1X5TA

Solution structure of the second rrm domain in splicing factor = 3b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
GSSGSSGIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second RRM domain in splicing factor = 3B
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Splicing factor 3B subunit 4
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x5tA01
2OSQA 1PGZA 2HGMA 2OJ3A 2DGWA 2MQPA 1NO8A 2NZ4A 2CPEA 4P6QA 2XS2A 3MOJB 4TLQA 3S01A 4Z2XA 2DNZA 2RU3A 2M0GB 1QM9A 3NS6A 4F02A 2L9WA 1YJWS 5EN1A 2MKSA 1OPIA 3FEYB 1Q7YT 1X4GA 2LCWA 2G1DA 2EK6A 2MZQA 3VAJA 3CCES 2KXNB 3EGNA 3MUVP 2MYFA 1SJ4P 1VQPS 2VOOA 2DGSA 4C0OC 3VAKA 2DNKA 1X5SA 5DDPC 1H2TZ 4ED5A 2U2FA 3U1LA 2DISA 2AYBA 1OWXA 4FXVA 1VQ8S 2E5GA 2HGLA 2CPFA 1U1KA 4UY8T 3IWNC 1R8HA 2DGOA 2ADCA 2X1AA 1U1NA 1PO6A 3TO8A 1X5TA 2RVJA 3CPWR 2CQPA 2KM8C 2MKJA 3EGZA 3MXHP 2X1FA 2VODA 2F9JA 3NNHA 1P1TA 3MD3A 1U1LA 3CUNA 3H2VE 4CH1A 5ITHA 1YWXA 2DHAA 2G0CA 4QQBA 3R1HA 1U1QA 2MHNA 3G9CA 1FO1A 2RNEA 3CMAS 3UCZP 5FJ4A 4F26A 1X4HA 2YH1A 2YWKA 1VBXA 2MQQA 1FT8A 2NLWA 4PR6A 5LXYA 3MURP 1UAWA 2LQ5A 1YIJS 1AUDA 5DM6Q 2KT5A 3V4MA 1SJRA 4YB1P 1H2UX 5BJRA 5GMKa 2MQOA 2LECA 2DB1A 2DNHA 2DGXA 2DH7A 2FPHX 2AYEA 1X0FA 1CVJA 5GVQA 2DNMA 2GHPA 5D77A 2DO0A 1F9FA 1WG4A 2DITA 1G2EA 1FXLA 2X1GA 2RRAA 2CQCA 1SJFA 1WHWA 1DBDA 2CQHA 1RKJA 1VQLS 3S7RA 3BS9A 3B4DA 2SXLA 1SJ3P 1U1PA 2M70A 3CCLS 1FHTA 3S6EA 2X1BA 5IM0A 2K3KA 5GAEU 2N7CA 5IQQA 3CC7S 2I2YA 1N52B 3JB9k 2DGTA 2N3LA 2DH9A 1KD1T 3NNCA 1A7GE 2OTLS 3IRWP 1VC0A 3FEXB 2RS8A 5DDOC 1K9MT 3R1LA 1YITS 3K0JA 3DXBA 2D3OR 1WG5A 2LA4A 3MI7X 3CCVS 2K8GA 2MZTA 4J5OA 2KRRA 1H6KX 3SXLA 3I56S 5LSOA 3CCJS 2YKAA 2KXFA 1YI2S 2KH9A 2E5IA 2MZJA 5JVHQ 3CULA 1X5PA 2DK2A 4PKDB 5DETA 1VQOS 1KOHA 3UCGA 