1X5SA

Solution structure of rrm domain in a18 hnrnp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
102
structure length
102
Chain Sequence
GSSGSSGMASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold-inducible RNA-binding protein
publication title Solution structure of RRM domain in A18 hnRNP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 9
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x5sA01
2DIVA 5GAGU 2KM8C 3MD3A 2J0SD 2XSFA 1M90T 2F9DA 2KVIA 2OJ3A 4F26A 3R27A 1X4BA 1X4GA 2QFJA 1VQNS 4Z2XA 2CQGA 3R1HA 2MQOA 2OIHA 2HYIB 1UW4A 4OZ1A 2DGQA 5DM6Q 2RS8A 1RK8A 1WWHA 1DRZA 2AD9A 3PIPQ 5BJRA 3I56S 2EK6A 1IQTA 3VAGA 2A3JA 1WEXA 2RVJA 2DGOA 3CCRS 2CPJA 4TLQA 2KN4A 3CCUS 2MKCA 1N52B 3S01A 2J76E 2BOPA 2MZRA 2RNEA 2G1DA 3US5A 2RRAA 3MXHP 4M5DB 2MXYA 5ITHA 1A7GE 2KRRA 3EX7B 2MB0B 5DM7Q 2LKZA 1VQOS 2LQ5A 2DHSA 5JVHQ 2M8DB 1WF2A 2DGUA 1OIAA 2DNHA 3CC4S 2NLWA 4WIIA 2E5GA 2CPHA 2MKIA 2DK2A 2LMIA 5IM0A 1U1MA 1FJCA 2CJKA 3SMZA 2O3DA 2MZ1A 4CIOA 2DNZA 2MKHA 2MGZA 1PGZA 2KYXA 2XNQA 1U1RA 1FJEB 2DO4A 4YUDA 1QM9A 4TU8A 2ZJRQ 1HL6A 3CCVS 4CQ1A 2MZJA 2M8HA 2VODA 4UQTA 5CYJA 2RU3A 2WBRA 3P3DA 2KI2A 4P6QA 1WEZA 1SJ3P 2FY1A 2KG0A 4F02A 2X1AA 4ERDA 1HD1A 2KH9A 2CQ2A 3BEGB 1VC6A 2CQBA 1M5PC 1FNXH 2MQNA 3BS9A 3PIOQ 1JJHA 2X1BA 2DNQA 1WG1A 3H2VE 3MD1A 2ERRA 4FXVA 1KD1T 2XS7A 2SXLA 2XNRA 3VAJA 3U1LA 5MLCV 4Y0FA 2BZ2A 3CULA 1X4HA 2DGTA 1HD0A 2XB2D 2M88A 2JX2A 1X5OA 1VQ4S 4J5OA 4A8XA 5DDPC 4BS2A 4WFNQ 5CA5A 2DITA 3P6YC 3U1MA 3HI9A 1N54B 2DGXA 4IUFA 2KU7A 2CPEA 1DZ5A 2JRSA 2DNNA 4IOCQ 2DNKA 5JVGQ 1UP1A 2AYBA 4V19X 2E44A 2YTCA 4IOAQ 3MUTP 2D9OA 1OWXA 5GAEU 3G96A 2HGLA 3K0JA 2N3LA 1WHWA 3VAHA 2M4MA 2MJUA 1L3KA 3P49B 3BO2A 2JWNA 1WHXA 5IFMA 3EGNA 1VQ9S 3G8TA 3ZZZA 2DHXA 3CMES 2CQ1A 2DNRA 1U2FA 5GAHU 3HHNB 2MYFA 1FT8A 1NO8A 5IM0B 1M5KC 1WF1A 4PRFA 2EVZA 2FC9A 3MOJB 1H6KX 2CPIA 2CQCA 1X4CA 2MGZB 1N8RT 1BY9A 2LCWA 1VQMS 3VALA 5LXRA 1URNA 3CCJS 2MJNA 1G2EA 1UAWA 2KHCA 1WTBA 2DISA 2DGVA 3VAKA 5H1SV 1W2BR 2J0QD 2MZSA 2L41A 3UCZP 2K3KA 3CCLS 2MMYA 1U1LA 4LMZA 1K8AT 1YHQS 1Q7YT 2I2YA 2YH1A 1QVGR 2MSSA 2VOOA 3NNAA 1WEYA 2G0CA 4U67Q 3CCES 2CPDA 3V4MA 2MPUA 1VQPS 3Q2TC 1U1QA 2KM8B 1X4DA 2UP1A 3OW2R 2HGNA 4PKDB 2M52A 1HA1A 1VC0A 1ZZNA 1S79A 1M5OC 3ZZYA 1VQKS 4PR6A 4WKRA 1DHMA 2MQMA 2RRBA 2QEXS 2YKAA 2DNGA 1P27B 1D9AA 3J7ZT 1VQLS 5D77A 2B0GA 2MY8A 1H2TZ 3CC2S 4FXWA 1QVFR 1R8HA 1XN9A 1FO1A 1H2UX 2MSTA 1X4AA 2CQHA 2MKJA 3DLLQ 2I38A 2XS5A 3IWNC 1WI6A 2DNMA 2M2BA 4CH0S 1SXLA 2OSRA 2YWKA 4F25A 2ZJPQ 3VAMA 3VAFA 3RW7A 2FHOB 2KXHA 2L08A 3RW6A 1WG5A 2MZQA 3BO3A 2DIUA 2AYEA 2QA4S 2CPZA 2OTLS 4WF9Q 1X5SA 1JJ2R 1VC5A 3LQVA 2D3OR 4QQBA 2DGSA 4YB1P 2KXFA 2G4BA 2M7SA 2LEBA 2U2FA 3G4SS 2MY7A 5LSLA 3JB9k 5EN1A 2DH8A 2RUGA 4C4WA 2DNPA 1X5PA 3IRWP 2HZCA 4WCEQ 2LXIA 1VBXA 3VAIA 2PE8A 4TU7A 1KC8T 3Q2SC 3CXCR 1JJ4A 3MUVP 3N9UC 1M1KT 2XS2A 1N88A 2VOPA 2YH0A 4LIRA 3G8SA 1B7FA 2KT5A 3NNHA 1SJQA 2CPFA 1VQ5S 2DH7A 1U6FA 1X4EA 2DNYA 3MI7X 2DNLA 3FEXB 3B4MA 2CQPA 3H2UB 1O0PA 2RQ4A 2ADBA 3S6EA 2ADCA 1SJFA 1Q86T 1U6BA 3NS6A 4IO9Q 2MHNA 3D2WA 1YJNS 1VBZA 1VBYA 4ED5A 1H2VZ 1VQ8S 1WELA 1U1OA 3UCUP 3FEYB 3CCQS 3SDEA 2MQPA 2DHGA 3UD4P 1KOOA 3CCMS 2F3JA 5DDRC 3DXBA 2CPXA 5DETA 2VONA 2EK1A 1R8PA 2N7CA 1K9MT 1YI2S 1K73T 1VQ6S 1FXLA 3THPA 1U1NA 3B4DA 2OTJS 2DNOA 5FJ4A 3MURP 1VQ7S 2KFYA 2LYVA 2N82B 1P1TA 2RT3A 2RQCA 3ULHA 2CPYA 3THTA 1YJ9S 1FHTA 2V94A 3G71S 3VF0B 3UD3P 3S7RA 2CQIA 3CMAS 1SJRA 1AUDA 3SXLA 1WG4A 3CD6S 2Q79A 3UWTA 4Y00A 3BO4A 2J8AA 3LPYA 1UFWA 1Q82T 5LJ3Y 3MDFA 2M9KA 2AYGA 5LSOA 3EGZA 3TYTA 2X1GA 2AYMA 1KQSR 4ZKAA 2DB1A 3UE2A 2MQLA 3NS5A 1U1KA 2LA6A 4QU7A 2D9PA 1D8ZA 2MKKA 2DHAA 2MQQA 3P5TL 2DH9A 2MZTA 4EGLA 1M5VC 5LXYA 1NJIT 4YOEA 2N3OA 2E5IA 3I55S 4C7QA 4LJMA 4TU9A 5GMKa 1YTYA 1OO0B 2GHPA 1YIJS 3L3CA 1WHVA 3TP2A 5DDOC 1X0FA 1S72S 1KOHA 3G9CA 2DO0A 1Q81T 1ZH5A 3CUNA 2K8GA 5HL7Q 2U1AA 2RS2A 1X4FA 5LJ5Y 4C0OC 5GVQA 2KG1A 3MUMP 1DBDA 3J7YU 1F9FA 4QPTA 2X1FA 2FPHX 3SDEB 4W92B 1X5TA 4RU2A 2CQ4A 1U1PA 2KRBA 3CCSS 1YJWS 5HO4A 2FC8A 3NNCA 1CVJA 3R1LA 3UCGA 4UY8T 5D78A 1WI8A 2JVRA 5DDQC 2E5HA 1RKJA 1OPIA 3NMRA 4QU6A 2E5JA 1WHYA 5IQQA 1PO6A 4OZ0A 2M70A 1WF0A 2LA4A 2LEAA 2M0GB 2LXUA 1FJ7A 3S8SA 2L9WA 3G6ES 2DGWA 1YWXA 2OSQA 3TO8A 2MKSA 2CQ3A 5GADU 3CF5Q 1SJ4P 2LECA 2PEHA 1YITS 2ZJQQ 2HVZA 4WFAQ 5CXTA 3CTRA 2GO9A 2JVOA 2CQ0A 4CH1A 2CQDA 1A9NB 2KXNB 4WFBQ 2NZ4A 2HGMA 3CPWR 4W90B 2F9JA 3CC7S 1JMTA 1ZZFA 1NU4A
chains in the Genus database with same CATH superfamily
