABKC 2WLKA 1F23A 3GWKC 4UB6Z 1L0LH 4DR6B 3N2GA 4KP4A 1PPJH 3FX7A 4O2BB 2AHZA 4O4IB 3FB7C 3CRCA 5HFMA 4DR7O 4FPPA 2E3CA 2FYUH 2OTLV 5L3EA 4BR6A 3T1CA 4PV1B 2YXLA 3T1HB 2QR4A 3RWRD 2A06H 1OCOB 2QM4A 3HKDB 2P5OA 2VRZA 1XQ8A 4F4LA 1GKFA 4W4KA 1VQ8V 4KUMA 4JI8O 4GKKB 2BE3A 1WLEA 3ZHSA 4AILC 1HW7A 1RSOA 2P4VA 1BT8A 5F2VO 2Y48A 2Q69A 4QE9A 1XHXA 1QR9A 4LH6A 1TUEB 1K97A 2B1IA 2D2CB 4I0XB 1YTFB 1N4CA 2ZDIC 2X0LA 2MW2B 4DRXB 3Q4HB 3H1IH 4LF8B 1HNWO 4LFCB 3K5OA 3G6EV 4MVUA 1UFIA 4JGSA 2PI4A 4OX9B 4K8ZA 4DR1O 3LSUA 3ZRWA 2ZM6B 4IT5A 3K59A 2XAHA 1GM9A 5C8YA 1HNZO 1YI2V 3JCUZ 3OUFA 2OCHA 3K0GA 3JD0A 4LF9B 1UPGA 1Q90D 2LW1A 1PD3A 2XAFA 3RN4A 1BE3H 1M56B 1NTZH 1ZSPA 3ZX6A 2ADPA 2ZKOA 1Z5VA 3LNNA 3R66A 3VBBA 4UCSA 3ETEA 4WBNB 4GX2A 1SQBH 4X20B 1IBKB 4J10A 2FTKA 2EULA 5A2QN 4FVMA 1K73W 1DTOA 2ZXWC 5IWAO 1MABG 1KP2A 4BW5A 3W7XA 5EC1C 2EIKB 4X66B 5E1AC 1B06A 1ZLZA 2DE0X 3AG2B 3WG7C 3E2EA 1SESA 2UXNA 3SYQA 5EBMC 1JA8A 4JTDB 4B7EA 3OMNB 4B3RO 3M99B 4DXWA 2ZNIA 3ASNB 1BSMA 2ZDIA 2GV9A 4N23A 3RYFA 3CE2A 2YEVA 3U0ZA 5KX5A 1E1RG 1KKCA 3I55V 2H8PC 2Q67A 5LA6A 1IXBA 4FLUA 3CWBH 4X65O 4JI2O 4R50A 2P06A 1L0NH 2PUSA 5EK0A 3T4DA 2WLLA 4F6EA 1YHQV 4LF5B 4D7TA 3ASOC 4I4TA 5L3GA 4UCTA 1FS0G 3VQVA 1KECA 1QLNA 4OPAA 1N8RW 4DV2O 2UU9O 1S72V 2EBOA 3QO7A 1A32A 3O65A 2YI9A 4PI0A 2XHBA 5JH7B 1ROPA 4UV8A 4O4JA 3RW0A 2WLIA 3N2KA 2GUZA 3SPGA 4PA3A 4J7ZA 4DV3B 4JYCA 4DK1A 2UXCB 2QKSA 5JVDA 2OWOA 5KHJA 1WA8A 2BSKA 5J2UA 2F4VB 5A9GA 1S5JA 3JASB 1QVFU 1AJNA 1VQLV 3GVMA 1V9PA 3DC5A 4JYBA 1P7BA 2NR5A 2PGGA 4DR4B 3RVZA 5EYPB 3H1LH 5DN6G 1KBHA 5J9PC 3CXHF 2P67A 2F1MA 3JATB 4W4LA 2WWWA 4YJ2B 2QGNA 4DV6O 2EIMB 2WA4A 2WPDG 1AJPA 2P90A 1VQKV 4YHHB 4IYHA 4U3JB 3ZMUA 2RCVA 2KSDA 3OUSA 5B1AB 3F7YC 1WP8A 2E5LO 1NI8A 2XASA 1N36B 3JD4A 4C7UA 1EBOA 2V7QG 3M7MX 4KFMA 3CCMV 3CXCU 2UUAB 1YXBA 2EX3A 4IIJB 4CH4A 3ABLB 4R7CA 3L72H 4O2BA 4O4IA 4Q20A 1VF5B 1Q6HA 2HR3A 2JVDA 5KHHA 5B3SC 3C3SA 4YY3O 1OCZB 5K1PA 3OMIB 3N27A 1VIBA 4B3MO 2GHYA 4O4HB 3VOUA 3HKDA 1OJHA 1N34O 1YSCA 2IJKA 5IE9A 3L70H 4LH7A 2EIKC 5DEDA 3ZCCA 1J95A 4R8CA 2R9RB 2GTSA 3ABMB 2QE7G 2UUBB 4I0XA 5IJ0B 4IYIA 3ASNC 1W59A 3BA9A 4DRXA 3Q4HA 3RBZA 1COWG 4RQEA 3AK2A 4JZGA 1P49A 4DR3O 1KQSU 1FYJA 4TQDA 3K9SA 1AROP 1K9MW 2E75B 2ITCC 3D8CA 4KHPB 1VQ6V 4FZ1A 2CH7B 4NB5A 4FZ0A 3J81N 1CPYA 1LUWA 2HG5C 4DK0A 1Z5WA 2N04A 4DV1O 1BMFG 3K57A 2AW9A 1U96A 2A7WA 3P3PA 4WBNA 4X20A 2EJRA 3CD6V 3JYCA 3AG3B 1D2DA 2ZR3A 2VQFO 1R3IC 2WAMA 4TSFG 2UUCO 4PDVA 2LGWA 2XT9A 4AQYB 4B7KA 2RNBA 3NR7A 4IL6Z 4RUEA 1VQPV 1NKDA 2CDYA 4DV4B 2Q5ZA 5JQGB 3CB2A 1FXKA 1WN7A 2BOCC 2PYJA 3OW2U 3JAWB 3BHPA 4UVAA 3DGEA 1JMKC 3ZS8C 4X1YB 3OTOB 4LF6B 2R72A 4QE7A 4J7KA 2EIMC 4YIOA 3FAVA 2BCCH 5L3CA 1JJ2U 5J2TB 3MD0A 4ZIBA 2K9PA 5B1AC 4DR6O 2Y4UA 1M93A 3IAYA 1AILA 3HR0A 1JOYA 3MHSC 2PZSA 3BCCH 5LOVB 1MA1A 1IXMA 2JJ1G 4RAIA 4P30A 4YJ3B 1BQZA 1NS1A 3F5TA 4HZ3A 3T1HO 5IDJA 2ZE6A 4EFBA 4JI0B 5JH7A 2BTQB 3O9OA 3CCQV 4G28B 1OCZC 4D7SA 5K1XA 1TAEA 1MG1A 1Q81W 2AZ2A 3ZEDA 4H44B 1I0HA 1JFFB 3HKBB 2QKCA 1MZEA 3E8BA 3JASA 5LYJB 3S3WA 4H37A 4MVOA 5BMVB 2Z5UA 5LMNB 4JYAB 1Q82W 4L8JA 1TUBB 5EYPA 2WLMA 4UCRA 1SQQH 1K4DC 1GMGA 4H13B 3VQYA 3VQWA 4LFCO 5LGNA 3JATA 2UXDO 4YJ2A 2QWQB 2EIJC 3ABMC 3H1KH 3EXAA 5B66Z 1WB8A 3E22B 2Z0AA 4OX9O 4OPHA 4GLXA 2ZXWB 2GBOA 4U3JA 3E86A 3OD4A 1OV9A 2IBZH 2ZM6O 1NVPB 3H01A 3APOA 2OTJV 5KA6A 3ETGA 4WCEV 2Q7EA 5JJJB 1WNSA 2XAJA 3JAKB 2EILC 2ZE5A 2QKAA 1YJNV 3L9DA 1GM7A 1J5EO 4UCVA 1RPOA 2W6JG 4X89A 1KU9A 3E8HA 4LF9O 5IYDO 1AJQA 4IIJA 3WB1A 2R9AA 3E8GA 2XNDG 4HYOA 1RM1C 3EHBB 4B3TB 3SJBC 2Y0PA 4QGPA 1IBKO 1R6KA 3CCJV 1R3LC 4PD4F 4I5SA 3TGUH 3CJHB 1K8AW 4MSWC 4X66O 1DF5A 1XNRB 5L3BA 2AHYA 2DW4A 2Q9LA 5CA0B 1NJIW 1BZKA 4O4HA 2DJVA 1OCRB 1IBLB 1R1BA 2YICA 1ZTEA 3ASOB 2HEPA 1SZTA 3DC6A 2FMLA 4GYCB 4NTYA 3SPJA 2NNUA 1NQTA 2QSAA 4PJ0Z 1SRYA 3AG4B 1DLBA 1FFXB 3B4SA 2M7WA 4HAMA 