1XN9A 1DRZA 2M9KA 2VOPA 2KHCA 1OIAA 2MGZB 2LA6A 3PIPQ 3Q2TC 2LKZA 1NJIT 4TU7A 1M5OC 5GADU 3UD4P 2OSRA 5D78A 2MB0B 2CPJA 3VAFA 3UCUP 3J7YU 3CTRA 2DH8A 1VC5A 3P49B 2CPHA 2HVZA 5GAGU 1WF0A 2YH0A 1VQ9S 4IUFA 4PRFA 2B0GA 1BY9A 2FC8A 2CJKA 2XNRA 1WI8A 2D9PA 1N8RT 1R8PA 3BEGB 3P3DA 2LXUA 3CCQS 2J0QD 1VQ5S 3THTA 2J0SD 3VAMA 4RU2A 4CQ1A 3S8SA 2KG1A 1Q81T 1ZZNA 3G96A 2JWNA 3PIOQ 3DLLQ 3HI9A 1WHVA 3UE2A 4WF9Q 1X4AA 4TU9A 3J7ZT 4WCEQ 2MZ1A 2M8DB 2G4BA 2CQ3A 1SJQA 1D8ZA 3R27A 3RW6A 3CCSS 3I55S 3UWTA 1VQMS 2XSFA 2FY1A 1NU4A 1H2VZ 2J8AA 2MKHA 1U6FA 4LIRA 3EX7B 3LQVA 2CPZA 2RQ4A 2CQGA 4U67Q 4LJMA 2LYVA 5JVGQ 1P27B 2JVRA 2BZ2A 1Q86T 2LEAA 2ZJQQ 2MZRA 3D2WA 1U1MA 3CC2S 2DNOA 1QVGR 5LXRA 1S79A 2MMYA 2DHXA 2L41A 3BO2A 3BO4A 2HYIB 2M88A 5CA5A 4CIOA 1KOOA 2A3JA 2DNNA 1YTYA 2AD9A 1HD0A 1U1OA 2RQCA 5CYJA 3P6YC 2KN4A 2KFYA 3VAHA 1WEZA 3UD3P 3N9UC 3L3CA 2OTJS 3VAGA 1WHYA 2JX2A 4WKRA 3CD6S 4IOAQ 1VQKS 2XS5A 2DGVA 3ZZZA 4TU8A 1U1RA 1WELA 3MD1A 2MY7A 2O3DA 2DNQA 1DZ5A 2CQ0A 2LMIA 4QU7A 2AYGA 2KXHA 2YTCA 4ZKAA 3Q2SC 3CF5Q 1YJNS 1ZH5A 2KYXA 3MDFA 3US5A 4WFNQ 2UP1A 1M5PC 1M5VC 2N82B 3G6ES 1VBYA 4QPTA 4YOEA 3CCUS 3G8TA 1X4EA 4V19X 4ERDA 5CXTA 3RW7A 1B7FA 5GAHU 2DNPA 3ZZYA 2M2BA 4C7QA 2I38A 1VQ4S 1VQ6S 2ZJRQ 1YJ9S 2MZSA 3NMRA 2MPUA 3TP2A 2RT3A 2DO4A 5H1SV 3G71S 3CCMS 1YHQS 3OW2R 2MKKA 3H2UB 2D9OA 2CQ2A 2DHSA 2MKIA 1KC8T 5LJ5Y 3VAIA 1ZZFA 2DIUA 4OZ0A 4A8XA 5LSLA 2MSTA 2DGUA 5LJ3Y 1IQTA 1JJHA 1JJ4A 3NNAA 4YUDA 1VQ7S 1JJ2R 2DGQA 1UFWA 4CH0S 3LPYA 2CPXA 2FHOB 2GO9A 2CQDA 2MXYA 1HD1A 2DIVA 1U2FA 2DNLA 1WI6A 1FJCA 3THPA 2MSSA 2MJNA 1N54B 2E44A 3CC4S 1M90T 3TYTA 2LEBA 3NS5A 3SDEA 2MJUA 5DM7Q 1WG1A 4Y0FA 2MQLA 4UQTA 5MLCV 2M52A 2RUGA 2V94A 3CXCR 4BS2A 3G8SA 1X4BA 2ZJPQ 2E5HA 4M5DB 1K73T 2BOPA 4LMZA 