2HAIA 2MQ8A 3MMJA 2LFVA 1ZAWA 3DMJB 1O8BA 2RUSA 3OJUA 2DGQA 1BD6A 3O2IA 1N32J 4CT9A 2CADA 1WEXA 3HT0A 2J76E 2R9LA 5F3ZA 4JUZA 4QWDA 3QFWA 2K06A 4K5SA 5JMNA 2RF2A 1ZBTA 2KL8A 2HK2A 2HRTA 4USHA 2RDJA 1BHNA 3HZGA 4J9LA 1F5AA 4B3MJ 4JV2A 2ZJRQ 1HW9A 5IXUA 3KYLA 3E51A 2E1RA 4CQ1A 4ECZA 2VPYB 4C2MA 4NOHA 2HW3A 1AB8A 1NJYA 2IAJB 2XYHB 1PJ7A 3MR6A 1VQ4S 3T9ZA 4ZCLA 4OHZA 2W4PA 1NK9A 4PQUA 1HWLA 4FYDA 2IHR1 4ECSA 4F4YA 5CYMB 3Q8SB 1RT7B 3QRPA 2Q43A 5DRKA 4IG3A 4CWBA 1NMEB 3N01A 3M8SA 4NYOA 4QYZJ 3W8PA 3DN9A 1NO8A 3MPDA 2FC9A 5BYRA 1KEKA 2DEJA 4QWCA 1JLGB 2RDDA 1ZM2A 2WVCA 2IDLA 3M6UA 3KDNA 4ZVFA 4X62J 4FF2A 4HI1A 3HSDA 5BR8F 3CCWA 3QFHA 1CQNA 2NXCA 1GXLA 2XMTA 2UVWA 2FVRA 3Q2TC 2VASA 5F0UA 4FS2A 5J2NA 3GYGA 1WDTA 3MMBA 1FEEA 3I87A 4OJ3A 3W66A 1DHMA 2LEPA 3CW2C 4QZVB 1SC1B 2EG2A 2B0GA 3CC2S 2BKPA 2JZ5A 3T6BA 2M2BA 3L4BC 4IFYA 2UVVA 1HQEA 4NYZA 2V2VA 1WG5A 2RKIB 4YHHF 1CS4B 4KGVB 5L1JA 2UUBF 5IT4A 3GIJA 2YQ0A 1N5TA 4UQGA 9ATCB 3RR7A 1AUSL 2FYXA 4QYZK 1RT2A 2ZHAA 4C4WA 3WDOA 1S9EB 4F67A 2VOPA 3G8SA 1VQ5S 2WSEC 3A1YG 1X4EA 3OXLA 3J81j 1D9FA 4P72A 5I4MA 2IVFB 1FRKA 4OZJA 3M9NB 2G0JA 2AU0A 2MQPA 5CD4A 3CCMS 3TJ9A 3BGFA 2YNFB 1XWLA 3MCMA 2HIYA 1WC3A 4PWWA 5D0EA 1Z4UA 2YVSA 4NYPA 4DN0A 4ES1A 4NLGA 4JI1F 2XO7A 3EZOA 2OPSA 1SH3A 3S7RA 3ZTPA 1SJRA 3C3LA 3F41A 4DUYJ 4PG6A 2YKMB 4ED4A 2AJFE 3TJ8A 4B3TF 2H54B 4DR2F 4IQXA 5IZHA 1OS5A 3GZ7A 3HSJA 3Q83A 4I2QA 5K14A 1LW0B 5A8WA 3DLKA 4ZHRB 2W9BA 1NSPA 5FDLA 2DH9A 1R43A 3EVWA 2N3OA 3NEKA 4ECRA 2GA7A 3HVTA 5KG2A 1RAOA 1PJ6A 2C2NA 3I6PA 4BC9A 5HL7Q 4HT7A 4LRDA 2BYCA 2V4JB 2CUYA 4WJBA 2QFIA 3KTQA 2FPHX 2QN6B 2VBYA 4L73A 4FVMA 4NCGA 3C15B 4BHQA 4IRDA 2LU2A 3UCGA 4UY8T 2I6WA 5EGYA 5HROA 1OPIA 1LOUA 2D7SA 3DLJA 4KKOA 2QRRA 1ZS6A 3W5ZA 3C19A 1XBWA 1VBKA 1FJGJ 1K47A 1KBRA 4YDXA 1Q78A 1VDHA 3SSQA 1B3TA 1O51A 5CXTA 3RAXA 3EGWB 5E2QA 2CQDA 4V19J 2ACMA 4OI1A 3CC7S 4MKAA 2JSXA 2XSFA 1BWVA 2LVWA 2HMIA 4WKYA 1HR0F 2WSCC 1MROB 4J9KA 2BRLA 3UD5A 4H4OB 4RR5A 1NPPA 1RK8A 4X64F 2VFUA 2IPOB 3PIPQ 2IIHA 2HQDA 2ZE2A 3O8WA 1QJHA 1F6TA 3VAGA 3P45B 2PSZA 4MIBA 2A18A 5L39A 5J2MA 2E1PA 2ZZNA 2MZRA 3KJNB 1GQEA 3EX7B 1VQOS 4RL1A 1TTHB 5E0OA 1OYEA 4HDGA 5KT4A 5ETPA 5HJYA 3TARA 2CPHA 2HHSA 3G2XA 2XCAA 4DWIA 4ZP8A 3FBBA 3W62A 2OMOA 3Q23A 4YFUA 3NXZA 3CJ0A 4N7TA 1TZ0A 3BS9A 2AX0A 2G13A 3FDSA 1RT3B 3VAJA 1HHQA 1WUUA 2VU5A 4TLRA 4DV5J 2R8IA 4OI0A 2KT3A 4DU7A 1U48A 3PJXA 2DR6A 2Z4PA 5EX0A 2PN6A 2DNKA 3B82A 3G87A 4FZVA 4DL6A 2R2RA 3MUTP 4CTAA 2D41A 3OTDA 3G96A 4U7CA 2O01C 4Q2LA 1FD2A 3HKZD 1RACB 2HSEB 2DNRA 2PD1A 1NK5A 4HH0A 2ASLA 2VQEF 3K8WA 3C6TA 1SC6A 4X4QA 3LOUA 1X4CA 2IM0A 3VALA 1WNEA 1NM2A 3PFEA 4MKVA 3POTA 1UAWA 3MEGB 4CYUB 2DT9A 4OYPA 1YZ6A 4S0MA 5GADI 4ZPVR 3R6LB 3C6UB 3WC0A 1EETA 2EKNA 1YX2A 3VV2B 4ZVHA 5T14A 1T02A 4B08A 2V0NA 4XTTA 5E3RA 1F5CA 5T7LA 3OW2R 3TUPA 4PR6A 3MM5A 2RRBA 4DS4A 1QSYA 2Z2MA 3J7ZT 2E9TA 4LREA 4RWXA 4OL8A 1H2UX 2NUUG 2YWKA 1U45A 2EFNA 5EUHA 2OLWA 3THVA 2JLGA 3IBWA 2HHHJ 1VC5A 4QQBA 4MIWA 3D9BA 3LO3A 4DG1A 2FHKA 1FKOA 3IRXA 2OO4A 3JSBA 4FYYB 5EN1A 2DKOB 2GCFA 2E9RX 1FRIA 2EBEA 5F8LA 3W7BA 2Y8YA 4LSZB 3H98A 2BE9B 5B09A 1VRQC 2D69A 3HVAA 3NS6A 1PC5A 3UPFA 3WIUA 3GE9A 4IG0B 2DHGA 4ZVSB 1IKYB 3M6VA 4ETXA 5AXKA 1VK3A 2XMAA 1RTHA 1YJ7A 1RLDA 3KLEA 2EC0A 1PBAA 4KPYA 3W2VB 3I4PA 2N82B 1P1TA 2CPYA 3HCXA 4HLBA 5F8NA 4RW8A 4RNMA 4B3RF 4ID8A 3UD3P 3PR5B 1FWLA 2VQFJ 5DQGA 4X4TA 2ZM6J 1UA0A 2RAQA 5GAEI 3LP1B 2F8MA 3HHKA 4JV5J 5LSOA 1KTVA 5J2PA 4X84A 1FX2A 3PW7A 4H54A 2VUGA 4Q43A 3V4IB 1RBLA 4Y65A 3W1YC 4J9MA 1IM6A 4LBHA 3UNYA 2D3O1 1RXOB 1B64A 3DRYA 2E5IA 1RAGB 3ISZA 3QT6A 4I4BA 1OO0B 1PAUB 4DR1F 4NLYA 2WONA 1AZSB 4UTGA 3IS9B 2C2ZB 2DVIA 3PYDA 3BR9A 3JAMU 2H4WB 2N7YA 4TNOA 4JI8F 3QNWB 3I0RA 1S99A 4RU2A 1FDBA 3ZZTA 5KFGA 4ZIWA 3JXOA 2YWHA 2GMJA 2E5HA 3DRPB 4RU9A 2IM2A 2JC0A 4NLQA 3MR5A 2IC3A 3OR2B 1CG2A 2UUCF 1SQEA 4L74A 4E98A 4F2RA 3KNAA 3MMAB 4CNZA 3M8ZA 3CD7A 1C0UB 1RAFB 3NP5A 1S0NA 3A8IA 3T1HF 4B02A 3BQ1A 2MEWA 2KVIA 2IRXA 4PPDA 4ZVQB 1Y3JA 3D0HE 4ZPAA 4BLGA 3T1HJ 3W64A 3KXDA 4ICLB 2AKWB 3LF0A 3VR1A 3KG0A 4K4TA 3ZTOA 3ETMA 1A7GE 1NK4A 2DR7A 2R7UA 1Q5VA 3BQ0A 2JHEA 2GC8A 1B0VA 1HNWJ 4R0EA 5KFOA 2R7WA 3WC2A 1MW7A 2HQ3A 2HFVA 3CCVS 2RU3A 3GFXA 2DY9A 4AQYJ 2PMHA 1ZA1B 2LXFA 5CAAA 1VC6A 3IGVA 1U8SA 3PIOQ 2B4UA 2SXLA 4DLEA 4RNNA 1X4HA 3LTOA 4JI3J 4OQJA 3TJAA 3LAMA 1IKVA 2JLFA 3HHLA 4X65F 2Y3YA 4PXDA 2VKZG 4F0MA 4NL5A 3MAQA 3H5YA 2DNNA 1YJRA 3DKDA 2ZVSA 2B7BB 3IAS9 4CCHA 4DL0C 3TX0A 2CWKA 2HWIA 2Z2YB 4NMXA 4FBTA 6FDRA 3BPDA 2C3YA 2FD2A 3P49B 2VBZA 4C11B 2FJWA 5BXIA 5KFNA 2F8HA 5KFQA 4F4XA 4ZVGA 1TL1A 1RE1B 1JIHA 1Y0HA 4ECXA 2W2MP 4B9LA 3CCJS 4LT6A 4ENOA 1NPKA 3AB2B 2DGVA 3VAKA 4OX9J 3W3SA 2Q6CA 3AJ1A 2CFXA 2YWGA 3PHEA 4UOFA 3JYTB 1NLKL 3UCZP 2Y8WA 3CCLS 2NXNA 4X4NA 1Q7YT 4YY3J 3ILIA 3OFEA 1SJ1A 1KQGB 2GIRA 2CPDA 2FUG9 2DRDA 4USUA 4USVA 3GJQB 3ITHA 1CJKA 4KB7A 1GT8A 3KFWX 2YKAA 1REGX 3BKFA 2F65A 3AJ2A 2RE1A 5A8RB 1QLNA 3IWNC 3T19A 4AD6A 1C2PA 3VAFA 2GIQA 2KXHA 4OMFG 3HM9A 2VG7B 3G6VA 2QSFA 4WIQA 2AYEA 2RRNA 2CPZA 2YXLA 1CC7A 5RUBA 1GXTA 1JJ2R 1DQ8A 3KMQA 4YB1P 1YG0A 4ZS6A 2FVSA 1UCNA 3GR1A 3K17A 5LSLA 3GG0A 5THWA 3TVKA 4TU7A 3UDCA 2GFFA 3RB3A 3IP0A 2QGFB 1S97A 1DQAA 3MI7X 3N4WA 2XHWA 3B4MA 1EKSA 1ZOTA 3D6TB 3S6EA 3LAKA 1Q86T 4LF9J 2APOA 3T5JA 3KJFB 3KLIB 3FRZA 2EI5A 4HVZA 4LFCF 5HQLA 2F7VA 3X3UA 2V9KA 4IO1A 2WAQD 2W2QP 3BH7B 1ELOA 3THPA 1U1NA 2G9OA 5AE1A 2LYVA 1HHSA 2OEJA 2ZH8A 4RKUC 3QMQA 4WP8A 4ED0A 2O1PA 1FHTA 1RA6A 1DAXA 2IM3A 1FRMA 3CO0P 1RB0A 2KT2A 2N4DA 2RSQA 4GVBB 2NSBA 3DGPB 2AX1A 2VL1A 4F04B 3MDFA 4DSFA 3UE2A 4N5SA 2GAGC 5G0RA 1TL3A 2R7SA 