1X5SA

Solution structure of rrm domain in a18 hnrnp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
102
structure length
102
Chain Sequence
GSSGSSGMASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RRM domain in A18 hnRNP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Cold-inducible RNA-binding protein
total genus 9
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x5sA01
5GVQA 1BY9A 3S6EA 3CXCR 5LXYA 2DH7A 2M8DB 3NNHA 1F9FA 3BO3A 4TU9A 1QVFR 2XB2D 2MGZB 2KYXA 2MKHA 1Q86T 4OZ1A 1JJ4A 3K0JA 1IQTA 1WG5A 2KVIA 2DNKA 2PE8A 1YHQS 3B4DA 2KG1A 2DGXA 1DBDA 2HVZA 4QU6A 3P5TL 1PGZA 1OPIA 4P6QA 3TO8A 2HYIB 2KM8C 2DIUA 4CH1A 2RRBA 4C4WA 1M5KC 1SJ3P 3SXLA 1QVGR 1NJIT 1FT8A 1Q7YT 1WG1A 2GO9A 3J7YU 3THPA 3CMAS 3THTA 2CQ0A 2JWNA 1KQSR 2QA4S 3DLLQ 1ZZFA 2QEXS 2DGQA 1SJFA 4IO9Q 1VQNS 2LXIA 2ADBA 2DITA 3P3DA 1VC5A 1N52B 2DIVA 3R1LA 2DISA 2CQBA 2KI2A 2AYMA 1HL6A 2RS8A 1U1KA 2BOPA 1S79A 4LMZA 1HD1A 2DNGA 1RK8A 1YITS 3JB9k 5CYJA 3BO2A 2CQIA 4TU7A 2FC8A 4IOCQ 2VOPA 3CCLS 2MXYA 1VQPS 4W90B 1U1RA 2RUGA 4F02A 2MQPA 1SJ4P 4LIRA 5JVHQ 4UY8T 1U1OA 4W92B 2X1FA 1JJ2R 1UW4A 3G96A 1WF0A 2M88A 2MYFA 2YTCA 1NO8A 2DNYA 1ZZNA 2HGNA 1U1MA 5IQQA 2B0GA 3UWTA 1YIJS 1H6KX 1VQ8S 1WHWA 1U1QA 1M5OC 2FHOB 2AD9A 4YOEA 2FC9A 2OTJS 1M5PC 2DGSA 2MKCA 1SJRA 4IOAQ 3G4SS 1ZH5A 1X4EA 5LSOA 3MD1A 2U2FA 2J76E 2NZ4A 2LKZA 1VC0A 2CPHA 3IWNC 3HHNB 5D78A 2A3JA 2MZ1A 1FNXH 2CQ3A 2CPFA 3NMRA 4J5OA 3CMES 5GAEU 3I55S 2FY1A 3UCGA 5DDRC 1PO6A 3S7RA 3TYTA 1UFWA 2EVZA 1M90T 3VAJA 2RS2A 4IUFA 2LECA 2HZCA 1M1KT 3BO4A 2LQ5A 3ZZYA 3S01A 2O3DA 2CPYA 2FPHX 1WELA 2KH9A 5CA5A 5LXRA 2RU3A 4RU2A 3CTRA 4BS2A 3RW7A 3EX7B 2BZ2A 1Q82T 4Y00A 1KD1T 1KOHA 3US5A 2DK2A 3MD3A 2LXUA 3P6YC 4YB1P 3CCMS 2L9WA 4YUDA 1FJ7A 3CCUS 2I38A 2YH0A 2PEHA 2KHCA 2KN4A 5GADU 1D9AA 4WF9Q 4EGLA 2Q79A 2NLWA 2MY8A 2CPIA 4WFAQ 2UP1A 1WF1A 1X4FA 4ERDA 1HD0A 4TU8A 2XNQA 5DETA 2L08A 3HI9A 2F9DA 5HL7Q 3NS5A 2DNLA 2RVJA 1SJQA 3G8TA 2MKKA 2DNMA 3V4MA 5JVGQ 5LSLA 1FO1A 3OW2R 2RNEA 2AYGA 4CQ1A 2KU7A 3G6ES 1VQMS 1OWXA 2CQDA 2LMIA 3VALA 1URNA 3TP2A 1CVJA 2YWKA 1A9NB 3LQVA 3B4MA 2DNQA 1X4BA 4Y0FA 1R8HA 2G0CA 2EK6A 1XN9A 2OSRA 4QU7A 2WBRA 2MGZA 3PIPQ 2E5JA 1X0FA 5CXTA 2DNNA 5GMKa 1N88A 1YTYA 1K9MT 4F25A 3SDEA 3DXBA 2RT3A 3G9CA 1N54B 2F3JA 1FXLA 3J7ZT 1N8RT 3CC4S 4PRFA 3PIOQ 4PR6A 1P27B 1WEXA 2CPEA 2MZJA 2CQ2A 3L3CA 3UD3P 1A7GE 2CQ4A 5DM6Q 4QQBA 1VBYA 1O0PA 2LEAA 1KC8T 2K3KA 2DH8A 1Q81T 2DNHA 1K73T 2MQMA 4WFNQ 2ZJPQ 2MB0B 2MY7A 1U1LA 2KRBA 3CC7S 4C0OC 5DM7Q 3CC2S 1VQ7S 3MUTP 1VQLS 2DGWA 2MJNA 2MKJA 2AYEA 5MLCV 1OIAA 2L41A 1VQ6S 2XS2A 1WHXA 4C7QA 3MOJB 4QPTA 2CQPA 3FEYB 2DO4A 2HGLA 2JVOA 2DNPA 2M0GB 1VBXA 2MKSA 1X4GA 2K8GA 2MQNA 2DNZA 1WEYA 5FJ4A 2DNRA 1UAWA 2KT5A 1DHMA 3CCSS 1YJNS 4V19X 2MKIA 1WEZA 2CQ1A 2HGMA 3EGZA 2M52A 1VQ5S 2DHSA 2KXNB 3G8SA 3UD4P 3CCVS 1YJWS 1HA1A 3NS6A 4CH0S 1M5VC 4ZKAA 4WKRA 4PKDB 4FXWA 1G2EA 4WCEQ 2G1DA 1QM9A 3VAIA 4WFBQ 1YI2S 2KXHA 4OZ0A 5HO4A 3CUNA 2U1AA 1X4CA 1JJHA 1VBZA 3P49B 2D3OR 2DNOA 2YH1A 2CPZA 3CCRS 3NNCA 2MQOA 1DZ5A 4UQTA 2E44A 2CQGA 2CQHA 2E5GA 2E5IA 2MSSA 1B7FA 1WTBA 1VQKS 2MJUA 2J8AA 3CULA 1X5SA 3MUMP 3EGNA 2OTLS 5ITHA 1SXLA 4U67Q 2LCWA 2F9JA 3MDFA 3LPYA 1U2FA 1R8PA 2RRAA 4Z2XA 2XSFA 1X4DA 1U6BA 2OSQA 2GHPA 1WHYA 2X1BA 1S72S 4TLQA 1KOOA 2M70A 2KFYA 1X5OA 2MZSA 2MZTA 1DRZA 3MURP 5LJ3Y 2J0SD 5BJRA 2CPDA 1RKJA 2ZJQQ 3VAFA 5GAHU 3UCUP 1YWXA 2MHNA 5H1SV 3MUVP 2MZRA 2CPXA 1WF2A 1AUDA 3Q2TC 1P1TA 1VQ9S 1UP1A 2DGUA 2DH9A 2RQ4A 2VODA 4ED5A 1FJCA 4CIOA 5D77A 5IFMA 1X5PA 2LA6A 2N3LA 2X1AA 4FXVA 3CPWR 2J0QD 1H2VZ 1WG4A 2XNRA 2KG0A 2JRSA 3IRWP 2YKAA 3NNAA 2N82B 2RQCA 2DGOA 3CCJS 5IM0B 2LEBA 2DGVA 2CQCA 2EK1A 3CD6S 2DGTA 5DDOC 1U1NA 2M8HA 2MPUA 2M7SA 2CJKA 5DDPC 1H2TZ 2KM8B 1H2UX 3I56S 5DDQC 2ERRA 3SDEB 4M5DB 2AYBA 2G4BA 2CPJA 1X4AA 3U1LA 2JX2A 3S8SA 3ULHA 1JMTA 1VQ4S 2ZJRQ 3D2WA 3BS9A 2V94A 3R27A 2D9OA 3H2UB 2XS7A 3SMZA 3VAGA 2M2BA 2XS5A 2D9PA 1OO0B 1WWHA 2MSTA 1WI6A 2E5HA 1WHVA 5GAGU 5IM0A 2DO0A 1FHTA 2M9KA 1VC6A 2X1GA 1U1PA 2VONA 3CCES 2MQQA 2MZQA 3VAMA 1W2BR 3UCZP 1FJEB 2VOOA 3MI7X 3CF5Q 1X5TA 1U6FA 3FEXB 2JVRA 3R1HA 3BEGB 2OJ3A 2LYVA 2QFJA 2M4MA 2LA4A 3Q2SC 4WIIA 2KXFA 5EN1A 1NU4A 3N9UC 2MMYA 2ADCA 1YJ9S 1L3KA 3VAKA 3MXHP 4LJMA 2DHXA 3VAHA 2OIHA 2MQLA 3ZZZA 1X4HA 2KRRA 4F26A 2N3OA 2I2YA 4A8XA 2DHAA 3CCQS 1VQOS 1K8AT 3VF0B 3H2VE 3U1MA 2DHGA 2DB1A 3UE2A 3RW6A 5LJ5Y 3G71S 1D8ZA 2SXLA 1WI8A 2N7CA
chains in the Genus database with same CATH superfamily