2MQMA 2RRBA 2DNYA 1FJEB 1WEXA 2CQIA 1L3KA 2QFJA 1U6BA 2F3JA 1M1KT 1WHXA 2N3OA 2JVOA 2AYMA 3B4MA 1URNA 4FXWA 2ADBA 2LXIA 2U1AA 1WTBA 2DHGA 4W92B 3VALA 2CQ4A 2PE8A 1VQNS 2CQBA 5HO4A 1SXLA 1RK8A 5IM0B 2JRSA 3G4SS 1W2BR 3P5TL 2XS7A 2CQ1A 1JMTA 1OO0B 2PEHA 2HZCA 3MUMP 2Q79A 4IO9Q 2CPYA 2KM8B 2MKCA 2KG0A 2WBRA 2KU7A 3CCRS 3CMES 2MY8A 4OZ1A 2KRBA 2F9DA 2J76E 1WF1A 1KQSR 1D9AA 3SMZA 1FJ7A 1QVFR 2HGNA 4WIIA 1HA1A 1X5OA 2ERRA 1WWHA 3SDEB 1VBZA 1M5KC 1WEYA 2MQNA 3HHNB 1Q82T 2MGZA 2L08A 3MUTP 4C4WA 3BO3A 2FC9A 1HL6A 2M7SA 2CPDA 2EK1A 2VONA 4WFBQ 3ULHA 2QEXS 2M8HA 1WF2A 2RS2A 4W90B 1X4FA 1DHMA 1A9NB 2XNQA 1VC6A 5DDRC 4WFAQ 3U1MA 1K8AT 5IFMA 5DDQC 2XB2D 2E5JA 4F25A 2CPIA 1N88A 1X4CA 2OIHA 1X4DA 1UW4A 4EGLA 2DNGA 2QA4S 1FNXH 1O0PA 1S72S 2KVIA 4QU6A 2EVZA 1UP1A 2KI2A 2DNRA 5HL7Q 4IOCQ 2M4MA 3VF0B 4Y00A
chains in the Genus database with same CATH superfamily
2VZ9A 2MDAA 4PXBA 2CWXA 2H5JB 1N33F 5C24A 4DR7J 1ZPWX 2ACMA 3ONQA 2NYIA 2I5JB 4F3QA 4YHHJ 1KNZA 1VI7A 1REGX 1LV5A 2XS2A 5KT4A 3HXMA 3MOJB 1NPKA 3S01A 4B3OA 1EQ0A 4GVLA 3BGOP 3N5BA 3PKMA 1VDHA 1FESA 4FYXB 3KLGB 2QMUB 1WKJA 1Y5IB 3RJMB 2P6TA 3LANA 2FJBB 3IM8A 3OFGA 1RLCL 4KV8A 3FZBA 4BCAA 2MKSA 3T1YF 4USUA 1N56A 1JWWA 1Q7YT 2RU9A 2R3VA 3ET6A 4ED4A 1HYSB 2CG8A 4C8MA 3RBXA 3W8GA 1IJEB 1WUUA 2EFQA 3AXMA 2BV3A 2FDNA 2VC1A 1NZAA 1V3ZA 2QLXA 3OVSA 3ET6B 4G65A 4DL3A 3U27A 1BHNA 2WVBA 2Z8QA 5LMNJ 3ADAC 1ZTWA 3CCES 4JI4J 1T94A 5DS7A 2ZKUA 2PD1A 3QZ8A 2BRKA 2D3O1 1IWGA 4ZCKA 2VB6A 1VQPS 2VOOA 1RWPB 2DGSA 2G1HA 1PG5B 1PILA 3HHLA 4ICLA 2OFGX 3W66A 1X5SA 3DN9A 5T41A 4RLEA 2IBOA 2XMUA 2U2FA 2G13A 2C2OB 3N6NA 1K0TA 3PRBA 4LRBA 3CSKA 4AQYF 4OYIA 1XMOJ 3PJ9A 4G1QB 5I3QA 4V1Ak 2HBYB 3KHRA 1VQ8S 1LWCB 4CCHA 1RAOA 1SBRA 3ZNJ1 1FVSA 4CI0B 2CPFA 1LW0B 