3MCNA 3R5CA 3AHPA 2VG5A 1SC4B 4F0KA 1NJIT 3I96A 1NAQA 4OYXA 1N5QA 1FRXA 1U47A 1IBCB 3TOQA 4E0DA 1Q81T 3CUNA 1ZPWX 2PA8D 1JLGA 3D3CJ 5LJ5Y 2DPIA 2VIHA 2BQUA 3AD9C 2ZOMA 2O5DA 1SL1A 4NXNF 5ETMA 1NNDA 1WC6A 1Q8LA 4USTA 5D78A 1T0TV 4OLOA 4QYRA 4FKXA 1T9TA 4DZDA 3KUGA 2X3GA 3JSMB 1MSWD 1KVKA 3M32B 2HNYB 3LW5C 4CLLA 2M70A 4O4RA 3A3NB 2ATCB 3U27A 3WX8A 2HPUA 2KO1A 3W5XA 2ZJQQ 3IWLA 5D4OA 2KDOA 4WFBQ 2OPQA 3OSPA 1VLOA 4AUKA 3QAUA 2J0SD 4AXIA 1M90T 4G1QB 5M2PA 3K59A 1RDRA 1VQNS 1QE1B 3NCPA 3NCRA 3QLHB 2ZOGA 2MQOA 3OHBA 2HYIB 2B8QA 3J81U 2RS8A 2A6MA 3D68A 2RVJA 3T9NA 3RBDA 3CVKA 2C2EA 3NGKA 1U0HA 4URSA 5DM7Q 3CJTA 2DHHA 3PYEA 4CP5A 1R0AB 4O44A 3E01B 2DK2A 1G6BA 2HHUA 2Y0SD 4DV4J 3JTPA 2MZ1A 2XSJB 4X4RA 4CIOA 3M05A 2QMWA 2EBGA 2XNQA 1V5IB 2QX0A 5D4NA 2NYIA 1F3FA 3M6WA 5IOLA 2KI2A 3HVRA 4OLPA 1KKHA 1XR5A 3BQ2A 2ERRA 3VVTA 4UY85 2XB2D 4USKA 1JLBA 1RGVA 1SKRA 1N54B 1DZ5A 1VIXA 2GJIA 5EHHA 1J5OA 1YRUA 3TZXA 2X51A 1OWXA 1RT4A 2BKNA 3BGRB 3JS9A 3B54A 5U47A 4ES2A 5IFMA 4J90A 4N76A 3Q8UA 3F44A 2DHXA 1TMJA 4M5IA 4NZ7A 1E6YB 2HQIA 1H6KX 3I32A 4PQAA 2BQ3A 5HMYA 1VQMS 1NDPA 3M2VB 2W4DA 3D5MA 1VRTB 4TYAA 1NK6A 4XAKA 3DM2A 3ZZOA 2L41A 2XMVA 1KLMB 5HVHA 3QGPA 4NE9C 3O44A 1VOMA 3D66A 2XMUA 3DYAB 1GMWA 4K2XA 5L1IA 1N6QA 1VC0A 4B9SA 2QEXS 2BV3A 3OL8A 5LMNJ 4UUWA 2RIJA 2OI2A 3AOBA 5KFRA 1I94J 4QIFA 4L6V3 5AJ3F 4ELTA 2PI5A 2WOMB 2QA4S 2C1EB 1LW2A 4ZVTB 4LFAF 3NWGA 4DL4A 1S6QA 4N77A 2U2FA 1URRA 1KFSA 3CJ3A 1R8CA 3D6MB 2LXIA 4DSJA 3KKFA 3LP0A 1N88A 4K0KJ 1FKPB 2DNLA 4CO4A 3GIKA 1VR6A 4AYBD 2ADBA 1TK8A 4CLTA 3LPEA 3KK1A 2FZGB 2W2PP 2XWYA 4ER8A 3T1YF 3SDEA 3NL0A 1UZDA 3C14B 1M5HA 3MM6B 3BDPA 1EQMA 1HYSB 2UUWA 3FNNA 1WSRA 2RQCA 4A4JA 3GPAA 2OEMA 3G71S 3VF0B 1UW9A 2ZHBA 3MAAA 4LSLB 4GO5X 8RUCA 3I82A 3EGZA 3FFIA 3WQPA 5B0BA 3TYTA 1TUVA 1IVZA 4I6WA 4DV6J 3VVUA 1SH2A 4Q0BB 5GAHI 1VHFA 1CJTB 4NASA 2ZH9A 3J7Z5 9RUBA 3I4HX 5EX3A 3IMQJ 4O4GA 3TVZA 2HAFA 2IYGA 2F63A 2LDYA 1TVRA 4I7FB 2PT0A 3KK3A 3MUMP 4LBIA 1ICEB 4KYZA 3DLEB 3TAMA 1X5TA 3C6UA 3QRRA 4MK9A 4Q8FA 4Z7CA 4MFBA 5J1EB 4Q8EA 2YKPA 4N8OA 4USWA 2WRMA 1U2RA 4U95A 3PYFA 1S7IA 3DCAA 4ECUA 1LWFA 1FTCA 4DU8A 2OPPA 3DDIA 2EFPA 8ATCB 1WF0A 4J7CA 5LOQA 4ED7A 1CSJA 1LXJA 1PJ5A 5D3GA 1N33J 1PCAA 4JI0F 1IN0A 4I67A 4OI2A 3TO8A 2YNHA 3U02A 3ZNUA 4WFAQ 5IT9U 1HBUA 2VBXA 3LANA 2X3DA 3OR1B 4OHWA 2IMWP 1JMTA 5KG1A 2ZBRA 3KJVB 4DBQA 3GR0A 2QLWA 3QJJA 2CKWA 3TANA 3MR3A 3M2UB 4Z2XA 2ZH7A 2GVZA 2BABA 2CQGA 3AODA 4PG4A 2DRBA 2OIHA 2C2KB 3PW4A 2EC2A 3I56S 2V67A 4WK3A 3JTNA 4JBCA 2HHVA 2CPJA 3M2RA 4Y2KA 7AT1B 3US5A 4RBVA 4EBDA 4LF5F 2MXYA 4ZVUB 2Q1LA 2JEFA 2MB0B 2DHSA 4OZLA 1EP4B 4DPUA 4M5HA 3D4JA 2NLWA 3KHHA 4OX8A 4RW9A 2CJKA 1H0HB 2ZVIA 3CMQA 4P7TA 3W2VA 1N5YA 1FEHA 3SCJE 1FRLA 4UQTA 4ECYA 1S1WB 1SJ3P 3NRBA 1UVNA 1FNXH 5L9XA 4QW9A 1KD1T 5EDWA 1X0PA 4B9MA 3H2LA 3W5YA 2E1MC 1KR4A 1X5OA 3PX6A 2Y1RI 1S76D 2ZH3A 2ZBIA 5D0RA 2H5EA 5A2QU 1H7XA 1U26A 4KT0C 2E7XA 4XIUA 4Y2CA 2CJBA 3J7YI 4X2BA 3NGUA 4Z7YA 5E3AA 3MM9A 3VGVA 4MT1A 1UEUA 1R27B 2HS3A 5IV3A 2MJUA 1C0TA 3BO2A 4BC7A 1QTMA 2ASJA 1RWKB 2ATLA 2RF2B 2VA3A 3V6HA 3TAQA 3BBFA 3IM9A 3DLGA 1XNRF 2RILA 3VZIA 1TKZA 2CQCA 1IWAA 3NGDA 1URNA 2HLTA 4GC7A 5D8HB 3CIZA 4OI3A 3K5NA 3TNVA 4LVNP 3OVAA 2DYAA 2I0XA 2QLFB 2E66A 1RWMB 1EZZB 2FLOA 3CCES 4PG8A 3ONQA 2MPUA 1HLWA 4EZ9A 4LFBJ 2BX6A 1TUGB 4DI6A 1M5OC 1VQKS 1FXDA 2H4YB 1MWZA 2YY3A 4PQUB 2PFFB 5M2RA 1WC0A 3AD7C 2OGUA 2GW8A 4CH0S 2OSRA 4C8MA 2CYYA 4EK2A 2FHOB 2FHMA 2R2UA 2VD3A 4IG3B 4NEYA 3N5BA 4RW7A 2PEBA 2B9YA 4JB8B 4RUAA 2Z8QA 4RWWA 3L09A 4QR0A 1Q5YA 1RHQB 3JB9k 1S0MA 4DR3F 3R7BB 1NPRA 1VBXA 2BW7A 3KK2A 4U96A 2BQRA 4YDDB 5KTQA 3X1LB 4DR6J 1TL5A 1S6OA 2RQ4A 1HNIA 4A8FA 4KE5A 2B4PA 4LIWA 1TL7A 5E3CA 2ADCA 4DSIA 5HI7A 4JI2F 2QC3A 2MHNA 3GFHA 1XIQA 3ET6A 3CCQS 2PO4A 3UD4P 4LRBA 1HARA 3H4BA 3SI8A 2PA3A 1I3OB 1YBAA 2N7CA 4WTOB 2PMZD 5J2NB 3MMBB 3TZZA 4PUOB 4OHVA 4JYAF 3I31A 5DO2A 2C3UA 4IFYB 3ZNJ1 1HQEB 3DHXA 3BO4A 4I1TA 2J8AA 4OX6A 2DR5A 4F8RA 1Q82T 5LJ3Y 1X60A 3DNCA 2MQLA 4K50A 1RT2B 2PMWA 2BM1A 2AWZA 1KSPA 2XY6A 3CO9A 2H51B 4YOEA 5HJXA 1YDLA 4I0WA 1QUVA 4MYUA 2BUNA 4AFFA 3QIPA 4C0OC 3EWGA 2NXUA 1C1BA 1O6XA 2CVIA 2V2QA 5DJBA 4M5LA 2MTLA 3HVWA 4RNFA 2FC8A 3NNCA 3LGHA 1S5ZA 5HMXA 2JVRA 3CJQA 3R97A 1Q8KA 2E5JA 1WHYA 2OPSB 1K1SA 2NUHA 4FYXB 4GC6A 2PFDA 4K4ZA 1U25A 3QPIA 4K5RA 1RJJA 3C2PA 2V2ZA 3AT1B 2B8PA 3PCOB 2CJ9A 3VHQA 2CQ3A 2AHOB 3AOCA 2YX7A 1OSDA 4J9PA 2O67A 5KT2A 3ADAC 5KG7A 4I2QB 1RHRB 5K14B 5A8WB 1ZZFA 3DLKB 2W9BB 5GAGU 5FDLB 1H98A 1JKHA 2B6AA 1X4BA 4KGXB 3KLHA 3HVTB 3GILA 3GP9A 4P2SA 3HHLC 3M8PA 5DM6Q 3SSRA 2CNOB 5F8HA 1PYOB 2XYGB 1HWJA 2WB1D 5CD4H 3A13A 3CJKA 2KN4A 2FJDB 3S01A 4NCGB 2BM0A 4DPOA 1A0OB 2B9WA 2P9GA 4RX6A 5HROB 2W2NP 5DG7A 2BJ9A 2XHCA 4WZMA 1EX8A 2O3DA 3D6HB 6AT1B 1PGZA 4KKOB 4Q7AA 2AIRB 3OVSA 1GAOA 2A10A 4L72B 3GV5B 4ALZA 1HL6A 3QSYB 3GJTB 1HKAA 3MWBA 2GAHC 2AJ1A 2ZDPA 2ZNYA 3PW2A 3R5GA 4FYVB 4EBEA 2CQ2A 3O3LA 1GTHA 3QAEA 4KO0A 4NA3A 1N5SA 4FXVA 2XS7A 3FRYA 2EW9A 2YQ3A 2HMIB 2N4CA 1EKRA 4X4PA 3RAMA 3C16A 3CJSA 1SIWB 1UP1A 2VKRA 