1X5SA

Solution structure of rrm domain in a18 hnrnp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
102
structure length
102
Chain Sequence
GSSGSSGMASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RRM domain in A18 hnRNP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Cold-inducible RNA-binding protein
total genus 9
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x5sA01
2MZQA 2MJUA 2CQGA 2DNMA 1N8RT 2DNHA 1W2BR 4TU8A 2XS7A 1A9NB 1Q82T 2KM8C 3BO2A 2ZJRQ 3NMRA 2RS2A 1KOOA 1U6FA 3R1HA 3VF0B 3RW6A 2DB1A 1SJRA 3VAMA 3US5A 1WWHA 2PE8A 2DHSA 4OZ0A 4Y00A 2KRBA 1JJ4A 3UWTA 1M1KT 2CQ1A 1P1TA 3P5TL 1KOHA 4U67Q 1ZZNA 2LEBA 3CC4S 2LYVA 5MLCV 5DDRC 2YKAA 1Q86T 4W90B 2LXIA 3G8SA 5IFMA 2RUGA 4Z2XA 3BS9A 2MGZB 5CYJA 3IRWP 2MB0B 3H2UB 1H6KX 1X4DA 2CQ2A 5FJ4A 1M5PC 2YWKA 1PGZA 2DGVA 1U1OA 1WHXA 1O0PA 1WI8A 1FXLA 2CQ3A 1WHWA 1WTBA 3THPA 1S79A 2DO4A 2MGZA 2CPXA 2DK2A 2MZSA 3CCVS 1WF2A 3NNCA 1DHMA 3P49B 5GVQA 2HZCA 2CQCA 5IM0A 2CQIA 3IWNC 2FC9A 2FPHX 3VAGA 2M9KA 3MUVP 1U1LA 2DH8A 4ZKAA 3VAKA 3I55S 3CCMS 3EGZA 1OWXA 2MKHA 2F9DA 3H2VE 2N7CA 2DIUA 2D9OA 2GO9A 3P3DA 2AD9A 2CQ0A 1JJ2R 2J76E 1X4AA 3U1MA 3ULHA 3TYTA 2KVIA 1FO1A 3UD3P 2CQBA 2CQPA 2CQ4A 1SJ4P 2JVOA 1WF1A 1U1QA 3SDEB 1S72S 1AUDA 2LEAA 2HVZA 4P6QA 2EK6A 2LCWA 2N82B 3K0JA 1PO6A 3CXCR 1SJ3P 2M7SA 3EX7B 1NU4A 1RK8A 1F9FA 2X1FA 3HI9A 5IM0B 2ADCA 4W92B 1M5KC 2LQ5A 2CPZA 1VQNS 3NNAA 2FHOB 2MXYA 3I56S 4IOCQ 4F26A 4UY8T 3CCLS 1YJNS 1BY9A 2VOPA 2FC8A 1OO0B 2AYMA 2DNLA 4FXWA 3J7YU 3B4MA 2MZJA 3UCZP 2DHGA 3Q2TC 1OPIA 5GAHU 1WG4A 1NJIT 1HA1A 1U2FA 2BOPA 4UQTA 2CPFA 2HYIB 2M88A 2KHCA 2J0SD 5LSLA 2DNKA 2ZJPQ 2OSRA 1VQOS 1WEXA 1XN9A 3PIOQ 2DGSA 2VONA 1K9MT 5GMKa 1QVFR 1VBYA 1CVJA 2B0GA 4CIOA 2X1AA 1A7GE 4ED5A 5DM6Q 1D9AA 1L3KA 2MKCA 2AYBA 2VOOA 1HD0A 3CMAS 3DLLQ 3MOJB 2MJNA 3TO8A 1VQ7S 3BO4A 2E5JA 2MQQA 3P6YC 1R8PA 2X1GA 4WIIA 2FY1A 2I2YA 2O3DA 2XS2A 1N54B 3SXLA 5DDQC 1N52B 3UCGA 1FJEB 4TU9A 1X5OA 2OJ3A 1N88A 3MUMP 1K8AT 2MY7A 1X5SA 2MZRA 4QQBA 3VAJA 4IUFA 2CPDA 1VC5A 1YWXA 2G1DA 3MURP 2XSFA 4CQ1A 1RKJA 5DDPC 1FJ7A 2MZTA 2KXHA 3OW2R 4Y0FA 2XNRA 2J0QD 3BEGB 3CC7S 3CCES 3U1LA 2RVJA 4YUDA 2M8DB 4C4WA 2AYEA 4IOAQ 3S8SA 3CCQS 2MSTA 3ZZZA 1WEZA 2KH9A 1U6BA 5GADU 1KQSR 4YOEA 5HL7Q 4TLQA 3VAHA 2DNGA 1SJFA 2RQ4A 2E5GA 1VQ4S 4CH0S 2DH9A 2J8AA 2MMYA 2NLWA 2MPUA 2MHNA 1KC8T 2OTJS 1VQKS 2E5HA 2E5IA 2L41A 5GAEU 1SXLA 2QA4S 2K8GA 2RRAA 3MD3A 3S7RA 1X4HA 1R8HA 1HL6A 4FXVA 2DGQA 2JVRA 3CTRA 1VQ8S 2DNPA 2D3OR 5IQQA 2RS8A 1U1KA 1U1MA 4J5OA 2M0GB 3CPWR 2CJKA 1FJCA 2G0CA 2OIHA 2OTLS 2AYGA 4QU6A 1OIAA 4EGLA 3NNHA 5D77A 1WI6A 1M90T 3J7ZT 4A8XA 1Q7YT 2DISA 3G8TA 2DNQA 2U2FA 3PIPQ 2ZJQQ 1DBDA 2N3LA 2V94A 3FEYB 1YJWS 2HGMA 5CA5A 2XNQA 1VQ9S 2KI2A 3CCUS 3R1LA 4WFAQ 1WHVA 1X5PA 2RT3A 3EGNA 4C7QA 1FNXH 3UE2A 3ZZYA 1JJHA 1K73T 1H2TZ 3CMES 2DNOA 2HGNA 3FEXB 4PRFA 2KT5A 2KXFA 2F9JA 2OSQA 5JVHQ 5CXTA 2VODA 4PKDB 3G96A 2MKJA 2EK1A 1FT8A 2N3OA 2MKKA 2DNYA 3VAFA 4M5DB 1VQLS 2CPJA 1U1PA 2KU7A 3VAIA 1VC0A 3LQVA 3VALA 1D8ZA 2MQPA 3D2WA 1VQ6S 5JVGQ 2WBRA 1M5OC 4ERDA 1HD1A 4F02A 2RNEA 5DDOC 2M4MA 4CH1A 2M8HA 1VQ5S 1VBXA 3CCSS 1SJQA 2DH7A 2LA6A 1FHTA 2M2BA 1YHQS 2KN4A 3G4SS 3Q2SC 5LXRA 2JWNA 2F3JA 2RQCA 2L9WA 2Q79A 2SXLA 3NS6A 1UFWA 4TU7A 2MKSA 2KM8B 3B4DA 1X4GA 2BZ2A 2DO0A 1YI2S 1URNA 2DGXA 4QPTA 2MZ1A 5EN1A 2YH0A 2DNZA 2LA4A 4LIRA 2CQHA 1NO8A 1VQPS 2MYFA 5LXYA 1YJ9S 1M5VC 2KYXA 3TP2A 3G71S 4RU2A 1IQTA 4LJMA 3MXHP 2KRRA 2CPEA 2U1AA 2YH1A 3DXBA 5DETA 2KG0A 2CPIA 1YTYA 2DGOA 3SMZA 1WEYA 3HHNB 1VQMS 3CD6S 3UD4P 3G6ES 2M52A 1UP1A 2CPYA 2E44A 4IO9Q 5GAGU 2G4BA 2QEXS 4WFBQ 1YITS 1B7FA 3V4MA 2X1BA 2MSSA 2ERRA 2JX2A 4QU7A 3S01A 4WFNQ 3CCRS 4WF9Q 1VC6A 3CF5Q 2LXUA 4OZ1A 4WCEQ 1WF0A 3THTA 5H1SV 1X0FA 1WG5A 3N9UC 5DM7Q 4PR6A 1QM9A 2DNNA 4LMZA 3S6EA 2CQDA 5D78A 3UCUP 4C0OC 3L3CA 2GHPA 3SDEA 3CC2S 1H2VZ 5LJ5Y 1U1NA 1QVGR 1VBZA 2CPHA 1G2EA 2KXNB 1UAWA 1WG1A 1H2UX 3MI7X 2HGLA 3CCJS 2LKZA 2MQOA 2KG1A 1WHYA 3MDFA 1P27B 2KFYA 3CUNA 1ZH5A 1KD1T 1X5TA 2I38A 3BO3A 2DNRA 3JB9k 2D9PA 4WKRA 2DGTA 1X4EA 2QFJA 1X4FA 2DHXA 2MQMA 5LSOA 5ITHA 1U1RA 2XS5A 4V19X 2M70A 4YB1P 2MQLA 2MKIA 2LECA 1YIJS 3RW7A 5BJRA 1WELA 5HO4A 2DGWA 2L08A 1DRZA 2XB2D 1ZZFA 3MD1A 2NZ4A 2ADBA 2PEHA 4F25A 2K3KA 2LMIA 1DZ5A 1X4BA 3CULA 2UP1A 2RRBA 1JMTA 2RU3A 2DITA 2MQNA 4BS2A 2DGUA 3G9CA 5LJ3Y 2A3JA 2DHAA 3R27A 1X4CA 2DIVA 3LPYA 2EVZA 1UW4A 1Q81T 3NS5A 2JRSA 2YTCA 3MUTP 2MY8A
chains in the Genus database with same CATH superfamily