5L1JA 2R7WA 1SPBP 5GVQA 4HDGA 1R8CA 2OPRA 3LWLA 3M8WA 4H4MB 2HHWA 2C3OA 1IWAA 4RUBA 3KLIA 1IR2A 3G87A 3KMSA 1QVFR 3BSNA 3SFUA 1T03B 2MKHA 2OO4A 2VPYB 3JSYA 1JJ4A 3L7OA 5D8HB 1HMVA 4XK8C 2WB4A 3MCNA 1IXKA 5D0GA 1SL2A 4N8NA 2V0NA 5KFNA 4ZVFA 3BSCA 2PE8A 4UW2A 1FWKA 3B4DA 3BBFA 3PG9A 4KHRA 4DV7J 4LR7A 4P6QA 2GMLA 1KDNA 1C4AA 2AEJA 2KM8C 4XPEA 2FJWA 4JI4J 4ECXA 4F67A 4OHWA 5D3GA 4YB7A 1SCJB 3DLJA 1G4CA 1PIEA 3PEJA 1RAAB 2YNGA 4PG8A 4K50A 4B9UA 1HNIA 1NH8A 1R43A 1YX2A 2BJ3A 1SB6A 3SXLA 2HK3A 2LEPA 1UFKA 3HFKA 3QO9A 3CO9A 2KL8A 1FT8A 3JXOA 4RW9B 3CW2C 1WG1A 2VV5A 2CNOB 3PHTA 3MMJA 1T05B 2DYAA 2VUGA 4RW6A 4LF4F 5DG9A 2AX1A 2JWNA 1SQFA 2CQ0A 1AUSL 2X7IA 3A4TA 2D3UA 3JTPA 4O44A 1U2RA 3CJRA 3RUBL 3BREA 3IWLA 4ZOSA 1SJFA 2VA3A 1IKWA 3HX9A 2ADBA 4OQJA 1MMLA 1ZPWX 4GVBA 3DLGA 4QIGA 1NJWA 1YRTA 1X9WA 2K2PA 2CG8A 4Y2MA 3PVXA 2IC3A 3BDEA 3GE9A 4J9KA 2HQDA 1XMQJ 3KHGA 1PJ7A 1RI7A 1EETA 4FP9A 4U95A 3DHXA 3MPYA 5C24B 1Q1KA 2BE2A 4NZ7A 2DISA 5F3ZA 4YR0A 2XGPA 1NSPA 1UPPA 2CYYA 4TNOA 3QGIA 2B7CB 4N5SA 1JLEA 1U1KA 3HJFA 2LU1A 2V67A 3OTBA 1S1TA 4LMZA 4DZ6A 1HD1A 4B17A 5CYQB 1RT2B 4JV1A 5HANA 4CO2A 1Q16B 1RT5B 1Y5LB 2FY8A 2HRYA 2CJQA 2ASJA 1YJ7A 4DR6F 1U8WA 2BANB 1KFDA 2B9XA 2RUSA 4TU7A 1U48A 2HNZB 2ZKUA 2Y8WA 4LF8J 3T6BA 3JQJA 4Y6IA 3CCWA 3O8WA 3IO1A 2OD6A 4DLEA 2J8SA 4X84A 4DPWA 2P2CB 4LIRA 1KLMA 5GMEA 5JVHQ 4CLFA 4J9LA 1U1OA 1JWWA 2R7RA 4PCQA 4L72B 3DM2A 1SUQA 4DR5F 4K0KJ 2X1FA 1JJ2R 1UW4A 1P1LA 2YNHA 3A3PB 2FJVA 3W2WB 3C3LA 1QLNA 1DQ9A 2YTCA 3ETOA 4X4OA 1OJ4A 2HGNA 3U7JA 3ZZUA 2B0GA 5EWEA 1VQ8S 1H6KX 2BM1A 2GFFA 4NLQA 1QTMA 4LF8F 4ECSA 2AD9A 5I4MA 3J7Z5 2FC9A 3BM7A 4JI2F 2A10A 4J90A 4K4XA 1SUQB 4LRAA 2XLKA 4O3PA 4RW4A 2V34A 4R25A 1D0EA 4G1IA 1TL7A 2CJ9A 1PYTA 5DLGA 1RTIB 2ABYA 2B8QA 2NZ4A 1FRMA 3FNNA 5L9XA 3PR5B 2HIYA 2CPHA 3SYZA 3V5RA 3H4DA 1VISA 2J7KA 2HQIA 3TA1A 5KFKA 2JSXA 4AQYF 4X4SA 1RJJA 3AA8A 3JTOA 4KBIA 2LDYA 3RZAA 1QAJA 4ATNA 3MM8A 4QPXA 3CMES 1F2GA 3I55S 1RT1A 1XJWB 5E3AA 2IMWP 2VPZB 4KGKA 1R89A 2L48A 4EUVA 2HMIA 4C11A 1PILA 3S7RA 2J0WA 3EZOA 3PW7A 3MM6A 1MU2B 1IBMF 1MROB 3OR1A 4TYAA 1AFIA 2HQCA 3VAJA 2RS2A 4ZVSB 2WOMB 1UZHA 3BO4A 3GONA 4RUAA 4GKKF 4Q7AA 1KKHA 3MMBA 4G6VB 3NMAA 3W63A 1MNEA 4ZVEA 1X7VA 5CA5A 3ZTPA 2VPXB 3QQCD 4OYOA 4CDIA 2P9CA 3GJQB 3SBMA 3NCPA 4ZIVA 4CO0A 3QSYB 4LQ3A 3G8QA 4LVNP 2JEIA 4BS2A 3M1VB 2IJRA 3QNWB 2BE7D 5I3UA 3US5A 3OBIA 1GEHA 2RE1A 3D5MA 3MD3A 5KT5A 2IM3A 5D4OA 4DUYF 1SJ1A 1LXNA 1TZ0A 3T9ZA 2C2DA 3AJDA 1BQNA 1RAIB 4FVCA 2YH0A 4UUXA 2D69A 4DFPA 2PEHA 1WORA 5D3GB 1HHTP 4LF5J 5GADU 1WUUA 2I0XA 3GSIA 4QW9A 3IGNA 4CO4A 3L09A 1D1UA 1WKJA 2ASDA 2IA6A 3HKWA 4HL9A 4OJ1A 1NRKA 4ID8A 4V1Ak 4F3QA 1QSSA 2NLWA 4LFCJ 1FJGF 1F5BA 1C1CA 4DN9A 2H4WB 4FN5A 4RL1A 2E5LF 2ZE2A 2Y3YA 2YWWA 4LREA 2XWYA 2UP1A 3TZYA 1KBRA 3DRSA 4L75A 2VL1A 4ZPDA 3CO0P 1S1TB 2DPIA 3W8GA 4IRDA 1RT3A 4PXEA 1REVB 4JI7F 1UJ4A 3VGUA 2LQ9A 3M2VB 1S77D 1KTQA 1S97A 1FEEA 2L3MA 4G1PA 1PYSB 2F9DA 3TVKA 1CBKA 2NUHA 3BR9A 1G1XA 3QAUA 3GYNA 1F3VA 3M9NB 2DNLA 2VIHA 1VBKA 3HHEA 3LPEA 1JKHA 2M3DA 1TKZB 4MKAA 3G8TA 1RTDB 1LFPA 3IXQA 2OEMA 3M05A 3NG8A 3S1TA 1RLCL 2XMKA 2N7YA 1FO1A 2ZH4A 4B3OB 1N5QA 4O3RA 1U09A 2XI3A 2VICA 2HBQB 1OWXA 2G13A 4BCAA 4FBUA 3MF5A 1RAJA 1C2PA 3H98A 2YWGA 4A8FA 4LFAF 3H40A 3B8HA 2XGQA 3PW4A 4R8UB 3RB3A 2XMAA 2IBOA 3TUJC 1JLAB 3RAXA 2HURA 3TA2A 4TY8B 2FB0A 2VQEF 2NZCA 2MHEA 2G1HA 2VBZA 3DFEA 4KGZB 4DX8H 5KAKA 4IOBA 2DNQA 4ZPTR 2ZZMA 2B4PA 1HNVA 1NHKL 1S57A 1YG0A 3OTCA 1HBNA 4EO8A 1V6HA 5DQHA 4B9MA 3HK2A 2WBRA 2HFZA 4USMA 1KS2A 1Z2LA 2E5JA 4AUKA 4CTAB 3KLEA 3CJ3A 1N0UA 4WP3A 1S0VA 4WK3A 3GWCA 4ECUA 5CXTA 2B9WA 4RW8B 1FFSB 3DHWC 4TXSA 4LFAJ 1N88A 3CDEA 3BSAA 5KFOA 3DI6A 3UNGC 3UW1A 2XHCA 4C48A 2ZZTA 3N01A 3ADAC 3DOMA 3LTOA 3SDEA 2VQFF 1TL3B 1ROFA 3TVYA 4LF1A 1S5ZA 3BGRA 1E6YB 2RT3A 3CE8A 2Y1LB 3M6WA 4IR1A 1MWQA 1CG2A 3F44A 3QT6A 2E7VA 1UWAA 4FVMA 5U47A 2RF2A 8RUCA 1ZAVA 3PYDA 1UVNA 1LXJA 3PKMA 4KGMA 1LWEB 3OL8A 4C8ZA 1IKXA 4Y2AA 3VHQA 3TR5A 4NMXA 2JL9A 2K1RA 4DEZA 1CJVA 3EICA 1Q7LB 3M8ZA 4NYZA 2CPEA 1QAXA 1XEZA 2VG5B 3AODA 3H5UA 1RACB 1TAQA 2A0FB 4MFBA 5T7LB 3UD3P 3J7A1 4QQBA 5FIIA 4FYWB 2UV8A 3OFEA 2AGPA 3O5TB 4NRUA 2C2KB 1KC8T 2J5AA 4R0EA 2Q66A 3RBXA 4N56A 4IG0A 3JYTA 2MQMA 4A46A 3WQPA 3OQ2A 4QOTA 2Y8YA 5F8JA 2MB0B 2MY7A 4DN0A 5KG6A 1TUGB 3CC7S 1RWXB 3OFFA 4C0OC 3W62A 5DM7Q 1CLFA 3CC2S 1WC1A 2HW3A 1FX4A 3FCHA 2H1YA 4WK1A 5DQIA 5GAHI 1PAUB 1PBUA 2AYEA 2L41A 2BR0A 1TQLA 2DY1A 2C3PA 3MMCB 5K5MA 4JYAJ 4LSLB 4K4ZA 4DQRA 2R8IA 2ZHBA 3MFHA 4FBTA 2BQRA 3ISZA 3J80Y 3EPGA 2HGLA 4HHHA 3LF0A 1NCLA 3DLBA 2K06A 2R9LA 4ANEA 2IM0A 3DRYA 5BYSA 1RAOA 4YS2A 5C2GA 2FHJD 4A8QA 2YPZA 2FHMA 3D6FB 5M2UA 2FJXA 3SSQA 1RT4B 2VJUA 5L38A 2A6MA 5KTQA 1WEYA 4IQMA 3MM6B 1IM4A 1OMSA 1RHUB 4M5LA 1KSPA 1AROP 1U6ZA 4DSKA 3Q89A 2AQ4A 4DHVA 3FRZA 3FBBA 2PIIA 4TN2A 1WEZA 2HGMA 3MM8B 4DOZA 2XO7A 3CJKB 3EGZA 2C3YA 4XDDA 2KXNB 3KK2B 4F8RA 1RBLA 1YJWS 4X4UA 2GIFA 3NS6A 4M5GA 4HLBA 1XWLA 4DCOB 3IS9B 4P71A 3HD2A 2ZBIA 3MGJA 1G2EA 1G6BA 2G1DA 3UFCX 4DBQA 1JJCB 3OJSA 2CDQA 4RZRA 5HO4A 2Y1JA 1K0TA 4DV0F 4DV4J 1T9TA 3PV8A 2JZ5A 1W7WA 1MMDA 3EVOA 2K3IA 3HKZD 4RBUA 5DG8A 4WZMA 1X4CA 2HRUA 1VBZA 2RRAA 3BDPA 2DNOA 4B02A 3V6KA 3CCRS 3OUYB 3BSOA 2MQOA 1EX8A 1LW0B 1U0SA 4DG1A 2AX0A 4Z7CA 3N79A 1HWJA 1RAEB 2HNDB 1GMWD 1R6YA 2CQHA 1WSVA 2E44A 2E5GA 3VCDA 2ZH7A 1KRPA 4GKJJ 4GVLA 1VQKS 3QRQA 4IG3B 3PJXA 1RP5A 3KNAA 2MJUA 3BF4A 4OX9J 3AQOA 1T9YA 3VGSA 2NXEA 3MEEA 2XC9A 4FF2A 1LFWA 1EP4A 4YR2A 2HIQA 3MUMP 4FS2A 3EGNA 4Y34A 1RABB 5DZ6A 1IBMJ 2FLLA 1BD6A 5K8MA 2OTLS 2XZTB 4OJGA 2HVDA 5DJBA 3W66A 4U67Q 4UQGA 4K4TA 1T3OA 2LCWA 4IG0B 3MMCA 4B3RF 