3GCWP 2YNIA 4PG5A 4CO3A 2GQQA 2Y9HA 3FSYA 5J2MB 3PW5A 1OMSA 3EM1A 3D6FB 4JV0A 2W8LA 3MEEA 5M2UA 4MYTA 3M6XA 1IBKF 1Y5IB 3VQSA 1N8RT 2LCWA 2R3VA 1IBLJ 2BMBA 3RG6A 5H1SV 4DX5A 4NA1A 2HS4A 3WZ0A 2YH1A 2R7QA 2OD6A 1BQXA 2IJFA 3L95X 4DX7A 3PEHA 1J5EJ 5L1KA 3V2UC 4IFVA 4I68A 1YJUA 1UEVA 2XMMA 3C46A 4I69A 2I38A 3MFHA 2C2RA 2HEKA 4FBUA 2UUAJ 3GB0A 3TR5A 4CTAB 3FCWA 3LQVA 3PJWA 3UQSA 3UO0A 1S6UA 2AZ1A 3G4SS 2HZCA 1Y10A 3VAIA 4DUZJ 4DCJB 1VLYA 3C6TB 2VC1A 1CQMA 2JEJA 5GMDA 2KKHA 3BSCA 1U6FA 3POTB 1VHIA 1B7YB 5A8KA 1XMOJ 1N36J 1MMLA 3FKBA 1EETB 4HTJA 4UOHA 1UFLA 3HSZA 4URGA 1DTTA 2F3JA 4K8RA 4A8KA 1QUPA 5T7LB 3D1QA 4Y34A 3B4DA 3MM5B 5LMUF 4MMOA 3H4DA 2KFYA 4DV3J 4J9RA 1QAYA 4F4AA 3ENAA 3PJ9A 3A4TA 1JXLA 1TKTA 1RP5A 4UT4A 4IDKA 5KFKA 1FKOB 4NMLA 3IRXB 3NS5A 1EARA 3D1OA 4QU7A 1D3WA 5IS2A 4CM2A 5A76A 3R2DJ 1L3TA 3RB4A 3QJPA 1M5VC 3CSKA 1U6ZA 3D0IE 3I55S 1KONA 3IBFB 2JJ4D 1YTYA 1JLAA 1KLNA 2P9CA 1HBMA 2IA6A 4GKJJ 1GEHA 1HHTP 2F4VJ 3SFGA 3D28A 2XZTB 1KLMA 3SBMA 1RTHB 1QSSA 1HWUA 3KNGA 2HG4A 3W2WA 3KLEB 2FLPA 2OP5A 2RJZA 3AXKA 1LNQA 5IT9Y 2IFXA 4K4XA 2EFOA 2C2OB 4RW8B 4JI4F 2LA4A 2M0GB 3G6ES 1HNXF 4DX8H 1SJ4P 2LECA 4HTIA 5F8IA 4NCAA 4CNYA 1UPPA 4C8ZA 1VMBA 2RB7A 5J2PB 2GO9A 4CH1A 1N48A 4B3OB 3H20A 5LM7E 5C42A 1VJQA 2OJ3A 3R27A 2ZZMA 2XLJA 2XMKA 3IM8A 3R1HA 4WK1A 1HBNA 3MM8A 2QL5B 2IMOA 2V8DA 2WONB 4CLYA 2VDIA 1FKPA 2EK6A 1EAYC 2A3JA 2Z58B 4DV2F 2RMLA 4H4MA 3QJLA 4C48A 3I0RB 2HHQA 2A2DA 3W65A 2B7CB 4USIA 2UV8A 2BRKA 3U1NA 5E33A 5KFAA 2W01A 2E5LF 2E5GA 2H5IB 5HK4A 3KWMA 1HMVA 5D6GA 1DTQA 4MIAA 2IC3B 4FNHA 2E1AA 5I3UA 3DI6A 4KC5A 4PYDA 1S12A 2BKOA 1IJFB 3HFVA 3P3DA 1YRTA 4WYLA 2QL9B 1RLCL 1HD1A 2AEFA 3M30A 2LQ8A 3TA0A 1AT1B 4YB5A 1N34F 3M8QA 2IBKA 5A2QY 3DRXA 1WG1A 3M9OB 3MGJA 3ISNC 2D3ZA 1H72C 4ZP7A 2YKQA 1TELA 2CJQA 3PFOA 4USJC 1HQUB 1S1UA 2DITA 2QG9B 5JXSA 1NRKA 2F5GA 1T05A 4A48A 4M5JA 4V19X 1CLFA 4FF1A 2YPZA 2HGLA 4RO0A 3V6JA 3PX0A 1NEEA 2M4MA 2CIMA 1L3KA 1XQIA 4CO0A 4DV1F 1IKXA 4TKTA 3BGLA 1MU2A 5C24A 3D67A 2MYFA 2R42A 1T03A 5FLXU 1MMDA 3Q22A 4QIEA 4UOCA 4GMKA 2J0QD 2RHQB 2GGPA 4AT1B 1WACA 3OXFA 1VCTA 2MMYA 3CJ8A 4LMZA 2HFNA 3LALA 4RW4A 5LL6d 4DV7J 2MSSA 1DFDA 2VFRA 2B5JA 4A47A 2EG1A 5CYQA 4QPXA 1YSJA 4WYWA 1P27B 1D9AA 1IKVB 3HHLB 1W26A 4P52A 4MKBA 3NMAA 1UZHA 2MKJA 3ENWA 2AGPA 1WI6A 1RU2A 2NR0A 3SV4A 4IOBA 1V3RA 2V4QA 3N6MA 2IVMA 2W9CA 2G4BA 4P73A 4DSEA 3PRVA 3WX4A 1TL1B 4OZNA 4J9VA 4M63A 4RBTA 2VFVA 5IQ6A 3QZ7A 4FS1A 5ETKA 1O0PA 3LWLA 3D2WA 1VBZA 3DOLA 2AGOA 1U1OA 3FEYB 5E7OB 4QR2A 4TN2A 2J8SA 1T3OA 3K7RA 5DDRC 1H73A 4DF8A 3NBPA 2BR0A 4ZPBA 2AV5A 5DLFA 5HBMA 2V63A 4U7UD 3ITHB 4JI7J 1CJKB 3GYXB 1RZMA 1RTIA 2KTQA 4JOUA 3PVXA 3AH6A 3Q8PB 2P2CB 1YJ9S 3MMCA 4KIAA 3CIMA 2XC9A 1ZM3A 2BA9A 3KMSA 1XJWB 3LPYA 1TKXA 4P2MA 3HPOA 3J80U 3MPVA 3G8QA 1S9GA 2XO6A 4E8UA 1SKSA 2YBVA 2UU9F 3MOZA 4ZCMA 3OFFA 3KJQB 4OYMA 3RJMB 3VGUA 3GFZA 5GMKa 1YIJS 2QIFA 2UXDF 3M4XA 1E6VA 2NZCA 2A6OA 3GONA 1P6TA 2B4VA 4NEZA 2FJAB 4R25A 4I56A 4KRWA 3E3XA 4W92B 4IRKA 3L7OA 2R7XA 1U1PA 2KRBA 3TZYA 3L9ZA 1V5VA 1WI8A 3OVBA 1TL4A 1NZ8A 3ZZ0A 5I3PA 3FJ2A 4M95A 1NDCA 5IWAF 1HFEL 2BE2A 4DX6A 1ZTTA 4O3RA 3PV8A 2ASDA 1FJ7A 2DEIA 2OSQA 3T41A 3CF5Q 2B3TB 1RWOB 1YBTA 1OQ3A 4NLDA 3FSIA 5E3PA 4LF1A 4ZN3A 2WBMA 2JVOA 4KPCA 4DR5F 4G6VB 4X4OA 5B0GA 3FK4A 3MM7A 5HAOA 5G0RB 2QZ8A 1TL3B 2DIVA 3OJSA 4OHXA 1RAIB 2VG5B 4X66F 4A8MP 5K9FA 4YR3A 5CHCB 2P8IA 2GX8A 3DXSX 4LBPA 4DR5J 2F8EX 1RCOB 3SV3A 2FTRA 3MECA 3G82A 2RRAA 4ILLA 3VQTA 1NZAA 2HFOA 2LKZA 5CCMA 2DGUA 2OEKA 1Q1KA 3KG4A 3F56A 2XMWA 4WFZA 2ZUGA 2FJVA 2QJ3A 1Y11A 1U7LA 2UXBF 1S57A 3PX4A 2DO4A 4PUOA 3ZFVA 4TU8A 5BR8J 4FPIA 3NCQA 4I2PB 3IR6B 1FWKA 5J2QA 5HSPA 1DQ9A 3HDSA 2KH9A 2CJXB 1JJHA 4QIGA 2NXJA 1JNZB 3Q0AA 1B4SA 2OPQB 2VHGA 4ZK7M 5G4DA 2C22A 4BS2A 4DR4F 1VIOA 4YS2A 3KOAA 4YHHJ 1NDLA 2UUBJ 2CPEA 1P1LA 2J7KA 3SYZA 4PCQA 2C3MA 5CH7B 2YTCA 1GH8A 1L3UA 1ZA2B 3RBXA 4J9NA 1WHWA 2IRUA 1U0HB 2EFVA 2JWNA 1R6YA 5KFSA 3I5BA 4O44B 3B8HA 5DLGA 3A12A 4NI2A 1AFIA 3MOJB 3KHRA 2AEMA 1RHKB 4DV0F 4AXJA 4F0HA 3M1VB 3TAPA 3CDBA 4OYZA 4ZVEA 2DY1A 1JK9B 2GMHA 1W2IA 4DPTA 4ATNA 2HLUA 1TQLA 4HH1A 4ILRA 2HS0A 1SCJB 2AZ3A 4JI1J 3RR8A 2R8HA 4MK8A 4HKQA 4ID5A 1FDDA 1JLBB 3BBBA 1QVFR 4JV1A 3EGVA 1RT5A 2CQHA 2UVRA 4B3TJ 1SXLA 4DR2J 4DR7F 2ZJPQ 1J5OB 1VFJA 5KFXA 4C6AA 4A8OA 1C1CA 3RW7A 4EUVA 3T5LA 1F2HA 2J9DA 2E29A 1RT4B 1YRXA 5EWEA 2PGCA 2UXCF 2C2DA 3HHDA 2LEBA 1ZM4A 3R5JB 3QSIA 1S6PA 3QIDA 1KC8T 4OJ1A 2B9EA 2YX1A 1PILA 2EFQA 4UUXA 4P71A 1S0OA 5I42A 2XLIA 4ZCKA 3DM2B 2KJWA 4QIWD 3HZEA 1KOOA 1H7WA 3KLFA 1K9MT 2HFUA 1N6QB 1XNQF 2R7TA 2AMCB 2ZNZA 3CJ4A 2ASYA 2OTJS 4EYIB 2IY5B 1D0EA 3N28A 1J27A 2AJQA 1YQHA 4M1KA 3NGSA 2HWHA 4LF8F 3GTYX 1IR1A 3G6YA 5CZVA 2B56A 4ETZA 3OQ2A 3IFEA 3E8OA 1LW2B 5HLFA 3GJSB 1KVIA 4DDFA 2AYGA 2VJVA 5F0WA 4LF7F 1S6QB 2C3OA 3K89A 1HR0J 4PYAA 4LF8J 3PW0A 3BZQA 4EGLA 5LXYA 2WHOA 1XMQF 1NCLA 4X64J 3PYGA 3LP0B 2MKYA 1ZPVA 2GHPA 5ETTA 3OXGA 5KFWA 4ZJLA 3KLGA 2DO0A 1ZH5A 3UI3A 1ZM9A 4X4VA 3KK1B 2NSCA 4MAKA 4YR2A 3PR4A 1FNOA 3SDEB 3K2YA 2BANB 3OUYA 5J1NA 