3RGIA 2MJUA 4DL5A 4QWBA 2QTWA 5LM7E 2AT1B 4IH7A 1UVKA 2NXEA 3EVMA 4BDPA 3VVTA 4B3SJ 1QAIA 4CO0A 1B64A 2P6SA 1NK8A 4NA2A 4UUWA 4YR0A 3NAHA 1LWCA 4U9RA 3I5CA 2ZJRQ 3BO2A 2BQUA 1TL3B 2MLZA 3M6VA 1L3UA 3VF0B 3QZ8A 1VOMA 4DV2J 2ROPA 3RR8A 2KHDA 4DR2J 2Y1JA 4EUVA 5HJYA 3US5A 4CT8A 3QGIA 1CQNA 4A8KA 4WTYA 1JJ4A 3UWTA 4J90A 1EP4B 5DGBA 3OV7A 1I6JA 1H7XA 2FVCA 3PV8A 1KVJA 5D3GB 1N36J 4QJVA 1KOHA 2K06A 1RWWB 1Q7LB 1ZZNA 5E5NA 3R9LA 3HVWA 2BJ7A 3TQEA 1BUXA 3JSMA 2V8HA 5LMUF 2LEBA 4DR6F 1N5SA 3AJDA 4QBUA 3HSGA 2EFOA 1Q86T 2V8VA 4W90B 4ZVQB 3T5KA 5HLFA 3TA2A 2HPUA 3OBIA 4Z2XA 4I2QA 2OHDA 4B02A 1SL2A 5CYJA 4QIVA 3H2UB 5FJ4A 2Y8WA 2HQDA 3TZZA 3CMQA 4FXDA 4WTOB 1IR2A 3MR2A 3HHLD 3Q8RB 4I4BA 2LEPA 2YNGB 4OYAA 1RT3B 4F50A 4DZDA 1Q78A 2B7CB 2NSBA 4ED0A 3R6GB 4OYWA 2WAQD 1ZAWA 1VK8A 2FJBB 3AH6A 3CW2C 3G87A 1NHKL 4ES1A 4GC6A 1I94J 2HHHJ 1FTRA 1NZAA 2OLWA 3N5BA 4Q45A 4N41A 3EXCX 1FESA 1RA7A 2DO4A 4I2QB 5HJXA 1S7HA 2IBKA 8AT1B 1QTNB 2DK2A 4X64J 4O3RA 3DRPB 1QSSA 3NNCA 5F3TA 1HW8A 2AIRB 1LWFA 1WOSA 3IR7B 4B3TJ 5GVQA 3JXOA 4DR5J 1UEKA 2CQCA 3SQGA 3M2RA 2V9KA 4RWWA 3OJUA 3GQCA 3PYGA 3VAGA 3IWNC 1C0TB 4RPFA 1QAYA 3AFGA 3MUVP 3DN9A 1GXLA 2E9TA 5F8NA 1FRMA 4DR4J 5C7PA 1MG7A 2ZDPA 4DLGA 5EHHA 3HPOA 1O51A 2YY3A 1NK9A 3CD0A 4G1IA 3EVWA 4P10A 2R2UA 1D9FA 2N7CA 2HMIB 4NA3A 4TNOA 3GFHA 1O6XA 2YQ3A 1JXVA 3VHQA 2RD5C 2CQ0A 3PVXA 1X4AA 2ZZTA 4I1TA 1XTZA 3U1MA 2W7AA 2ZWPA 4GO7X 3H7HB 5IC6B 4ZIVA 1R8CA 2CQBA 2HKEA 3KHRA 1Q79A 2CQPA 2W9CA 3I31A 2F65A 3CJ3A 2CQ4A 2XLIA 1U1QA 1TP7A 4X66F 3A3PB 5L1LA 3K5MA 1D1UA 3E2EA 1TL5A 2HVZA 5J2MB 4P6QA 3L7UA 4M95A 4DL3A 5I3UA 3TA0A 5B0FA 2FZKB 2EK6A 4LUBA 1Q5VA 4JI8J 3OR1A 3O1LA 2KB2A 3DRYA 1SH0A 4GO5X 2H5IB 1FJGF 2KL8A 1SJ3P 4DR1F 1F6TA 2HURA 4IRCA 2PD1A 1F9FA 1GXTA 1S4EA 1HARA 3GFXA 3RZAA 4YHHJ 2XMVA 4KV8B 2ADCA 4F67A 4OZJA 5T14A 3B6BA 2IC3A 4EO8A 2UZAA 1VFJA 3W61A 4JI3F 1L3VA 1TU0B 4YB6A 2UXCJ 1ZA2B 5KFMA 2YWGA 4JI5J 3A3NB 4GVBB 1RLCL 4DX5A 3GZ7A 3KK3B 5D4NA 3BJYA 1YBAA 5IV4A 3HHLC 1U48A 4KGZB 1SC6A 2QT7A 2R9LA 3RRKA 2VOPA 1NCLA 2B9WA 2FC8A 3GLJA 2H48B 3M4XA 1TKZB 4PPZA 3VZHA 4LRDA 2G2OA 4AYBD 2D74B 4LFCF 1CJTB 2L9NA 8ATCB 1RU2A 3TJAA 1EARA 4I56A 2PN6A 4IOBA 2UVVA 4KPYA 2C2ZB 2FIUA 1NJIT 1BQNB 2HLUA 3DMJA 1U2FA 4ZHRB 1FDNA 4UQTA 2R2TA 2HYIB 4I67A 2XYGB 3C15B 1IBMJ 2DRAA 3BSNA 1S0MA 4NMLA 1ZS6A 3R7SB 3UVJB 2OO4A 3NLCA 5KFFA 3GV5B 3PIOQ 3LUYA 3GIMA 3C6TA 1TAQA 5E3RA 2VG5B 2ZH8A 2HVIA 4AL5A 2VPWB 2LU1A 2ATLA 1QVFR 1VBYA 1HQEB 2G13A 5IT0A 4ECVA 4A47A 4C0HA 5KT2A 4OHVA 4PXBA 7FD1A 1A7GE 1R7IA 1RAIB 2P9GA 1U45A 3TZWA 1NK5A 4FPRA 2DR8A 3RB6A 1PKUA 2HBRB 3U7JA 4ZJQA 3OHBA 1FA0A 5ETVA 1MMNA 4YMEA 3F0NA 2VC0A 5DQGA 4UOGA 4MIAA 4ZPBA 2AEMA 2GCFA 3BYRA 2MJNA 3Q8YA 2VBYA 3TQ1A 2E5JA 1AW0A 3NGKA 1CC7A 4CO5A 5EGYA 2GAHC 3PHEA 1SL0A 2HBQB 4ZIWA 4YR2A 1KQKA 4B3MF 6FD1A 4U8YA 2GFFA 3VR1A 3M9OB 1HBMB 4NYOA 3PKYA 3CSKA 3D0HE 2B4UA 1CJTA 1X5SA 3CDUA 1K8AT 1FKPA 1SH2A 4IUFA 3OL9A 1VC5A 5A8KB 1RBLA 1RT6B 2LDYA 3HVTA 3K2YA 2W9BB 2ZH3A 4M5DA 3J7Z5 3MURP 2PIIA 4WZMA 4CQ1A 2XEXA 4X84A 2AJQA 2L48A 4C8MA 1XC9A 2HQIA 2QC3A 2YNIB 2J0QD 1P9YA 1RLDA 2AP6A 3PYFA 3CCTA 3RG6A 3CC7S 1AUSL 1UWAA 1Q1KA 2EBGA 2YKMB 1BXNA 2VKZG 4NZ6A 1UZHA 3UN3A 4GC7A 1NB2A 2QL5B 2Q6CA 1S6UA 4HVZA 4IH5A 5ETSA 5ETPA 4AT1B 1HNZF 3QRPA 4IO1A 1WOOA 2IMOA 3ENQA 3KLIA 4IOAQ 3S8SA 1HQEA 3MPYA 2OPSA 2CZ4A 1S1UA 2VG7A 1DLOA 1SCJB 3GWCA 3M32B 2QLXA 3HHKA 4FKYA 1AB8A 3GILA 1PYOB 4KYZA 3O2IA 4QOTA 3ZZZA 1JIHA 3RAQA 1NDLA 1WEZA 5FD1A 3HHLA 2KH9A 4UT4A 3Q23A 3PJWA 3QGHA 5FLXU 5GADU 5HL7Q 2D1CA 1EB0A 2P5VA 4MK8A 4USJC 3QAEA 4J9KA 1XR5A 2E5GA 4CLWA 1LWEB 1G1XA 2BKOA 4A48A 1FRHA 2I8EA 2MMYA 1IJFB 1BQNA 1VJWA 2CVEA 2MPUA 1NBEB 2NLWA 2Q43A 2Z57B 1REVB 2AGQA 4EK2A 3OVBA 4X4OA 1IKYA 1FRLA 3TAMB 3GONA 2I5JA 3CT9A 3CJ8A 3EE3A 8RUCA 4RLEA 5GAEU 2QA4S 4FS1A 3KUGA 3PG9A 1RWNB 4OJ3A 3H8YA 5D4PA 3FSXA 3POTA 4RW6B 1NDKA 5KFOA 4DS5A 1RTHA 4Z7YA 1T9TA 2AHOB 2OPPA 3D6FB 1J5EF 2OI2A 4B9UA 4ZVRB 3CTRA 3QJPA 1BGXT 2RUSA 4LVOP 4FKXA 2RRNA 4OZ5A 4RKUC 2DNPA 2Y8YA 4ZA1A 2R7TA 4CLSA 3IAM9 3DHXA 1U1KA 2FZCB 2UV8A 4J5OA 4N77A 4J9SA 4ECSA 3VZIA 3NY0A 5BR8F 1OSCA 5K5MA 2R8GA 4NLUA 3FKBA 3CPWR 1GT8A 1RJJA 4RO0A 1FJCA 1J2VA 3RAXA 2OIHA 1SC4B 4KH0B 4WXOA 3BGFA 3LGNA 5LT5A 1U7LA 4KFBA 5B0DA 3MTKA 1WTFA 2AYGA 2G1HA 2DR7A 4QU6A 2ZM6F 1N5QA 3PJXA 2VKRA 1JNZB 2NUUG 4HEA9 1WI6A 4LT6A 4ICLA 1FX2A 4DCOB 1Q7YT 4X62F 2CNLB 5HROA 2DISA 3K8WA 3JSRA 4CLKA 3HT3A 2GVDA 1X7VA 2DNQA 2ALYB 2RF2A 1U25A 2C3OA 5M2PA 4W98A 3UD5A 1FNMA 2NYHA 2HK2A 4B9NA 2BEFA 2XMKA 3ENVA 5L1IA 2HGMA 1VI7A 2XGQA 3T3FA 3OT9A 5E3PA 1R43A 2L9DA 2OEJA 4R8UB 1VQ9S 4ILLA 3MM6A 4U7UK 3UN5A 1KRPA 3R1LA 4WFAQ 5DZ6A 4EO6A 3D68A 5HBMA 1UJ6A 5K14B 4U8VA 1X5PA 4ZP7A 4CRJA 2V4RA 1HBUA 4ZLLA 2V6AA 2QA1A 2IBOA 2R2SA 1FNXH 2R8KA 3ZZYA 1LOUA 1QUPA 1X0PA 2V2ZA 3JTOA 1JJHA 2VJVA 2CDRB 4CLYA 3SYZA 1H2TZ 4CCHA 4DPWA 4Y34A 4OX6A 5CCLA 5J2QA 2MDAA 1FE4A 2R8HA 4P2XA 2HGNA 5A8RB 4FF2A 3MMBA 3FEXB 2KT5A 4PWDA 5KG6A 1XR7A 1FFSB 4ITSA 4PKDB 5JJBA 3TWZA 3E8OA 4F3OA 5KFJA 1FK9A 2JFDA 3ICLA 1WKLA 1RT4B 5JMNA 4M5DB 3EGVA 1U2CA 1WUUA 1XNRF 2YNGA 5HAOA 1U1PA 3E01B 4MH8A 2NPIA 3M2VB 4ZHRA 2YQ0A 3DOMA 4QR0A 2E1RA 5EDWA 4DV6J 4JYAF 2VJUA 4C3KA 4NEYA 3I82A 4ERDA 2B5JA 3BV8A 4MMOA 4WE1B 4CH1A 3BQ2A 3V6JA 3TW0A 4F4XA 4DL6A 2IM0A 2HG4A 3HD2A 4OX7A 4CI0B 4DPXA 4DSKA 1SB6A 4F4KA 1FHTA 2EI5A 2B6AB 1I3OB 4KPCA 2J6TA 1UWBB 2P2CB 2LFVA 3D3CJ 5L1KA 1WC6A 3W5ZA 3D1OA 4DR2F 3C2PA 2KYZA 1Y7PA 3M30A 4CO4A 2BKNA 1SKWA 2BOPA 3ENWA 4O3QA 3HX9A 1BQXA 3LH2S 3NS6A 1N0UA 2ACYA 3UN2A 4C11B 3HVRA 2D3O1 1SKUB 2JHEA 3N4WA 1URNA 1CPZA 4KQZA 3HKZD 2KFZA 2UUTA 1HNVA 1OY9A 