4OHZA 3MR3A 3IWNC 3BPSP 1T03B 3OQ2A 4EBDA 1WKLA 2UUCJ 2D41A 1Y3JA 2OD6A 3TO8A 1JLBA 3D68A 5K8MA 1BMQB 1UFLA 2NYHA 4D3HA 2RVJA 4LT6A 1YQHA 2A18A 3CPWR 4ECQA 4CLLA 5H9EK 1NKCA 4B3RF 2GJFA 5E3RA 4LRFA 3ENVA 5KFJA 1LKZA 1LW2A 2BE9B 4MK9A 1PC4A 2ZVIA 5IC4B 2VODA 3F41A 3FMWA 1Q53A 3PJWA 4NLQA 4NLWA 2BACA 3PW7A 3V81A 2PN6A 5FLXY 4KAIA 5CYMA 1U1LA 3CUNA 3VZHA 2CAJA 3V6JA 5ITHA 4ER8A 2ZC4A 3A12A 2RKIB 4LREA 4R5PA 2G0CA 1U26A 4ZJOA 4NCGB 4EYHB 1V5IB 5J2MA 2GIQA 3AB2B 4UF4A 3R1HA 1OMSA 3BGUA 3T41A 4WFXA 3ZTPA 3AH6A 4ANCA 3OL7A 3G9CA 2IMWP 3CMAS 4I2PB 1IJFB 1RI7A 3UI3A 4PUOB 2YWKA 1SQGA 2Z30B 4PQAA 1JNZB 1VBXA 2IVFB 4M1KA 4KGKA 4FPRA 2Y3YA 1FT8A 4URGA 4X4RA 3NCPA 3UN5A 4J9PA 3MCMA 1UAWA 4I56A 1VK3A 2HEKA 3IGVA 2DY9A 2FIUA 1F2HA 3OJUA 2KT5A 2G0IA 1SJRA 2JNJA 1H2UX 5E3CA 5BJRA 2POKA 1M5SA 2J9DE 4DV3F 5GMKa 4ED2A 1WC3A 4EYIB 3O6QA 2EKNA 4ZIWA 2FQQB 3AOAA 4LFBJ 2GZOA 2OTLS 2GNKA 4M63A 1UZDA 4PYDA 4PG5A 4F67A 2BMBA 5J2PA 2GHWA 1CVJA 4DXLA 4DU7A 2HHSA 1E6VA 2EFPA 1O5JA 2QL9B 4IO1A 5HMYA 2KHDA 2MQ8A 1JXEA 3JQKA 3MMBA 4YEAA 1WHWA 4LSNB 1TELA 4DPOA 3KG1A 4QWBA 2XLKA 2OD4A 1OY9A 2Q3PA 4KO0A 1R0AB 1FA0A 4K0KJ 4KRWA 3FZ2A 4JV5J 4P7TA 5KFTA 2W4DA 1TL7B 3A4TA 4ZPWR 2WOMB 1N34F 4A8YA 3GFXA 1XWLA 4OX7A 4Y6IA 1U1PA 2JHEA 5E3PA 4HVZA 5J1NA 3JSMB 2DHHA 5KG2A 4E98A 2Q6BA 5GAEU 1Q78A 3EVMA 1RYRA 3P49B 2QL7B 3HCXA 2XMJA 3KMSA 3JB9k 3M6VA 4OV6A 3H5XA 3HFZB 1Y0HA 2DVIA 1C0TA 5D8HB 3QO9B 4OQJA 1YJTA 2ZM6F 1R0BG 4LF8J 2HRYA 3WX4A 1KD1T 1H72C 1RWMB 3I31A 2B6AB 4K7QA 4ANDA 5F8GA 3IRWP 1F0XA 1N5TA 4U95A 5J1PA 3U1NA 1IBMF 1C0TB 4RR5A 4JI0J 2GMJA 1OYEA 2VG6A 2WVDA 3W5ZA 3K0JA 3M8QA 2RE1A 2D3OR 1X9WA 5KFOA 3BV8A 2HMIB 4ID5B 1WG5A 2XBPA 4P72A 2C3YA 1PBUA 2LA4A 3OTBA 2LFVA 3SCIE 3ZFVA 4EO6A 3GQCA 3HK2A 1SC6A 