5IJ0A 5KHIA 1IDSA 4F6RB 2WSSG 5ITZB 3TK1A 3JALB 1IVSA 4LF5O 1I94O 3FB5C 2AZ0A 1I7FA 3OEHG 3BRCA 5IYZB 1YJWV 2P4KA 1O9HA 4DV0O 3CRMA 3UCSC 3K79A 3APQA 3T4ZA 1PL0A 2D3OW 2OYQA 2Q7HA 2N05A 1MSWD 4JI7B 1WAZA 2CH7A 5LHIA 3CCLV 3L75H 4X8AA 4NR1A 5FPOA 4GKJO 2B1GA 2V4DA 1LNQA 5H6RA 2VWKA 4MVRA 1ZUQA 1P84F 4OXSA 3SYOA 2QWRB 3OM3B 1N33B 3JARB 4Q6GA 1H2MA 5DM6V 2CTQA 5KAIZ 2F4VO 4I9WA 5EZYB 4X64B 3A0HZ 3D3IA 4Z1MG 1VF6C 2WLJA 4I7ZB 5JQGA 3B8NA 2JS5A 3STZC 4DR5O 2ZR2A 3OTFA 3I5DA 4MVQA 1E79G 3AEIA 3WFVA 1NH2D 1B3QA 3FFQA 3JAMN 5B3SB 4YHHO 1XEQA 2ITDC 4X1KB 3CMAV 2QTOA 1R3JC 4CBCA 4X1YA 4K0KB 4TV9B 1SF9A 3B09A 3ETDA 4CC5A 3RYIA 1VARA 4LFBB 3SPCA 3J80N 1H38A 3ZJZA 2VS0A 5J2TA 2RQ6A 2UUAO 3HKEB 3T1YB 1JJOA 2IM9A 1K7DA 1Y74B 4BIUA 1YEWA 2RDCA 5EBLC 2HVJC 2X6AA 5CMUA 2CTPA 4JI4O 1UJWB 3STLC 5LOVA 2UXBB 4YJ3A 1N32O 2Q73A 2XAQA 5LMUB 4FLTA 4LF4B 3ZMZA 4DUYO 4GX0A 2KQXA 2BTQA 2LJ2A 1W0KG 2IU3A 4UCUA 1AR4A 5CB4B 3THOA 5GONB 4J7JA 5AG2A 1VF6A 1JFFA 4E2LA 1OCRC 3HKBA 5KMGB 3CC7V 4NTXA 2JEXA 2DQ0A 1BHAA 5LYJA 3K08A 3JCZA 2UUBO 4UB8Z 5IJ9B 5BMVA 2YI8A 2ZQMA 2QWPB 1TUBA 1H2NA 4YXWG 4EB6B 2Q8VA 4U7OA 1FXVA 3AG4C 2JEUA 5BR8B 3ZBHA 1KD1W 3T2MA 4CS4A 5CBHA 3E22A 1Y76B 4JTAB 1CEZA 3QF7A 3UT5B 4MW8A 2K1EA 3B2EE 5KUMA 3CC2V 1H2KA 5LL6Y 1YDXA 5KHKA 4B08A 1EZJA 4KHPO 2ODMA 1W0JG 3JAKA 1W2BU 4ABMA 1MMMA 1L1FA 1G1XB 3CRAA 4OGQB 4WFGA 2C2AA 2M6YA 3G71V 4NYKA 3SYCA 3HB3B 1Q5OA 2AGAA 3RYHB 3BVOA 4I50B 2XOKG 2PTMA 4DR1B 1RFYA 3G80A 1AI5A 1Q3EA 2GDSA 1YZBA 3KCYA 5CA0A 1S77D 3SPHA 4X62O 3K06A 3KZIZ 4G27B 4BIZA 3G4SV 4FLWA 5B1BC 5CA1B 3CYOA 1BQ0A 2X6BA 3TXQA 4LC1A 3QG5A 3OFNG 4FLZA 4UVBA 3IC7A 2ZD9A 1HNXB 4DUZO 3OAAG 2IJJA 1FFXA 1MSDA 3I56V 4LF6O 4F6RA 1LR1A 2FKXA 2CGOA 5IWAB 5ITZA 4HBNA 1FJGB 3E35A 3JALA 1M5IA 3P30A 1XHZA 3K5NA 1SQXH 4X9QA 2E76B 4JZ2A 4RO2A 4XDLA 3QNEA 4B3RB 3MDSA 5IYZA 1M1KW 3ZMTA 1ZL8B 4QJFB 1S5HC 1DK1A 4WFEA 1SKVA 4BAYA 4UVCA 3H1JH 5H9CA 3DSQA 1AI4A 3H1HH 1DF4A 2CTRA 4JI0O 4G2KA 2EIJB 3ETQA 1I08A 4P9PA 1JQ0A 4JI2B 5EC2C 4JAUA 2Q0OC 3JARA 1WP7A 3OGCC 4PA4A 1XMQB 1TA8A 4B3SB 4CS2A 3OEEG 2EILB 4GZRB 2ZCEA 3W7SA 2JGDB 3KKYA 1VQ7V 4JYAO 4DV2B 4MTFA 2YDEA 2UU9B 2DYSB 3TXSA 1RM1B 2F95B 1PV0A 2QWOB 1QR8A 4H33A 2CE4A 5C93A 4RUFA 1AR1B 3FKSG 4BWAA 4KL1A 3C90A 3RFRA 2JDIG 2O57A 3JD1A 4X1KA 4DV7B 2Z3YA 1DGSA 3L73H 4TV9A 2Y4TA 5H5NA 1YCIA 3ABUA 2HHHB 1NR7A 1H2GA 3LUTB 1I5YA 3G67A 1QQCA 2HFEC 2H94A 3HKEA 3CCEV 1OCCB 1Y74A 4P2ZA 5FPRA 1K5QA 1AR5A 1H8EG 1BCCH 4NXNB 4L87A 2YIBA 3QO8A 3GWOA 5LP6C 3E89A 1SA0B 1WPXA 4GCZA 4WFHA 1IBMB 3ZHVA 5KHGA 4D6TH 4DO2A 4LNUB 4DW1A 1XNRO 2ETNA 3SPIA 2FL4A 5B1NA 2E5LB 3FYEB 1IBLO 2QJ1A 4UV9A 3H9VA 5IY5B 3AG1B 3CP1A 4ZI7B 4MS2A 5CB4A 1Q86W 5GONA 1PNMA 4NXMB 5KMGA 3OT7A 1SQGA 3CMEV 1URFA 1SERA 1FFTB 1K34A 4JYYA 2CGNA 3ZHRA 5IJ9A 1EN4A 2EZPA 4H0LB 4EB6A 5H2FZ 4YY3B 5EIBD 5CN0A 3JSLA 3CC4V 1PM9A 1JCHA 4PA7A 1HR0B 3IC9A 1Y76A 4FJCC 4DV5B 1N34B 1EM1A 3MAQA 4IGGA 3ZRSA 3UT5A 4A5UB 4PA6A 4JI1B 2DQ3A 1X59A 2OIGA 3PN1A 2YXYA 3FB6C 4GKKO 1NBMG 3ZRVA 3SDLA 1FXHA 4J11A 5IT9N 2NN4A 1R73A 4LR3A 1GN2A 2A0LA 4EKWA 3CRQA 3K5MA 3CRRA 4TV8B 2DWEC 3AK1A 1QU7A 1V54C 4LF8O 2B9ZA 3RYHA 2ATKC 1H8HG 4I50A 1MNGA 1VQMV 4TWKA 1ZAUA 1GK9A 1M57B 1Y6XA 4DR3B 4QPJA 2XUMA 1VQ9V 5FNVB 1XREA 1SQVH 2JS3A 1GAXA 3ML0A 2N74A 4JI3B 3M8AA 2Y69B 5CA1A 4QIWF 2HLDG 2ZINA 1KKDA 2LFSA 3LDDA 1TGOA 1WB7A 1YIJV 1PNKA 3TJTA 2WLIB 2YSUB 3A8TA 4J41A 2DYSC 5D5QA 4MT8A 1FAFA 1SETA 3ZIAG 4NKGB 2BSKB 5GW7A 2VQFB 1VEWA 2CUGA 1YF2A 1Y66A 3T1YO 3CS5A 1U97A 1B04A 1XNQB 1XI1A 1K5SA 3TETA 3MHHC 3GB7C 3R65A 2R70A 3IFXA 1BS3A 3NXSA 2UXBO 1ZL8A 1HWYA 1OCCC 1Z2GA 5LXTB 4FLVA 5LMUO 2ZE8A 4LF4O 1YJ9V 1YTFD 1T5EA 2KB1A 2BTOA 1NT2B 3CCSV 5LHHA 2WLNA 4JTCB 3FYIB 4AI8A 4ASUG 1GN6A 1AP5A 3A0BZ 4XDKA 1CP9A 5BZBA 1VMGA 1XOUA 1YVWA 1WJZA 2DOSA 5IY5C 3AG1C 4R6ZA 4LFAB 1NZ6A 2VQEB 5FLXN 5GTIZ 4Z2WA 2QWNB 