4LF6J 1TV6B 3HM9A 2XSFA 2FVSA 4NWBA 4U7CA 5LMNF 2OSQA 5IC6B 4ZCMA 2AJ0A 3BYRA 2LU2A 4TLQA 5HAOA 1S9EA 4EWTA 4PEOA 2RJZA 2KFYA 4OIXA 3LA0A 5J2PB 5LJ3Y 3LAMA 1IKWB 4H4OA 5E2QA 1KWMA 1DTTB 2CPDA 2BKNA 1U26A 1Q0NA 1TL1B 1RT7A 2AEMA 4P72A 1DURA 4OI4A 4AXIA 4EI2A 3UNYA 4ZP8A 3JSMB 2ZJQQ 1HQUB 4XO0A 8AT1B 4WBFA 4DFKA 2RDIA 3QMQA 1IR1A 2MHNA 2YKNB 5H1SV 5GAHU 3PX6A 2ZNZA 3MUVP 5CQGA 1MWZA 3GJRB 4X66J 1AUDA 4NLUA 3Q2TC 4DV1F 5EUHA 2DH9A 1UP1A 2RF2B 4KPYA 2RQ4A 1VCTA 4FPRA 2MDAA 5KFUA 3KLHB 2ZH2A 2W2NP 4URQU 3SIPB 1S0MA 4HDHA 4M5KA 1X5PA 1PYOB 1LNQA 5KFHA 2XY7A 4QWBA 3BN4A 3JYTB 4J9SA 2J0QD 5ETTA 1V5IB 1H2VZ 1WG4A 3D67A 5KFPA 2QYGA 5LSRA 4DPXA 3OR2A 3QLHB 1XR7A 1JLGA 2W2PP 4KGXB 3MPVA 3IRWP 2FD2A 4ANDA 3OVAA 4RW7A 4J9RA 1YRUA 4NLSA 4Q43A 4TY8A 3M8YA 3DRPB 2HZAA 4J7CA 4ZVOB 2WVEA 3VVTA 3W9JA 1NMEB 2FZCB 2LEBA 4KQZA 1BWEA 1WC5A 1HYSA 4G1QB 2AF6A 3G2XA 5KFIA 2QN6B 1NHUA 3MM5A 2PI5A 1UW9A 5JJBA 5E41A 1GX5A 3N28A 1TK8A 2AZ3A 4DPOA 2IC3B 2OMLA 2PD1A 4MYUA 4NI2B 2OI2A 3TAMB 1J27A 1H2TZ 2B9EA 4USTA 2V8HA 3EGVA 4KH0B 1E6VA 3I0RB 5A2QY 2ZH9A 2NPIA 3AXMA 3G82B 4PXBA 5SZTA 4K4WA 2Z30B 3NWGA 3SV3A 2JX2A 4I2QA 2NPFA 3ULHA 2C2EA 2KTQA 2P8IA 4ZMMA 3BS9A 1VFJA 2AJ1A 4DR7F 2ZH3A 2XS7A 3HHLA 1UPMB 2CWKA 3BB5A 1P8GA 4FKYA 2QZ8A 3KG0A 2J9DE 4NLPA 3Q8RB 4NCBA 4KFBA 3RB4A 3MM9A 3PFOA 1KQFB 5GAGU 1S1WB 3IFEA 5J2QA 2DO0A 2H5IB 5HQMA 2DCUB 5K8OA 2XULA 2M9KA 2X1GA 5IWAF 5KFMA 1XERA 3UD5A 2ZM6J 4DV2J 2WCXA 4QZVB 4JI3F 5RUBA 3UCZP 2R7SA 2HFVA 2VOOA 2ILZA 2V8PA 4OMFG 1YBAA 2QV6A 2YKPA 4ECWA 3B78A 1CJTA 1Y4ZB 1ITPA 1EJ7L 1U6FA 3CJ8A 3A12A 3FEXB 3HSZA 3LOUA 3M8QB 1RWWB 3FEZA 2V8GA 3BEGB 6FDRA 3R1HA 2DRAA 4RLEA 3D4JA 3IN5A 3Q2SC 4A8YA 2ROPA 5D15A 2AGQA 4CLSA 1YVFA 1VGYA 3N9UC 4OJHA 4ES3A 5KFJA 1IBLF 3M1VA 3LP2B 2GAGC 1JLCA 3Q8UA 3VAKA 2AIRB 3DKDA 3SFGA 3EE3A 2V5HG 1URRA 3JSRA 4LJMA 3MXHP 2DHXA 4J91A 4ZVGA 4UOGA 3VAHA 4MIBA 3THVA 4F3OA 4ILLA 4F4YA 5HROA 3PEHA 1QE1A 1X4HA 4OHXA 1AZSA 3A3OB 3Q8QB 3HP6A 2EKNA 1GTHA 1K8AT 4JI6J 3U1MA 5EX3A 4CNZA 4AE5A 4LRDA 3GIMA 3FMWA 2DCLA 1Q95G 2WONA 3FGVA 4QWCA 1ICEB 1XR5A 1UA0A 3T19A 1T94A 3KDOA 4ED3A 2SXLA 4B3SF 2BABA 5F8HA 2F63A 2CJXB 2G2YA 2OGUA 3BGLA 3EVMA 3M8PB 3OD2A 4JUZA 1EP4B 5KG7A 3PR4A 3GIKA 3GILA 3PYGA 3LH2S 1I3OB 3QGGA 4F4XA 2JEGA 5LXYA 1F5AA 4DPYA 1IBKJ 3TANA 2M8DB 1F9FA 3HHLC 4Q8FA 5KFTA 3E51A 3FCWA 3LGMA 3I82A 5J1NA 3MCMA 2DR7A 1S1XB 5F41A 4DX5A 1IQTA 3PNIA 2OPPA 4OJ3A 4F04B 1VIXA 2DNKA 5KFZA 3Q8SB 3OL6A 5C5JA 2CUYA 1HBUB 2XG8A 2WTFA 4ED2A 1DBDA 3WC0A 1OPIA 3TO8A 3Q8YA 2H51B 3AJ2A 5B0DA 3OV7A 2OFGX 1G7CB 2Z8QA 5C2CA 3NOCA 1OPZA 1RT4A 2RMLA 4IFVA 3L7UA 1C1BA 1ULRA 3EGWB 4AL5A 2DEJA 1Y5NB 2C3UA 2ZVIA 4LSLA 4ID5A 4P74A 4DX6A 4DV4F 3PX0A 1M5KC 2QLXA 4M63A 5I3PA 3E2EA 3QIDA 3FBEA 4OX7A 1NJIT 4F4ZA 1UZDA 5CAAA 4AXJA 3LAKA 1HR0F 1X60A 2DRBA 2GMHA 3EUNA 4U9RA 3PZPA 3J7YU 4DL2A 2ZD1A 1FRXA 1VMBA 3THPA 3EWGA 3CMAS 4J9OA 2B8PA 2NS1B 4FS1A 2QA4S 3DLLQ 4WE1B 4H4KA 2C2NA 4DFJA 4IO9Q 3IBWA 3EJMA 2V4RA 2VA2A 1WJ9A 1C0UB 2F5GA 1ZBTA 3CIZA 4XPCA 3E3XA 2NCKL 4IKAA 5FLXY 4QWEA 3TZZA 1SL1A 1T9WA 2GCFA 2D3O1 4RNOA 2JJ4D 4C8NA 5KFLA 4M95A 4WU2A 5KFGA 3J80U 2EW9A 2L9DA 1CULA 2GGPB 3C15A 1RWMB 2HG4A 4QIVA 3U02A 4LR9A 3NGRA 1HR0J 2HHHJ 2EFGA 3V2UC 3KJFB 1QD1A 1RT2A 4NLWA 3EPIA 1S79A 4DUYJ 1JB0C 4X64J 2D1CA 1TMMA 1UETA 4PPZA 5D0HA 4TYBA 1RWOB 3HSJA 1D3WA 2XYGB 3DGVA 3H20A 4IH6A 4CRJA 2ZH6A 2AJ4A 2H48B 1N32J 1KLMB 1S49A 2VU5A 3B54A 2ZWPA 3VGTA 3PACA 5JMNA 2AHOB 4IOCQ 2W9AA 2Z4PA 5E0OA 4S0MA 2VH7A 1WOPA 2WW4A 3D0GE 1VHFA 1HLWA 2QJ3A 2QA2A 3EMTA 3I4PA 4NLVA 1IKYB 4HR2A 5B0BA 2EBGA 3RB0A 1I94F 3AH6A 2XY6A 4UY8T 3WIVA 2RSQA 2HZVA 1SV5B 4Y2KA 3AXKA 4PG5A 3G96A 1BMQB 2APOA 4EZ6A 4F2SA 3WX8A 1NO8A 1S59A 1U0HA 1B0VA 1Q79A 1N34J 2I8EA 2E29A 1U1MA 1VK3A 3I4HX 3C46A 2CZVC 1FRHA 1WHWA 2XHWA 3D3BJ 3LP1A 1U1QA 2DD8S 2N4DA 2RH3A 4RNNA 1M5OC 4AT1B 1NDCA 1T3NA 4C3LA 1WD6A 3CEDA 2H5JB 4K59A 5F0UA 2J6SA 3RBDA 2MKCA 3FBFA 4QYZJ 3BR8A 1SJRA 3CGIA 2JLEA 1Q8IA 3G4SS 3RRKA 2W7OA 4ED7A 3NRBA 1QJHA 3HHLB 4OYMA 4OHZA 4HH0A 4K2XA 1JXVA 3MD1A 4PXCA 1TKZA 2U2FA 4ZCKA 5B0EA 4ZLLA 3GV8B 2JEJA 4I67A 1I51B 3TJAA 2C28A 4GO7X 2R2TA 2HFSA 4I2QB 2VQEJ 1FRKA 3IWNC 2E1MC 2AMCB 3R97A 3HHNB 1H0HB 1FNXH 1FRJA 2P9EA 5KG3A 2R7XA 2AWZA 4J5OA 1QY7A 4PG7A 5KT3A 4FYXB 2XSJB 4HEA9 3F73A 2CNLB 3PY8A 4QR0A 5AXLA 2IAJA 5KG2A 1RBAA 5DDRC 3HPOA 4EBCA 1NB7A 2D3ZA 4H4OB 1OY9A 3DYAA 3TYTA 1GX6A 1UFWA 2KJVA 3KLGA 1Q8BA 5H9FK 1BXNA 1B7YB 3GB0A 2ZHOA 4KHPF 5AE2A 3DRSB 5GAGI 2YX4A 2LECA 4LRFA 2FLPA 2WSFC 2FZKB 1C0TB 3S01A 4Q0BB 2CPYA 1WELA 4OV1A 5HQLA 2QA1A 2RU3A 3PKYA 4O4GB 1ACMB 3Q0AA 1FDDA 5DG7A 4A4JA 4DL7A 1PJ6A 1EIYB 2UUCF 3EX7B 1RADB 2JC0A 5HVFA 3J81U 1ZM9A 3UN3A 3ZFVA 1V3SA 2DK2A 2IYGA 2OPRB 4Q44A 3JTNA 2HBRB 1JLFB 2P5VA 2QX0A 1FCAA 2GO8A 3UDCA 5KFAA 1FNMA 1OYDA 3DU6A 3NCQA 2L9WA 3CCMS 4KHPJ 1GH8A 3HVTB 1UEKA 3MMAB 1REVA 3CCUS 2I38A 2JC1A 1H3DA 2W25A 6AT1B 4F50A 1RWUA 3KHRA 3T1HJ 4CO1A 2UUAF 4JI5J 4WF9Q 2Q79A 3M2UB 4HH1A 5J2NB 3TNVA 5CD4A 4RX6A 2OPQA 1RU1A 5C7PA 1UWBA 3MR6A 4WFAQ 1HBUA 3GQCA 2EFNA 