4Q8FA 2UXCF 3LO3A 2AQ4A 4IRDA 2JLGA 2C1EB 1BQMB 5F8GA 1TL1B 2LVWA 4ES3A 5A8RA 2PDAA 4PXCA 1RT2B 4GRSA 3QMQA 2C3MA 1TK8A 4DF8A 4ANEA 3PEHA 4C11A 3MXHP 2HVEA 1VGYA 4JYAJ 2KRRA 3W64A 1YBTA 1VMBA 3W65A 4A8FA 2PMWA 3AD8C 2YQ1A 4ID5A 1URRA 2ZWOA 3H5UA 2DKOB 1IVZA 2ILYA 2WVCA 2CPIA 2C42A 2UXDJ 2O01C 4QWCA 2ZZNA 2DCUB 1KVIA 1LQ9A 4A4JA 1S59A 1UKUA 5E7OB 5K20B 2RMLA 2PC6A 2XZWA 2FVSA 3UI3A 1DTQB 1NHUA 3D7SB 3HULA 3UD4P 4TLRA 2J9EA 3SSRA 1MWZA 4BHQA 3KNGA 1OQ3A 4IO9Q 5GAGU 1O8BA 2G4BA 2QEXS 2YX7A 5E33A 5D0HA 4YB7A 3OHAA 1ITPA 4WZQA 3LTOA 1KONA 3C16A 1R6VA 1T95A 1LW2B 3AJ1A 2MSSA 1H73A 2WOMB 5IWAF 3T5HA 2AV5A 4M5MA 3CIZA 1N5VA 3JAMU 5BR8J 1Y0HA 5CABA 3J81Y 1RT5B 3CJSA 4QR2A 2VF3A 1RKIA 1TELA 3C6TB 4IFVA 1WG5A 1RWVB 2Z2LA 3N9UC 4HT7A 5DM7Q 4H4MB 5KFAA 1D8YA 2YWWA 3DRXA 3OLBA 4PQUB 2HEKA 2BE7D 4DV4F 3MMCA 3GJSB 5HMZA 3TZYA 2C2KB 3OVAA 2G0JA 3S6EA 5J2NA 1HWKA 3TJ8A 3VGSA 4X62J 4DR1J 3M8ZA 5FLXY 1S1VB 1RTJB 1WC3A 3J7AN 2HNZB 3L3CA 3CC2S 1H2VZ 1KVKA 4CH7A 1QVGR 2PI4A 2OPQB 3ILIA 2CPHA 3NGSA 2HHWA 5K8NA 4YR3A 3IM9A 2RDIA 1RHRB 3W9IA 1MMLA 2IM2A 1VRUB 5AE2A 3QGGA 1FEEA 1OQ6A 1YVFA 4NLXA 4YP3A 2H54B 4NI2A 1RAJA 4L3KA 3CCJS 2FVPA 2LKZA 2CA9A 4B3RJ 2MQOA 3ZTPA 4KH1B 1KHWA 2IRXA 1HMVB 2WVDA 5B0EA 4U7CA 1S1VA 2E1PA 4XDDA 1K1QA 3UNYA 1S6OA 2WRMA 3JS9A 4ATNA 5CCMA 3KLEA 3BGRA 3GIKA 3MR3A 4U96A 1RT4A 3HFKA 3GJQB 3TUPA 3LAMA 4DBQA 4I69A 3A8JA 2V5HG 4WKRA 4L3NA 1ZOTA 1OJ4A 1KLMB 2QFJA 4IYQA 5H9FK 1IUJA 2MQMA 4TY9A 1U1RA 1KFSA 2PMZD 1N56A 5D8HB 4CP5A 4TVAB 2VBXA 4HH0A 3SQOP 3ILLA 2MQLA 4ELTA 1YJUA 2W24A 2RKIB 4Q2LA 2BANB 4NLQA 2FJAB 5HO4A 2K1RA 5I42B 1YJRA 2XB2D 4WU2A 1FCAA 3OTOF 4UW2A 2GAGC 1QSLA 3QFHA 4DV6F 3K5PA 1TZ0A 2YKPA 1BMQB 3DMJB 1JLGB 3MM5A 1J27A 1RHKB 3BH7B 5ADZA 1TV6A 5LMNF 3HMJG 5FDLA 4LF5F 1KDNA 2ZOFA 2KKHA 2IY5B 4XPEA 1ZAVA 2IJRA 4HHUA 1ZM2A 5AT1B 4CM2A 3A3OB 3Q8PB 1Q4RA 4WFYA 4DV1J 1N5YA 3EZUA 2DITA 4LR7A 4HACB 3TARA 5KOWA 1SQFA 1CC8A 4FNHA 4LF4J 3QSYB 2R7QA 2ACMA 3KJQB 4C8LA 3OTBA 4JUZA 4LQ3A 1X4CA 4OL8A 5DQIA 2F63A 4OI0A 5DO2A 4IR9A 1F9HA 1UW4A 3MPUB 3M1VB 3WQPA 1J5EJ 3NS5A 4EBDA 2GMLA 3R2DJ 2V67A 3NRBA 1Q5YA 3QPIA 3CJRA 3N5FA 2MY8A 1JK9B 5KFUA 2R7WA 2DNMA 1WJ9A 1SL1A 2B4VA 3M8RA 3FCHA 3FQKA 1R0BG 4Y2KA 1W2BR 1JLEB 3BQ0A 1SUQA 4WKYA 1KSPA 1DLOB 2AJFE 3QGPA 2XSJB 1DQ8A 1U6FA 4NLYA 4CNZA 4DV0J 3E01A 4F8RA 2DB1A 1SJRA 4RW7B 2XY6A 5HMYA 5B09A 2XMWA 2PE8A 1F3FA 2BJ1A 5HN0A 1JQGA 2PA8D 2QZ8A 2BANA 3LF0A 2WB4A 4N8OA 3PNIA 4ZCLA 5AXNA 1M1KT 1IKVB 3ITHB 2ZFHA 4I6AA 4Y28C 3P5TL 5D0GA 2F8EX 4U67Q 2YKOA 3KG0A 1NK7A 3DLGB 3OQ2A 1AFIA 2E7WA 5H9EK 2LYVA 1D0EA 1HWIA 2FY8A 3CC4S 1F9EB 1CG2A 2FZGB 2IIHA 4DUZF 1RCXB 1RT3A 1RZMA 2EEYA 3I6PA 4MYUA 4RW7A 1HR0J 2VQFJ 2ZVSA 3BS9A 4HTJA 1X60A 2R3VA 3MM7A 2PI5A 2XHWA 1X4DA 3I9ZA 3RBZA 3VTIA 1NKEA 3U1NA 2HWHA 4OYBA 2YX1A 1JB0C 2IRYA 1Y10A 1Y4ZB 2W01A 4Y2AA 4RUBA 2DGVA 3POTB 2RJZA 4KC5A 4ZP9A 1NK4A 5CAAA 1CJUA 2LQBA 1WI8A 4W4MA 2A2DA 1EQ0A 5J1EB 4DV2F 3DRRB 3PW2A 4J9VA 1HYSA 1Q8KA 3MEDA 4KGVB 4NL5A 1LWXA 3HFVA 2FHKA 3HHLB 3K7RA 3KXDA 4FF4A 2WSCC 3FCWA 1YSJA 3OFEA 1WHWA 4RW9A 4EMDA 1T03A 3SFUA 1OSDA 1A0OB 1PJ7A 2CJQA 2HNYA 4NXMJ 3P45B 4CLFA 3LGHA 4P52A 5K8MA 1WF2A 4N8NA 1OS5A 3NOGA 2K7KA 1S1XB 4YY3J 2OMLA 3PRBA 2FB0A 3Q8QB 4OHYA 3DRSB 4PWUA 5D4LA 4OI3A 3CCWA 4UZBA 2RSQA 4QYRA 4K4ZA 4ZVFA 3S1TA 4WXWA 4DFJA 4PWDB 5F0UA 4IG3A 2JC0A 4C97A 2EXUA 2KDOA 4X64F 4NLDA 1U1LA 4OI2A 2LLZA 4F36A 2QRRA 2L3MA 4NOHA 4F3QA 3NWGA 3VAKA 4KSEB 3CCMS 4JV5J 1IR0A 3HK2A 3WZ0A 3M8SA 3CJQA 3EGZA 1OWXA 2MKHA 4USUA 5CZXA 1RI7A 2Z56B 1YJTA 2B56A 3CGIA 3H2VE 4ZCMA 4ZVTB 1RT7B 4FYYB 3VGVA 2HZVA 2D3UA 3PEJA 2DIUA 3LA0A 1PJ5A 1IBKJ 2AJ0A 3P3DA 4RW4B 3Q0AA 2IJFA 2MKYA 3IM8A 1WSRA 3ULHA 4FPIA 4F2SA 2BA9A 2KVIA 3TX0A 5A8KA 2HHVA 3M9NB 3HVAA 2E7VA 2Z2ZA 2C2DA 1FFWB 2QE5A 1SJ4P 2JVOA 3SBMA 1TV6B 2X7IA 3SDEB 3W2VA 3PR5B 1XR6A 4A8WA 3RB3A 3BR8A 2G2ZA 4TY8B 3FBEA 3GIIA 1M1HA 2HHQA 5IC4B 4ENOA 5CQGA 4Y2CA 4I68A 2V63A 4IFYA 1Q95G 1GEHA 4ZPTR 4JI4J 4DSEA 1U8SA 2B43A 2LCWA 2IC3B 4OX9F 2N82B 1C1CB 1PO6A 3JSBA 3CXCR 1FERA 3RTVA 2M7SA 3DGPA 3RBXA 1BQMA 1F2HA 3DDKA 5K8OA 5D3GA 1VRQC 2ZNYA 2VG7B 2P6TA 3HI9A 1TK0A 2OGUA 3QWUA 2ZH9A 3ZZRA 1RYSA 3NGRA 1MN7A 1BWVA 2DRBA 1NDPA 2BE9B 2QMUB 1VQNS 3NNAA 2G2YA 1RHJB 2J7UA 3CJTA 2XY5A 1GQEA 3UR0A 5HQMA 1YJ7A 4R0EA 2MXYA 1IXKA 5D6GA 3O8WA 4G3IA 4X4NA 3NCRA 5HATA 2VPZB 4J7CA 3P8BB 1SUQB 4UY8T 4YFUA 2V8PA 3CCLS 1TAUA 1QSYA 3BKTA 2PA3A 4AQYJ 4O44A 2GMHA 1YJNS 1VLOA 4U7UD 4ECUA 4KGMA 1BD6A 3BKUA 2MLYA 1TVRA 1CULA 5AJ3J 1TK5A 4RWXA 1R27B 2HQ3A 4LQ9A 3IGNA 1VK3A 2O67A 4N5SA 3V2UC 3GG0A 3MF5A 2DHGA 3G86A 4NE9C 3OUYB 2Z2YB 1WG4A 3QNWB 1C4CA 2Q66A 1F5AA 2M88A 3NKYA 3RRHA 3I9V9 2KHCA 3MEEA 3RAMA 1FRIA 4L75A 4OYPA 2FJVA 2HHUA 2J0SD 5LSLA 5IQ6A 2DNKA 1HNWJ 1EHWA 1UVMA 1RWOB 3ELHA 2DHHA 1FKOA 3GSDA 1VQOS 2LP4A 1PYSB 5AE3A 2DGSA 4KJIA 3PR4A 3M2RB 3TUJC 4ID5B 4RBUA 3MECB 4K8RA 9ATCB 5GMKa 2RIJA 5ETNA 4DX6A 1CVJA 3OR1B 3PO5A 2B9YA 2X1AA 4CIOA 4M5NA 4QWDA 3AOCA 3OL7A 3KLHB 4AL6A 2BVZA 2EG2A 5DM6Q 1TL3A 3TA1A 3AQPA 3QRQA 2QLBB 2JC1A 2DR6A 