2W6IG 2JGDA 1VQOV 4JAVA 2DMXA 1D5NA 4JI5B 2IJIA 2Q6AA 4I55B 5BR8O 3K58A 2DWDC 1BHBA 3ZN0A 1QVGU 4PHZA 2MK3A 2W0FC 3DTUB 2RN9A 5JWPA 5KAFZ 2PYLA 1PP9H 5B5EZ 3W7TA 1JPXA 3BY6A 2OCCB 4DV3O 2Q68A 3G6BA 4TUYB 2UXCO 3OR6C 4X1IB 3KCXA 2A79B 4MVMA 5B1BB 1M90W 4WF9V 1SZXA 3OGIB 1K3EA 4DR4O 1K33A 2EINC 3IGAC 2YIBD 1Y4MA 2RJZA 2ZNJA 2UXDB 2H3OA 4J9ZB 2Q7GA 4QNHB 1SA0A 1Y67A 3JD2A 4JI6B 3JAWA 3ZMVA 5JJNB 4LNUA 3DXRB 3OE7G 2Q4PA 4DR2B 4DW0A 4TOIA 1B6QA 3ZN1A 4FM0A 1N36O 4ZI7A 1M57C 4CZZA 3AG7A 1F4NA 1J5EB 1NR1A 4FLXA 3P32A 1AI7A 5IYBO 4FFBB 1HNXO 5EIBC 2Y69C 1Q6UA 4AHCA 3F7VC 4IHJB 1VQ4V 1X4TA 2OT5A 4LCUC 1F7YA 2BOBC 4JV5B 1VP7A 2LGQA 3BA8A 1FJGO 1IZ3A 1VF7A 1XL4A 3HPLC 3K03A 4LF7B 2PY5A 3ZHQA 1XMOB 2PF4E 4QPKA 3RYCB 4MVSA 1WPBA 1FXKB 1PKXA 2JIZG 1G8MA 4YIPA 2ILMA 2L6LA 1QLEB 4K3AA 4WFBV 4K8XA 1NH2B 1VQNV 5HFLA 4I9QA 4UCOA 1QNMA 2P22C 3U11A 4DR7B 1SS3A 2DYRB 3FAVB 4TV8A 3CCUV 3BPZA 1I5XA 2RMKB 1PNLA 1VQ5V 4LBEC 3B77A 3SYAA 1I94B 1XMQO 4B3SO 5CA3A 3RGBA 4O2AB 5FNVA 3ZRXA 4BW9A 4JI8B 2NLJC 4DV0B 1NTKH 1KC8W 4EFEA 1XDCA 1G4YB 2UXXA 1XBLA 3CCVV 2VWJA 4J9YB 5CBFA 4WFFA 1H2SB 4GT1A 2F43G 5LP6B 4GKJB 3P3NA 2IH3C 3BEHA 4FM2A 3ABTA 1IX9A 4ICGA 4DV7O 1GO3F 5CBGA 5BY1A 1D5AA 1HNWB 2LW7A 1OCOC 1R6NA 4MTGA 4ZHQB 3SR2C 3CCRV 2HHHO 2F93B 3CJHA 3KG2A 2E74B 2JK5C 2OCCC 2L35A 2IU0A 2JGUA 3BAAA 1JVMA 4AQYO 1HNZB 4NXNO 2F23A 2HJFC 1F4MA 5GTHZ 2P7TC 4GX1A 4DV4O 4ZOLB 4DR5B 1S76D 4XDJA 3IJ4A 1GH6A 4P9OA 1IBMO 2G38A 3SJQC 4MTXA 5LXTA 2HVKC 1V55B 3K3WA 2GSMB 4RQFA 2W0XA 1TVKB 2IJHA 3L71H 2ADQB 3OTOO 4PDLA 5KA5A 4DYLA 5LGTA 3OMAB 4JF3A 4CH3A 1MOFA 4FMTA 3HKCB 2KG7B 3D36C 4HNAB 4NXMO 4ZBMA 3UQ8A 4FIPC 1E1QG 2JRIA 4CH5A 4JI4B 2PI5A 2V1DA 4FM1A 1ENVA 3D3QA 4UUJC 2LFRA 5LBQA 5L3FA 2DN9A 3B40A 5L3DA 5JJEB 1N32B 1XILA 3QO5A 1KP3A 4I55A 1LUVA 1M56C 4DUYB 1FD9A 1AI6A 3SJAC 1V54B 1HR0O 1Q6IA 3A0RA 2P6JA 4DV5O 4FK5C 4O4LB 4JI1O 2OIEA 4X65B 4LWSB 1KYOF 4TUYA 4J80A 4CC6A 1YITV 4MVZA 5BXZA 3AG2C 4X1IA 3RVYA 1EN5A 3N2GB 1GM8A 3TCUA 1FXKC 5EZYA 3UO2A 1M9NA 3K04A 2ARHA 1P7GA 2QTSA 3C3TA 2X6CA 1H2LA 5LGUA 2QM7A 5JCOC 1QLEC 5LMNO 3FB8C 2YUAA 2YC0A 3LDCA 3LSQA 4TT3G 3BABA
chains in the Genus database with same CATH topology
1HNZO 2DOSA 4LF6O 1F7YA 4LF7O 4LF8O 4AQYO 3J7AU 5FLXN 4NXNO 1J5EO 1FJGO 2FKXA 1A32A 4DV4O 4LF9O 4JI5O 1XMOO 3RT3C 2UUBO 2F4VO 1IBMO 4JI7O 5BR8O 4JI3O 4GKJO 2ZKOA 4DR6O 3R66A 1IBKO 2N74A 1AILA 1XNRO 3M8AA 5A2QN 3OTOO 4X66O 5IWAO 1DK1A 1N33O 4DR5O 4DV3O 1IBLO 4DR7O 2DJVA 1NS1A 2UXCO 4DR3O 3F5TA 1R1BA 5LL6Y 4JI0O 4X64O 3JAMN 3T1HO 1FYJA 4NXMO 4DV6O 4YHHO 4B3TO 1XEQA 4KHPO 1FKAO 2JRIA 4B3RO 1G1XB 4DR4O 3J81N 1XMQO 2E5LO 3J80N 4B3SO 3T1YO 1XNQO 4JI6O 4JI8O 4DV1O 2UUAO 2AGAA 1HR0O 1AB3A 4DV5O 4JI2O 4X65O 4JYAO 4K0KO 4DR2O 4JI4O 4JI1O 4LF5O 2UXBO 1D2DA 1YZBA 2VQFO 1I94O 4A5UB 5LMUO 4LFBO 1N36O 4LF4O 1KUQA 4X62O 1R6TA 1X59A 2UUCO 1N32O 4LFCO 2UXDO 5BXZA 4GKKO 4DUYO 1HNWO 4YY3O 4DV7O 2Z0AA 5BY1A 4OX9O 3SDLA 4OPHA 4DV0O 5IT9N 4OPAA 4B3MO 2LW7A 2HHHO 4DR1O 4DV2O 1HNXO 5H5NA 2ZM6O 2UU9O 1N34O 5LMNO 4DUZO 4LFAO 4JV5O 2VQEO 3O65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ O;  2DOS A;  4LF6 O;  1F7Y A;  4LF7 O;  4LF8 O;  4AQY O;  3J7A U;  5FLX N;  4NXN O;  1J5E O;  1FJG O;  2FKX A;  1A32 A;  4DV4 O;  4LF9 O;  4JI5 O;  1XMO O;  3RT3 C;  2UUB O;  2F4V O;  1IBM O;  4JI7 O;  5BR8 O;  4JI3 O;  4GKJ O;  2ZKO A;  4DR6 O;  3R66 A;  1IBK O;  2N74 A;  1AIL A;  1XNR O;  3M8A A;  5A2Q N;  3OTO O;  4X66 O;  5IWA O;  1DK1 A;  1N33 O;  4DR5 O;  4DV3 O;  1IBL O;  4DR7 O;  2DJV A;  1NS1 A;  2UXC O;  4DR3 O;  3F5T A;  1R1B A;  5LL6 Y;  4JI0 O;  4X64 O;  3JAM N;  3T1H O;  1FYJ A;  4NXM O;  4DV6 O;  4YHH O;  4B3T O;  1XEQ A;  4KHP O;  1FKA O;  2JRI A;  4B3R O;  1G1X B;  4DR4 O;  3J81 N;  1XMQ O;  2E5L O;  3J80 N;  4B3S O;  3T1Y O;  1XNQ O;  4JI6 O;  4JI8 O;  4DV1 O;  2UUA O;  2AGA A;  1HR0 O;  1AB3 A;  4DV5 O;  4JI2 O;  4X65 O;  4JYA O;  4K0K O;  4DR2 O;  4JI4 O;  4JI1 O;  4LF5 O;  2UXB O;  1D2D A;  1YZB A;  2VQF O;  1I94 O;  4A5U B;  5LMU O;  4LFB O;  1N36 O;  4LF4 O;  1KUQ A;  4X62 O;  1R6T A;  1X59 A;  2UUC O;  1N32 O;  4LFC O;  2UXD O;  5BXZ A;  4GKK O;  4DUY O;  1HNW O;  4YY3 O;  4DV7 O;  2Z0A A;  5BY1 A;  4OX9 O;  3SDL A;  4OPH A;  4DV0 O;  5IT9 N;  4OPA A;  4B3M O;  2LW7 A;  2HHH O;  4DR1 O;  4DV2 O;  1HNX O;  5H5N A;  2ZM6 O;  2UU9 O;  1N34 O;  5LMN O;  4DUZ O;  4LFA O;  4JV5 O;  2VQE O;  3O65 A; 