4IFYA 4F4WA 2ZZNA 4X62J 4O3OA 2ZH8A 2PC6A 4MK9A 3OL7A 1X4FA 1MU2A 1R27B 2GJIA 1HD0A 3HFZB 5EHHA 3QFWA 4IRCA 5J1EA 4NYOA 1Q5YA 2XNQA 3NCRA 4NLOA 2Q6CA 3HI9A 5HL7Q 1KVKA 1FD2A 2BVZA 4BWJA 5KT4A 3H4BA 4RBVA 4URGA 2HWTA 2UUAJ 4JI5F 3ENVA 1FWLA 2ZUGA 3CWJA 3I0SA 3W64A 1SKSA 3OVBA 2DNMA 4I2PB 5LSLA 3QRRA 1HARA 1B4SA 3L4BC 4ETZA 1HNXJ 2EC0A 1FK9A 4KKOA 2KU7A 1N6QB 1VQMS 1TL7B 3PX4A 2AT1B 2LMIA 1XMOJ 1WTFA 1K1QA 2CFXA 4DR6J 3VALA 1ZAWA 3HDSA 2GIQA 3R7BB 4WTYA 2C1EB 3DU5A 3R7SB 2BX6A 9ATCB 5AXMA 1YZ7A 2FQQB 1HI8A 3B4MA 3DM2B 2FLNA 3LANA 2B4UA 2LQJA 4UOFA 4Y0FA 2G0CA 4K4YA 4QU7A 4U96A 1KNZA 3PYEA 2W9CB 3SI8A 5HK4A 3IR7B 4O23A 3A8KA 2DNNA 3R2CJ 3HSDA 5C42B 1GNKA 1RLDA 3KFWX 1K9MT 3EZ5A 1U7LA 1S6PA 5F0WA 1RUSA 5HP1B 4B9VA 2ZDOA 1CJTB 2Z2MA 3EVWA 1BWVA 2V63A 3ET6A 4MK8A 5FLXU 3G6YA 4CLKA 1N8RT 2GIRA 3D66A 3CC4S 1YBTA 1HPZA 1LWCA 3AQPA 4OYAA 1N36F 3PIOQ 1L3UA 3MPUB 2W1BA 3AHPA 2BE2B 3CD5A 4MMOA 4Z37A 5HMYA 3GV5B 3MAQA 1N48A 4FKXA 3SZ2A 4X4VA 2MTLA 2MZJA 5IC4B 3W61A 1JXEA 2CQ2A 3BV8A 4P75A 5HMWA 3A13A 3M8RA 3L3CA 3BKFA 4IFYB 4RWXA 1L3SA 4E0DA 5KG1A 5KG4A 3LGHA 1O0PA 2LEAA 4AQYJ 4YR3A 3KLFB 1NH7A 4BC9A 3OTOF 4DV5F 1Z2ZA 3M2UA 2CG4A 3PRVA 4CP5A 4EZ9A 2K3KA 2VPWB 1OQ3A 2FJEB 2BRLA 2E5LJ 5BR8J 1QE1B 4J9MA 4KE5A 4P7VA 1UJ5A 2ZJPQ 4LF9F 2UXDF 5M2PA 1NDKA 4KJIA 1OS5A 2Y1IA 1N36J 1UVMA 4ZN3A 5SUHA 1GT8A 1PAEX 2V2ZA 1JLFA 3BYPA 4CYUB 2DGWA 1FKOB 2MJNA 2Y0BB 4RJVA 1OIAA 2HFOA 3GFXA 4XTTA 3T5JA 2XS2A 2FHJA 3DLEA 1J2VA 2QIFA 3E01B 1FRIA 2EG1A 3NOGA 2B43A 1W2IA 2CQPA 2FJDB 3CT9A 3BGFA 4M8LA 4P2MA 3FEYB 4ZJLA 3CJTA 1NNDA 2DO4A 3H7HB 3UR3C 1RAFB 2M0GB 4ANCA 5KFWA 5L1LA 3RJMB 4Q0BA 1HNIB 3NAHA 1TFWA 5BR8F 4LF9J 4MFBB 2HQFA 3KXDA 2DNZA 2QLJB 3NBPA 1NM2A 1XK8A 2R8JA 2YNIA 4NL5A 2LDIA 3CNQP 2K1RB 3KLGB 2D74B 2KT5A 2OHDA 4U8VA 2XMJA 3DOMB 3UN5A 2IFXA 1RHQB 5JXSA 5K14B 5G0RB 2B6AA 2JNJA 1KTVA 2I9SA 2IYIA 3FCVA 3ITHB 4KO0B 2DTJA 2YNFB 3MM9B 1NPRA 2CJAA 2XEXA 3ETMA 4I64A 3G8SA 4CTAA 1U4BA 4LSNA 2HHPA 4CH0S 4ZKAA 1M5VC 1M5PC 2WW8A 1FESA 1TMJA 4FXWA 1RSCA 4O44B 4CT8A 3PYFA 1JKHB 2CIMA 1T7PA 2K7KA 5L46A 4WCEQ 2LFVA 3WDOA 1QM9A 4ZPBA 2OKQA 4PQAA 3W5ZA 5H9EK 2Y0SD 1C4CA 1M1GA 2B6AB 2GHVC 2KXHA 3VAIA 1QAIA 1B70B 2JLGA 3MM5B 2MLYA 3C6TB 5FDLB 3M30A 2ZOFA 2GJ2A 2PSZA 4MAKA 2U1AA 2YNIB 2VQFJ 3O6QA 4I68A 3NGUA 2HFUA 2R3VA 3I9ZA 5D6GA 4WP8A 1N33F 4MKYA 4LQ9A 1O6XA 2HEKA 1U2CA 2GNKA 2XMTA 5HMXA 1DZ5A 2CQGA 4F4KA 1I6JA 2P6SA 1DFDA 4JYAF 2MSSA 3D6TB 4USVA 1FXRA 2NXCA 1IUJA 3R5JB 4DR5J 3C66A 2DY9A 5F8IA 5HVGA 5K8NA 3LO3A 4QIEA 1HIYA 3TJ9A 3ZNJ1 1U02A 4Q8EA 1D9DA 1JLQB 1YSJA 6FD1A 3T41A 4B3RJ 2LLZA 2KFZA 5ITHA 3EDRB 2XM3A 1S10A 3M2VA 1EARA 3W5YA 4NLRA 4Y3CA 2IM2A 3M8SA 3FRYA 4DU8A 3K89A 4DV3F 2O01C 1R8PA 1WDDA 4K4SA 4WPAA 4DSJA 2O5DA 4K2JA 5L9NA 4Z2XA 1RT7B 3JSMA 3DDNA 2Z56B 4KAIA 3BQ0A 1DTTA 2VDIA 1X4DA 4OV6A 2LQ8A 1S7IA 3ZNUA 1WHYA 2QLFB 2V4JA 2HAIA 2X1BA 3AOAA 2GS8A 2YKNA 2DXDA 3MTJA 3SSSA 1SC1B 4PYDA 4DFMA 1AT1B 2F8HA 3MFIA 3V6JA 1KFSA 1IBLJ 2NYIA 2MZTA 1TL1A 3MURP 2BEFA 2HWIA 2ZBRA 3CMQA 1J5EJ 1IM6A 3P8BB 1FI4A 1RKJA 4P52A 3D7SB 4DR2J 5M2RA 4MTPA 2V2QA 3VAFA 1U8SA 2ATLA 3UCUP 3AD9C 1YWXA 3HVWA 3OVSA 1KR4A 3RR7A 2H65B 3KG4A 2HS4A 2W2MP 4KV8A 1SH3A 3IR5B 4NMLA 2JHEA 4WE1A 2E9TA 2ZOMA 1S1UA 2A6OA 2VODA 4N47A 4CIOA 4ED5A 3CJKA 1FJCA 2Q6BA 2RD5C 1RTHA 3VVUA 5IFMA 3ZZTA 5I3UB 3NS7B 1P9QC 4OZLA 3DOLA 2QT7A 3M2RA 4AD6A 2LA6A 2N3LA 3CPWR 4I56A 1KVIA 1J5EF 5A8KB 3RU0A 3D6HB 3PCOB 1XC9A 2CVIA 1GQEA 4ZCLA 3OSNA 3I5CA 1KLNA 4GKJF 2JRSA 2HHTA 4J9PA 2J7WA 2OAUA 1TKXA 2A2CA 3NNAA 3D9BA 4CLLA 5AJ3J 2RQCA 8ATCB 2JFKA 3CCJS 2AV5A 3ENQA 4DR4J 2HVHA 3FQLA 3BH6B 1MMNA 2EK1A 1N5YA 1U24A 4A8OA 2DGTA 1FRLA 3B82A 3N4WA 4IYQA 3Q8PB 5HBMB 1PSDA 3GPAA 4UUWA 5A8KA 5ETPA 1XMOF 4EK2A 3OLBA 3OUYA 1KVJA 3GZ7A 4WYWA 3U27A 1VRQC 4M5IA 3W5XA 3VWSA 1CJUA 2EXUA 3EZUA 4K4UA 3ZC4A 3KKFA 5DDQC 4HHUA 2KYZA 4OZNA 2ZHAA 2ERRA 2BM0A 5LMNJ 1UJ6A 2CPJA 4H4KC 2HWHA 3IAM9 5CYMB 1VQ4S 2JDJA 1JMTA 2WONB 3N6LA 2ZD1B 4DR4F 1RHMB 2H4YB 2VFSA 2BRKA 4TY9A 2D9OA 2MQ8A 2QLWA 2M2BA 4OZ5A 2XS5A 2D9PA 1OO0B 1WWHA 2E7WA 4LIWA 4UTGA 3KK2A 1VJWA 1WI6A 7FDRA 5BYQA 1ZM3A 1LV5A 2B9YA 4GO5X 5IM0A 3V81A 3K5PA 2FLOA 1VQ6S 4ICLA 3PDNA 3MEGB 2VG7B 2B56A 3CCES 1LK7A 5J1EB 2MZQA 3VGVA 1CQMA 1FFWB 1W2BR 2YWHA 1FJEB 2BDPA 2VC1A 1BQXA 1JLCB 4F3MA 4U7UD 4J9UE 1F5CA 1PBAA 1T02A 2R2RA 4N41A 4EBEA 4KKOB 3RG6A 5BXIA 4PABA 2M4MA 2HQGA 4O3NA 4C9DA 2A2DA 3H42A 2LA4A 1YJTA 4WIIA 5E7OB 4JI0F 4BWMA 3ILIA 4KRWA 4P7TA 3O2IA 4DWIA 3A8IA 3WX4A 5EN1A 1NU4A 3C19A 2QMXA 3O3LA 1CPZA 2DHHA 1YJ9S 2QE5A 2GX8A 1SH0A 2QSWA 2AZ1A 3CIMA 4DSFA 1S0OA 1LK5A 2H5EA 2OELA 4LBPA 4DV1J 3DLHA 4EYIB 1OYEA 1SBRA 3K5MA 1JLBB 2HVEA 2MQLA 2XMVA 1JLAA 1VLOA 4OYBA 2GAHC 3MECA 3SEOA 4XDCA 2DKOB 2PMWA 1IKXB 3OT9A 4RNFA 5J2NA 1C0TA 2OPQB 4RBTA 3RBZA 4BC7A 3CCQS 4C8KA 2AKWB 4M5JA 2BJ8A 3FFIB 3UDEA 2DHGA 3UPFA 4DL4A 1E6YA 4IH5A 4MKBA 1X8DA 3MR2A 2GQ2A 2QL9B 3CDAA 1NK5A 1T03A 1S1VA 5HLFB 1AA1B 1WI8A 1I1GA 2QL5B 2FHKA 3IG1A 3VZHA 3ZTOA 1CEZA 3WIUA 3GJSB 1BY9A 4OI3A 2EFVA 3S6EA 4PYAA 1NKBA 4YN3B 