1X9MA 1JLEA 5KFBA 1RAHB 1IQZA 2J5AA 1LEOA 3SZ2A 4ZPWR 1J2VA 4DSKA 2DR9A 4L3NA 1EHWA 4ZLLA 4C8OA 1PKUA 3MAAB 1X9WA 2DCUB 2YKOA 2XMJA 2HQCA 5GADU 4LR9A 4KGZB 1L3SA 4NZ6A 1NSQA 4KHPF 4KJIA 3CTRA 2K2PA 3FFIB 2CNLB 2F9JA 2RD5C 2RHSB 2Z56B 5KG5A 1P9YA 4DL2A 5HQMA 4F4ZA 2XZWA 4WFYA 3R5AA 2J0XA 2IYIA 4O4GB 3H59A 3AQPA 1DRZA 1TVRB 5ETLA 4L3KA 3KK3B 2K3IA 3TAMB 1N52B 3QT7A 2AQ4A 4B9UA 4B9TA 4MFBB 2VQEJ 4NLRA 4KQZA 2MLXA 5JVHQ 4EZ6A 3PEJA 4MK7A 2CDQA 1OIAA 4WIIA 1FJCA 3TEGA 2F40A 4NLOA 1LWFB 3BSAA 3BV8A 2OPPB 1ACMB 5L38A 1CJVA 4LF6F 5KT6A 3IAM9 5B0FA 4LVOP 5D3GB 1TAUA 1S1VA 4NRTA 2YNHB 2KZZA 4F02A 4ZPCA 1HBUB 2NPFA 1S1XA 1Q16B 4EMDA 3OD2A 3UW1A 1NKEA 1I51B 4RJVA 3RRGA 2AF6A 5KG0A 2YWEA 3CULA 4PEOA 4HI2A 3PRBA 3MPUB 5DDPC 1Z2LA 5CA5A 2GVZB 3QWUA 5D0HA 2HK3A 4IUFA 5KFHA 4PXBA 4IOCQ 3ZTSA 3GMGA 2V4RA 3R2CJ 2ZKUA 1VS3A 3M2RB 5GAEU 4ZP9A 1QAXA 5FLXY 1RUSA 5L9NA 3QO9A 5K5MA 2GO8A 4GRSA 1RQ0A 4OYBA 4P75A 2W2OP 3HHNB 4B3SF 4RW9B 2EVZA 3BSNA 3HD1A 4V1Ak 2K1RA 2MJNA 3P4UB 3GWCA 1N5YB 2ZOFA 3KG1A 2A0FB 5DGBA 2L48A 4A8QA 5AE3A 4FN5A 3R3TA 2K3KA 4J9UE 3ILJA 5ETNA 2G0CA 1Q8IA 1RWPB 4ELUA 4P74A 5MAOA 1T9UA 2BE7D 2M52A 4B3RJ 1HA1A 1ZZNA 1NSAA 3IC1A 3AXMA 4F3MA 3IXQA 1FD8A 3NOGA 4B3OA 4FXWA 2JOQA 1G4CA 2CG8A 4RUCA 3DDKA 2LU1A 2GIFA 3VAMA 3OHAA 2CZVC 2QYCA 2BACA 1QY7A 3FMWA 2ILZA 3A3PB 4WF9Q 3DFEA 3MM9B 5AT1B 3U7JA 1C0TB 2ALYB 3EXCX 2OFGX 5F9LA 2H5JB 2ILYA 4DR1J 3DLGB 2CNKB 1CULA 1Q95G 2DCLA 1M1KT 3TEHB 1TKZB 2FJEB 1T9YA 2YX4A 4ED1A 2CQPA 4JI8J 4JI5F 2R4FA 4TQSA 1D8YA 4HYKA 2C2MB 4ITSA 2V8PA 1VBYA 2LQ9A 1FE0A 4A8YA 5LT5A 1OY8A 2V34A 3HT3A 1UMJA 4ZVOB 4KFBA 3VTIA 1T3NA 2W8KA 4TYBA 4JI5J 2HVEA 2D1CA 1T7PA 2UUCJ 2DNOA 3FBFA 1AYEA 2YNGA 1S4FA 1UL3A 1LWXA 4OYWA 2V94A 2EEYA 3ZZUA 1HQUA 2HQGA 3K8VA 3UWTA 3CJ5A 1U24A 1UWBA 1N56A 4RW7B 5IV4A 1LKZA 3R6GB 1NXIA 2M9KA 4F7VA 1GK8A 2HNDA 2ZH2A 1CJUA 1OSCA 2J7UA 2MKKA 4JI6F 1FF2A 1KP6A 1ZAVA 3KK2B 2ZWOA 4LJMA 1HNVB 1SBRA 3FVYA 2YPYA 2YWWA 3L3CA 2VG6A 3G9CA 3UN2A 1FE4A 1YZ7A 5KFCA 1HNIB 3W9IA 1TL7B 5BYSA 3UVJA 2R8GA 3ET6B 4QWBA 1Y9OA 2E1CA 2KYZA 2FZCB 1EIYB 2ZBCA 4M5DA 5F8JA 3SQGA 2G2ZA 4KGMA 2DXFA 2QTWA 4PZVA 3N6LA 2G0IA 4K4SA 1DY3A 4UZBA 2BDPA 3DRRA 1IBMF 4OX7A 2EKYA 2HVZA 3BYPA 3FSXA 4WE1A 1JLFB 2HGMA 3KUEA 3P5BP 5AE2A 4X65J 3GCXP 2POKA 2IJNA 3MD3A 1XR7A 2F9DA 2VH7A 3NKYA 3W61A 1X4GA 4C9DA 2WVBA 3AOAA 3PKYA 4C8YA 3IG1A 2UUTA 3QIPB 2OPRA 3PZPA 1RWUA 2BJDA 3CCRS 3R7SB 2FY8A 1C1BB 3SSSA 1WOOA 5ETRA 5DG9A 2M8DB 3RAQA 3NAIA 1LQ9A 4MJKA 1JJCB 2LMIA 5IM0A 2VPXB 2XGQA 3GIIA 1K1QA 3LH2S 2MGZA 4Y3CA 1QM9A 4K4UA 1WKLA 3WBZA 4IYQA 1HNZF 3QGHA 3H7HB 4GKKF 5IC4B 4NLPA 4NXMF 1RTDA 4FP9A 3R5DA 3GIRA 3WIVA 2YKNA 2HHPA 4LF4F 2W7PA 4C8KA 4X4UA 1JKHB 2B6AB 2JX2A 4TY8A 1JLQA 2WTFA 3KLHB 2HBRB 2EPIA 4F2SA 3UN5A 1EJ7L 2FJXA 3M8PB 2DGXA 1T11A 3TX8A 3F0NA 3TRGA 2AYBA 3W60A 4HACA 4IOAQ 3CJKB 5CCLA 1N32F 3T5HA 2B43A 5H9EJ 1GTEA 2CQ1A 3MEKA 1FT8A 2XGPA 2K7JA 1P8GA 2CPIA 2FJBB 2HBZB 3TUIC 1R89A 3ENQA 1HWKA 1RAJA 3H5XA 3PO4A 4LFCJ 5LSRA 2QSWA 2LQBA 3H5UA 5ETOA 3CD5A 1SVDA 3KDOA 1YHQS 4DLGA 4B3MF 2LQJA 3OTOF 3I0SA 4KO0B 1WEYA 2HGNA 2QMUB 1S79A 4MTPA 1F2GA 2FVQA 1F1BB 1BQNA 1VQLS 1LWEA 3IBCB 2HURA 4U7UK 3OTOJ 1U2CA 3C16B 1R7IA 1ZAXA 3S1TA 2MZQA 1U4BA 1T95A 2YNIB 3IR5B 5H9EK 3SCKE 4NLWA 3H5SA 4IQMA 4DQSA 3UDVA 2LDIA 2MY7A 3RRHA 3OV7A 1BQMA 2RUGA 4O3PA 3MEEB 5KOXA 1FESA 1JJ4A 2J6TA 3FEXB 3Q8RB 5ADZA 3PRDA 1U6BA 4NXNJ 2M5YA 2G2OA 5KT5A 2LP4A 1FWPA 1WELA 3UCUP 1KWMA 4I2PA 3MZIA 1G1XA 5DETA 2QLBB 1V3ZA 2RQKA 3P96A 1R8PA 1QD1A 4X62F 4DOZA 3MPYA 3F73A 1WKJA 4IFVB 1HPZA 1RT1A 5KT3A 3Q8YA 4IKAA 3ULHA 3ZO7A 3THTA 4QCLA 4C3KA 3A3OB 2CQIA 3ILOA 4OI4A 4R5PA 1RABB 2Q79A 4XK8C 1S1TA 2HFZA 2XYPB 4C8NA 3DRSA 2AYMA 4NA2A 2LA6A 3V81A 4CZCA 3EE3A 4MKYA 3HSGA 1FXRA 1ZETA 1JLCA 1NKBA 2I5JA 2YQ1A 1TU0B 3CWJA 1W25A 5A8KB 1OY9A 4IRCA 3M1VA 5T41A 3BKTA 4AL6A 2FIUA 5D0GA 4DPXA 1DTTB 2HZAA 3FEZA 5DDQC 1UJ4A 4Q2MA 5KFYA 2I9SA 1RTJA 1Q79A 2P9EA 3CDUA 3HKWA 1YBUA 1T8EA 3RUBL 5AXMA 4OZ0A 4KAIA 1RYRA 4CLWA 3EJMA 5K8NA 5E5NA 2MKSA 3M8RA 4BWJA 1FI4A 3HJVA 4QBUA 4DUYF 1WOSA 1TKTB 4IDKB 4YQWA 3LP2A 2FLLA 2XWXA 3CPWR 3HO1A 1Y00A 3KHLA 2B4OA 4YEAA 4F26A 4RBUA 2ZH4A 4ANCA 1JLAB 4OV6A 5K8OA 2QYGA 2W7AA 1IWGA 1HBMB 1QDUB 5BJRA 3J7A1 3TA1A 2DD8S 1BMQB 4TLQA 1RT6A 3N6NA 3PG9A 3UNGC 1IR0A 3BYRA 3MXHP 3MR7A 2BJ1A 4ZPDA 1DLOA 4G1PA 1WF2A 3W2WB 1U1RA 3FQKA 1FX4A 2HRYA 3G6XA 2ZC4A 4P6QA 3EMTA 2ZUAA 3SQOP 4OZ2A 3MD1A 4GVLA 1FJGF 4Y0FA 4KGKA 1CPZA 3B6BA 4HDHA 1HD0A 2Q3PA 5C42B 4OHYA 3HF5A 4OI6A 2J9CA 5AJ3J 2ROPA 4HL9A 1UFKA 2R7RA 4CO1A 1HBNB 3MM8B 2FVCA 3VZHA 2HBYB 4LFAJ 2CZ9A 4CLSA 1LV5A 4P2XA 5KFTA 4H4MB 1FRHA 1U49A 1R3NA 3PO5A 3V6KA 3NS7B 3I9ZA 2V5HG 3JQJA 1L3VA 2BANA 3G8TA 4TVAB 1U2FA 5GAHU 3ZZRA 1HMVB 2XI2A 1DTQB 5I3UB 1D09B 5LXRA 3DI6B 3T1YJ 4JP8A 2QMXA 2H65B 2MZSA 1WC5A 2WB4A 4AE5A 4M8LA 1U1LA 1WC1A 3M30B 3M8QB 2VOOA 1SPBP 2JNJA 2KFZA 1MN9A 5EWGA 1PYTA 1AXQA 2WK4A 1HWIA 1L5UA 3ZZYA 3RTVA 1FCAA 2PC6A 2ZWPA 3JAMY 2HNZA 1S1UB 2MSTA 1FO1A 2V9WA 2V68A 1XEZA 1T05B 4F25A 4DV5F 3RW6A 3BO3A 4CLUA 