#chains in the Genus database with same CATH topology
 1GN3 A;  1BGY H;  1G6U A;  4PA9 A;  2DYR C;  3JD3 A;  4PDR A;  4GUN A;  1R3K C;  1SQF A;  2FB5 A;  2CK3 G;  1THZ A;  3DXR A;  3F5W C;  2YID A;  3LSS A;  1JR9 A;  3D36 A;  3W7W A;  4E4E A;  3UO3 A;  1ZX3 A;  4JI3 O;  1EZV H;  1RSO B;  3CSX A;  4FLY A;  2YS8 A;  3JSN A;  3L74 H;  1NU1 H;  2HP8 A;  1S3J A;  3A2F A;  1XUQ A;  4FFB A;  3ZHU A;  2HJD A;  4N21 A;  3X2Q B;  3B8M A;  4IHJ A;  4X88 A;  1S0V A;  2IW5 A;  5KLV H;  1EN6 A;  2A9H A;  3SJC C;  4B3T O;  3SYP A;  2CAZ C;  3ICX A;  1FKA O;  4DV6 B;  4MTO A;  3ZRW B;  3S3X A;  2X7R B;  3U10 A;  1NTM H;  4K35 A;  3ABK B;  1M4U A;  5H6Q A;  4X62 B;  4LP8 A;  1XNQ O;  5C8Y B;  3QTC A;  4NVP A;  3RYC A;  1EFR G;  4U7N A;  5E79 Z;  1AB3 A;  1RPR A;  5JCO A;  4XBF A;  2QEX V;  2CTW A;  4DUZ B;  3LNM B;  3PJS K;  3WB0 A;  4BIO A;  1R6T A;  4ZKI A;  2GTA A;  3W7U A;  3QVN A;  3RYI B;  3CEI A;  2EJ7 A;  1S5L Z;  1V55 C;  3UM7 A;  1P4R A;  3EVK A;  4JPR A;  1Q7Y W;  2JJ2 G;  4B3M B;  3AK3 A;  1OZ0 A;  1N0N A;  5LHG A;  1US6 A;  4LFA O;  2VQE O;  5EBW C;  1FPO A;  4O2A A;  1NVP D;  4J42 A;  1BL8 A;  3ABL C;  4JI5 O;  1ZWI C;  2EIN B;  1SC5 B;  3RYF B;  2YEV B;  4JI7 O;  5KX5 B;  2KKW A;  3LDE A;  5LP6 A;  2YXH A;  2QDO A;  3CX5 F;  1MZF A;  4WFA V;  5LA6 B;  3CHX A;  3WB2 A;  1HP8 A;  4MW3 A;  3SGI A;  1K92 A;  3E8F A;  5FL7 G;  2WLL B;  5B1O A;  2LQT A;  4TQF A;  3BFR A;  1N33 O;  4ZHQ A;  3UKM A;  1GRJ A;  1GN4 A;  4PI2 A;  1RP3 B;  1KB9 F;  1QHT A;  4JAA A;  4CH6 A;  4I4T B;  4X64 O;  2LO1 A;  1KMI Z;  3VQX A;  2LP7 A;  3ZMS A;  2B5U A;  4UXN A;  4KXR A;  1ORQ C;  2HKO A;  4ZOL A;  1XL6 A;  5D5P A;  4JAS A;  1SQP H;  4JI6 O;  3EFF K;  1Q8I A;  4PEL A;  1OHH G;  4DV1 B;  4O4J B;  3N2K B;  5DEC A;  2GUZ B;  2QA4 V;  2ZT9 B;  1TVK A;  5KUK A;  4NTW A;  4K0K O;  2R9I A;  5IYC O;  4DR2 O;  4Z1V A;  3K0D A;  4U3F H;  4RWU A;  2ZE7 A;  4PDM A;  3WG7 B;  5JVD B;  1Q43 A;  5J2U B;  1WA8 B;  4LFB O;  2YIA A;  1KUQ A;  2Q0A A;  4UFZ A;  1IUR A;  3HKC A;  2KG7 A;  2UUC B;  4HNA A;  4FFK A;  1AP6 A;  2A3Q A;  1JX9 A;  1HDJ A;  3K9A A;  3K5L A;  3E83 A;  5TIS Z;  2XAG A;  2QM8 A;  2WLH A;  3WU2 Z;  4JV5 O;  2XTA A;  1QBZ A;  1CXZ B;  1L8D A;  4GX5 A;  3OR7 C;  3X2Q C;  3CPW U;  4LF7 O;  3J7A U;  1N0J A;  1K4C C;  2AXT Z;  1AVM A;  3FD9 A;  1O9G A;  1PL4 A;  2ZIO A;  1GTO A;  1F51 A;  1XMO O;  2ZIM A;  3RT3 C;  2EZO A;  4O4L A;  3AG3 C;  3ZHT A;  4EEQ A;  1QCE A;  4CS3 A;  2WA3 A;  2F66 C;  4LWS A;  2Y0I A;  2IH1 C;  3ABK C;  2WLK A;  1F23 A;  3GWK C;  4UB6 Z;  1L0L H;  4DR6 B;  3N2G A;  4KP4 A;  1PPJ H;  3FX7 A;  4O2B B;  2AHZ A;  4O4I B;  3FB7 C;  3CRC A;  5HFM A;  4DR7 O;  4FPP A;  2E3C A;  2FYU H;  2OTL V;  5L3E A;  4BR6 A;  3T1C A;  4PV1 B;  2YXL A;  3T1H B;  2QR4 A;  3RWR D;  2A06 H;  1OCO B;  2QM4 A;  3HKD B;  2P5O A;  2VRZ A;  1XQ8 A;  4F4L A;  1GKF A;  4W4K A;  1VQ8 V;  4KUM A;  4JI8 O;  4GKK B;  2BE3 A;  1WLE A;  3ZHS A;  4AIL C;  1HW7 A;  1RSO A;  2P4V A;  1BT8 A;  5F2V O;  2Y48 A;  2Q69 A;  4QE9 A;  1XHX A;  1QR9 A;  4LH6 A;  1TUE B;  1K97 A;  2B1I A;  2D2C B;  4I0X B;  1YTF B;  1N4C A;  2ZDI C;  2X0L A;  2MW2 B;  4DRX B;  3Q4H B;  3H1I H;  4LF8 B;  1HNW O;  4LFC B;  3K5O A;  3G6E V;  4MVU A;  1UFI A;  4JGS A;  2PI4 A;  