4FKXA 3FSXA 5KFVA 1RHKB 3SQGA 3W60A 4P10A 1LOUA 4J5OA 4KGMA 3RZAA 4A4JA 1H6KX 1U0HB 2D7SA 5CD4A 2UU9F 5LSOA 1Q8KA 1RAJA 2F1FA 2YQ1A 4BC9A 4U8VA 4F04B 3KLFB 3FKBA 5C24B 1J5EJ 3WBZA 2HLUA 5HQLA 2E5IA 1F5AA 2XLJA 2MZJA 5JVHQ 1YI2S 1YVFA 2PDAA 3LTOA 4L3KA 5A8WA 1TK8A 4FNHA 2J5AA 3CULA 1GMUA 4IG3A 1JJCB 2YNIB 4J9SA 1VQOS 1LW0A 1KOHA 5GMDA 2KT2A 5IWAF 2M9KA 3IRXA 2LA6A 1KVJA 3Q2TC 4DPUA 2XGPA 1M5OC 3Q22A 2WSEC 5HVFA 1P9QC 5D78A 1MMDA 2MB0B 2UZAA 3VAFA 3DHXA 3J7YU 4ID8A 4DQRA 3M8ZA 2IDEA 8RUCA 3K2YA 2C1EB 1GAOA 3H59A 3TVZA 4CLSA 1W25A 1D09B 4IOBA 1VC5A 4DQQA 2CPHA 3TJ9A 4KHMA 1F3VA 3OXLA 2E7XA 1VQ9S 1SV5B 4DV0F 4FYWB 1TAUA 3PRDA 4NXNJ 2OAUA 3C6UA 4IYQA 4KPCA 3TA2A 4ATNA 2MLYA 1FDBA 3I82A 3DHWC 4DL6A 2JDJA 4WPAA 1N8RT 3BEGB 3D0HE 2QO3A 3PX0A 5F8MA 1QAXA 2HK3A 3GILA 1U2CA 2LXUA 4DR5F 3QRQA 4L74A 1JK9B 3K8WA 3MMCB 3GV5B 3ICLA 1W2IA 3TJAA 2J0SD 2E5LF 3J7YI 3QJPA 4RU2A 3S8SA 2UXBJ 2XHCA 3CO0P 3GJSB 4JI6F 3L7UA 2K1RB 1HBOA 3PHEA 3H5SA 4JP8A 3TX0A 1NHVA 4R8UA 3PIOQ 4DS4A 2XMAA 3HJFA 3M8WA 4DN9A 3GMGA 1RAIB 4J9LA 2ZVSA 1X4AA 4A8WA 4TU9A 2ZH6A 2IMOA 3J7ZT 2OFHX 3QWPA 3M30A 3MM7B 5I3UB 3R27A 3I0RB 4KJIA 1PIEA 2PFDA 3QAEA 1RCXB 3NY0A 4CO4A 5A0YB 3I55S 2GMLA 3M2VA 4NLXA 4KR0B 1M1GA 1P6TA 2B9WA 2YNHA 3IG1B 4RKUC 4ECWA 3VZIA 1FTRA 1S1VA 2D74B 4IDKB 2XSFA 4DV7F 3CWJA 2DY1A 4I68A 3CO9A 2ASJA 5A76A 3CD5A 1H2VZ 1TL3B 2RH3A 2MKHA 1U6FA 1T3OA 3PYGA 4C11B 2FVSA 2PT0A 4RUBA 3GYXB 1EP4B 4IG0A 3WIVA 1FRJA 2BKNA 2IHR1 2W8LA 1SH3A 3I96A 2QTWA 3PACA 4DX7A 4C48A 2CPZA 2ASDA 2UVRA 4X4QA 3GWCA 1K1SA 4DZ6A 2HURA 2DR5A 3D66A 3MPUB 4WK1A 1M0SA 4JI3J 2VC0A 3QSYB 2JVRA 1RUSA 5AXKA 3OHBA 4FF4A 3IP0A 2JC0A 3MMCA 3O5TB 1R3NA 3HVRA 2HHTA 4ZVTB 5EGYA 2V8DA 5L9NA 1S10A 2AD9A 1C4AA 1S79A 2AJ1A 2MMYA 2L41A 3BO2A 