4R8UA 2OAUA 3HHEA 1KN6A 2I1RA 2OTLS 2G2YA 4HEA9 3TW0A 3HJFA 4BBYA 1IKXB 4EYHB 3BSOA 1X5PA 3NLCA 2OH2A 1MU2B 1SUQA 5C24B 3GYNA 4CLPA 1BUXA 5J1PA 4ANDA 1T03B 2B9XA 2WSFC 4LIRA 1B7FA 2KT5A 2DNYA 2AGQA 3H2UB 3PM9A 5HN0A 2HRUA 2WCXA 1S4EA 2GGPB 1RBOB 2W25A 1H2VZ 1QAIA 2J9DE 4RW4B 2VONA 2B5JB 2EXUA 2FHJD 5CYQB 1VGYA 2XTJP 2HVHA 2XLKA 5KT7A 5FJ4A 1T9VA 2RT3A 5HMWA 3HX9A 4CT8A 2UVUA 3HK2A 3TUZC 4JI0J 2CA9A 2QLXA 3BN7A 3W63A 3PXGa 3SXLA 1NKCA 3CD6S 1KDNA 4Y00A 4WU2A 4FVCA 1XERA 2QT7A 4WFXA 4OYOA 5K20B 4DCOB 2ACYA 2W9CB 3T5KA 1NH7A 3BGOP 2X1GA 4XDDA 1FA0A 1FK9A 4C0BA 2J7WA 2HHHF 1LFPA 6FD1A 2JDJA 3P5TL 3C66A 4C7QA 4TU9A 1NSKL 2VDHA 1FFSB 2D74B 5DDOC 4ZN1A 1X0FA 1RWWB 4LF5J 3DOLB 2GJ2A 3J7YU 1R8BA 3J7AN 1TV6A 5IC6B 3O1LA 3NBPB 2QL7B 3RRKA 2JFKA 5HO4A 5HBMB 3CD0A 4J9SA 2JEGA 4D3HA 2V8GA 3GIMA 1RTIB 1SL2A 4QU6A 1MWQA 4TY9A 4K4WA 3HULA 3MMCB 1HI1A 1MNEA 1UJ5A 2L9WA 1TR0A 2DGWA 1TKXB 1G7CB 4OIXA 3OL7A 5HP1A 2VQFF 4CLZA 2CQ0A 1S9GB 2ZM6F 2FB0A 2NZ4A 2KM8C 2DJWA 4JV5F 3RB0A 5K8MA 2BW2A 4P10A 1X31C 4DFKA 3RYLA 4BDPA 3QT8A 2DRAA 1PSDA 4OZ1A 4P9SA 1WWHA 3CDEA 1E6VB 2AP6A 5E3QA 4DFPA 4N56A 1NJXA 3OLBA 1REVA 2IBOA 3CCUS 3W9JA 2MKCA 3LGNA 1XNRJ 5K8PA 4M5NA 2VV5A 2KJVA 1SC3B 2XEXA 1UJ6A 3H0PA 1FFGB 2HHTA 3GFYA 2BJEA 2MKHA 5B08A 2BE2B 1KVJA 2KYXA 4G65A 1B0TA 3C8YA 1NJWA 1HBOA 1TMMA 2ZHOA 5A0YA 2WBRA 4ERDA 5FD1A 1I6JA 2OHDA 3I9V9 2Z2ZA 4QOTA 1JXVA 3LGMA 2DNQA 3H2VE 3ENVA 5F41A 1NHUA 2DR8A 3MM7B 5C7PA 3DOKA 3OL6A 5B0EA 1B99A 1LWCA 4FDFA 2WVEA 3HFKA 2JRSA 1HNVA 1N0VC 2E44A 2PIIA 3MECB 2D9OA 4DR3J 1RKIA 3G82B 3NY0A 3P8BB 1WHXA 4ECVA 1VQ9S 3Q8QB 3TZWA 1LK7A 5C25A 1WF1A 2BJ8A 3MHYA 2HKEA 1KRPA 4JI2J 2ZDOA 1IKWA 3IR7B 1HNWF 2J9EA 3TI0A 1TAQA 1WORA 4PG7A 1W2BR 3FGVA 1KFDA 5J2QB 1HQ2A 1K0VA 1Q8BA 1PBUA 2NQPA 3EPIA 2GVDA 2IJRA 2QO3A 4JYAJ 4Q5VA 3BBCA 4AQYF 4PKDB 1JLFA 4RW6A 3GV7B 3CJRA 2DNGA 4KH0B 1XN9A 4OZ5A 1Y5NB 3MEDA 2XS5A 4PWUA 1O5JA 4JI3F 3ZXWA 3V6DA 1SQFA 1NH8A 1Z2ZA 1U09A 1TFWA 2Z30B 2DGSA 5HVGA 2P5VA 3IRWP 2DBBA 3LUYA 4WCEQ 4NI2B 2E9ZA 4QJVA 2XS2A 3OT9A 3NNHA 3DOMA 2CPFA 1KQFB 4K7QA 4HHHA 3FMBA 1F9HA 1RAAB 2VFTA 4KHRA 3EYZA 5CZXA 4O23A 5I3QA 4LRFA 4AL5A 5L8RC 4KV8A 1PYSB 7FDRA 2ROEA 1F3VA 4OX9F 1V6HA 2JH3A 2EK1A 1ULRA 1YI2S 3J81Y 1VQ6S 1UVKA 4YY3F 2R7VA 1I1GA 3BJYA 4ID5B 3WHIA 4WXOA 4RNOA 1RT5B 3MF5A 4W98A 4HT5A 2ZD1A 1WG4A 1C1CB 3AJDA 4PWDA 1YLXA 4X4SA 1S59A 4CO2A 2W9AA 4ZKAA 1NHKL 1N4LA 5KFMA 1D9DA 1S6PB 2O66A 3E2EA 3DMJA 1WHVA 2KHDA 3TP2A 5I42B 1S72S 1KOHA 3G86A 3QGIA 1X4FA 4H4KA 1VQYA 4QPTA 3TWZA 2IVYA 2VA2A 3OTBA 1YJWS 2C28A 4LF9F 3KLFB 1SIZA 3NMRA 1IM4A 1YJTA 3SFUA 1BGXT 3RGIA 4CLKA 4NLVA 3RU0A 3S8SA 1YWXA 5HLFB 4G1IA 5HMZA 2GMLA 3D3BJ 3D1HA 2IAJA 5B0AA 4W90B 2NS1B 3M7VA 1FTRA 4O3SA 4C8LA 4WP3A 1QAJA 3KLGB 4OYIA 3M8WA 5CYMA 4KHMA 1RT7A 1RHUB 2DGOA 3BGUA 3PACA 4DF4A 1HIYA 4PAAA 3R5BA 4NCBA 3OUYB 4XDCA 2EWHA 1JLEB 4DMZA 5ITHA 2KRRA 4ECQA 3MCSA 1IBKJ 3DU6A 1RU1A 1U1MA 1SKUB 2H48B 1RCXB 2D3UA 2P6SA 2B51A 1JQGA 4EWTA 5JJBA 4N41A 2CJAA 4YUDA 1VYAA 2BJ7A 3CDAA 1QTNB 5CQGA 3H25A 8AT1B 5DZ7A 3D54A 4DQRA 4NLUA 3KHGA 3U1LA 2BZ2A 2GQCA 2DGTA 4F36A 4EEYA 5C5JA 2C3PA 4NWBA 1TK5A 2P6TA 4HHJA 1RWNB 1FERA 5JVGQ 2HQFA 3QQCD 3I5CA 4IR9A 2QLJB 2RKIA 1CS4A 2PI4A 3EICA 3Q89A 7FD1A 1VRUB 4TXSA 1CC8A 4M5KA 3JQKA 3RZAA 4W4MA 4RUBA 3D0GE 3CMES 2VBWA 1S9EA 1K44A 4PRFA 1YGYA 1CJVB 2Y0BB 1BXNA 4DV4F 1M1HA 4ZITA 4ECWA 1ROFA 1S1VB 3PKMA 4DCPB 1GX6A 1GFWB 2ZBPA 4EU0A 2HFSA 4RLEA 4DZ6A 5LMUJ 1S1XB 2YNFA 4YB6A 1FKAF 3FBEA 3QGGA 2KM8B 2AJ2A 2E7VA 3BM7A 1AFJA 4CH7A 1PAEX 1UWAA 1SB6A 1TKDA 1BWEA 2F4FA 2QA1A 3QBCA 1WOPA 4CI0B 5CABA 2YKMA 2L08A 3O6QA 2DIUA 4XO0A 3HFZB 2MLZA 1X5SA 4DFMA 4LQ9A 3QO9B 3TQ1A 2KXFA 5EWFA 1H3DA 2VICA 4DQQA 2AW0A 4XPEA 1LW0A 3OBIA 4ZHRA 1XR6A 5HQ8A 2KFNA 4QWEA 1B70B 2DH7A 2K1RB 3KLVA 3UDEA 2V4JA 3HLUA 4IO9Q 4DFJA 3K5PA 3OTCA 3O5TB 1VQ8S 5KG3A 1N5VA 1T9WA 3C15A 1SQGA 5SZTA 4ECTA 1GMUA 3OSNA 3MPWA 1FXLA 1FVSA 1DJ0A 4YN3B 4JI4J 3MURP 3GQCA 1VQ7S 1C4CA 4LRCA 2VB6A 1HNXJ 1QSLA 3EDQB 5DGAA 1LK5A 5LMNF 3GU0A 1I94F 1SL0A 4ZJOA 1LFWA 2DB1A 1U1KA 3UDLA 1D8ZA 2DHAA 3FZ2A 2R2SA 3T6JA 1CULB 2IA0A 1MROA 1DURA 2M3DA 3PDNA 2IRYA 4RNHA 4DV2J 4LSNB 4H4OA 1JNRB 1VK8A 5F8MA 1RA7A 4I6AA 5B0CA 4O3NA 4K0KF 2VJUA 4FF4A 2E5LJ 5F8GA 4F3OA 1V9OA 1WKKA 2CQ4A 4KFBB 1SV5B 1CVJA 4RPFA 3BREA 1MN7A 1YK9A 3NAHA 1F5BA 2V50A 2QA2A 1RKJA 4E2FB 5IQQA 2YNGB 2KB2A 3T3FA 1M1GA 3FC9A 2ZC3A 3MTKA 4N47A 2KVQE 2Q6BA 4KTQA 5KOWA 1N34J 4C98A 4ZCIA 2LXUA 3IGNA 2I8EA 4NZ0A 1UWBB 5L46A 3BDEA 1NK7A 1NB7A 1UPMB 2C42A 1T9XA 2ROGA 4ILMA 2GJFA 2HNDB 1RT3A 1CJUB 4CRJA 3UN3A 3N79A 4K59A 1X9SA 2HHWA 4LF2A 3GJRB 1Q53A 3PY8A 4DV6F 3K5OA 1UVJA 5H9FJ 2VG6B 4J37A 5KFFA 2G1HA 4HHUA 4CM0A 3UVJB 4DV1J 5IT0A 4ZPTR 4K4YA 2F1FA 3VWSA 1RYSA 4K2JA 4M5DB 3SQGB 2LQ5A 4I64A 4M5GA 1V3SA 4U8VA 1F0XA 4L75A 2MKIA 2AT1B 3BR8A 2NXEA 4WWSA 4URQU 2FGCA 1FJEB 4ZVRB 2W1BA 3EPGA 1VI7A 3MEGA 2FDNA 4CYUA 4EO8A 3DRRB 2ZBQA 2VODA 1NBEB 1R6VA 3H90A 2NYHA 3LWMA 2DXEA 2FY1A 1EB0A 3N0VA 2MQNA 1N33F 4MH8A 1B0PA 4ZDNA 4WE1B 5L1LA 2XNRA 3RBZA 1BLUA 