4OX9 B;  4K8Z A;  4DR1 O;  3LSU A;  3ZRW A;  2ZM6 B;  4IT5 A;  3K59 A;  2XAH A;  1GM9 A;  5C8Y A;  1HNZ O;  1YI2 V;  3JCU Z;  3OUF A;  2OCH A;  3K0G A;  3JD0 A;  4LF9 B;  1UPG A;  1Q90 D;  2LW1 A;  1PD3 A;  2XAF A;  3RN4 A;  1BE3 H;  1M56 B;  1NTZ H;  1ZSP A;  3ZX6 A;  2ADP A;  2ZKO A;  1Z5V A;  3LNN A;  3R66 A;  3VBB A;  4UCS A;  3ETE A;  4WBN B;  4GX2 A;  1SQB H;  4X20 B;  1IBK B;  4J10 A;  2FTK A;  2EUL A;  5A2Q N;  4FVM A;  1K73 W;  1DTO A;  2ZXW C;  5IWA O;  1MAB G;  1KP2 A;  4BW5 A;  3W7X A;  5EC1 C;  2EIK B;  4X66 B;  5E1A C;  1B06 A;  1ZLZ A;  2DE0 X;  3AG2 B;  3WG7 C;  3E2E A;  1SES A;  2UXN A;  3SYQ A;  5EBM C;  1JA8 A;  4JTD B;  4B7E A;  3OMN B;  4B3R O;  3M99 B;  4DXW A;  2ZNI A;  3ASN B;  1BSM A;  2ZDI A;  2GV9 A;  4N23 A;  3RYF A;  3CE2 A;  2YEV A;  3U0Z A;  5KX5 A;  1E1R G;  1KKC A;  3I55 V;  2H8P C;  2Q67 A;  5LA6 A;  1IXB A;  4FLU A;  3CWB H;  4X65 O;  4JI2 O;  4R50 A;  2P06 A;  1L0N H;  2PUS A;  5EK0 A;  3T4D A;  2WLL A;  4F6E A;  1YHQ V;  4LF5 B;  4D7T A;  3ASO C;  4I4T A;  5L3G A;  4UCT A;  1FS0 G;  3VQV A;  1KEC A;  1QLN A;  4OPA A;  1N8R W;  4DV2 O;  2UU9 O;  1S72 V;  2EBO A;  3QO7 A;  1A32 A;  3O65 A;  2YI9 A;  4PI0 A;  2XHB A;  5JH7 B;  1ROP A;  4UV8 A;  4O4J A;  3RW0 A;  2WLI A;  3N2K A;  2GUZ A;  3SPG A;  4PA3 A;  4J7Z A;  4DV3 B;  4JYC A;  4DK1 A;  2UXC B;  2QKS A;  5JVD A;  2OWO A;  5KHJ A;  1WA8 A;  2BSK A;  5J2U A;  2F4V B;  5A9G A;  1S5J A;  3JAS B;  1QVF U;  1AJN A;  1VQL V;  3GVM A;  1V9P A;  3DC5 A;  4JYB A;  1P7B A;  2NR5 A;  2PGG A;  4DR4 B;  3RVZ A;  5EYP B;  3H1L H;  5DN6 G;  1KBH A;  5J9P C;  3CXH F;  2P67 A;  2F1M A;  3JAT B;  4W4L A;  2WWW A;  4YJ2 B;  2QGN A;  4DV6 O;  2EIM B;  2WA4 A;  2WPD G;  1AJP A;  2P90 A;  1VQK V;  4YHH B;  4IYH A;  4U3J B;  3ZMU A;  2RCV A;  2KSD A;  3OUS A;  5B1A B;  3F7Y C;  1WP8 A;  2E5L O;  1NI8 A;  2XAS A;  1N36 B;  3JD4 A;  4C7U A;  1EBO A;  2V7Q G;  3M7M X;  4KFM A;  3CCM V;  3CXC U;  2UUA B;  1YXB A;  2EX3 A;  4IIJ B;  4CH4 A;  3ABL B;  4R7C A;  3L72 H;  4O2B A;  4O4I A;  4Q20 A;  1VF5 B;  1Q6H A;  2HR3 A;  2JVD A;  5KHH A;  5B3S C;  3C3S A;  4YY3 O;  1OCZ B;  5K1P A;  3OMI B;  3N27 A;  1VIB A;  4B3M O;  2GHY A;  4O4H B;  3VOU A;  3HKD A;  1OJH A;  1N34 O;  1YSC A;  2IJK A;  5IE9 A;  3L70 H;  4LH7 A;  2EIK C;  5DED A;  3ZCC A;  1J95 A;  4R8C A;  2R9R B;  2GTS A;  3ABM B;  2QE7 G;  2UUB B;  4I0X A;  5IJ0 B;  4IYI A;  3ASN C;  1W59 A;  3BA9 A;  4DRX A;  3Q4H A;  3RBZ A;  1COW G;  4RQE A;  3AK2 A;  4JZG A;  1P49 A;  4DR3 O;  1KQS U;  1FYJ A;  4TQD A;  3K9S A;  1ARO P;  1K9M W;  2E75 B;  2ITC C;  3D8C A;  4KHP B;  1VQ6 V;  4FZ1 A;  2CH7 B;  4NB5 A;  4FZ0 A;  3J81 N;  1CPY A;  1LUW A;  2HG5 C;  4DK0 A;  1Z5W A;  2N04 A;  4DV1 O;  1BMF G;  3K57 A;  2AW9 A;  1U96 A;  2A7W A;  3P3P A;  4WBN A;  4X20 A;  2EJR A;  3CD6 V;  3JYC A;  3AG3 B;  1D2D A;  2ZR3 A;  2VQF O;  1R3I C;  2WAM A;  4TSF G;  2UUC O;  4PDV A;  2LGW A;  2XT9 A;  4AQY B;  4B7K A;  2RNB A;  3NR7 A;  4IL6 Z;  4RUE A;  1VQP V;  1NKD A;  2CDY A;  4DV4 B;  2Q5Z A;  5JQG B;  3CB2 A;  1FXK A;  1WN7 A;  2BOC C;  2PYJ A;  3OW2 U;  3JAW B;  3BHP A;  4UVA A;  3DGE A;  1JMK C;  3ZS8 C;  4X1Y B;  3OTO B;  4LF6 B;  2R72 A;  4QE7 A;  4J7K A;  2EIM C;  4YIO A;  3FAV A;  2BCC H;  5L3C A;  1JJ2 U;  5J2T B;  3MD0 A;  4ZIB A;  2K9P A;  5B1A C;  4DR6 O;  2Y4U A;  1M93 A;  3IAY A;  1AIL A;  3HR0 A;  1JOY A;  3MHS C;  2PZS A;  3BCC H;  5LOV B;  1MA1 A;  1IXM A;  2JJ1 G;  4RAI A;  4P30 A;  4YJ3 B;  1BQZ A;  1NS1 A;  3F5T A;  4HZ3 A;  3T1H O;  5IDJ A;  2ZE6 A;  4EFB A;  4JI0 B;  5JH7 A;  2BTQ B;  3O9O A;  3CCQ V;  4G28 B;  1OCZ C;  4D7S A;  5K1X A;  1TAE A;  1MG1 A;  1Q81 W;  2AZ2 A;  3ZED A;  4H44 B;  1I0H A;  1JFF B;  3HKB B;  2QKC A;  1MZE A;  3E8B A;  3JAS A;  5LYJ B;  3S3W A;  4H37 A;  4MVO A;  5BMV B;  2Z5U A;  5LMN