1SL0A 3CIMA 5IV3A 2AX1A 4HKQA 1TL4A 2DXFA 4Q2MA 4CIOA 1RAAB 2YNGB 3NAIA 4YHHF 1Q8IA 1HD0A 2V4JA 3GE9A 4I7FA 5CYJA 2F65A 3OL6A 2KFYA 4DQPA 2VBYA 3FQKA 3VAHA 3UD3P 3TAMB 4NLSA 3C15A 3VAGA 1FRXA 4FPIA 3B78A 3WHIA 1U45A 1EKRA 1JLGA 5F8HA 4EU0A 4EBEA 1Q7LB 2HNZA 1AB8A 1S6OA 2OEKA 1JLEB 2B3TB 3KJQB 3V6HA 3MM9B 2WAQD 2NXUA 4FYVB 4KO0B 1R0AA 4HACA 2XCAA 3IRXB 5F0UA 1RBOB 4NLDA 3H4DA 3F56A 1RT5A 1AT1B 2CQ0A 2AWZA 2KFZA 2LMIA 2QZ8A 3D54A 3NGTA 3NOCA 5CZVA 2HQDA 2YY3A 3L7PA 2AYGA 1HYSA 1C1BA 2IAJA 3CF5Q 1S97A 1JQGA 2VPXB 3MHYA 1KRPA 3BREA 3FJ2A 2W7PA 5ETOA 2XY7A 4H4KC 3KYLA 2CADA 3QJLA 4G1QA 1SUQA 3N01A 4AE5A 1CJTA 1ZA2B 4DSEA 1QAYA 1X4EA 4V19X 3ZTQA 5BR8J 1B7FA 1A0OB 6AT1B 1JKHA 1KEKA 4NCAA 2M2BA 3NBPB 1VQ4S 4DR4J 2QMXA 3HPOA 1U4BA 2V50A 1VIOA 5H9FJ 1W7WA 4PG8A 4OLPA 2DO4A 4B3RJ 2XSJA 1XC9A 2HHWA 3FSIA 3MEGA 1OSDA 1RWWB 2GS8A 4Z7CA 2VFSA 5L1KA 5ETQA 2FHKA 2UUAF 3H98A 2MKIA 2NXNA 1OY6A 3CJ8A 3PNIA 3GG0A 2C3OA 1NCLA 2AW0A 5LJ5Y 3GSDA 4EUVA 1RYSA 2HHVA 4C8KA 5KG7A 1IM6A 1ZZFA 1C2PA 1TVRA 1XJWB 3RYLA 3J7Z5 4DFPA 4PCQA 4RW8A 3SCKE 1ZA1B 5F3TA 5LJ3Y 2XYHB 2W9BB 3SCJE 1JLFB 2IRXA 1CS4B 2XMTA 3GZ7A 1IQTA 4GVBA 3KHGA 3ZXWA 1MG7A 3NAHA 4KFBB 1NRKA 3WQPA 4IQXA 4OZ3A 2KDOA 2BUNA 3PX6A 2XG8A 2HIYA 2Z4PA 3FRYA 5T7LA 2CPXA 1I5OB 2FHOB 1IKVB 2E7VA 5THWA 3OUYA 4XTTA 2GC8A 2GO9A 3BSOA 2WZ1A 2DIVA 4CNZA 1KBRA 4MYUA 2F5GA 1LXJA 1LWCA 1S1UA 2ZDOA 3I9ZA 1R6VA 1FDAA 2DNLA 5HK4A 3W65A 3TUZC 3I0RA 1RQ0A 1NUEA 2WVCA 3IAS9 4ETZA 1FX4A 3KK3B 1N54B 2VKZG 3F73A 3OVBA 4DV3J 3NWRA 4U96A 2W9CB 4DSLA 3TJ8A 4WFYA 2NXJA 1BC6A 1KN6A 2RQMA 1BQNB 1FD8A 2B4VA 4HH0A 2DPIA 4Y0FA 2MQLA 5MLCV 1JLFA 3EE3A 4F0KA 2H5IB 2RUGA 4OHXA 2V94A 2R9LA 4DV6J 2HW3A 3CXCR 3M1VB 4BS2A 2YX1A 3G8SA 1RT7B 4CRJA 4YMEA 1RTDA 2IBKA 