1L3KA 1MWYA 1N32F 3MOJB 3DLLQ 5KG7A 2CRLA 4PXEA 4LFCJ 3NMAA 5KFGA 2DPIA 1HBOB 3MTJA 3MR6A 2XG8A 1R3NA 5E0OA 4DUTA 4XPCA 1DARA 4BC9A 3W2WB 4NCAA 2V2VA 1R8PA 4DU7A 1MROA 2XS2A 5C24A 1N54B 3B82A 1LW2A 4A8SA 1S0OA 3F44A 3HSZA 3D0IE 3SXLA 1N52B 5DG8A 2QSFA 1HHTP 1FJEB 1KKHA 3GIJA 2HFVA 1X5OA 4TYBA 2OJ3A 2NXUA 3ZZOA 2R4FA 1NZ8A 4O3OA 2XLJA 5GADI 2MY7A 2MZRA 4QQBA 4NXMF 1S6PB 1VBKA 2WW4A 3VAJA 4FF3A 2ZBQA 2GQ2A 1Z1ZA 3N28A 3V6KA 2XSFA 3UW1A 1RKJA 5CHCB 1B99A 2GIRA 4NA1A 5KFBA 2YNFB 3HJVA 4ED3A 2ZZMA 3I0RB 1L3SA 2KZMA 1FJ7A 1YBUA 3D6TB 4RR5A 1AZSA 3G82A 3PHTA 4P2MA 2XNRA 1CQMA 1DQAA 4RX6A 3MM8B 2J0XA 1RTJA 3J81U 3LWMA 2JJ4D 3U1LA 2FVRA 1VJQA 1B0TA 4YUDA 4V19J 2QMWA 5RUBA 3J80U 2AX1A 4HLBA 4DCJB 4DQRA 4IQXA 1BC6A 3D28A 2CJBA 3KJVB 2W4CA 2E29A 3L9ZA 5HMWA 2IA0A 4LF4F 4URGA 2HVDA 4PG5A 3FK4A 2JEFA 1HNZJ 3ET6A 1UFKA 2WVEA 4K4WA 1N36F 1J5OB 1KQSR 4DL2A 5DGAA 3MCSA 4KR0B 3QZ7A 4K4TA 1TKZA 2DNGA 2RQ4A 2V50A 2AMCB 3MCMA 1VQ4S 3IMQJ 4CH0S 3KLEB 4M63A 4B3OA 4AXJA 2B9XA 1GMUA 3BN7A 4CTAA 1KC8T 4ECQA 3LOUA 2E5HA 1NNDA 2LXFA 2CYYA 4NLRA 4H4OB 4DOZA 4AUKA 2IDEA 3QT7A 1T11A 3IR6B 4LBHA 5I3QA 1RDRA 3CDEA 4TXSA 2HSEB 2RRAA 5KG0A 1CSJA 2XI2A 1GMVA 1KQGB 1N0VC 3GU0A 2DJWA 1X4HA 3S7RA 3DU6A 4RU9A 2P8IA 4DFKA 3PACA 2ROGA 1RWKB 2H5JB 1C2PA 1IKXA 4FXVA 4NLGA 1XWLA 1I51B 2BJ9A 1HNVB 2BJ3A 4JI7F 4QCLA 4L73A 4NCGB 1BHNA 3GB0A 4C3LA 4M5HA 1G6BA 1BE4A 2NXNA 2EKYA 2X3DA 2RS8A 1RXOB 4NLTA 4KFBB 5FIIA 4ZVGA 5IQQA 2HS0A 3EYZA 5IZHA 1U1MA 3AB2B 3PJ9A 1PG5B 2FJXA 1F1BB 3CVKA 4C8KA 2RQMA 2OMOA 1SQEA 1TR0A 4PWWA 4Q43A 2CJKA 3ITHA 3N01A 1XEZA 4DL0C 4RW6A 5AJ3F 3JQJA 4Q7AA 4KKOA 4J91A 1RCOB 2LU2A 3VV2B 1R0AA 1G7CB 3BGOP 3MEEB 3NNHA 4JI2F 1B0PA 3C15A 4PYDA 5IOLA 4OFZA 2UUBJ 4HH1A 1S9GB 2YNHB 2HS4A 4MIBA 5C42A 4XO0A 3C14B 1TL4A 4I64A 4DV1F 2EG1A 2YWHA 2ZJQQ 1SJ1A 2XI3A 4DPUA 5DRKA 3OTEA 2QGFB 5AXKA 1LWEA 5J1NA 5J1EA 3RBEA 1D9DA 1IBCB 4ZLPA 2F4VJ 5CA5A 1FI4A 2KI2A 1KWMA 3CCUS 3JQMA 1H38A 4IDKA 1NK6A 2VICA 2XYHB 1NH8A 3W60A 2W4DA 1IKVA 1V5VA 2A18A 2CAJA 4CO2A 4UUXA 1FDDA 4BBYA 4MKVA 3M8PA 1K73T 2E1AA 3MZIA 5BYSA 1PIEA 2HNYB 3FEZA 1IN0A 4X66J 1M5HA 1CBKA 5IS2A 2VBWA 3Q22A 1N33F 4K0KF 3SZ2A 2KXFA 2E66A 3I4HX 5JVHQ 3M32A 4O3NA 4JI2J 3X1LB 4CNYA 1IBKF 3LP1A 3QQCD 3W5YA 2DNYA 2MKKA 1RYRA 1GX5A 4WYLA 1RT6A 2V9WA 2CPJA 3DOKB 2BXJA 1TFWA 2FQQB 1FRXA 1WSVA 2XBPA 2F4FA 3LQVA 1P9QC 3FBCA 4K4UA 3KK2A 3PW7A 3D2WA 1YQHA 2YNIA 3SCLE 2WBRA 4LF9F 1HD1A 4OJ1A 2ZNZA 1HYSB 4PG6A 1VQ5S 1TUGB 2KZZA 3K5LA 3CCSS 1SJQA 2LA6A 4GKJF 2ATCB 1QE1A 4J9PA 2EPIA 5JXSA 4DI6A 2M2BA 3FDSA 4B17A 2ZH2A 1ZM3A 2Q6BA 3WC0A 1GTHA 4RUCA 2CKWA 2XWXA 3JYTA 3G4SS 3LP2B 4URSA 4DSFA 2L9WA 3OFHA 2CG8A 1RSCA 2SXLA 3CJ4A 5A8WA 1UFWA 2W7PA 4DV5J 1H0HB 3KG4A 2KM8B 1VIOA 2BZ2A 3B4DA 3FBFA 5F0WA 2UXBF 4F04B 2JLEA 3VCDA 2MZ1A 2C3YA 2YH0A 2LA4A 3KK1A 1HR0F 3MFIA 2CQHA 1UPPA 3Q83A 1M5SA 2AX0A 2MYFA 1JLGA 3MM5B 4QYZJ 1JLCB 3ZTSA 4BLGA 2DD8S 4PCQA 4ID8A 5GAEI 4OI6A 4ZN1A 1E6VA 1ZTWA 1TKXA 3EMTA 3KOAA 2WONA 2A0FB 4H54A 1PSDA 2A6OA 4JI0F 3DXBA 5DETA 3KUHA 3M8QB 1SI9A 3SFGA 3DYAB 3SMZA 4DR7F 4ZJLA 1VQMS 1CULB 3CD6S 5L8RC 1S99A 2GGPA 4M5GA 4NLOA 2QMXA 2BM1A 4I2PA 1UP1A 2FHJD 2E44A 3DM2B 3IBCB 3V5RA 3BDEA 3WBZA 4ZVSB 4DU8A 4WFBQ 3CIMA 3OUYA 4JI7J 3FQLA 5KFEA 2IYGA 4DV5F 2KJVA 2X1BA 5B08A 4YY3F 9RUBA 3TX8A 1VIXA 5CD4H 4ED8A 2YKNA 3M6XA 2ERRA 1MROB 1NM2A 4NRTA 1R0AB 3C6UB 3L4BC 3S01A 3MMCB 3VQSA 3G6VA 1VC6A 1WC0A 3CF5Q 2LXUA 3HZEA 4KT0C 3KMSA 1GTEA 3TRGA 3KLGA 4AL7A 3GTYX 4WCEQ 1WF0A 3THTA 2IRUA 5H1SV 1X0FA 1XIQA 2HNZA 1FKOB 5A6PA 2E9RX 3ZFVA 5F8IA 5GMDA 3GFZA 4PR6A 4A8MP 2DTJA 3LALA 2FGOA 4CLUA 3F73A 4DWIA 4NXNJ 5H9FJ 3MMJA 3MCOA 1FNOA 1PAEX 1EJ7L 3H98A 3QSIA 4XIUA 1FEHA 2C2MB 3DRPA 5B7WA 3NL0A 5AE1A 1R31A 5KFHA 3RB4A 3UCUP 2ZBPA 2A2CA 4ZPWR 2CADA 4PEOA 4IDKB 5LJ5Y 3MAQA 4OV1A 2BQ3A 2C2RA 1U09A 1JKHA 2XGPA 4DV4J 2I1RA 1C1CA 1WKJA 2QLWA 1UAWA 3H20A 1N34J 1PILA 1FTCA 2G9OA 2VA2A 4F0HA 3R5CA 1VCTA 3BGRB 4USKA 1A6LA 3R7NB 3ZNJ1 1H98A 1LW0A 2AEJA 3KLFA 4K4XA 4QIGA 4Z7CA 1WHYA 2CWXA 4OI4A 4UOHA 2KFYA 4OX9J 3CUNA 1OMSA 1NRKA 3WIUA 4EFAC 1DTQA 3AODA 2AJ2A 2I38A 3IRXA 2IYIA 2HAFA 3BO3A 2FLPA 2UUAF 3OXGA 2FHJA 5DQHA 2HHPA 3JB9k 1H74A 4UTGA 2DGTA 3HHEA 3W5XA 1UVLA 1X4FA 1XNQJ 1KTVA 1NAQA 2OUGA 4GVBA 5LSOA 3JSMB 2O1PA 1TL7B 1I94F 2HHHF 4V19X 3DOMB 2XS5A 3QLHB 3R5JB 2PFDA 4YEAA 4RNFA 4DN9A 5HP1A 1RTDA 1TKXB 4MK9A 1JLAA 2DGWA 1X9SA 3EZOA 4J9UE 4LF8J 2NZ4A 1RHQB 4DQQA 2PEHA 2ADBA 5I3UB 4P73A 2LMIA 4R25A 2HIYA 1NXIA 5J2MA 2FJEB 1X4BA 4H4MA 4ZN3A 3VVUA 5MAOA 2UP1A 2EKNA 2H4WB 2RRBA 2V8DA 4F4ZA 3M05A 2I9SA 1SIWB 4O4RA 3T5LA 2B7BB 4OJHA 5J2QB 4GKJJ 4ZVPB 2J0WA 4HHJA 2MQNA 4RW8B 2H4YB 5A8WB 1CJVB 1RTZA 4ES2A 2DGUA 5B0BA 2HHSA 4DR4F 5L1JA 3G9CA 5LMNJ 2A3JA 3PRDA 5H9EJ 3RBDA 1NKBA 1PBUA 2ASLA 1LEOA 4X4VA 4I6YA 1FX4A 2BRLA 1C0UA 1FD2A 2EVZA 4CTAB 4F2RA 4BWMA 4C0BA 2ASJA 1HKAA 2FVQA 3L7PA 2YTCA 4WP9A 3T1AA 3SI8A 1HNWF 1TVRB 1FJGJ 2M8DB 2F1FA 2RH3A 5J2PA 2CQGA 2DCLA 1YZ7A 2BBEA 3R5AA 2B8QA 2F8HA 4N47A 5BXIA 1N8RT 3M8YA 3PY8A 4DF4A 5KG3A 2XS7A 1A9NB 1C0TA 1Q82T 