2F65A 3BGRB 4JI7J 3QJLA 2G9OA 3CCZA 3UO0A 3NNHA 4URSA 2OFHX 3L95X 2ZM6F 2XB2D 1Q86T 4FF3A 4OZ1A 5CD4H 1S48A 2HAFA 3TAMA 2ZNYA 1VRTB 1QSYA 4C8YA 5J2MA 1HI1A 1WG5A 1OSDA 1UEVA 2V2KA 2KVIA 1NJYA 2GA7A 2UU9J 3CD6S 2C2RA 4ITSA 2CXEA 2ZBQA 1YHQS 1VDHA 3P5TL 3KYLA 1F9EB 2HYIB 4DR7J 2J6UA 2DIUA 4ALZA 3JAMU 2DEIA 3DRPA 4B3TJ 3KJVB 4ZN1A 2Q3PA 4LRBA 3EXYA 3K5LA 4Q5VA 3FSYA 2RRBA 4C4WA 3AOCA 5J2MB 5KG5A 2OLWA 3H25A 4KFBB 2YWEA 4KB7A 3K7RA 1UKUA 3KHHA 1SKUB 2V2VA 2YVSA 3A8JA 3K17A 1SJ3P 3CJ2A 4CYUA 3P96A 2RQKA 5FDLA 5A6PA 4DF8A 5KFYA 4YQWA 1QVGR 1VQSA 4DV2F 2OH2A 2XLJA 4YDDB 1Q7YT 2UU9F 4LBIA 4JI3J 3NAIA 2GO9A 4MKVA 4AFFA 3RRGA 2OD4A 4I6WA 4DPTA 3F0NA 4ZP9A 1J5OB 1VYAA 1R0BG 3BQ2A 1EQ0A 1RTJB 1ZZFA 4DSLA 3QWUA 1ZM2A 3W7BA 4YP3A 1R0AB 2LXIA 2MLZA 1NK6A 1RCXB 4I7FA 4O0NA 4DQIA 5T41A 2IRXA 2IVFB 3BJYA 3PJ9A 4PUOA 2QL7B 1MROA 2FVCA 3ZTRA 1NXIA 2H54B 4KHMA 2GJFA 4CCHA 1TFYA 4UZCA 3R1LA 3SQGB 4BBYA 4QJVA 4ECRA 2CQBA 2NSCA 3HLUA 4ZA1A 1FDNA 2KI2A 4C98A 2HRTA 2QLBB 2RS8A 4N76A 1H7WA 2PA8D 4R5PB 2BOPA 4B3MF 4ZS6A 1IQZA 4IQXA 3R7NB 3HD1A 3T9NA 4RW7B 5CCMA 3GIIA 2COLA 4G65A 3HO1A 4DV0J 5CYJA 1TV6A 2IJNA 2FC8A 3KK3A 4DDFA 3PW5A 1EAYC 3IC1A 3MEEB 3UQSA 2BJ7A 4MJKA 1BUXA 1RTIA 1RT6B 2V8DA 2UZAA 3GP9A 4I6AA 4RO0A 4X62F 3GLJA 1FTCA 3K57A 1U1RA 4TQRA 2W9BB 1UVLA 4MK7A 4OYWA 4WP9A 2OEKA 2RUGA 4DX7A 2HHVA 1DQAA 1EKSA 4W92B 4DL5A 3CDWA 4YFUA 4K5RA 2YQ3A 2B4VA 3IRXA 3PTWA 4MH8A 4PWWA 3RB6A 4LFBJ 2LXFA 3QBCA 4P2SA 2MYFA 5JUMA 2DNYA 1HQUA 4GC6A 1ZZNA 3MM7A 1NK4A 2DR5A 5AE3A 2AJQA 1YJVA 2I5JB 2XZWA 2Q1LA 2YX7A 3UWTA 3JAMY 4DUZJ 2CRLA 1YIJS 1X9SA 4W4MA 1R3NA 2FHOB 3MEGA 4ZIWA 5ETKA 1RWKB 2UVUA 4YOEA 4PQUB 4WJBA 2CJYB 1SC3B 2DGSA 2C2MB 3CSKA 3N0VA 4O4RA 4OYZA 5L8RC 4ZLPA 5F9LA 4IOAQ 3C14A 1M5SA 1RTZA 2ASLA 1JX4A 1FKAF 1ZH5A 1H7XA 4WTOB 5HMZA 4NCAA 4Q45A 3TAQA 3I0SB 3HT0A 3I32A 4MT1A 5A8WA 2J76E 2UXBF 1RT1B 3DLKA 5E5NA 1TAUA 2OUGA 2FVQA 2JFDA 5HATA 4UOHA 4OYIA 1QSLA 1XNQF 5D78A 1FTRA 1VIOA 2EI5A 2HS3A 1PJ5A 1S6PB 3LALA 2MZ1A 2W8KA 4DL6A 2CPFA 2CQ3A 4C0HA 4XAKA 4P10A 4RKUC 3QZ7A 1VC5A 1NKCA 3KG1A 2VG6B 5GAEU 3RR8A 5F8GA 2DBBA 5A8WB 1H72C 5KFXA 5LMUF 3KNGA 2VJVA 2ROGA 4C97A 4B3SJ 3MZIA 2WAQD 3U1NA 1YQHA 1JNZB 3SCJE 3NY0A 4OFZA 1M90T 5E3RA 4Y2IA 1IBKF 2B5JB 1FVSA 1RISA 3BH7B 1RTHB 2LQ5A 3D28A 4I7FB 4N7TA 4DV6F 1XNRJ 1WC0A 1RQ0A 2O3DA 2FPHX 3GCWP 4DI6A 2HNYA 2KH9A 2AEFA 1PC5A 2GVDB 3D1QA 3AAWB 1F60B 3QAEA 4RU2A 4WFZA 4RW6B 1FVQA 1GMWA 3CTRA 3DGPB 3RW7A 1RHRB 5IT9Y 1TR0A 2BZ2A 4Y00A 1Q82T 1RDRA 3QO9B 4DUTA 1HFEL 2XWXA 2BANA 2IDEA 2LXUA 3KUHA 3TJ8A 4TQSA 2R8HA 4ECTA 1IVZA 4RWWA 4USJC 4NLGA 3FSIA 3CJ4A 4NXMJ 4I4BA 3CVKA 4YB1P 1NLKL 2W9BA 3P6YC 1VOMA 2YQ0A 4YUDA 1F1BB 1VRUB 1MSWD 1FJ7A 2KT3A 4OX9F 4F0MA 1XTZA 2CNKB 2KHCA 2KN4A 5E3QA 3KHLA 1D9AA 2BW2A 1XNRF 4OZJA 2MLXA 3DYAB 3DDIA 1L3VA 4WZQA 3WHIA 2FJBB 1I94J 1V3ZA 2FUG9 3PM9A 2MY8A 1NPKA 5G4DA 3T1YF 3I31A 1WF1A 5CYQA 3OXLA 5MAOA 2V50A 2ZKTA 1T11A 1NSAA 2J7UA 3QT7A 3C16A 1JLEB 2Z2YB 3D3CJ 4TLRA 2G2OA 3M30B 1HI0P 2ZC4A 2WVCA 3DN9A 4TU8A 2NR0A 5DETA 1JLQA 4P2FA 2ZVSA 3NS5A 2AW0A 3DOKB 5HI7A 1Q78A 2DT9A 2RVJA 1RA6A 1AW0A 1LWXA 1T9VA 2P6TA 1UTAA 1SJQA 2PMHA 2VZ9A 3IR6B 5CZVA 4YY3F 1LWFB 4RW9A 3PO5A 5IZHA 4FDFA 5THWA 3DI6B 1DJ0A 4O0IA 1Y7PA 2RNEA 3BQ1A 5B0AA 1NBEB 2CDRB 2E9RX 4CQ1A 3GIRA 3HMJG 1J5OA 1Y0HA 1ZPVA 3PHEA 4JI4F 1TP7A 5KFSA 3TI0A 3G6ES 1ZAXA 5AE1A 3G6XA 3H2LA 3LP1B 1SKRA 5C25A 1VJQA 1WC6A 4NI2A 1CVJA 4BDPA 4NLTA 1U0HB 3MTKA 4D3HA 2IVMA 5KOXA 4YY3J 3NP5A 1X0PA 4J9VA 3FDSA 4OI0A 1A9NB 4ZVTB 1SV5A 1YJUA 3CJSA 1NPPA 4CLTA 3T1AA 1R8HA 2ILYA 2OSRA 1XN9A 3BBBA 3JQKA 2RDJA 4LF7J 2EFOA 3GR1A 4ZVHA 2IDLA 2IAJB 4LSZB 3H0PA 5A8RA 3R5BA 2XLIA 3Q24A 2R8GA 4IDKB 3QT5A 4BLGA 2B4OA 4CM0A 4KO0A 3T1HF 2PT0A 2EWHA 5ADZA 1YTYA 2ATCB 5GAEI 3OTDA 3IG1B 1UA1A 2J9EA 2BACA 2YY3A 2J6TA 3GMGA 1S12A 1TL4A 1R8BA 3BKUA 3UR0A 5L1KA 1S7HA 3KLIB 2QG9B 5EWGA 1RT3B 3QYYA 4UOCA 1SIWB 4DL0C 1MN9A 2KT2A 3J7ZT 3PRDA 4IDKA 4OZ3A 4PRFA 1YDLA 1OSCA 3KLFA 7FD1A 2VONA 2OMOA 1RKIA 3ILLA 4LT6A 3T5LA 4NA1A 1O51A 4A48A 4ER8A 5J2PA 3UDVA 1HYSB 1ZS6A 1WEXA 2B7BB 3MR7A 2ASYA 3R3TA 3NBPB 1S9EB 4X4TA 4K8RA 2ZUAA 1KQKA 1NDPA 4DV3J 1H98A 3UN2A 5DM6Q 3C8YA 3H8YA 1VBYA 3GYXB 4KC5A 4ZLJA 2XMWA 1FKOA 4KT0C 5KFEA 3OR2B 3QLHA 1SH2A 5HQ8A 2UVVA 2DH8A 4DLGA 3QZ8A 1XIQA 3DGPA 3CJ0A 2WSCC 1ELOA 2ZBCA 2ZH1A 4RPFA 3HHKA 5ETOA 2DVIA 1VQ7S 3GU0A 3MUTP 1RYSA 5BYRA 2ZOGA 2GHWA 4NASA 4I1TA 1U25A 2JLFA 1XQIA 3CCTA 1WHXA 2VDHA 3R5DA 3MOJB 2XO6A 4QCLA 2WOMA 4JI2J 1IWGA 3AB2B 4Y2CA 4OI6A 3ICLA 4USWA 3D68A 2DR8A 3T6JA 1VBXA 1B0PA 4DR3J 1ZA2B 3WZ0A 1F3FA 2VD3A 2XQCA 3FQKA 1N5TA 1HPZB 3KJNB 2K8GA 4NLXA 4C3KA 2MQNA 2CZ4A 2FVRA 3DXSX 5FJ4A 1UAWA 4JB8B 1HNWF 2ZE2B 1DHMA 2H3EB 4KPCA 3H90A 1BLUA 3KK1A 3I5BA 4V19X 4ZVRB 4C8OA 4LUBA 1Y10A 2EFQA 2CQ1A 1GXLA 2VG6A 2MKIA 3RTVA 2M52A 1S0NA 4V19J 3JS9A 2DR6A 5AJ3F 1S1UB 1U49A 3UD4P 1IJEB 3FMBA 1HA1A 4DUZF 2RU9A 1AYEA 3MHYA 4PKDB 1S99A 1NSQA 2ACYA 2VBWA 1MLAA 1EZZB 3FUYA 1DLOA 4L73A 1HBOB 1TK5A 2OPSA 3M6VA 4X64F 2R7TA 1YI2S 2FVPA 3H5SA 4OHYA 2XBPA 1RZMA 