B;  4JYA B;  1Q82 W;  4L8J A;  1TUB B;  5EYP A;  2WLM A;  4UCR A;  1SQQ H;  1K4D C;  1GMG A;  4H13 B;  3VQY A;  3VQW A;  4LFC O;  5LGN A;  3JAT A;  2UXD O;  4YJ2 A;  2QWQ B;  2EIJ C;  3ABM C;  3H1K H;  3EXA A;  5B66 Z;  1WB8 A;  3E22 B;  2Z0A A;  4OX9 O;  4OPH A;  4GLX A;  2ZXW B;  2GBO A;  4U3J A;  3E86 A;  3OD4 A;  1OV9 A;  2IBZ H;  2ZM6 O;  1NVP B;  3H01 A;  3APO A;  2OTJ V;  5KA6 A;  3ETG A;  4WCE V;  2Q7E A;  5JJJ B;  1WNS A;  2XAJ A;  3JAK B;  2EIL C;  2ZE5 A;  2QKA A;  1YJN V;  3L9D A;  1GM7 A;  1J5E O;  4UCV A;  1RPO A;  2W6J G;  4X89 A;  1KU9 A;  3E8H A;  4LF9 O;  5IYD O;  1AJQ A;  4IIJ A;  3WB1 A;  2R9A A;  3E8G A;  2XND G;  4HYO A;  1RM1 C;  3EHB B;  4B3T B;  3SJB C;  2Y0P A;  4QGP A;  1IBK O;  1R6K A;  3CCJ V;  1R3L C;  4PD4 F;  4I5S A;  3TGU H;  3CJH B;  1K8A W;  4MSW C;  4X66 O;  1DF5 A;  1XNR B;  5L3B A;  2AHY A;  2DW4 A;  2Q9L A;  5CA0 B;  1NJI W;  1BZK A;  4O4H A;  2DJV A;  1OCR B;  1IBL B;  1R1B A;  2YIC A;  1ZTE A;  3ASO B;  2HEP A;  1SZT A;  3DC6 A;  2FML A;  4GYC B;  4NTY A;  3SPJ A;  2NNU A;  1NQT A;  2QSA A;  4PJ0 Z;  1SRY A;  3AG4 B;  1DLB A;  1FFX B;  3B4S A;  2M7W A;  4HAM A;  5IJ0 A;  5KHI A;  1IDS A;  4F6R B;  2WSS G;  5ITZ B;  3TK1 A;  3JAL B;  1IVS A;  4LF5 O;  1I94 O;  3FB5 C;  2AZ0 A;  1I7F A;  3OEH G;  3BRC A;  5IYZ B;  1YJW V;  2P4K A;  1O9H A;  4DV0 O;  3CRM A;  3UCS C;  3K79 A;  3APQ A;  3T4Z A;  1PL0 A;  2D3O W;  2OYQ A;  2Q7H A;  2N05 A;  1MSW D;  4JI7 B;  1WAZ A;  2CH7 A;  5LHI A;  3CCL V;  3L75 H;  4X8A A;  4NR1 A;  5FPO A;  4GKJ O;  2B1G A;  2V4D A;  1LNQ A;  5H6R A;  2VWK A;  4MVR A;  1ZUQ A;  1P84 F;  4OXS A;  3SYO A;  2QWR B;  3OM3 B;  1N33 B;  3JAR B;  4Q6G A;  1H2M A;  5DM6 V;  2CTQ A;  5KAI Z;  2F4V O;  4I9W A;  5EZY B;  4X64 B;  3A0H Z;  3D3I A;  4Z1M G;  1VF6 C;  2WLJ A;  4I7Z B;  5JQG A;  3B8N A;  2JS5 A;  3STZ C;  4DR5 O;  2ZR2 A;  3OTF A;  3I5D A;  4MVQ A;  1E79 G;  3AEI A;  3WFV A;  1NH2 D;  1B3Q A;  3FFQ A;  3JAM N;  5B3S B;  4YHH O;  1XEQ A;  2ITD C;  4X1K B;  3CMA V;  2QTO A;  1R3J C;  4CBC A;  4X1Y A;  4K0K B;  4TV9 B;  1SF9 A;  3B09 A;  3ETD A;  4CC5 A;  3RYI A;  1VAR A;  4LFB B;  3SPC A;  3J80 N;  1H38 A;  3ZJZ A;  2VS0 A;  5J2T A;  2RQ6 A;  2UUA O;  3HKE B;  3T1Y B;  1JJO A;  2IM9 A;  1K7D A;  1Y74 B;  4BIU A;  1YEW A;  2RDC A;  5EBL C;  2HVJ C;  2X6A A;  5CMU A;  2CTP A;  4JI4 O;  1UJW B;  3STL C;  5LOV A;  2UXB B;  4YJ3 A;  1N32 O;  2Q73 A;  2XAQ A;  5LMU B;  4FLT A;  4LF4 B;  3ZMZ A;  4DUY O;  4GX0 A;  2KQX A;  2BTQ A;  2LJ2 A;  1W0K G;  2IU3 A;  4UCU A;  1AR4 A;  5CB4 B;  3THO A;  5GON B;  4J7J A;  5AG2 A;  1VF6 A;  1JFF A;  4E2L A;  1OCR C;  3HKB A;  5KMG B;  3CC7 V;  4NTX A;  2JEX A;  2DQ0 A;  1BHA A;  5LYJ A;  3K08 A;  3JCZ A;  2UUB O;  4UB8 Z;  5IJ9 B;  5BMV A;  2YI8 A;  2ZQM A;  2QWP B;  1TUB A;  1H2N A;  4YXW G;  4EB6 B;  2Q8V A;  4U7O A;  1FXV A;  3AG4 C;  2JEU A;  5BR8 B;  3ZBH A;  1KD1 W;  3T2M A;  4CS4 A;  5CBH A;  3E22 A;  1Y76 B;  4JTA B;  1CEZ A;  3QF7 A;  3UT5 B;  4MW8 A;  2K1E A;  3B2E E;  5KUM A;  3CC2 V;  1H2K A;  5LL6 Y;  1YDX A;  5KHK A;  4B08 A;  1EZJ A;  4KHP O;  2ODM A;  1W0J G;  3JAK A;  1W2B U;  4ABM A;  1MMM A;  1L1F A;  1G1X B;  3CRA A;  4OGQ B;  4WFG A;  2C2A A;  2M6Y A;  3G71 V;  4NYK A;  3SYC A;  3HB3 B;  1Q5O A;  2AGA A;  3RYH B;  3BVO A;  4I50 B;  2XOK G;  2PTM A;  4DR1 B;  1RFY A;  3G80 A;  1AI5 A;  1Q3E A;  2GDS A;  1YZB A;  3KCY A;  5CA0 A;  1S77 D;  3SPH A;  4X62 O;  3K06 A;  3KZI Z;  4G27 B;  4BIZ A;  3G4S V;  4FLW A;  5B1B C;  5CA1 B;  3CYO A;  1BQ0 A;  2X6B A;  3TXQ A;  4LC1 A;  3QG5 A;  3OFN G;  4FLZ A;  4UVB A;  3IC7 A;  2ZD9 A;  1HNX B;  4DUZ O;  3OAA G;  2IJJ A;  1FFX A;  1MSD A;  3I56 V;  4LF6 O;  4F6R A;  1LR1 A;  2FKX A;  2CGO A;  5IWA B;  5ITZ A;  4HBN A;  1FJG B;  3E35 A;  3JAL A;  1M5I A;  3P30 A;  1XHZ A;  3K5N A;  