3HO1A 2RS2A 3KJVA 1KOOA 4FVCA 3AD7C 3DDNA 3R1HA 2GJFA 5IV3A 5J2NB 4JV2A 1WWHA 4HTIA 2KRBA 3PFEA 5I3PA 2YXLA 1DY3A 2QIFA 4RNHA 4QR1A 2HNDB 4IG3B 2Y3YA 4A8YA 4F0KA 2CG4A 4G1QA 2CIMA 3R8YA 6AT1B 4MJKA 3UVJA 3PW4A 1NJZA 2YNFA 4KGKA 4MAKA 4BWJA 3ZTOA 5MLCV 4S0MA 1JXLA 5A76A 4E0DA 2YKAA 4H4KC 4X2BA 2GJ2A 3DLEB 3HVTB 1ICEB 3SIPB 3AXKA 3VGTA 3AAWB 2GVZA 2HRTA 5ETOA 4ECTA 2RUGA 3LP2A 2NR0A 4QIFA 2Z4PA 2MB0B 3IRWP 5IT9Y 2CQ2A 1RAEB 2GHWA 1WDTA 3OR2B 5L9NA 5A2QY 4ECYA 1S9GA 1SKSA 2BRKA 2MQ8A 3OFFA 1DTTB 2YWKA 3QIPB 2DPJA 2IDLA 1VRTB 5CYQB 3R97A 1WHXA 1O0PA 2WSFC 1NJXA 3IA0A 1NSKL 2HAIA 1SH3A 2FHMA 3DU5A 4P74A 1KEKA 5KG2A 1FXLA 2CQ3A 1BLUA 3M1VA 3NWRA 1S4FA 3T1HF 3LWLA 1JLBA 3FFIB 4FVMA 3CDAA 3UDVA 5GMEA 3ZZ0A 5B0GA 3G6XA 5KT7A 2ZDOA 3N6LA 3ISND 2CPXA 4CLPA 1UTAA 3BBBA 5EWFA 1NKCA 3V6DB 2GIFA 4XTTA 4UQGA 2HVHA 3UPFA 1DHMA 4P7VA 1XERA 1T8EA 1GMWA 2N4DA 2CZ9A 3NG8A 2CQIA 2H9ZA 2NXJA 4OZ3A 2FC9A 5DZ7A 2ZITA 5ETMA 4PYAA 1JLBB 1MN9A 3FFIA 4NYZA 3OLAA 2V68A 5F8MA 1UZDA 2VQFF 3IO1A 2W4PA 2J8SA 4ECRA 4QWEA 3OSNA 3MEDB 2XC9A 2JEGA 4ZKAA 4R5PB 1R6YA 2Y0BB 3IS9A 5I4MA 1R8AA 3I55S 1HNXF 3OD2A 2AJ1A 4ZVOB 5G0RA 2H51B 4CT9A 1TUWA 3KLVA 3MCNA 1AROP 2VDIA 1QAXA 1KS2A 3HF5A 2GVDB 3KJNB 2GZOA 2RB7A 3FCVA 3PX4A 4NPOA 2D9OA 1KLMA 2DRDA 1Y00A 2AD9A 4DQSA 2ZE2B 1JJ2R 1YRTA 3PXGa 3W9JA 1U24A 2HIQA 1T0TV 5L46A 1KP6A 3TYTA 3FGVA 3O6QA 1FO1A 4DXLA 3UD3P 1SKRA 3QIPA 4WE1A 2FDNA 2H65B 4X4TA 3T1YF 1WF1A 2JZ5A 2JSXA 2XZTB 2EBEA 5E3AA 1S72S 4DN0A 1AUDA 2XZDB 1B3TA 1ZPWX 2ZD1B 4L74A 1ZBTA 3D9BA 1IQZA 4RW8A 1T9YA 3K0JA 1TKTB 2PSZA 4UZCA 1S9EB 3FSYA 2K7JA 1FWLA 5HI7A 2CJAA 1K0TA 2I0XA 3IFEA 2FLLA 2X1FA 3EWGA 5KFCA 1KFDA 2BYCA 3IBWA 3CDBA 3K5NA 2ZH1A 3NEKA 1X9MA 1H72C 2C3PA 1M5KC 2LQ5A 1EETB 2HQFA 2OAUA 4CO1A 3BDPA 3C6UA 3QT6A 3WIVA 2DEJA 2NZCA 2FHOB 4X65F 1HLWA 2YWFA 4JI6J 2B4OA 4HT5A 2DBBA 4LF6J 3PX0A 3IBFB 4H4KA 2CVIA 3DOLA 4A8QA 3V4IA 1Z2LA 2YKQA 3EXYA 4Q0BA 3N6NA 5C24B 1OO0B 4B9MA 2ZHOA 3AHPA 2V69A 3CJKB 1UEVA 2E1MC 4ELUA 4JI4F 4FXWA 3AA9A 3B4MA 1NEEA 2MZJA 2QJ3A 1R89A 2HMIA 1JLFB 3L09A 3NP5A 5GAHU 5F41A 1R0CB 1HA1A 3I5BA 4DEZA 7FDRA 2IM3A 3FJ2A 2V4QA 2CPFA 2VQEJ 3C19A 1L3TA 5E2QA 3A8EA 4DUYF 4IG0A 3D0GE 4IR1A 3CDWA 1FK9B 3KJFB 2Q3PA 2E5LF 2D41A 2OSRA 4OHZA 1WEXA 5SZTA 1YKWA 4JV5F 4RNOA 2RDJA 2VONA 2KFNA 1YGYA 5KFZA 3H5SA 4YN3B 1FXRA 1RT5A 2HW3A 3V81B 4ANCA 3ONQA 4LF6F 3T19A 3M8PB 4RBTA 2B0GA 4B08A 4P9SA 2HZAA 4PABA 3OTCA 2W9AA 4ED5A 2OPRB 4JBCA 1HBUB 1IWAA 1ULRA 2XSJA 3RUBL 3J7YI 4CO3A 2DT9A 3CMAS 1DAXA 1XMQF 3DM2A 3TO8A 3TAQA 3BO4A 3OTOJ 4YS2A 3A4TA 3P6YC 3Q86A 1MWQA 1PJ6A 2XM3A 3MEGB 1U6ZA 1SBRA 5KFLA 3OVSA 4KHPF 3BSCA 2OEMA 4X65J 3MR5A 2N4CA 3ZTRA 2VQEF 1UJ5A 4RL1A 4TU9A 2XO6A 4ZPVR 3HZGA 4TQRA 2GS8A 3MUMP 5HQLA 4EZ6A 3KLFB 4OJGA 4C8OA 1HWLA 2G1DA 3NGUA 1OPZA 4O0NA 5A0YA 5DDPC 2P9EA 2MZTA 3MM9B 2B5JB 4JI1J 1WKKA 3KKFA 3BH6B 2UV8G 4ED4A 3OW2R 2V8GA 5HK4A 2R7UA 5DJBA 2ZEJA 1IM4A 3AD9C 3QO9A 3K58A 3BEGB 1V3RA 1UW9A 3QT8A 4ZVUB 3GG1A 1JNRB 4WU3A 3BPDA 4I7FB 4C4WA 2AYEA 2BOAA 4PXDA 1LV5A 1SV5A 1GH8A 4ZVHA 1LKZA 3CO0P 3MECA 2NSCA 4FZVA 1HI8A 3CD5A 3M2UA 1T03B 2HBZB 4EWTA 4O4GB 4RZRA 2ZH5A 4LSNA 4NWBA 2R8JA 2CXEA 2DXDA 1LK5A 1U6BA 5CZVA 1LFPA 1WC5A 4O3PA 2BQRA 4YOEA 1UVIA 4ZMMA 1P8GA 1LWFB 2Z2MA 3MPDA 4IQMA 3VAHA 4FYWB 2V34A 1I5OB 1PC5A 2WOMA 3O44A 3DFEA 4NZ0A 3ETMA 5CYMA 4C6AA 2FD2A 2J8AA 1XMOF 3TZXA 1FF2A 1S10A 4JI3J 4K4SA 2WSEC 1S9FA 1IM6A 3C14A 1VQKS 1WD6A 3C46A 2YPYA 4Y65A 3IG1B 1KLNA 2Y1LB 2L41A 4ZOSA 3W9HA 1RAHB 1SXLA 2CNKB 1QUVA 3BSAA 3OXFA 2ZC4A 4I0WA 2PEBA 2K8GA 1EZZB 4U95A 4G65A 3ISZA 4ZLJA 3MMAA 4LSLB 2WK4A 3GJRB 4KV8A 1HIYA 1JKHB 1U2RA 5T41A 3SCKE 1Q8IA 1R8HA 1ZAXA 1X8DA 1U0SA 2HFUA 3BB5A 3GFYA 3GR0A 2DGQA 1Q16B 3O3LA 4NXNF 2JVRA 4RBVA 3K89A 4XK8C 4Y6IA 2VPYB 1EP4A 4LRBA 4ZS6A 3T41A 3OXLA 1S6QA 4X4QA 3KHLA 1NDCA 1W2IA 4Q44A 2PT0A 2QL9B 2HS3A 3H90A 5B0CA 2RQKA 2FGCA 2BR0A 4TY8A 1IKWA 5KTQA 2M0GB 2IVFB 3QJJA 3WC2A 2B3TB 4PQAA 1NHVA 3MM6B 1N34F 2V4JA 1TQLA 2RHSB 3D1QA 3B78A 1OIAA 4IG0B 3QATA 2LDIA 4ZLNA 5D77A 3OJSA 2J5AA 2DYAA 5EWEA 3J7ZT 4A8XA 2VL1A 2QLJB 2VFRA 2EFPA 3GPAA 4DL4A 2IHR1 1Z4UA 2WW8A 1T7PA 1T9VA 2JNJA 4KAIA 4J37A 4USHA 1S12A 2POKA 2DVIA 1T94A 1XNQF 2Y9HA 1S1WA 2KJWA 1DBDA 2MTLA 2BJDA 3BGUA 3DNCA 3R5DA 1F60B 1RTIB 5G0RB 4DPOA 2N3LA 2HQCA 3FEYB 3B8HA 1VRTA 2W8KA 1U49A 2E1CA 2C3UA 1V9OA 2XNQA 4HDHA 3HM9A 1XMOJ 5FDLB 4IH6A 3QFWA 4K2XA 4V1Ak 1RBOB 3WHIA 4CLTA 2RT3A 3EGNA 1Y5LB 4C7QA 5D15A 3UE2A 4GKKF 4RUAA 2JFKA 2GX8A 5EWGA 2F4VF 1KR4A 4LVNP 2K3IA 4ZK7M 2DNOA 5F8JA 2OP5A 3CE8A 1TFYA 4JI5F 2ALZA 5D4OA 3NGDA 1FXDA 2Z58B 5SUHA 2XCAA 1NJYA 4PRFA 1WACA 3TVKA 2F9JA 1RAOA 4NX9A 3VQTA 5CXTA 4ELVA 2VODA 2R7SA 1IKWB 2OPSB 3G96A 2MKJA 2RU9A 2N3OA 4DLEA 4C48A 3I32A 3VAFA 4QYZK 3H4BA 3BQ1A 2KU7A 3VAIA 1U0HB 1C4AA 1MW7A 5HBMB 3FSIA 1VC0A 4DV3F 1CEZA 4K7QA 3VALA 1VQ6S 3GYNA 2EFNA 1LW0B 1M5OC 1QJHA 2OELA 3ISNC 1KHVA 4PPDA 4F02A 2RNEA 5DDOC 2M4MA 1S77D 2M8HA 2ASDA 3IC1A 3H4DA 2X3GA 3TI0A 2ZHBA 1S1WB 5EUHA 1KBRA 1DQ9A 1HBOA 1NSAA 3KWMA 4G1QB 1NUEA 3GSIA 3DOLB 4M8LA 