4A8SA 4HYKA 2HHQA 2NYHA 2G0IA 1AZSB 2R7OA 4DV5J 2YQ1A 5LOQA 4CLUA 2IY5B 1P9YA 2QMUB 3MPDA 3R5AA 4CM2A 3N5FA 2D3OR 1Q5VA 2YH1A 2CPZA 3M6UA 1HHQA 1RAHB 3OFGA 3PJWA 3RYLA 4U8YA 1WOOA 4NLYA 4UT4A 3OHAA 4CO5A 5ETLA 1N5YB 4UF4A 4A8WA 3TUIC 4J9NA 3DRRB 1JNRB 1IKVA 1BQMB 3GTYX 4FNHA 4DPUA 4NZ0A 2J8AA 5HROB 3J7YI 4K0KF 3FVYA 3IRXB 3ELHA 3TOQA 1X5SA 1SC4B 4TKTA 3D1HA 3T3FA 2UUBF 4NEYA 4RUCA 2W01A 3MCSA 1RGVA 1FJGJ 2PFFB 3OTOJ 1SXLA 2RILA 3POTA 2GZOA 3WC2A 3W9HA 3JSBA 1WACA 4PWUA 1FF2A 1U2FA 2W2OP 4P9SA 3UDLA 3HVAA 1GTEA 1M5HA 2BE9B 2NXNA 4O4GA 1PG5B 4A8MP 2HK2A 2E1PA 1HBMB 4ZPAA 4RNMA 1U6BA 2GHPA 2KZMA 3OLAA 1NJZA 1T0TV 2EKYA 2YXLA 3RRHA 1KOOA 4YEAA 1X5OA 2VKRA 5GADI 1F9HA 2MZSA 3K58A 4PQUA 2R7UA 4A47A 1N4LA 1DRZA 2HLTA 2J0SD 1R0AA 4NXMF 3GCXP 4QR2A 4YB5A 4NXNJ 1WKLA 3MR5A 1OY6A 5T7LA 1N5SA 4ZP6A 2VASA 3N5BA 4PUOB 2ZWOA 3M32A 2NXUA 2QTWA 3BGOP 3DDKA 3MMAA 5LT5A 3GJTB 1JXLA 2MZRA 4Q2MA 2W8LA 2CPXA 1WF2A 2X3GA 1YJRA 1RTJA 2DGUA 3OSPA 1RAGB 3HHDA 4ZDNA 2GMJA 2C2OB 1XMBA 4KYZA 1KONA 1TUVA 3W8PA 3M8QA 1NAQA 3NKYA 1RT6A 3ENWA 1U47A 1G3OA 1RWVB 5K14A 4FXVA 2X1AA 1S9FA 1N33J 1HKAA 2P9GA 1X9MA 4G1QA 2XNRA 2WZ1A 4O3QA 3LUYA 5B09A 4EBDA 3WBZA 3I96A 2WSEC 2YKAA 3HCXA 5L1IA 1KHWA 2N82B 2UUCJ 1HW8A 1T9UA 2PI4A 4LF2A 3MAAB 3BPDA 2QC3A 4F7VA 1REGX 2BJ9A 3CB4A 5DDOC 2NREA 3HJVA 1U1NA 1BHNA 4DS4A 1LW2B 3A1YG 2M7SA 2VFVA 3W2VA 1Q8KA 3SSRA 4UZBA 2BMBA 2HLUA 2VB6A 1S6OA 2IM1A 2W4CA 3D0IE 3V6DA 5IT9U 3DLGB 1H2UX 3M4XA 3G82A 3IBFB 3I56S 3SDEB 1RE1B 4M5DB 5IOLA 4ZJQA 3I5AA 1WC4A 5L39A 5LM7E 2G4BA 2HFNA 3M6XA 1X4AA 4HI1A 2IHR1 4GC7A 3U1LA 1ZTWA 3S8SA 1HQ2A 4ZPWR 2HHXA 3FFIA 3SQOP 4B3TF 1IR0A 1T05A 1FDBA 2IJFA 4F0KA 4RU9A 3R27A 4H54A 2E1RA 4L74A 4NCGB 1CS4B 5HLFA 4F2RA 4ZHRB 5EX0A 1TKTB 2C42A 5HJYA 5D4PA 3D1OA 2MSTA 4R0JA 2DXFA 3K59A 2YX1A 2ZEJA 2E5HA 4C2MA 4DR2F 2WHOA 1F2HA 3MAHA 4OLOA 4PPDA 4USHA 4KR0B 2IRUA 4A8KA 1X31C 3IWXA 2RKIA 1YGYA 2ALYB 2BBEA 1U1PA 4R8UA 1VC6A 4UY85 4ZPCA 2RRNA 1HBMA 2BXJA 3VAMA 3MI7X 3CF5Q 2Z0GA 4EFAC 4IR9A 2V9KA 5HP1A 1B3TA 1FE4A 1Y11A 2HKEA 3TA0A 1DTQB 2UXCJ 2LYVA 2Q43A 4DV7F 1SC6A 4PXDA 5CHCB 2M5YA 1S6QB 4HACA 3KMQA 4QYZK 3W3SA 4HVZA 1XMQF 2UVWA 2EC2A 4RNHA 2E66A 2MMYA 5KFFA 3J81Y 2IPOB 2ADCA 3GFHA 3KTQA 3KOAA 2O66A 3W60A 1L3KA 4H4MA 1M1HA 3GG0A 1NK0A 2HHSA 2DRDA 1RWNB 1NSKL 1Y3KA 4NPOA 4USKA 4B08A 4ECVA 4WWSA 1KQGB 5KFCA 2EFPA 2V8VA 1S4EA 3HFVA 2D7SA 4ZVPB 5CCLA 2OIHA 3L9ZA 2KFNA 4OYPA 1FKPB 1HWIA 4WU3A 4LF4J 3ZZZA 1Y00A 5HVHA 2KRRA 4NA3A 4ZCIA 1WOSA 4F26A 5ETRA 2AP6A 5KT7A 2I2YA 1C1CB 2BJ1A 3P45B 2HHUA 4JP8A 2HS0A 2XYHB 3GSDA 5T14A 2VG7A 4U7UK 3FKBA 2ZH5A 2HBZB 1HWKA 2J0XA 3H2VE 2NXJA 1DLOB 1Z1ZA 2FTRA 3OXFA 2DB1A 4ECYA 3RW6A 3AT1B 5LJ5Y 3G71S 1OQ6A 4ZITA 1TVRA 5DLFA 1D8ZA 3FSXA 3T5HA 1T8EA 1JK9B 2N7CA 1LWCB 3VQSA 2L9NA 3IA0A 5KFQA 4PWDA 3GFZA 1CJUB 1K47A 3ENAA 4PG4A 3R6GB 3CXCR 1TTHB 2EEYA 2BOAA 2DH7A 2WBMA 3MCOA 3DRRA 3BO3A 4TVAB 4TU9A 4X2BA 2GVDA 2MGZB 2KYXA 3TZWA 4CZCA 2HNYB 2EG2A 2V9WA 3K0JA 2G0JA 2VBYA 3KLVA 1O8BA 5EWFA 1HW9A 3UVJA 3VZIA 4K4VA 4OI1A 4C8LA 2UXDJ 1TL5A 1IKVB 1BQMA 1ZETA 4QU6A 2UXBJ 2KG1A 2W9CA 2DGXA 3MR3A 2HVZA 1WNEA 4IRKA 2VFUA 5A76A 1PGZA 1PCAA 2AJFE 4RW4B 3Q86A 1EHWA 3OPKA 1HNXF 1TK0A 2HMIB 4JI0J 4CH1A 2BKPA 4ZJOA 2FZGB 3L7PA 5HN0A 2BUNA 1HBOA 2C2ZB 4NYPA 4OZ2A 3UVJB 3D6MB 1FK9B 5D0RA 5I42A 4B3OA 3NLCA 4PWDB 4DQSA 4LF6F 4I2PA 2VFTA 1Q53A 2VKZG 1ZOTA 3BPSP 1S4FA 3O1LA 3DLKB 2HNZA 3THTA 3KDNA 4ECQA 2DPJA 3QJJA 1I5OB 1DARA 2QRRA 3IS9A 1KQSR 5DZ7A 2QEXS 3W9IA 2DGQA 3IM8A 1VQNS 2RHQB 4O3SA 5DRKA 4FF1A 1DTQA 2YKQA 2DITA 5K8PA 3QPIA 3P3DA 3I6PA 2QFIA 1VR6A 5DQGA 4X65F 4DR1F 1YZ6A 3PRBA 5AT1B 1N52B 4WXOA 3ZZ0A 2DIVA 5KFRA 5EDWA 3V4IB 4NLDA 3QRPA 3CD7A 1NKEA 3NGKA 1LWEA 2UUBJ 1KN6A 4C0BA 5KT2A 2AYMA 4QYRA 5CABA 1HL6A 3R6LB 2W7AA 4MYTA 3NXZA 4FYVB 3X3UA 4RUHA 1D8YA 4JI1J 2VG5A 1GMVA 1AFJA 2EPIA 5F8NA 3FC9A 2DNGA 1TKXB 1RK8A 2V4JB 3R8YA 3H5YA 1YITS 3F56A 1UVJA 2FIUA 5D0EA 3AJ1A 3JB9k 4NCGA 5C24A 4JV0A 3BO2A 2CQIA 4E98A 2C3MA 4EMDA 4KY3A 4WXWA 3UI3A 1FNOA 2VOPA 3CCLS 3TX8A 2MXYA 1UEUA 3H59A 3OL9A 3QIPA 2H9ZA 3HVTA 1TL3A 1VQPS 4Y28C 1LEOA 4GKKJ 5B08A 4NE9C 1WDTA 3IMQJ 1NEEA 1NHVA 3ISND 4CI0B 5EGYA 4NXNF 4HTIA 4F0HA 2MQPA 1SJ4P 4F02A 3V6DB 1T95A 1HHSA 1S6UA 4U6PA 4DMZA 1H38A 1FDAA 1WF0A 2M88A 4X4RA 4DCPB 1NK9A 4CO3A 1CJVB 3TEHB 2FGCA 1BE4A 1YKWA 4FNIA 5IQQA 3D0HE 3ISNC 2AU0A 3GR0A 4ELVA 5J2QB 5F8MA 4OYXA 2OTJS 2YBVA 4QWAA 1VRTA 2V4QA 2XMUA 2PEBA 2GV1A 3OHBA 4LFCF 3OJUA 1X4EA 5LSOA 1CS4A 3NEKA 1N5VA 5IV3A 2F7VA 2YPYA 3QIPB 2BYCA 5ETNA 4ES2A 2XSJA 2LKZA 2NUUG 2W2QP 2YNFA 1VC0A 2YKOA 4QIFA 3QGHA 2A3JA 5A6WA 2XI2A 3G6VA 1ZYQA 4M5MA 1LWFA 4ELUA 4GRSA 2O67A 1RWPB 1GXUA 3MAAA 4FPIA 3NMRA 1CJKB 1FE0A 2BW7A 3TARA 2FY1A 1CC7A 3UCGA 1LW2A 3HZGA 5G0RA 1YRXA 1PO6A 1HNZF 4X66F 1CULB 2GGPA 2ZITA 3C15B 5CYMA 2PA3A 4DL3A 2PO4A 1HQEB 4N77A 4ZVQB 1W26A 1HNVB 5B0CA 2HVIA 4AYBD 2EVZA 3IBCB 1YBUA 3MECB 3Q8VA 4CLYA 5ETMA 1QTNB 4IUFA 2HZCA 1M1KT 5FD1A 2A1BA 1JQGA 1UCNA 3ZZYA 1R31A 1NZ8A 4MIAA 1JLGB 3CDUA 1SVDA 1RA7A 2MEWA 2XYPB 2YKMB 