2FZKB 1MMNA 2FQQB 3MTJA 2V69A 2JL9A 4A8XA 4D3GA 1NB2A 3AB4B 5H9FK 4WFNQ 2CJYB 1Q7LB 4F50A 1HW8A 3IG1B 5DG8A 2KU7A 2OPRB 1KHVA 3HHLD 3FZBA 4DL5A 3L7PA 3Q24A 4CDIA 1S7HA 4OJHA 4A8WA 2XBPA 5IM0B 4U8YA 1S77D 2MDAA 5KAKA 2MGZB 3TA2A 3BB5A 4KY3A 2RH3A 2L9NA 4ZIVA 1EQ0A 3AAWB 4KR0B 2J6SA 3TVYA 4IG0A 1IKYA 3NNAA 1UETA 2ZEJA 1RTDB 4U67Q 5D4LA 1U1QA 1N0UA 2YKNB 5DS7A 2UP1A 4YMEA 2CG4A 1U0SA 3NWRA 4AL7A 4TY8B 2HIQA 1JLQB 1OY6A 4EBCA 2MY8A 4G3IA 1X4AA 1U8WA 3DLLQ 4PPZA 2OFHX 4ZMMA 2DNMA 4ED6A 1F9EB 4Q45A 4PXEA 4HACB 2GZOA 5DQIA 1CBKA 3RBEA 3LP1A 4DPYA 1HI0P 2UU9J 3CCZA 2D3OR 3GV8B 3BKUA 4WTYA 1Z1ZA 3VCDA 2VFSA 4L76A 3V4IA 2DH8A 3KUHA 2DXDA 2V6AA 2PE8A 2UXDJ 4J9QA 4DJBA 4P7VA 2OD4A 1AZSA 3IS9A 2XY5A 1OQ6A 1SJFA 2JC1A 2HHXA 4ED8A 3M8YA 3VGTA 1Q4RA 3DGVA 3QATA 1RADB 3ELHA 3HMJG 3EUNA 3I0SB 3JSYA 3I5AA 1S49A 2CPXA 2XM3A 5IWAJ 1GMVA 3AA9A 2L9DA 4U6PA 4OYAA 3DRPA 4U9RA 4YR0A 4Y2IA 1BQNB 2EFGA 4QW8A 3IO1A 1LWEB 4LFBF 3OR2A 2L3MA 2XULA 4DUTA 3IWXA 3CMAS 5KFEA 2KZMA 1UFWA 4NPOA 3MMAA 3OTEA 1C0UA 1T94A 1JB0C 4X66J 3BH6B 3HD2A 2NPIA 1BQMB 1BE4A 4KBIA 4Y2AA 3CCTA 2COLA 4F3QA 3HXMA 4ZVPB 1D1UA 1AROP 1VQSA 4NLSA 1R31A 3K5MA 3PHTA 2Z2LA 2Y1LB 1RTZA 4ES3A 2K8GA 2RS2A 4Y6IA 2ZITA 3EVOA 4ICLA 5GVQA 4DR6F 3JTOA 2IDEA 3R7NB 5D4PA 1ZYQA 2Z0GA 1UVMA 4Q44A 4IH5A 2MLYA 1VJWA 2VZ9A 2UXBJ 1HPZB 1RT1B 4FXDA 5A6WA 5KFIA 1ZTWA 1PO6A 4FNIA 2YWFA 2GQ2A 3R8YA 1SI9A 4IH7A 4DSLA 1PG5B 4ZA1A 4R5PB 3MFIA 5D15A 1APSA 2J6UA 2BOAA 4HR2A 2DPJA 1UTAA 1TK0A 1XTZA 1JX4A 3QZ8A 1S1TB 4C97A 3PTWA 1AW0A 3DRSB 4DR4J 2XZDB 3V81B 2A2CA 2QFJA 1JLCB 4DN9A 1FDAA 2I5JB 4QIVA 1RSCA 5F3TA 2BEFA 1UW4A 2WW8A 4ANEA 2AD9A 2J0WA 4IR1A 4B9NA 2HZVA 4I6YA 2XCPA 5GMEA 1RHMB 2BVZA 2CNNB 2BOPA 2RNEA 3EVMA 1FVQA 3CB4A 2XY7A 2R8KA 2WZ1A 4C11A 3CC4S 1M5SA 4DV0J 5B7WA 1RTJB 1WTFA 4GO7X 1WDDA 4FKYA 4WU3A 1GXUA 1RI7A 2OUGA 3A8EA 1WJ9A 3CGIA 3QT5A 1CEZA 3JYTA 3RB6A 1W7WA 2MHEA 2V2KA 3K57A 1WEZA 2A1BA 2RDIA 2X1AA 2CQBA 3UR3C 2X1BA 2ZH5A 3LP2B 1BC6A 3H40A 3OL9A 2UV8G 4ZOSA 5MLCV 2FLNA 2NCKL 1FRJA 1HI8A 4B17A 3VGSA 1WC4A 2HVIA 1IUJA 4DR7J 1A6LA 5A8RA 4QWAA 1P9QC 3U1MA 3HI9A 3EZ5A 1KQKA 5KFLA 4CLFA 4O3QA 2UXCJ 2VG7A 2VPZB 1F60B 3FCHA 1RT6B 2RU9A 1NHVA 1I5OB 3CJ2A 4NRUA 3TUJC 1DLOB 1XC9A 4IH6A 4DS5A 1XK8A 3ZZZA 5F9NA 4FF3A 2HBQB 2Y1JA 1NJZA 1DARA 2W7OA 1BY9A 2ZKTA 4C3LA 3GG1A 2KHCA 2CWXA 2W4CA 5ETSA 2NREA 3NGRA 3DDNA 3KLIA 1K8AT 4LR8A 2WVDA 2I2YA 1XNQJ 3EDRB 4QR1A 2V8HA 1FDNA 3V4MA 1M0SA 5GAGI 4XPCA 1NK0A 3H42A 3ETOA 2Z57B 4M5MA 1GNKA 1OJ4A 4WKRA 2MQMA 4R0JA 1TUWA 3ISND 2AJ0A 4B9VA 4C3MA 1GMWD 1C4AA 3B78A 3SCIE 3T1AA 3QWPA 3W8GA 2QA4G 1RAEB 4GVBA 4LF7J 3W9HA 2OKQA 3DGPA 3ZZPA 3A8JA 1R0CB 3UR0A 1UKUA 1XMQJ 2M7SA 5A6PA 5HATA 2ALZA 2AJ4A 4CO5A 3DHWC 3CDWA 3Q2SC 2H1YA 1S48A 4YB7A 5JUMA 3MUVP 3OFGA 5C2CA 1SJQA 3SIPB 5KG6A 1PC4A 2GHWA 2ZE2B 3MR2A 1YJNS 1IBLF 2VPWB 2R2TA 4EI2A 4H4KC 3AFGA 2VF3A 4USMA 3QRQA 3AD8C 4UW2A 4WBFA 4A46A 1J5EF 4F4WA 5FIIA 3Q86A 2HNZB 3ZTQA 3JSMA 1IR2A 2XQCA 3M32A 2HNYA 1JWWA 1AUDA 4KHPJ 4DQPA 4R8UB 4KSEB 1SH0A 1RISA 2UUAF 4C0HA 4NX9A 3R9LA 4ELVA 1VRUA 4KH1B 3NOCA 2R8JA 3L7UA 1SUQB 5DQHA 2MZTA 4G1QA 4F4KA 4ZLJA 1QE1A 2WVFA 3QLHA 4DUZF 3BF4A 2U1AA 2ABYA 5KFPA 2KG1A 4ZLNA 3FCVA 2X1FA 2ZZTA 1XMOF 2CDRB 1N36F 1RWVB 4A8SA 1R0AA 3E01A 1H74A 4LF6J 5E41A 3BN4A 3V5RA 2XSJA 1KS2A 1TFYA 3TQEA 2DTJA 2LEAA 4DV3F 4RZRA 2X7IA 4LUBA 2PEHA 3AA8A 1FK9B 3M9MB 1A9NB 2KXNB 3Q8VA 5ETQA 4PXCA 1AA1B 4EFAC 4LRAA 3ZC4A 4K4VA 3SCLE 1Y7PA 4YP3A 4EO6A 4DHVA 3MCOA 1IQTA 1SKWA 1H38A 3IA0A 2E7WA 1NUEA 4DG1B 3DLBA 2HVDA 3ZTRA 3BGRA 2CRLA 1TV6B 2GNKA 2G1DA 4GKJF 3LA0A 4B3SJ 4DL3A 5AXLA 3DU5A 2F4VF 2DNHA 4BWMA 1YVFA 1E6YA 3SMZA 1Y5LB 4WPAA 2AEJA 2DNZA 2FVPA 1U02A 1S0VA 2CXEA 3M2VA 4J9OA 1VRTA 3QYYA 2BJ3A 1YJVA 2MZJA 2M8HA 2Q66A 5CYJA 3NG8A 2KG0A 5HP1B 1RWXB 1MLAA 3BEGB 1M5PC 3CT9A 1FFWB 3DYAA 1NDKA 2ZH1A 1R8AA 3JQMA 3FUYA 3JSRA 2M88A 4J5OA 1R0BG 2LLZA 1IJEB 3FQLA 5BYQA 5KG4A 2OMLA 1S10A 4ZJQA 4DXLA 3P6YC 1K0TA 1UA1A 1S9FA 4UOGA 2QV6A 4LSNA 1OPZA 2WOMA 5KFJA 3CE8A 1REVB 3K0JA 2N3LA 3VAHA 2ZFHA 4TQRA 1UVIA 2RQMA 2VC0A 3EGNA 5HANA 1SV5A 1UEKA 1NK8A 1MG7A 1M5KC 4O3OA 4ED2A 3EXYA 1X7VA 1JXEA 3HP6A 1PIEA 4OJGA 1G2EA 4DEZA 3J80Y 1KNZA 2XG8A 3GSDA 2Y1IA 3OFHA 1WTBA 2DISA 2PDAA 2GHVC 1HBOB 5A0YB 1ITPA 3GSIA 5AXNA 4ED3A 1WD6A 4UF4A 2UZAA 2HWTA 1QVGR 1RHJB 3C14A 4ZP6A 4N8NA 1VQPS 1X4DA 3MM6A 3DOKB 4BCAA 1HYSA 1LWCB 5D77A 1H2TZ 1R8HA 4PABA 4LSLA 1WSVA 3BPSP 4WXWA 2H9ZA 3SEOA 5B0DA 4JI6J 4NLXA 4Z37A 3CEDA 2ZH6A 3H8YA 2K7KA 2R7OA 1VISA 2FGOA 1LXNA 1TP7A 4Q0BA 1KTQA 2DNPA 5C25B 4Y2MA 2JLEA 1CJTA 5KFZA 4FYWB 2CVEA 3CXCR 3AY0A 2BBEA 3N9UC 2GV1A 2YH0A 1IKWB 2OELA 2JFDA 1X8DA 4FPRA 4I7FA 2FHJA 4ED5A 3AQOA 3DLEA 4P2FA 4RUHA 4OV1A 2GVDB 2WW4A 3DXBA 4LQ3A 1KHWA 2JEIA 5J1EA 5C2GA 5KFVA 1K73T 4DV7F 4RW6B 4NLTA 3CNQP 4O0IA 3NGTA 2CZ4A 1IBMJ 1Y3KA 3MEDB 3D7SB 3V6DB 3OPKA 3K5LA 5KFDA 1MWYA 1Q0NA 3A8KA 3DC2A 3GLJA 2V8VA 3N5FA 1KQSR 1IXKA 4OFZA 3OR1A 4J91A 3K58A 4UZCA 2D9PA 3OLAA 2IM1A 2MQQA 1OYDA 3KJVA 4M94A 3DOMB 3M2UA 4DPWA 1FNMA 4DQIA 1RBAA 3FBCA 4WZQA 3UFCX 4DL7A 2H3EB 3MAHA 3PNIA 1DBDA 2W24A 2QE5A 1Y4ZB 4KV8B 1F9FA 4LR7A 5SUHA 3CCSS 3R1LA 3IN5A 4OZ3A 3ILLA 1EP4A 2BXJA 2XI3A 4O0NA 2GS8A 3ICLA 5HVFA 4ZLPA 2CAJA 4Y28C 1GX5A 5ETVA 1HNZJ 4WP9A 1YKWA 4JI7F 4GKKJ 3EZUA 2ZD1B 4NXMJ 1UVLA 1XMBA 4PWDB 1YITS 1S1WA 4LF4J 1G3OA 5DZ6A 5KFUA 1NU4A 3DLHA