3V4IB 4O4GA 2JEIA 3MWBA 5LXRA 1U0HA 2HWTA 2F3JA 3EDQB 4EI2A 3JSYA 4BCAA 2OPRA 4B3TF 1HNIB 1Y11A 2NYIA 2QLFB 3I0SB 1YRXA 3KFWX 4OLOA 4Y3CA 4DMZA 2ZH7A 1EIYB 2MKSA 2IVMA 2AZ3A 5KFTA 1X4GA 4EBEA 3ADAC 1SC3B 1X31C 5JUMA 1RTDB 3HJFA 3R3TA 4HL9A 2DGXA 2GV1A 4OMFG 3KDOA 3IR5B 4QPTA 2V4JB 3TUZC 5EN1A 2W2PP 1NSQA 2YVSA 2DNZA 3D5MA 1XJWB 2AEFA 3TEGA 2IFXA 1S9EA 4ZPCA 5LXYA 1F5CA 4CM0A 2AJ4A 2KYXA 3PYEA 3TP2A 4C3MA 4N56A 2PGCA 4RU2A 2ZC3A 1IQTA 1CLFA 4MKAA 4LF9J 4LRCA 2J9DA 4LR8A 5LSRA 2W9BA 5KAKA 4DV3J 3FMWA 5F3ZA 1HNIA 3I0SA 2VG6B 4ZP8A 2U1AA 5T7LB 3WX8A 5HSPA 2YH1A 3SV3A 1UL3A 4ED7A 2R2RA 2NPFA 1T05B 1S1TB 4LR9A 2KG0A 4RW9B 2E7XA 3JQKA 1K1SA 2XTJP 3UFCX 1S0NA 5ETRA 2A10A 4OX8A 3P4UB 1WEYA 3C8YA 4LF5J 3GV7B 1N32J 1RB0A 3HHNB 3G8TA 4FBUA 3H40A 1Y5IB 2UUAJ 3NXZA 1NB7A 2QO3A 3ET6B 2EW9A 2AZ1A 2BE2A 1HI1A 4D3HA 1GX6A 3KK2B 1RA6A 3HSJA 3JTNA 1T05A 1YITS 1TUVA 4B9VA 1T9WA 2GQQA 4AXIA 1JWWA 3P96A 2JLFA 3GR1A 3V4MA 1E6YA 3AA8A 3OL8A 4TYAA 3IXQA 4P75A 4DR3J 2JX2A 3KNAA 2HFNA 4WFNQ 3KHHA 5C2GA 4WF9Q 4OZ2A 1IWGA 3T1YJ 4OZ1A 4OYMA 4USVA 1TL7A 4A46A 3BBCA 2IAJB 2HFOA 4P72A 2C2NA 2HNDA 3ZZTA 4PUOB 2HHTA 4JI0J 1F3VA 1FRJA 2DY9A 2W2MP 3A1YG 4P71A 2XWYA 1C1BA 2XHCA 2DNNA 4WYWA 5A0YB 1D3WA 4LMZA 2CQDA 1RAAB 1AT1B 2DR5A 1W26A 2VFTA 2ZOGA 3H59A 2ZH4A 4EBCA 4B9SA 1B70B 1VQYA 5B0AA 3QWPA 4C0OC 3LGMA 3SDEA 5GAHI 2JL9A 1N6QA 3PKMA 2LQ9A 4ZJOA 4GVLA 2OPPB 2COLA 4OYZA 5K9FA 4OZLA 3BM7A 4FF1A 4LRAA 1G2EA 4LSLA 3CJKA 2KXNB 1PCAA 3ENAA 1K0VA 3HLUA 2Z30B 1H2UX 3AB4B 2ZHAA 4AE5A 5G4DA 5IT4A 3MI7X 1REGX 1FKPB 2HGLA 4DPTA 2OH2A 4WJBA 1XNRJ 4EYIB 4XAKA 3M7VA 2KG1A 1NMEB 4RJVA 2DY1A 3MDFA 3MPVA 4DR3F 4CWBA 3THVA 2UUCF 1VR6A 2ZUAA 4U6PA 3BSOA 1QLNA 4F4AA 4GKKJ 1T3OA 2JDJA 3OL6A 5DLGA 4X4UA 1NPKA 2XO7A 2RHQB 1X5TA 1KD1T 3G8QA 4OQJA 1N5YB 5E3CA 3TJ9A 2YBVA 2CUYA 2D9PA 3N6MA 4RW4A 1VYAA 1Y5NB 2OPQA 4C8NA 2Z0GA 4XDCA 1U02A 3AJ2A 1MU2B 5ITHA 3C3LA 1JJCB 3SCJE 4YB1P 2FUG9 2LECA 4ECWA 2IPOB 2XMMA 2QL7B 1UCNA 3DRSA 3RW7A 1WELA 2ZBCA 3X3UA 2J9CA 4QIWD 4WFXA 1NK0A 1ZZFA 3MD1A 3MPWA 3EZ5A 1OY6A 2GNKA 4F25A 4HR2A 4R5PA 2E5LJ 2ZKTA 4KO0B 4TKTA 2R7OA 4HI2A 4MT1A 3AT1B 1DZ5A 1SC1B 2WVFA 2AF6A 3DXSX 3GIRA 4IFVB 5DG7A 3DGPB 1JMTA 3R2CJ 1M1GA 4WWSA 3CEDA 2BJ8A 1UVNA 5A2QU 3DKDA 5KFRA 1S97A 2NQPA 2ZE2A 3UNGC 2D69A 3NCPA 5LJ3Y 1JX4A 2DHAA 4QZVB 2XQCA 3R27A 4ER8A 3W8GA 3OR2A 5LMUJ 4K4YA 3LPYA 1S57A 4N76A 4HKQA 3RB0A 4OLPA 5IWAJ 3PDNA 4HYKA 1Q81T 1RU1A 3MFHA 1RBAA 2JRSA 3DOKA 4DV7J 3HKWA 3ZO7A 3B54A 5KFWA 4NLSA 1EKSA 2MZQA 1ZM4A 3PRVA 1W25A 3QBCA 4O44B 5GAGI 2DNHA 1YDLA 4J9LA 3BN4A 1TL1A 4OV6A 4N7TA 4YB5A 4TU8A 2XULA 3ZZUA 2IVYA 2QX0A 2KM8C 4DS4A 3PZPA 4ZPDA 2WONB 3NMRA 4FYVB 1N48A 3DDIA 3RW6A 3D66A 1Y3KA 4DDFA 4CYUB 2GMJA 4EEYA 4ZCKA 3VAMA 3EM1A 2LQ8A 3I87A 1J5OA 2DHSA 2FYXA 4MFBB 2GHVC 4MTPA 1V5IB 4OZ0A 1FD8A 4Y00A 1EETA 3OFGA 3ILOA 4O23A 2CQ1A 1LWCB 1P1TA 2VH7A 2BMBA 4Y2IA 3W8PA 4AQYF 3MGJA 1UWBA 3MMBB 1KQFB 2BW2A 4M5KA 2Q1LA 1SQGA 2AW0A 3GV8B 4UY85 3D6HB 5DDRC 1N33J 1UEUA 3BKFA 1RWXB 2LXIA 2MLXA 4MYTA 4NRUA 3G8SA 1U26A 5IFMA 3Q24A 4UF4A 4PG8A 1OYDA 3IG1A 1RT1A 3WDOA 3GYGA 2C2OB 4GMKA 2MGZB 3UDCA 1H6KX 4OIXA 3EJMA 1M5PC 1QTMA 4J9QA 2J6UA 4NI2B 3AXMA 1PGZA 1FDBA 4DCPB 1U1OA 3W1YC 3R7BB 5IT9U 1CJVA 2BX6A 1RTIA 1ROFA 4M5JA 3W2WA 4KY3A 1HWUA 5DG9A 2BW7A 1HHQA 3WX4A 4EYHB 3DLGA 1GNKA 1WTBA 3THPA 1T02A 1HFEL 1S79A 1VS3A 5ETKA 2W2OP 2MGZA 2C2EA 1S1UB 1P1LA 2GVZB 2MZSA 2Z8QA 3RR7A 4QWAA 5HQ8A 1RWPB 3CCVS 3P49B 5E3QA 1RAGB 2YX4A 3NS7B 5M2UA 2QYGA 3IS9B 4WFZA 4AFFA 3PW0A 1FKAF 2HZCA 4QIEA 5M2RA 4ECXA 2B8PA 2XYPB 5ETQA 5IM0A 2VA3A 1PC4A 2FPHX 4NLPA 1JLEA 5D0EA 5HMXA 2M9KA 4DSJA 3EPGA 1WDDA 3I0RA 2DH8A 1FFGB 3DI6A 3FMBA 3MMAB 4LRFA 3G2XA 3U27A 1F5BA 4F4YA 2A1BA 4MK7A 3TEHB 4TQSA 4DSLA 2HHXA 4IFYB 2IMWP 2I5JB 1T9XA 4ZPAA 3ZC4A 5C5JA 2AWZA 2F9DA 3BBFA 2YKMA 4NCBA 1HMVA 4KGXB 2F5GA 2W7OA 3FRYA 1S76D 3NBPA 2XY7A 2VV5A 1RT1B 2GO9A 4J9MA 2M3DA 4WK3A 3PTWA 3HDSA 2J76E 3LANA 2FLOA 5J2PB 4K4VA 4P2SA 1TMMA 4DV0F 4JB8B 1CJKB 3DLKA 4JI8F 4ZDNA 3KMQA 4K5SA 4PG4A 2GW8A 3BPSP 4J9RA 4L76A 4JV1A 5KFIA 4C98A 1HBMA 2WHOA 3PYDA 4WK1A 2NCKL 2V2QA 2LEAA 3CJ5A 3W3SA 1MSWD 2DXFA 4B3OB 1RACB 2HFZA 3KDNA 4OI1A 4YHHF 1VRUA 4O3SA 1RQ0A 3KLHA 1QDUB 2H5EA 2KVQE 1FRKA 1RADB 2Y1RI 1H3DA 4K5RA 2FTRA 4KKOB 3CJ2A 4YDDB 2W2NP 3SV4A 2AGPA 2ZVIA 5HVFA 2EC0A 2CJXB 2WCXA 2HBYB 3GCXP 1NU4A 1ZPVA 1RK8A 5LL6d 3EX7B 3T9NA 1IBMF 1LK7A 1GXUA 2F8MA 5KFXA 3QAUA 3M2UB 3TR5A 5IM0B 4OYIA 4I6WA 5HVGA 1WORA 2RILA 4DUZJ 4W92B 3KLIB 2CJYB 2CPZA 2W25A 4K59A 4DSIA 2VDHA 3W7BA 4B9LA 3TANA 5KG5A 1HQ2A 1RABB 3BREA 4M5IA 3LP0A 3I56S 5DLFA 3QLHA 4KHPJ 4IOCQ 4A8OA 1PYTA 4KE5A 4DFMA 1RWUA 3IWLA 2RE1A 2IM1A 4F26A 1RGVA 2XMTA 1YLXA 4L72B 2GA7A 3TNVA 3EDRB 2R7VA 1ZETA 1BY9A 2JOQA 1DURA 3MEGA 4ETZA 2AKWB 4ECZA 1V6HA 1QAJA 2PFFB 3DC2A 4QPXA 2J6SA 5EX3A 2AYMA 3IP0A 5CYQA 2QG9B 2DNLA 3MAAA 3R5GA 4C2MA 4H4OA 3J7YU 4OZNA 1JLQB 4JI1F 3N79A 1IKYB 3ZZPA 4ILRA 3RJMB 5KG4A 1UJ4A 4ANDA 3I5AA 3UCZP 4K2JA 3Q2TC 1OPIA 1LNQA 2YNHA 5KFPA 4MKBA 1B0VA 1HQUA 1MLAA 3D67A 2V0NA 