3QSIA 5ETVA 1R8AA 2HPUA 4ZP7A 3W65A 5LXRA 4XIUA 2VHGA 1U45A 4FF4A 1RTDA 3LW5C 3I87A 5AXNA 4DZDA 2A18A 3KJQB 4DF4A 1KD1T 3DLEB 1KOHA 4JBCA 1RHKB 5I42B 4QR1A 3SCLE 3AFGA 3D54A 2G2ZA 3BN7A 2WB1D 1SIZA 3IM9A 3M7VA 4IFVB 1MG7A 2D41A 4WYLA 4KIAA 5D4LA 3E8OA 3T5KA 3FZBA 1PKUA 4EGLA 3CJQA 2R2UA 2W7PA 5F3TA 2F4FA 4C11B 2GVZB 5DO2A 3A3NB 5DGAA 1LW0A 2CPIA 1NB2A 1W25A 2B5JA 4ICLB 1LKZA 1VHIA 3NL0A 2IBKA 2JEFA 4DQPA 2BJEA 1BC6A 1V3RA 1S1XA 1YLXA 2MKYA 4MIWA 9RUBA 5DGBA 4QBUA 2L08A 1GAOA 1MW7A 2OP5A 3CDBA 1FERA 4GMKA 1DY3A 3POTB 2ZDPA 1GMUA 5I3QA 3TUZC 3E01A 3ZXWA 3PW2A 3DMJA 2MKKA 3V4MA 2XTJP 5JVGQ 3K2YA 2Y9HA 4ECZA 2FDNA 3RAQA 3HVRA 4OI2A 3OW2R 2IVYA 5A2QU 2AYGA 4YHHF 1B64A 1Y5IB 4ID5B 4DG1B 1UMJA 2IRYA 3BGUA 2CQDA 1WSRA 2DR9A 5A0YA 1S76D 4I0WA 1DAXA 4D3GA 1XNQJ 4L3NA 3KUEA 5CH7B 4K5SA 1URNA 3TP2A 3P5BP 4AL7A 4DSEA 2YWKA 4NZ6A 3W1YC 2KZZA 1H73A 1GFWB 2RB7A 1C1BB 2IA0A 2BQ3A 1N6QA 2B3TB 3LQVA 3FBCA 2K7JA 1UVKA 2QYCA 3AB4B 3BZQA 3OR1B 4LR8A 1X4BA 2VF3A 4PZVA 2GQCA 2POKA 2EK6A 2Z2LA 3MEKA 4HT5A 4LVOP 2MGZA 4QWDA 5A0YB 3PIPQ 4CWBA 2QMWA 1EQMA 5IV4A 4CNYA 5KFDA 1X0FA 4KTQA 2YNHB 5ETSA 1RBOB 1A6LA 4EYHB 4EEYA 1PC4A 3JQMA 5GMKa 2ROEA 4ENOA 1H74A 3M8PA 2KDOA 4QIWD 2R8KA 4F25A 3KK1B 1AXQA 3DXBA 2FGOA 1NJXA 4JI6F 3C14B 1VS3A 5F9NA 2IMOA 3G9CA 1N54B 2V6AA 3K8VA 4IO1A 2F3JA 2IIHA 1FXLA 1RHJB 3KK3B 4I69A 5B0FA 2BV3A 1SQGA 3R9LA 4NX9A 1UL3A 1UWBB 1P27B 4HHJA 4PR6A 1RT5A 4NRTA 4G3IA 1RXOB 4ILRA 4J37A 2HBYB 3ILJA 3MM7B 1S1WA 3PXGa 5DS7A 3ZO7A 4R5PA 3K8WA 3OFHA 1A7GE 2CQ4A 3F41A 1QUVA 1TKTA 1BGXT 2QO3A 1GK8A 2PMZD 1LOUA 4LF5F 4NA2A 3N6MA 2DNHA 1Q81T 1K73T 2O1PA 1FKPA 4WFNQ 2J9DA 3FJ2A 5LMUJ 1R7IA 3J7AN 1Q4RA 2KRBA 1D09B 1EB0A 2W4DA 5J1PA 4DQQA 4DCJB 2C22A 1U1LA 3PO4A 4QW8A 4F36A 2EBEA 1WKKA 1ZA1B 4JI1F 2QGFB 2MKJA 5MLCV 1QAYA 4KV8B 2F40A 3DMJB 3ONQA 3X1LB 2CKWA 2R4FA 3LP2A 4FYYB 3W2VB 4QPTA 4C7QA 1VQYA 2HQ3A 2KKHA 3Q23A 2Z58B 4ED0A 3HSGA 2JVOA 1NDLA 2DNPA 5KG0A 5IWAJ 2MKSA 1S6QA 2WVFA 1QDUB 4HACB 2KO1A 1KP6A 2BA9A 3AD8C 5IQ6A 1Y3JA 1X4GA 3TQ1A 1SI9A 2PGCA 3TRGA 4DSIA 3ZTSA 2UUTA 2XZDB 2F8MA 3M9OB 4F4AA 3FK4A 5IXUA 2DNRA 5C25B 1SKWA 4ILMA 3CCSS 1YJNS 4GVBB 2CNNB 1FFGB 2BKOA 4ZPVR 4ZHRA 1FXDA 2JOQA 1APSA 4C8MA 4YMEA 2GW8A 3MOZA 1FEHA 2X3DA 4RW8A 2BQUA 4HI2A 1KEKA 1VQ5S 2DHSA 2KHDA 3KLEB 3CCVS 3C6TA 4WKRA 2Z57B 4M5DA 3TWZA 1SQEA 5KFVA 3HULA 1E6VB 3I0RA 1HBNB 4OHVA 3T1YJ 3NGSA 4LF7F 3TUPA 2YNGB 3LP0B 4NEZA 4B3MJ 3ITHA 2LVWA 4L6V3 3DOKA 4WFBQ 1HWLA 4OZ0A 5A8RB 4J9QA 1GXTA 3NGTA 3OXGA 2V68A 3KJVA 3CUNA 2CADA 3Q83A 4Y65A 4LSNB 4CLPA 3FZ2A 3ZTQA 2B51A 3B6BA 5IT4A 2KB2A 4ELTA 4FXDA 2PDAA 1NK8A 3ZZRA 3A8EA 1JJHA 3V6HA 1EKRA 3P49B 3NNCA 3R5GA 4OX8A 3EYZA 1B99A 1XBWA 2NQPA 3GG1A 4UQTA 3ZZOA 5GMDA 1F0XA 2E5IA 2R7QA 4FZVA 1B7FA 1WTBA 2AJ2A 2ZBPA 4KGVB 5KFBA 1BQNB 3PW0A 1HNZJ 1CJKA 1N34F 3CULA 1HMVB 2CJBA 4ETXA 3EXCX 5B7WA 3NGDA 4ZK7M 1IKYA 1UFLA 4P73A 1F6TA 4WFXA 2W24A 2XCPA 4IH7A 2XCAA 4B9SA 3C16B 2F4VF 1V9OA 1O5JA 2F9JA 4IG3A 3MDFA 3LPYA 2DJWA 2J9CA 4C6AA 3RBEA 3KLHA 5E33A 5AXKA 2VBXA 4HT7A 3C6UA 2UXCF 2E1CA 2V69A 3MMBB 1S1VB 2CA9A 4NOHA 1VI7A 1Q8LA 3IP0A 2UVRA 2WVBA 3DRXA 1S72S 4HKQA 2I1RA 3MEDB 2R7VA 2ZC3A 3R2DJ 3M32B 2M70A 1VK8A 2RHSB 3RGIA 4DJBA 4EO6A 5E3CA 1JLBA 4RR5A 5IT0A 4WIQA 1TELA 2Z2ZA 2WVDA 4WKYA 4ES1A 4B9TA 2JH3A 4N8OA 3M9MB 3CJ5A 2VFRA 3ZZPA 5BJRA 4EU0A 1NK7A 4PG6A 1N56A 2RAQA 4DR3F 3GIJA 2N4CA 2F4VJ 3TX0A 1HWUA 3MPWA 1LQ9A 2OPSB 3EM1A 1ZTTA 4CLWA 3ET6B 1VLYA 4L76A 5H9FJ 3HT3A 3ILOA 4W98A 1VRUA 2LP4A 2RDDA 5CZXA 3TQEA 1RB0A 2WRMA 4JOUA 4M5HA 1P1TA 1Y9OA 2QSFA 2QA4G 1VQ9S 1K0VA 2ACMA 3J81j 4ED8A 3VV2B 1VQLS 1T9XA 2CZ9A 1WC3A 5D77A 5HSPA 1MWYA 2RIJA 1CSJA 2ZFHA 3SV4A 4B9LA 1K1SA 3KWMA 1UVIA 1S9GA 2GC8A 2CWXA 2XMMA 3CD0A 4KSEB 3TAPA 2DXEA 5LL6d 3P4UB 3VTIA 2F8EX 2HNDA 2KG0A 3QATA 1N0VC 2R2SA 5C42A 4ZVUB 2NSBA 4BHQA 4CLZA 3AD7C 4M5NA 3DCAA 2I6WA 1L3TA 3IAS9 2DGOA 3IGVA 3I9V9 5IM0B 2OPPB 3TW0A 3G86A 3V81B 5E3PA 5HBMA 4ERDA 2DGVA 2CQCA 2WK4A 5F8LA 4JV2A 2I5JA 3K5NA 4YHHJ 5K9FA 3GFYA 3C2PA 5KT6A 2M8HA 2GQQA 4ED6A 1SL0A 2MPUA 3MWBA 3W2WA 4LFBF 4WFYA 3V4IA 4M1KA 2CJKA 4ZLNA 4Z7YA 5DDPC 1IBCB 1CQNA 1C0UA 2KM8B 5KOWA 1TKDA 1TVRB 2OEJA 2BJDA 3KUGA 2AYBA 4OL8A 1OY8A 2CAJA 1IJFB 1S9GB 3QWPA 4LBHA 1B0TA 4W90B 2ZJRQ 2UUWA 5HJXA 3D2WA 4JV5J 2KVQE 1HNWJ 2V94A 2X51A 1JIHA 3H2UB 4HTJA 4USUA 3SMZA 1KHVA 3VAGA 4LRCA 2VC0A 2PFDA 1N32F 2FJAB 3Q22A 2E7XA 3EDQB 4YB6A 1DQ8A 3N6NA 3H5XA 3SCKE 1WHVA 3RAMA 5IS2A 1V5VA 3AOBA 4K7QA 1YK9A 1R6VA 4P2XA 1FHTA 3VQTA 1Z4UA 3HHLD 1FA0A 3HF5A 4M94A 2MQQA 4B9NA 3QFHA 2YWFA 3AA9A 3O44A 4Q2LA 4YDXA 1QUPA 2XY5A 3NWRA 3QT8A 4JV5F 4JI8F 3M2RB 4USIA 1M0SA 1X5TA 2RQMA 2LQBA 4X4PA 4X65J 4DR1J 3HZEA 3BBCA 2JVRA 3TVZA 3BKTA 7AT1B 4X4QA 2OJ3A 2QFJA 3PFEA 2GVZA 3OTEA 1L5UA 4DXLA 1MN7A 4AL6A 1NZAA 1ZM4A 2KXFA 5H9EJ 4CT9A 1TUWA 1NUEA 4FYDA 3DOLB 1P6TA 1FX2A 2PN6A 4DV6J 1XR6A 4ED1A 4KH1B 2Y1RI 3GYGA 4OLPA 5K20B 3LGNA 2E9ZA 1RU2A 4OX6A 2YKMA 3GV7B 3K5OA 2HHHF 3QGPA 4DU7A 2UV8G 3SQGA 2FYXA 4JI8J 4X4NA 1EETB 3TEGA 1FD8A 4E2FB 1CC8A 2AGOA 1RCOB 4L3KA 4E8UA 5D4NA 1TU0B 5B0GA 2KJWA 2CVEA 2N3OA 4PAAA 1FWPA 3R5CA 1AB8A 5ETQA 4A8XA 2DHAA 1A0OB 2RKIB 1R0CB 3C6UB 1VQOS 1IN0A 2F1FA 3VF0B 1RYRA 2W4PA 3QJPA 2HSEB 3SCIE 3LP0A 3VR1A 4CH7A 3LWMA 4DS5A 3UE2A 2E1AA 3MEDA 4ED4A 3TZXA 1HQEA 2R42A 3AY0A 4C3MA 3DNCA 1K44A 4I6YA 3HXMA 3DC2A 2ALZA 1D9FA