chains in the Genus database with same CATH topology
1FTRA 3KJVB 4DBQA 2HAIA 5KG5A 3GR0A 3MMJA 2QLWA 4O3SA 3QJJA 2CKWA 3TANA 4DL2A 3MR3A 1ZAWA 3DMJB 4F4ZA 3M2UB 2XZWA 4C8LA 4Z2XA 2ZH7A 1O8BA 2BABA 2CQGA 4PG4A 3R5AA 4WFYA 3OJUA 2DRBA 2OIHA 1QAJA 2J0XA 3KLGB 3PW4A 2DGQA 2IYIA 4O4GB 1BD6A 3H59A 3O2IA 3AQPA 1DRZA 1TVRB 5CYMA 3I56S 4WK3A 4CT9A 3JTNA 4JBCA 4KHMA 1RT7A 3KK3B 2HHVA 1WEXA 2K3IA 2DGOA 3BGUA 3PACA 2CPJA 4DF4A 3TAMB 3R5BA 3M2RA 4Y2KA 1N52B 4NCBA 2J76E 3OUYB 2R9LA 5F3ZA 4XDCA 4JUZA 4RBVA 3US5A 2EWHA 4QWDA 4EBDA 2AQ4A 4LF5F 1JLEB 4B9UA 2MXYA 4DMZA 2Q1LA 5ITHA 4MFBB 4B9TA 2JEFA 4NLRA 2KRRA 4KQZA 4ECQA 2MB0B 3MCSA 2DHSA 5JVHQ 4K5SA 4EZ6A 3PEJA 4OZLA 2RF2A 4MK7A 2CDQA 1EP4B 1OIAA 1ZBTA 3DU6A 2NLWA 4WIIA 3KHHA 4OX8A 2RDJA 4RW9A 4USHA 1U1MA 2CJKA 1FJCA 1H0HB 2D3UA 2P6SA 2F40A 4NLOA 2B51A 1LWFB 3HZGA 4P7TA 3BSAA 4J9LA 2OPPB 4EWTA 5L38A 3W2VA 5JJBA 4N41A 2CJAA 4YUDA 1F5AA 1N5YA 1FEHA 4JV2A 4LF6F 2ZJRQ 1HW9A 5KT6A 3CDAA 3IAM9 1FRLA 3SCJE 5IXUA 3KYLA 3E51A 5B0FA 4LVOP 5CQGA 3H25A 5D3GB 2E1RA 4CQ1A 1TAUA 1S1VA 4UQTA 4ECZA 4NRTA 2YNHB 4ECYA 1S1WB 2VPYB 1SJ3P 2KZZA 4C2MA 4F02A 3NRBA 3D54A 4DQRA 4ZPCA 4NOHA 1UVNA 1FNXH 1HBUB 5L9XA 2HW3A 2NPFA 1S1XA 1Q16B 4NLUA 3KHGA 4QW9A 2IAJB 3UW1A 1NJYA 1NKEA 1KD1T 3RRGA 2AF6A 5EDWA 1X0PA 5KG0A 3U1LA 4B9MA 3H2LA 2YWEA 3MR6A 2BZ2A 2E1MC 2GQCA 1KR4A 3CULA 2DGTA 1X5OA 3PX6A 1VQ4S 4EEYA 3T9ZA 4ZCLA 2Y1RI 4HI2A 4OHZA 5C5JA 3PRBA 1S76D 2W4PA 1NK9A 2C3PA 5DDPC 4NWBA 1TK5A 2ZH3A 1Z2LA 4PQUA 2P6TA 2ZBIA 4HHJA 1HWLA 5CA5A 4FYDA 1FERA 3QWUA 2H5EA 2IHR1 1H7XA 4ECSA 4F4YA 4IUFA 1U26A 5KFHA 4PXBA 4IOCQ 4KT0C 3GMGA 2E7XA 4XIUA 5CYMB 3Q8SB 5JVGQ 4Y2CA 3I5CA 2CJBA 1RT7B 4IR9A 3J7YI 4X2BA 2Q43A 2RKIA 5DRKA 2V4RA 4IG3A 2PI4A 2ZKUA 5E3AA 1VS3A 3M2RB 5GAEU 3MM9A 4ZP9A 1QAXA 1UEUA 5FLXY 7FD1A 5L9NA 1R27B 1VRUB 3QO9A 2HS3A 5K5MA 2MJUA 3N01A 2GO8A 1C0TA 3BO2A 4BC7A 1QTMA 3M8SA 2ASJA 1RQ0A 4TXSA 2ATLA 1CC8A 3RZAA 4NYOA 2RF2B 3CMES 3D0GE 4QYZJ 2VBWA 2VA3A 1S9EA 3V6HA 3TAQA 1KNZA 3HHNB 3DN9A 3DLGA 1XNRF 1NO8A 4B3SF 2RILA 4RW9B 3VZIA 4PRFA 2EVZA 3BSNA 2FC9A 1TKZA 5BYRA 2CQCA 1KEKA 4QWCA 3NGDA 1YGYA 1JLGB 1URNA 2HLTA 2K1RA 2MJNA 3GWCA 1N5YB 2ZOFA 1ZM2A 3KG1A 4GC7A 5D8HB 4DV4F 5DGBA 2L48A 4A8QA 5AE3A 3CIZA 3M6UA 1ROFA 1S1VB 4OI3A 3K5NA 3TNVA 4ECWA 4LVNP 3PKMA 4FN5A 3R3TA 3OVAA 1GX6A 4ZVFA 2K3KA 2I0XA 4EU0A 4FF2A 2E66A 4HI1A 5BR8F 3CCWA 4RLEA 1CQNA 1GXLA 2XMTA 2UVWA 1S1XB 2YNFA 4YB6A 2G0CA 1Q8IA 2FLOA 3CCES 1FKAF 4ELUA 4PG8A 3QGGA 3ONQA 2MPUA 2FVRA 3Q2TC 2VASA 2KM8B 5MAOA 5F0UA 4FS2A 4EZ9A 5J2NA 2M52A 1HA1A 3MMBA 3BM7A 1ZZNA 1M5OC 1FEEA 3I87A 1AFJA 1VQKS 4OJ3A 1DHMA 2LEPA 3IC1A 1FXDA 4CH7A 1MWZA 4F3MA 2YY3A 3IXQA 4QZVB 1SB6A 1FD8A 1TKDA 4B3OA 2EG2A 2B0GA 3CC2S 4FXWA 4PQUB 2JZ5A 1BWEA 2QA1A 2JOQA 3T6BA 2PFFB 5M2RA 4RUCA 2GW8A 2M2BA 4CH0S 2OSRA 4CI0B 3DDKA 2LU1A 4IFYA 4C8MA 2UVVA 3VAMA 2CYYA 3OHAA 1HQEA 4NYZA 2YKMA 2FHOB 2L08A 1WG5A 3O6QA 2CZVC 2FHMA 2DIUA 2QYCA 2R2UA 2BACA 2RKIB 1QY7A 2VD3A 4XO0A 4YHHF 4IG3B 3FMWA 5L1JA 2ILZA 3N5BA 4RW7A 2UUBF 4WF9Q 1X5SA 5IT4A 2B9YA 4DFMA 3DFEA 3MM9B 3GIJA 3U7JA 4LQ9A 4RUAA 3QO9B 2Z8QA 3TQ1A 1N5TA 4UQGA 4RWWA 2KXFA 1C0TB 5EWFA 3L09A 1H3DA 4QR0A 3RR7A 3EXCX 2OFGX 2AW0A 4XPEA 4DQQA 1RT2A 1LW0A 5F9LA 3JB9k 2ZHAA 4C4WA 2ILYA 3OBIA 3WDOA 4ZHRA 4DR3F 1S0MA 1XR6A 1S9EB 5HQ8A 1VBXA 3DLGB 2KFNA 3KK2A 4QWEA 4F67A 2BQRA 4YDDB 2DCLA 1M1KT 1TKZB 2VOPA 2FJEB 3G8SA 5KTQA 3X1LB 1VQ5S 2WSEC 2DH7A 3A1YG 2K1RB 1X4EA 3KLVA 3OXLA 2YX4A 1TL5A 1D9FA 4ED1A 2CQPA 5I4MA 4JI5F 2R4FA 4TQSA 2IVFB 1D8YA 1S6OA 2RQ4A 4HYKA 1HNIA 4A8FA 4ITSA 4KE5A 2B4PA 2V4JA 4LIWA 5E3CA 2ADCA 3HLUA 5HI7A 4JI2F 4DSIA 4IO9Q 4DFJA 1FRKA 2MHNA 3GFHA 4OZJA 3M9NB 1VBYA 3K5PA 3OTCA 2LQ9A 3O5TB 1VQ8S 1FE0A 4A8YA 2AU0A 3CCQS 2PO4A 5KG3A 5LT5A 2MQPA 1N5VA 3UD4P 3CCMS 1HARA 3HT3A 1UMJA 3H4BA 4KFBA 2PA3A 3BGFA 3SI8A 2YNFB 5SZTA 1XWLA 3VTIA 4ECTA 1YBAA 1T3NA 3OSNA 2W8KA 2N7CA 3MPWA 4TYBA 2PMZD 1Z4UA 5J2NB 2YVSA 1FXLA 3MMBB 1FVSA 2D1CA 4NYPA 1T7PA 1DJ0A 2DNOA 3MURP 3GQCA 1VQ7S 1C4CA 4DN0A 4ES1A 4NLGA 4JI1F 2XO7A 4PUOB 4OHVA 4JYAF 3I31A 5DO2A 2OPSA 1SH3A 2VB6A 2YNGA 1QSLA 1S4FA 2C3UA 1UL3A 2V94A 3ZZUA 3S7RA 1SJRA 1HQUA 5DGAA 4IFYB 3C3LA 1LK5A 3F41A 3K8VA 1HQEB 4PG6A 2YKMB 3UWTA 3CJ5A 3DHXA 3BO4A 4I1TA 5LMNF 1U24A 1UWBA 2J8AA 2AJFE 4B3TF 1N56A 4OX6A 2DR5A 4F8RA 1I94F 4RW7B 1Q82T 1LKZA 4DR2F 4IQXA 5IZHA 5LJ3Y 1OS5A 2M9KA 3GZ7A 1SL0A 1LFWA 3DNCA 2DB1A 2HNDA 2MQLA 2ZH2A 4K50A 4I2QA 5K14A 1U1KA 1RT2B 1LW0B 5A8WA 1OSCA 2BM1A 2J7UA 3UDLA 3DLKA 4ZHRB 2W9BA 1D8ZA 2MKKA 4JI6F 2DHAA 3FZ2A 5FDLA 2R2SA 2DH9A 1FF2A 1ZAVA 2AWZA 1KSPA 3KK2B 2XY6A 3CO9A 3T6JA 1R43A 4YOEA 2N3OA 4ECRA 4I0WA 4LJMA 1QUVA 2IA0A 1HNVB 1DURA 2GA7A 1MROA 1SBRA 2M3DA 3HVTA 3PDNA 3FVYA 4MYUA 5KG2A 2BUNA 2IRYA 4RNHA