3F56A 4KO0A 5KFVA 2H1YA 3QRRA 4B3MJ 4KRWA 3E3XA 2BACA 3V81A 1X9WA 3I4PA 2ZJPQ 2F40A 4Q0BB 5LOQA 4LFBJ 1UFLA 2OKQA 1XN9A 2PO4A 2IAJA 4NASA 1IR1A 1RHMB 1D09B 1SVDA 1K9MT 4C8ZA 2LQJA 3MR7A 2VD3A 4CLLA 1TKTA 2VG6A 2V2KA 2B51A 3A12A 1HW9A 3SSSA 2VFVA 1SV5B 4LFAF 3BR9A 2O5DA 3E51A 2K1RB 5I42A 2UUBF 1C1BB 3H5XA 4WBFA 3CCZA 3TVZA 1UA0A 5E41A 4K50A 4JOUA 1N5TA 1CS4A 5K14A 5L9XA 1D9AA 2MKCA 4X4PA 3JYTB 3QYYA 1HD0A 3V6HA 2AYBA 1WNEA 2VOOA 1NPPA 4JV0A 4Q8EA 2BE2B 1VQ7S 2B6AA 4B3SF 2MQQA 4DX7A 1CJKA 5U47A 3DRRA 2B9EA 2GGPB 2GO8A 3I96A 2X1GA 1Q8LA 1HBNB 4WIIA 2ZBRA 3HCXA 2O3DA 2FY1A 2I2YA 3OPKA 3LAKA 3NAIA 1NSPA 5CD4A 3RRGA 2GJIA 5DDQC 4DUYJ 3EGWB 3UCGA 2CWKA 2RF2B 1LFWA 5C25B 5K8PA 4X4RA 1N88A 1KNZA 1KN6A 3D3BJ 1CS4B 1JLQA 2J7KA 2BABA 2N7YA 4QW8A 4DFPA 2CPDA 1V3SA 1YWXA 3KHGA 3C66A 1E6VB 2QSWA 5KT5A 2BDPA 3FVYA 2QV6A 2IA6A 3H0PA 5J1PA 5KFDA 1FWPA 1HHSA 1G3OA 2F7VA 1N4LA 4LBPA 2KXHA 2G0IA 5ETLA 5KT3A 4PUOA 4Y0FA 3GMGA 2CJ9A 3OTDA 1SPBP 3PFOA 2VPXB 1N6QB 2QYCA 3CCES 1B7YB 1EX8A 5EX0A 1QY7A 3TUIC 2RVJA 1XMQJ 3A13A 1HWJA 2XMUA 1K44A 2VUGA 3D4JA 4G1PA 4FS2A 5KFKA 1Q8BA 3DLJA 5HP1B 4MKYA 4CDIA 2YWEA 3DGVA 1AXQA 1LXNA 3ILJA 3M30B 5KT6A 4IKAA 3T6JA 3CCQS 2FLNA 2X51A 2MSTA 4E98A 4PG7A 4Z37A 4EZ9A 2J7WA 4ED2A 2EWHA 3MM9A 2NS1B 2CDQA 3Q8VA 5D0RA 4TLQA 1S1XA 2OFHX 4F4WA 4ED1A 1SJFA 4B3RF 2VASA 2BKPA 2OFGX 2YKNB 4LF1A 4RNNA 4KTQA 3C16B 2DH9A 2ZKUA 3P5BP 2AU0A 3KK3A 1F2GA 4HHHA 2JEJA 2XMJA 5DS7A 2MHNA 3W2VB 3G6YA 4MIWA 1S1TA 2OTJS 3QJLA 4NLVA 4ETXA 2W8LA 2E5IA 5HLFB 4C9DA 2HRUA 3QIDA 1CJUB 4LBIA 5L39A 3MD3A 2VZ9A 4D3GA 5AXLA 1GMWD 1T9UA 3CWJA 1ZYQA 1HL6A 1S0VA 2ZBIA 1MNEA 7AT1B 2WTFA 3UDLA 2UUCJ 1RT7A 3Q8UA 5KFSA 2APOA 3TOQA 5ETTA 1VQ8S 3DLBA 3K5OA 4USWA 1H7WA 3KYLA 4MFBA 2D3OR 2HK3A 3FC9A 3GE9A 3K8VA 3ETOA 4CYUA 2D7SA 4DPYA 2MEWA 1JLCA 3FNNA 4UOFA 2UXBJ 2HQGA 3QO9B 3M6WA 4FYXB 1UPMB 3G82B 3EICA 3KLGB 4HI1A 2W9CB 2UUWA 3SQGB 4R8UA 2G0CA 3MEKA 3SSQA 1UA1A 1NJWA 2OTLS 1YK9A 1QE1B 3SCIE 5F9NA 1GK8A 4EGLA 3IGVA 3TAPA 1F0XA 3KG1A 3H42A 2R7RA 1M90T 1FVSA 1TTHB 3BF4A 1C0UB 1XMBA 4O0IA 3GJTB 3N0VA 2U2FA 3LPEA 3PIPQ 2XMAA 4I2PB 1XQIA 4NMXA 4WPAA 3PX6A 5KG1A 3CJ0A 1QD1A 2V94A 1RUSA 2EC2A 3LP1B 4OHWA 1YJWS 2DR9A 3EPIA 3FUYA 2CNNB 2HLTA 4F0MA 1Y9OA 3NOCA 2VIHA 3MAHA 2BUNA 2ZH6A 3NBPB 3EUNA 4F3MA 1WHVA 3Q8SB 2BV3A 1FWKA 2FJDB 2H3EB 3KUEA 1Z2ZA 3M2VA 4JP8A 4ZCIA 4J9NA 4DV7F 4ED6A 3O5TB 2BM0A 4YDXA 1GAOA 3CMES 4I7FA 3H5YA 1RT2A 1ELOA 3PO4A 4B9TA 1Q53A 1WC1A 4LSNB 1MU2A 3T6BA 3J7A1 1IKXB 2OSQA 4Q2MA 3U02A 3NCQA 2R7XA 2WB1D 3JTPA 1IJEB 2EK1A 1FT8A 3BZQA 1S49A 1FDAA 1RWMB 1JLAB 4F7VA 1VQLS 1U47A 4USMA 1ZA1B 1U4BA 4NLWA 3SEOA 1HI0P 3TVYA 4ZP6A 2AGOA 4FP9A 5BYQA 2BJEA 1YX2A 5HROB 1D8ZA 4JI6F 2MQPA 4P2FA 5JVGQ 2IJNA 2VFSA 5HANA 1FVQA 1AYEA 1LXJA 4DX8H 4EU0A 3QT5A 1VBXA 3A8KA 1RISA 2DH7A 4M5LA 3H25A 4DL7A 3UR3C 3IAS9 1K47A 3L7OA 2XLKA 2GQCA 2VC1A 1ZM9A 3W63A 3LW5C 2UVWA 4Y2MA 3OSPA 2RAQA 2ROEA 1YHQS 5C42B 2KN4A 5KFNA 2VFUA 4QW9A 3IWXA 3Q2SC 2DXEA 2JWNA 4L6V3 3AOAA 4DZ6A 2RQCA 4DQPA 1IBLF 4LF7J 5BYRA 1B4SA 2Q79A 4USIA 3DLEA 3IN5A 4DG1A 4TU7A 1S6QB 3MHYA 2DO0A 3DI6B 2GC8A 4HDGA 3W66A 4NCGA 3CD7A 3K17A 1YI2S 4PQUA 1DFDA 1Y3JA 5AXMA 3UDEA 4E8UA 1VDHA 4KBIA 1OY8A 1NO8A 2B4PA 3Q89A 4LIRA 3AY0A 2VHGA 1YZ6A 2VBZA 1VQPS 1XBWA 1NLKL 1YJ9S 3G71S 1M5VC 1APSA 2VU5A 2UXDF 4LJMA 4WP8A 5L38A 5IXUA 1JXEA 2CPEA 3D54A 3MOZA 3R5BA 1M0SA 1VHIA 2D3ZA 2VG5A 3MM8A 4TN2A 2M5YA 1REVA 5KFYA 1AZSB 4LF8F 1V3ZA 1YTYA 1VQSA 4FDFA 4ILMA 4LF2A 3FZ2A 2CZVC 2R42A 2DGOA 3DLKB 2KTQA 3A8IA 4C8YA 3IRXB 4P7TA 2FJWA 1TKDA 1AA1B 4DR6J 4FYDA 2PMHA 3EVOA 2NREA 3G6ES 4OYXA 2R8IA 1S5ZA 2M52A 2CPYA 2J9DE 4LREA 2E9ZA 2O66A 1IBLJ 1YJVA 2W1BA 1O5JA 1EQMA 3HFZB 1P6TA 4USTA 2I6WA 2C28A 2UVUA 4LFBF 1B7FA 3VGUA 2OD4A 4KIAA 3CB4A 3GYXB 5T7LA 5CYMB 4PAAA 4X4SA 1I1GA 4QU7A 4K0KJ 4PZVA 1DJ0A 4ZVEA 3CCRS 2RKIA 2WVBA 1VHFA 1S7IA 3ZNUA 2ASYA 2ILZA 3NGTA 5C2CA 1RAFB 2DEIA 3M8QA 4UOCA 4AD6A 4FN5A 3J80Y 3JAMY 2NUHA 3AQOA 2KO1A 1L5UA 2YPZA 1RP5A 3M8WA 3D6MB 4NZ7A 4LF7F 2QN6B 1HPZB 1QM9A 1YRUA 3CNQP 3LP0B 4DQIA 5CH7B 2MHEA 2P9CA 3F41A 5D78A 2KT3A 4ALZA 3V6DA 1U8WA 3CO9A 5HVHA 5KT4A 3BYPA 5KOXA 1E6YB 1XK8A 5KFQA 3J81j 2GHPA 3FZBA 1U1NA 2EFQA 3H2LA 3PCOB 3RYLA 4WIQA 3KK1B 1VBZA 2HFSA 1RTHB 5F8LA 3MAAB 1FE0A 1S48A 2NXCA 2UVRA 1BWEA 1HBNA 1WG1A 2QA2A 2ABYA 1T3NA 3R6LB 2UU9J 1Q0NA 2ZUGA 6FDRA 3T1HJ 1S6PA 1DTTA 5A6WA 3ZXWA 3DLHA 2ZOMA 1RE1B 2EFVA 3T9ZA 1VLYA 2KT2A 3MM7B 4BC7A 5C25A 1P27B 4NEZA 4YQWA 2OEKA 1ZH5A 2VB6A 4FBTA 1EKRA 3DCAA 1EAYC 3HHDA 4IRKA 1G4CA 2DNRA 2CFXA 1X4EA 5F9LA 4Q5VA 3FBBA 2HWIA 1PBAA 4E2FB 2DHXA 4M94A 4M1KA 1MMDA 3PW5A 1W7WA 3L95X 4URQU 2EFGA 4NYPA 3VWSA 4CLZA 2M70A 4LSZB 4FNIA 3UQSA 4ZITA 2MKIA 1HNXJ 1NPRA 1YIJS 5BJRA 3DHWC 3K57A 3HP6A 2L08A 1DRZA 2W2QP 4WP3A 2C22A 3GCWP 1SIZA 1PAUB 2A6MA 2K3KA 1HPZA 2ZM6J 2RDDA 1WC4A 2WBMA 2ZD1A 1WOPA 1HQUB 3PM9A 1KTQA 1TMJA 3CULA 4DHVA 2OD6A 1JLFA 2CNOB 1UVJA 4G6VB 2HRYA 4DR7J 4KHRA 4CZCA 2UU9F 3KTQA 4LIWA 1NH7A 3D1HA 3M6UA 1UETA 2WZ1A 4KB7A 4LFAJ 2RU3A 5THWA 3HXMA 4BS2A 4DG1B 2JH3A 4KHMA 2QA4G 4RNMA 1R8BA 3DYAA 4DJBA 1VISA 4OHXA 2XCPA 3FRZA 3T5JA 3TAMA 3K59A 1ZTTA 2DIVA 1OYEA 3HD1A 3ZTQA 4R0JA 1ACMB 1RHUB 3HSDA 3AOBA 3RU0A 2K2PA 3HT0A 1GFWB 3W62A 4ICLB 4RUHA 1YG0A 5F8HA 3M9MB 2GIQA 3BGLA 2Y1IA 2QFIA 4OYOA 1AFJA 3MUTP 4HACA 1UMJA 3UO0A 4DR5F 3GP9A 4J9OA 2Y0SD