1SQX H;  4X9Q A;  2E76 B;  4JZ2 A;  4RO2 A;  4XDL A;  3QNE A;  4B3R B;  3MDS A;  5IYZ A;  1M1K W;  3ZMT A;  1ZL8 B;  4QJF B;  1S5H C;  1DK1 A;  4WFE A;  1SKV A;  4BAY A;  4UVC A;  3H1J H;  5H9C A;  3DSQ A;  1AI4 A;  3H1H H;  1DF4 A;  2CTR A;  4JI0 O;  4G2K A;  2EIJ B;  3ETQ A;  1I08 A;  4P9P A;  1JQ0 A;  4JI2 B;  5EC2 C;  4JAU A;  2Q0O C;  3JAR A;  1WP7 A;  3OGC C;  4PA4 A;  1XMQ B;  1TA8 A;  4B3S B;  4CS2 A;  3OEE G;  2EIL B;  4GZR B;  2ZCE A;  3W7S A;  2JGD B;  3KKY A;  1VQ7 V;  4JYA O;  4DV2 B;  4MTF A;  2YDE A;  2UU9 B;  2DYS B;  3TXS A;  1RM1 B;  2F95 B;  1PV0 A;  2QWO B;  1QR8 A;  4H33 A;  2CE4 A;  5C93 A;  4RUF A;  1AR1 B;  3FKS G;  4BWA A;  4KL1 A;  3C90 A;  3RFR A;  2JDI G;  2O57 A;  3JD1 A;  4X1K A;  4DV7 B;  2Z3Y A;  1DGS A;  3L73 H;  4TV9 A;  2Y4T A;  5H5N A;  1YCI A;  3ABU A;  2HHH B;  1NR7 A;  1H2G A;  3LUT B;  1I5Y A;  3G67 A;  1QQC A;  2HFE C;  2H94 A;  3HKE A;  3CCE V;  1OCC B;  1Y74 A;  4P2Z A;  5FPR A;  1K5Q A;  1AR5 A;  1H8E G;  1BCC H;  4NXN B;  4L87 A;  2YIB A;  3QO8 A;  3GWO A;  5LP6 C;  3E89 A;  1SA0 B;  1WPX A;  4GCZ A;  4WFH A;  1IBM B;  3ZHV A;  5KHG A;  4D6T H;  4DO2 A;  4LNU B;  4DW1 A;  1XNR O;  2ETN A;  3SPI A;  2FL4 A;  5B1N A;  2E5L B;  3FYE B;  1IBL O;  2QJ1 A;  4UV9 A;  3H9V A;  5IY5 B;  3AG1 B;  3CP1 A;  4ZI7 B;  4MS2 A;  5CB4 A;  1Q86 W;  5GON A;  1PNM A;  4NXM B;  5KMG A;  3OT7 A;  1SQG A;  3CME V;  1URF A;  1SER A;  1FFT B;  1K34 A;  4JYY A;  2CGN A;  3ZHR A;  5IJ9 A;  1EN4 A;  2EZP A;  4H0L B;  4EB6 A;  5H2F Z;  4YY3 B;  5EIB D;  5CN0 A;  3JSL A;  3CC4 V;  1PM9 A;  1JCH A;  4PA7 A;  1HR0 B;  3IC9 A;  1Y76 A;  4FJC C;  4DV5 B;  1N34 B;  1EM1 A;  3MAQ A;  4IGG A;  3ZRS A;  3UT5 A;  4A5U B;  4PA6 A;  4JI1 B;  2DQ3 A;  1X59 A;  2OIG A;  3PN1 A;  2YXY A;  3FB6 C;  4GKK O;  1NBM G;  3ZRV A;  3SDL A;  1FXH A;  4J11 A;  5IT9 N;  2NN4 A;  1R73 A;  4LR3 A;  1GN2 A;  2A0L A;  4EKW A;  3CRQ A;  3K5M A;  3CRR A;  4TV8 B;  2DWE C;  3AK1 A;  1QU7 A;  1V54 C;  4LF8 O;  2B9Z A;  3RYH A;  2ATK C;  1H8H G;  4I50 A;  1MNG A;  1VQM V;  4TWK A;  1ZAU A;  1GK9 A;  1M57 B;  1Y6X A;  4DR3 B;  4QPJ A;  2XUM A;  1VQ9 V;  5FNV B;  1XRE A;  1SQV H;  2JS3 A;  1GAX A;  3ML0 A;  2N74 A;  4JI3 B;  3M8A A;  2Y69 B;  5CA1 A;  4QIW F;  2HLD G;  2ZIN A;  1KKD A;  2LFS A;  3LDD A;  1TGO A;  1WB7 A;  1YIJ V;  1PNK A;  3TJT A;  2WLI B;  2YSU B;  3A8T A;  4J41 A;  2DYS C;  5D5Q A;  4MT8 A;  1FAF A;  1SET A;  3ZIA G;  4NKG B;  2BSK B;  5GW7 A;  2VQF B;  1VEW A;  2CUG A;  1YF2 A;  1Y66 A;  3T1Y O;  3CS5 A;  1U97 A;  1B04 A;  1XNQ B;  1XI1 A;  1K5S A;  3TET A;  3MHH C;  3GB7 C;  3R65 A;  2R70 A;  3IFX A;  1BS3 A;  3NXS A;  2UXB O;  1ZL8 A;  1HWY A;  1OCC C;  1Z2G A;  5LXT B;  4FLV A;  5LMU O;  2ZE8 A;  4LF4 O;  1YJ9 V;  1YTF D;  1T5E A;  2KB1 A;  2BTO A;  1NT2 B;  3CCS V;  5LHH A;  2WLN A;  4JTC B;  3FYI B;  4AI8 A;  4ASU G;  1GN6 A;  1AP5 A;  3A0B Z;  4XDK A;  1CP9 A;  5BZB A;  1VMG A;  1XOU A;  1YVW A;  1WJZ A;  2DOS A;  5IY5 C;  3AG1 C;  4R6Z A;  4LFA B;  1NZ6 A;  2VQE B;  5FLX N;  5GTI Z;  4Z2W A;  2QWN B;  2W6I G;  2JGD A;  1VQO V;  4JAV A;  2DMX A;  1D5N A;  4JI5 B;  2IJI A;  2Q6A A;  4I55 B;  5BR8 O;  3K58 A;  2DWD C;  1BHB A;  3ZN0 A;  1QVG U;  4PHZ A;  2MK3 A;  2W0F C;  3DTU B;  2RN9 A;  5JWP A;  5KAF Z;  2PYL A;  1PP9 H;  5B5E Z;  3W7T A;  1JPX A;  3BY6 A;  2OCC B;  4DV3 O;  2Q68 A;  3G6B A;  4TUY B;  2UXC O;  3OR6 C;  4X1I B;  3KCX A;  2A79 B;  4MVM A;  5B1B B;  1M90 W;  4WF9 V;  1SZX A;  3OGI B;  1K3E A;  4DR4 O;  1K33 A;  2EIN C;  3IGA C;  2YIB D;  1Y4M A;  2RJZ A;  2ZNJ A;  2UXD B;  2H3O A;  4J9Z B;  2Q7G A;  4QNH B;  1SA0 A;  1Y67 A;  3JD2 A;  4JI6 B;  3JAW A;  3ZMV A;  5JJN B;  4LNU A;  3DXR B;  3OE7 G;  2Q4P A;  4DR2 B;  4DW0 A;  4TOI A;  1B6Q A;  3ZN1 A;  4FM0 A;  1N36 O;  4ZI7 A;  1M57 C;  4CZZ A;  3AG7 A;  1F4N