chains in the Genus database with same CATH topology
5L1JA 2R7WA 5GVQA 4HDGA 1R8CA 2OPRA 3LWLA 4H4MB 2HHWA 2C3OA 3KLIA 3KMSA 1QVFR 3BSNA 3SFUA 1T03B 2MKHA 2OO4A 2VPYB 3JSYA 1JJ4A 3L7OA 5D8HB 1HMVA 4XK8C 2WB4A 1IXKA 1SL2A 4N8NA 2V0NA 5KFNA 4ZVFA 3BSCA 2PE8A 4UW2A 3B4DA 4KHRA 4P6QA 2GMLA 1C4AA 2KM8C 4XPEA 2FJWA 4ECXA 4F67A 4OHWA 5D3GA 4YB7A 3DLJA 3PEJA 2YNGA 4PG8A 4K50A 4B9UA 1HNIA 1NH8A 1R43A 3SXLA 1SB6A 2LEPA 4RW9B 3HFKA 3QO9A 3CO9A 1FT8A 1WG1A 2VV5A 3MMJA 1T05B 2VUGA 4RW6A 4LF4F 5DG9A 2AX1A 2CQ0A 2JWNA 3JTPA 2D3UA 4O44A 1U2RA 3BREA 3IWLA 4ZOSA 1SJFA 2VA3A 1IKWA 3HX9A 2ADBA 4OQJA 1MMLA 1ZPWX 3DLGA 4QIGA 1NJWA 1YRTA 1X9WA 2K2PA 4Y2MA 3PVXA 2IC3A 3BDEA 3GE9A 4J9KA 3KHGA 1RI7A 1EETA 4FP9A 5C24B 3DHXA 3MPYA 4YR0A 1Q1KA 2BE2A 4NZ7A 2DISA 5F3ZA 2XGPA 2CYYA 4TNOA 3QGIA 2B7CB 4N5SA 1JLEA 1U1KA 3HJFA 2LU1A 3OTBA 1S1TA 4LMZA 1HD1A 4B17A 5CYQB 1RT2B 4JV1A 4CO2A 1Q16B 1RT5B 1Y5LB 2HRYA 2CJQA 2ASJA 4DR6F 2BANB 1KFDA 2B9XA 4TU7A 1U48A 2HNZB 2ZKUA 3T6BA 4Y6IA 3CCWA 3O8WA 3IO1A 2OD6A 4DLEA 4X84A 4LIRA 1KLMA 5JVHQ 4J9LA 1U1OA 1JWWA 2R7RA 4PCQA 4L72B 3DM2A 1SUQA 4DR5F 2X1FA 1JJ2R 1UW4A 1P1LA 2YNHA 2FJVA 3W2WB 3C3LA 1QLNA 1DQ9A 2YTCA 3ETOA 4X4OA 2HGNA 3U7JA 3ZZUA 2B0GA 5EWEA 1VQ8S 1H6KX 2BM1A 2GFFA 4NLQA 1QTMA 4LF8F 4ECSA 2AD9A 5I4MA 3J7Z5 2FC9A 3BM7A 4JI2F 2A10A 4K4XA 1SUQB 2XLKA 4O3PA 4RW4A 4R25A 1D0EA 4G1IA 2CJ9A 5DLGA 1RTIB 2ABYA 2NZ4A 1FRMA 3FNNA 5L9XA 3PR5B 2CPHA 3SYZA 3V5RA 3H4DA 2J7KA 2HQIA 3TA1A 5KFKA 2JSXA 4AQYF 4X4SA 1RJJA 3AA8A 3JTOA 4KBIA 2LDYA 3RZAA 1QAJA 4ATNA 3MM8A 4QPXA 3CMES 1F2GA 3I55S 1RT1A 5E3AA 2IMWP 2VPZB 4KGKA 1R89A 2L48A 4EUVA 2HMIA 4C11A 1PILA 3S7RA 2J0WA 3PW7A 3MM6A 1MU2B 1IBMF 1MROB 3OR1A 4TYAA 1AFIA 3VAJA 2RS2A 2WOMB 3BO4A 4RUAA 4GKKF 4Q7AA 3MMBA 4G6VB 3NMAA 1MNEA 4ZVEA 1X7VA 5CA5A 2VPXB 2P9CA 4LQ3A 3NCPA 2JEIA 4CO0A 3G8QA 4LVNP 4BS2A 3M1VB 5I3UA 3US5A 3OBIA 2RE1A 3D5MA 3MD3A 5KT5A 2IM3A 5D4OA 4DUYF 1SJ1A 1LXNA 1TZ0A 3T9ZA 2C2DA 4UUXA 1BQNA 4FVCA 4DFPA 2YH0A 1HHTP 2PEHA 5D3GB 5GADU 2I0XA 4QW9A 1D1UA 3IGNA 4CO4A 3L09A 2ASDA 2IA6A 3HKWA 4HL9A 4OJ1A 1NRKA 4ID8A 4F3QA 1QSSA 2NLWA 1FJGF 1F5BA 1C1CA 4DN9A 4FN5A 2E5LF 2JEGA 2UP1A 2ZE2A 2XWYA 3DRSA 4ZPDA 2VL1A 1S1TB 2DPIA 4IRDA 1RT3A 4PXEA 1REVB 4JI7F 1UJ4A 2LQ9A 3M2VB 1S77D 1KTQA 1S97A 1FEEA 2L3MA 4G1PA 2F9DA 3TVKA 1G1XA 2NUHA 3BR9A 3QAUA 3GYNA 3M9NB 2DNLA 3HHEA 4MKAA 1JKHA 2M3DA 1TKZB 3G8TA 1RTDB 1LFPA 3IXQA 3M05A 3NG8A 3S1TA 2XMKA 2N7YA 1FO1A 2ZH4A 4B3OB 1N5QA 4O3RA 1U09A 2XI3A 1OWXA 2G13A 4BCAA 4FBUA 3MF5A 1RAJA 1C2PA 3H98A 2YWGA 4A8FA 4LFAF 3H40A 3B8HA 2XGQA 3PW4A 4R8UB 3RB3A 2IBOA 3TUJC 1JLAB 3RAXA 3TA2A 4TY8B 2FB0A 2VQEF 2MHEA 2VBZA 3DFEA 5KAKA 4DX8H 4IOBA 2DNQA 4ZPTR 2ZZMA 2B4PA 1HNVA 1YG0A 3OTCA 4EO8A 5DQHA 1HBNA 4B9MA 1V6HA 3HK2A 2WBRA 2HFZA 1KS2A 1Z2LA 2E5JA 4AUKA 4CTAB 3KLEA 3CJ3A 1N0UA 1S0VA 3GWCA 4ECUA 5CXTA 2B9WA 4RW8B 3DHWC 4TXSA 1N88A 3CDEA 3BSAA 5KFOA 3DI6A 3UNGC 3SDEA 3N01A 2VQFF 3DOMA 1TL3B 1ROFA 3TVYA 3BGRA 1E6YB 2RT3A 3CE8A 3M6WA 4IR1A 1CG2A 3F44A 4FVMA 5U47A 2RF2A 1ZAVA 1UVNA 1LXJA 3PKMA 4KGMA 1LWEB 3OL8A 4C8ZA 1IKXA 4Y2AA 3TR5A 2JL9A 2K1RA 4DEZA 1Q7LB 4NYZA 2CPEA 1QAXA 1XEZA 2VG5B 3H5UA 3UD3P 1TAQA 3J7A1 5T7LB 4MFBA 4QQBA 5FIIA 2UV8A 3OFEA 2AGPA 3O5TB 4NRUA 1KC8T 2J5AA 4R0EA 2Q66A 3JYTA 4N56A 4IG0A 2MQMA 4A46A 3OQ2A 4QOTA 5F8JA 2MB0B 2MY7A 4DN0A 5KG6A 3CC7S 1CLFA 3OFFA 4C0OC 5DM7Q 3CC2S 2HW3A 5DQIA 3FCHA 4WK1A 5GAHI 2BR0A 1VQ6S 2AYEA 2L41A 1TQLA 3MMCB 2C3PA 5K5MA 4LSLB 4K4ZA 4DQRA 2R8IA 2ZHBA 3MFHA 4FBTA 2BQRA 3ISZA 3J80Y 3EPGA 2HGLA 3LF0A 3DLBA 2R9LA 2IM0A 3DRYA 5BYSA 2FHJD 4A8QA 2FHMA 2FJXA 3SSQA 1RT4B 5L38A 5KTQA 1WEYA 4IQMA 3MM6B 1IM4A 1KSPA 1AROP 1U6ZA 4DSKA 2AQ4A 4DHVA 3FRZA 2PIIA 4TN2A 1WEZA 2HGMA 3MM8B 4DOZA 2XO7A 3CJKB 3EGZA 2C3YA 4XDDA 2KXNB 3KK2B 4F8RA 4X4UA 1YJWS 3NS6A 4HLBA 1XWLA 3IS9B 2ZBIA 3MGJA 1G2EA 1G6BA 2G1DA 3UFCX 4DBQA 3OJSA 2CDQA 4RZRA 5HO4A 2Y1JA 1K0TA 4DV0F 3PV8A 2JZ5A 1MMDA 2K3IA 3HKZD 4RBUA 5DG8A 4WZMA 1X4CA 2HRUA 1VBZA 3BDPA 2DNOA 4B02A 3V6KA 3CCRS 3OUYB 3BSOA 2MQOA 4ILMA 1LW0B 4DG1A 2AX0A 3N79A 1HWJA 2HNDB 2E44A 1R6YA 2CQHA 2E5GA 3VCDA 2ZH7A 1KRPA 1VQKS 4IG3B 3PJXA 1RP5A 3KNAA 2MJUA 3BF4A 3AQOA 2XC9A 3MEEA 4FF2A 1LFWA 1EP4A 4YR2A 2HIQA 3MUMP 4FS2A 3EGNA 4Y34A 2OTLS 2FLLA 1BD6A 5K8MA 4OJGA 5DJBA 4UQGA 4K4TA 4U67Q 1T3OA 2LCWA 4IG0B 3MMCA 4B3RF 1TV6B 3HM9A 2XSFA 2FVSA 4NWBA 4U7CA 5LMNF 2OSQA 4ZCMA 2AJ0A 2LU2A 4TLQA 1S9EA 4EWTA 2KFYA 2RJZA 4OIXA 5J2PB 5LJ3Y 3LAMA 1IKWB 4H4OA 5E2QA 1DTTB 1U26A 2CPDA 5IWAF 1TL1B 1RT7A 3JSMB 1DURA 4OI4A 4AXIA 4ZP8A 2ZJQQ 1HQUB 4XO0A 4DFKA 3PX6A 2RDIA 3QMQA 5GAHU 2MHNA 2YKNB 5H1SV 2ZNZA 3MUVP 5CQGA 1MWZA 1AUDA 4NLUA 3Q2TC 4DV1F 5EUHA 1UP1A 2DH9A 2RF2B 4KPYA 2RQ4A 4FPRA 2MDAA 5KFUA 3KLHB 2ZH2A 4URQU 1S0MA 4HDHA 1X5PA