chains in the Genus database with same CATH topology
2MJUA 4DL5A 4QWBA 4IH7A 1UVKA 4BDPA 1QAIA 4CO0A 1B64A 2P6SA 1NK8A 4NA2A 4UUWA 4YR0A 3NAHA 1LWCA 4U9RA 3I5CA 2ZJRQ 3BO2A 2BQUA 1TL3B 3M6VA 1L3UA 3VF0B 3QZ8A 1VOMA 2ROPA 3RR8A 2KHDA 2Y1JA 4EUVA 3US5A 4CT8A 3QGIA 1CQNA 4A8KA 4WTYA 1JJ4A 3UWTA 5DGBA 1EP4B 3OV7A 1I6JA 1H7XA 2FVCA 3PV8A 1KVJA 5D3GB 4QJVA 1KOHA 1ZZNA 1Q7LB 5E5NA 3JSMA 3HVWA 2V8HA 5LMUF 2LEBA 4DR6F 1N5SA 4QBUA 1Q86T 4W90B 2EFOA 2V8VA 3T5KA 5HLFA 3TA2A 2HPUA 3OBIA 4Z2XA 4I2QA 4B02A 1SL2A 5CYJA 4QIVA 3H2UB 5FJ4A 3MR2A 3HHLD 3Q8RB 4I4BA 2LEPA 2YNGB 4F50A 1RT3B 1Q78A 2B7CB 2NSBA 4ED0A 2WAQD 1ZAWA 1VK8A 2FJBB 3AH6A 4ES1A 4GC6A 1FTRA 1NZAA 2OLWA 3N5BA 4Q45A 4N41A 3EXCX 1FESA 1RA7A 2DO4A 4I2QB 1S7HA 2IBKA 2DK2A 4O3RA 3DRPB 1QSSA 3NNCA 5F3TA 1HW8A 1LWFA 3IR7B 5GVQA 2CQCA 3SQGA 3M2RA 2V9KA 4RWWA 3OJUA 3GQCA 3VAGA 3IWNC 1C0TB 1QAYA 3MUVP 3DN9A 1GXLA 2E9TA 5F8NA 1FRMA 2ZDPA 4DLGA 5EHHA 3HPOA 1O51A 2YY3A 1NK9A 3CD0A 4G1IA 2R2UA 1D9FA 2N7CA 2HMIB 4NA3A 4TNOA 3GFHA 2YQ3A 2RD5C 2CQ0A 3PVXA 1X4AA 4I1TA 1XTZA 3U1MA 2W7AA 4GO7X 1R8CA 2CQBA 3KHRA 1Q79A 2CQPA 2W9CA 3I31A 3CJ3A 2CQ4A 2XLIA 1U1QA 1TP7A 4X66F 3E2EA 5L1LA 3K5MA 1D1UA 1TL5A 2HVZA 5J2MB 4P6QA 4M95A 4DL3A 5I3UA 3TA0A 5B0FA 2EK6A 4LUBA 3OR1A 3O1LA 2KB2A 3DRYA 1SH0A 4GO5X 1FJGF 1SJ3P 4DR1F 4IRCA 2PD1A 1F9FA 1GXTA 3GFXA 1HARA 3RZAA 2XMVA 4KV8B 2ADCA 4F67A 4OZJA 5T14A 2IC3A 4EO8A 2UZAA 1VFJA 4JI3F 1L3VA 4YB6A 5KFMA 2YWGA 3GZ7A 3KK3B 5D4NA 3BJYA 1YBAA 1U48A 3HHLC 1SC6A 2QT7A 2R9LA 3RRKA 2VOPA 2B9WA 2FC8A 3M4XA 4PPZA 1TKZB 3VZHA 4AYBD 2D74B 4LFCF 2L9NA 2UVVA 4I56A 2PN6A 4IOBA 4KPYA 2FIUA 1NJIT 1BQNB 2HLUA 3DMJA 1U2FA 4ZHRB 1FDNA 4UQTA 2R2TA 2HYIB 4I67A 2DRAA 3BSNA 1S0MA 4NMLA 2OO4A 3NLCA 5KFFA 3GV5B 3PIOQ 3LUYA 3GIMA 3C6TA 1TAQA 5E3RA 2VG5B 2ZH8A 2HVIA 4AL5A 2VPWB 2LU1A 2ATLA 1QVFR 1VBYA 1HQEB 2G13A 5IT0A 4ECVA 4A47A 4C0HA 5KT2A 4OHVA 4PXBA 7FD1A 1A7GE 1R7IA 2P9GA 1U45A 1NK5A 4FPRA 2DR8A 3RB6A 3U7JA 3OHBA 1FA0A 1MMNA 4YMEA 2VC0A 5DQGA 4MIAA 4ZPBA 2GCFA 2MJNA 2VBYA 3TQ1A 2E5JA 1AW0A 3NGKA 1CC7A 4CO5A 5EGYA 3PHEA 1SL0A 4YR2A 1KQKA 4B3MF 6FD1A 2GFFA 3VR1A 3M9OB 1HBMB 4NYOA 3PKYA 3CSKA 3D0HE 2B4UA 1K8AT 3CDUA 1X5SA 4IUFA 1FKPA 1SH2A 3OL9A 1VC5A 5A8KB 1RT6B 2LDYA 3HVTA 3K2YA 2W9BB 2ZH3A 4M5DA 3J7Z5 3MURP 2PIIA 4WZMA 4CQ1A 2XEXA 4X84A 2AJQA 2L48A 4C8MA 1XC9A 2HQIA 2YNIB 2J0QD 2AP6A 3CCTA 3CC7S 2EBGA 2YKMB 1Q1KA 2VKZG 4NZ6A 4GC7A 2Q6CA 1S6UA 4HVZA 4IH5A 1HNZF 4IO1A 2IMOA 3ENQA 3KLIA 4IOAQ 3S8SA 1HQEA 3MPYA 2OPSA 2CZ4A 1S1UA 2VG7A 1DLOA 3GWCA 3M32B 2QLXA 3HHKA 3GILA 3RAQA 3O2IA 4QOTA 3ZZZA 1JIHA 1WEZA 5FD1A 3Q23A 3HHLA 2KH9A 3PJWA 3QGHA 5GADU 5HL7Q 2D1CA 2P5VA 4MK8A 4USJC 3QAEA 4J9KA 1XR5A 2E5GA 1G1XA 1LWEB 4A48A 1FRHA 2I8EA 2MMYA 1IJFB 1BQNA 1VJWA 2CVEA 2MPUA 2NLWA 2Q43A 3OVBA 1REVB 2AGQA 4X4OA 1IKYA 1FRLA 3TAMB 2I5JA 3CT9A 5GAEU 4RLEA 2QA4S 4FS1A 4OJ3A 5D4PA 3H8YA 3FSXA 3POTA 4RW6B 5KFOA 4DS5A 1RTHA 2OPPA 1J5EF 4B9UA 3CTRA 3QJPA 1BGXT 4LVOP 4RKUC 2RRNA 4OZ5A 2DNPA 4ZA1A 2R7TA 3IAM9 3DHXA 1U1KA 4J5OA 2UV8A 4N77A 4J9SA 4ECSA 3VZIA 5BR8F 1OSCA 5K5MA 2R8GA 4NLUA 3CPWR 1GT8A 1RJJA 1FJCA 1J2VA 3RAXA 2OIHA 4WXOA 5LT5A 3BGFA 3LGNA 1U7LA 4KFBA 5B0DA 3MTKA 1WTFA 2AYGA 2DR7A 4QU6A 2ZM6F 1N5QA 3PJXA 2VKRA 1JNZB 2NUUG 4HEA9 1WI6A 4LT6A 4ICLA 1Q7YT 4X62F 5HROA 2DISA 3K8WA 3JSRA 3HT3A 3G8TA 3V6KA 1X7VA 2DNQA 2RF2A 5M2PA 1U25A 2C3OA 4B9NA 1FNMA 2XMKA 3ENVA 5L1IA 2HGMA 1VI7A 2XGQA 5E3PA 4R8UB 1R43A 2L9DA 1VQ9S 4ILLA 3MM6A 4U7UK 1KRPA 3R1LA 4WFAQ 4EO6A 5HBMA 1UJ6A 5K14B 2V4RA 1X5PA 4ZP7A 2R2SA 1HBUA 2QA1A 2IBOA 1FNXH 2R8KA 3ZZYA 1LOUA 1QUPA 1X0PA 3JTOA 3SYZA 1JJHA 4CCHA 4OHYA 1H2TZ 4Y34A 4OX6A 5CCLA 5J2QA 2MDAA 1FE4A 2R8HA 4FF2A 2HGNA 5A8RB 3MMBA 3FEXB 2KT5A 4PWDA 5KG6A 1XR7A 4ITSA 4PKDB 5JJBA 3E8OA 4F3OA 5KFJA 1FK9A 2JFDA 3ICLA 1RT4B 4M5DB 1XNRF 2YNGA 1U1PA 3E01B 4MH8A 2NPIA 3M2VB 4ZHRA 3DOMA 4QR0A 2E1RA 5EDWA 4JYAF 4C3KA 3I82A 4ERDA 2B5JA 4WE1B 4MMOA 4CH1A 3BQ2A 3V6JA 3TW0A 4F4XA 4DL6A 2IM0A 2HG4A 4OX7A 4CI0B 4DSKA 1SB6A 4F4KA 1FHTA 2EI5A 2B6AB 2J6TA 1UWBB 5L1KA 4DR2F 3D1OA 2KYZA 1Y7PA 3M30A 4CO4A 3ENWA 4O3QA 3HX9A 1BQXA 3LH2S 3NS6A 1N0UA 2ACYA 4C11B 3HVRA 2JHEA 3N4WA 1URNA 1CPZA 4KQZA 3HKZD 2KFZA 2UUTA 1HNVA 4Q8FA 2UXCF 3LO3A 2AQ4A 2JLGA 1BQMB 5F8GA 2LVWA 1TL1B 4ES3A 5A8RA 2PDAA 4PXCA 1RT2B 3QMQA 2C3MA 1TK8A 4DF8A 3MXHP 3PEHA 4C11A 1VGYA 2KRRA 4A8FA 1VMBA 4ID5A 1URRA 3H5UA 2ILYA 2CPIA 2C42A 2O01C 4QWCA 2ZZNA 2DCUB 1KVIA 1LQ9A 4A4JA 1UKUA 5E7OB 2RMLA 2PC6A 2XZWA 2FVSA 3UI3A 1DTQB 1NHUA 3UD4P 4TLRA 2J9EA 3SSRA 1MWZA 4BHQA 3KNGA 1OQ3A 4IO9Q 5GAGU 1O8BA 2G4BA 2QEXS 2YX7A 5E33A 4YB7A 3OHAA 4WZQA 1KONA 1T95A 1LW2B 3AJ1A 2MSSA 2WOMB 5IWAF 3T5HA 2AV5A 3CIZA 1N5VA 1Y0HA 3J81Y 1RT5B 4QR2A 4IFVA 1RKIA 3C6TB 1WG5A 2Z2LA 3N9UC 4HT7A