A;  1J5E B;  1NR1 A;  4FLX A;  3P32 A;  1AI7 A;  5IYB O;  4FFB B;  1HNX O;  5EIB C;  2Y69 C;  1Q6U A;  4AHC A;  3F7V C;  4IHJ B;  1VQ4 V;  1X4T A;  2OT5 A;  4LCU C;  1F7Y A;  2BOB C;  4JV5 B;  1VP7 A;  2LGQ A;  3BA8 A;  1FJG O;  1IZ3 A;  1VF7 A;  1XL4 A;  3HPL C;  3K03 A;  4LF7 B;  2PY5 A;  3ZHQ A;  1XMO B;  2PF4 E;  4QPK A;  3RYC B;  4MVS A;  1WPB A;  1FXK B;  1PKX A;  2JIZ G;  1G8M A;  4YIP A;  2ILM A;  2L6L A;  1QLE B;  4K3A A;  4WFB V;  4K8X A;  1NH2 B;  1VQN V;  5HFL A;  4I9Q A;  4UCO A;  1QNM A;  2P22 C;  3U11 A;  4DR7 B;  1SS3 A;  2DYR B;  3FAV B;  4TV8 A;  3CCU V;  3BPZ A;  1I5X A;  2RMK B;  1PNL A;  1VQ5 V;  4LBE C;  3B77 A;  3SYA A;  1I94 B;  1XMQ O;  4B3S O;  5CA3 A;  3RGB A;  4O2A B;  5FNV A;  3ZRX A;  4BW9 A;  4JI8 B;  2NLJ C;  4DV0 B;  1NTK H;  1KC8 W;  4EFE A;  1XDC A;  1G4Y B;  2UXX A;  1XBL A;  3CCV V;  2VWJ A;  4J9Y B;  5CBF A;  4WFF A;  1H2S B;  4GT1 A;  2F43 G;  5LP6 B;  4GKJ B;  3P3N A;  2IH3 C;  3BEH A;  4FM2 A;  3ABT A;  1IX9 A;  4ICG A;  4DV7 O;  1GO3 F;  5CBG A;  5BY1 A;  1D5A A;  1HNW B;  2LW7 A;  1OCO C;  1R6N A;  4MTG A;  4ZHQ B;  3SR2 C;  3CCR V;  2HHH O;  2F93 B;  3CJH A;  3KG2 A;  2E74 B;  2JK5 C;  2OCC C;  2L35 A;  2IU0 A;  2JGU A;  3BAA A;  1JVM A;  4AQY O;  1HNZ B;  4NXN O;  2F23 A;  2HJF C;  1F4M A;  5GTH Z;  2P7T C;  4GX1 A;  4DV4 O;  4ZOL B;  4DR5 B;  1S76 D;  4XDJ A;  3IJ4 A;  1GH6 A;  4P9O A;  1IBM O;  2G38 A;  3SJQ C;  4MTX A;  5LXT A;  2HVK C;  1V55 B;  3K3W A;  2GSM B;  4RQF A;  2W0X A;  1TVK B;  2IJH A;  3L71 H;  2ADQ B;  3OTO O;  4PDL A;  5KA5 A;  4DYL A;  5LGT A;  3OMA B;  4JF3 A;  4CH3 A;  1MOF A;  4FMT A;  3HKC B;  2KG7 B;  3D36 C;  4HNA B;  4NXM O;  4ZBM A;  3UQ8 A;  4FIP C;  1E1Q G;  2JRI A;  4CH5 A;  4JI4 B;  2PI5 A;  2V1D A;  4FM1 A;  1ENV A;  3D3Q A;  4UUJ C;  2LFR A;  5LBQ A;  5L3F A;  2DN9 A;  3B40 A;  5L3D A;  5JJE B;  1N32 B;  1XIL A;  3QO5 A;  1KP3 A;  4I55 A;  1LUV A;  1M56 C;  4DUY B;  1FD9 A;  1AI6 A;  3SJA C;  1V54 B;  1HR0 O;  1Q6I A;  3A0R A;  2P6J A;  4DV5 O;  4FK5 C;  4O4L B;  4JI1 O;  2OIE A;  4X65 B;  4LWS B;  1KYO F;  4TUY A;  4J80 A;  4CC6 A;  1YIT V;  4MVZ A;  5BXZ A;  3AG2 C;  4X1I A;  3RVY A;  1EN5 A;  3N2G B;  1GM8 A;  3TCU A;  1FXK C;  5EZY A;  3UO2 A;  1M9N A;  3K04 A;  2ARH A;  1P7G A;  2QTS A;  3C3T A;  2X6C A;  1H2L A;  5LGU A;  2QM7 A;  5JCO C;  1QLE C;  5LMN O;  3FB8 C;  2YUA A;  2YC0 A;  3LDC A;  3LSQ A;  4TT3 G;  3BAB A; 
#chains in the Genus database with same CATH homology
 1HNZ O;  2DOS A;  4LF6 O;  1F7Y A;  4LF7 O;  4LF8 O;  4AQY O;  3J7A U;  5FLX N;  4NXN O;  1J5E O;  1FJG O;  2FKX A;  1A32 A;  4DV4 O;  4LF9 O;  4JI5 O;  1XMO O;  3RT3 C;  2UUB O;  2F4V O;  1IBM O;  4JI7 O;  5BR8 O;  4JI3 O;  4GKJ O;  2ZKO A;  4DR6 O;  3R66 A;  1IBK O;  2N74 A;  1AIL A;  1XNR O;  3M8A A;  5A2Q N;  3OTO O;  4X66 O;  5IWA O;  1DK1 A;  1N33 O;  4DR5 O;  4DV3 O;  1IBL O;  4DR7 O;  2DJV A;  1NS1 A;  2UXC O;  4DR3 O;  3F5T A;  1R1B A;  5LL6 Y;  4JI0 O;  4X64 O;  3JAM N;  3T1H O;  1FYJ A;  4NXM O;  4DV6 O;  4YHH O;  4B3T O;  1XEQ A;  4KHP O;  1FKA O;  2JRI A;  4B3R O;  1G1X B;  4DR4 O;  3J81 N;  1XMQ O;  2E5L O;  3J80 N;  4B3S O;  3T1Y O;  1XNQ O;  4JI6 O;  4JI8 O;  4DV1 O;  2UUA O;  2AGA A;  1HR0 O;  1AB3 A;  4DV5 O;  4JI2 O;  4X65 O;  4JYA O;  4K0K O;  4DR2 O;  4JI4 O;  4JI1 O;  4LF5 O;  2UXB O;  1D2D A;  1YZB A;  2VQF O;  1I94 O;  4A5U B;  5LMU O;  4LFB O;  1N36 O;  4LF4 O;  1KUQ A;  4X62 O;  1R6T A;  1X59 A;  2UUC O;  1N32 O;  4LFC O;  2UXD O;  5BXZ A;  4GKK O;  4DUY O;  1HNW O;  4YY3 O;  4DV7 O;  2Z0A A;  5BY1 A;  4OX9 O;  3SDL A;  4OPH A;  4DV0 O;  5IT9 N;  4OPA A;  4B3M O;  2LW7 A;  2HHH O;  4DR1 O;  4DV2 O;  1HNX O;  5H5N A;  2ZM6 O;  2UU9 O;  1N34 O;  5LMN O;  4DUZ O;  4LFA O;  4JV5 O;  2VQE O;  3O65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...