2L48A 2WB1D 3BDEA 4WFZA 1HLWA 2MQMA 3CE8A 2RRBA 2DNYA 1LEOA 1VR6A 3M8PA 2ZHAA 2BKOA 1HBNA 4FF3A 1AROP 4K2JA 2F3JA 2BQ3A 4LF4F 1M1KT 1G1XA 4C9DA 2N3OA 1RTDB 2JVOA 1OQ6A 3R6GB 1APSA 3DOMA 3I32A 4DS5A 4UW2A 4S0MA 1RT6B 3DCAA 4I69A 5K5MA 1XMQF 1WTBA 3IO1A 2DHGA 2H5EA 1S9EA 4DPYA 2R7UA 4GKJJ 4RPFA 3OVAA 2G4BA 3OXGA 2FGCA 3RAXA 4KHPJ 2QSWA 1T9TA 4Y2MA 5ETKA 4CLWA 1W2BR 1OJ4A 2XS7A 1U6ZA 5HAOA 1HWLA 4GRSA 1F5BA 2P9CA 1JMTA 1KONA 4LIWA 1B99A 1OO0B 1HMVA 4Y28C 2EFOA 1Q8BA 2PMZD 3KFWX 4M5GA 3KLEB 3MUMP 4K2XA 4DR2F 1HNZJ 2V2QA 3AA8A 5AJ3J 2KM8B 3GYGA 2H1YA 2V67A 5LL6d 2Y1RI 5A2QU 1NSQA 3MFHA 1F9HA 5H9FK 2VQFJ 3CCRS 3CMES 3ENAA 2LDIA 4KQZA 1EKSA 1RT5B 2KRBA 3P8BB 4KH0B 1VJWA 2O66A 4ES2A 1S9GA 1KFSA 5IV4A 2ZH9A 2V9WA 4Q0BA 1JB0C 1VFJA 1GXTA 4NCBA 2DYAA 4GVBB 5HI7A 3NS7B 1FJ7A 2HGNA 1E6YB 4YR0A 3R97A 1VLOA 1VJQA 1S59A 1HA1A 1X5OA 2E1RA 3AD7C 4MK8A 2K06A 1TUVA 3QGPA 4ES3A 2NZCA 1WEYA 4TQRA 3M8QB 1BE4A 1FXRA 3DRRB 2UUWA 2EG1A 4M5KA 4WK3A 5F0WA 4EMDA 2CZ4A 4QIVA 1GQEA 2VDIA 2VPZB 2FGOA 2IIHA 5G4DA 1OPZA 4F4AA 2MGZA 3JTPA 3MUTP 2ZH7A 1C0UA 3BO3A 1HL6A 2CA9A 1UL3A 2EPIA 2M7SA 2CPDA 3HF5A 4USVA 5D4LA 4UQGA 1EJ7L 4ZLPA 4WFBQ 2RHQB 1UMJA 3AQOA 2NXCA 2V8VA 1Y3KA 5AXNA 1DHMA 3IA0A 4JV5F 5CH7B 3Q8UA 1P9YA 4J37A 4WFAQ 2W7OA 4LF5J 1KQGB 4CLUA 2XB2D 5ADZA 1R7IA 2HS0A 4DG1B 3GJTB 3MPYA 2E5JA 5GAGI 3AD9C 2W9BA 3DU6A 3NCRA 1N88A 1X4CA 4ELUA 3GP9A 4U7CA 5M2UA 3CDBA 2CJQA 1CJKA 4UOCA 3HJVA 4CDIA 3OTOJ 3KNAA 3AQPA 5D0HA 5B0AA 5SUHA 2IJRA 1S1WB 2RDIA 1MNEA 2CDQA 2XULA 3V6DB 1TL3A 4N77A 1SIWB 2R7QA 3QRRA 3M05A 2KI2A 3IWLA 1A6LA 4IOCQ 4WP9A 5L1LA 2VD3A 3LAMA 1U1MA 1RTHA 4DL0C 1U49A 3WC2A 2WSFC 4LR7A 4B9MA 3BN4A 2OSQA 2OJ3A 5D3GB 2RJZA 3PHTA 3DRRA 2BKPA 3TAQA 4I1TA 4B02A 3VVUA 1D1UA 4J9MA 5AE3A 4CO0A 3GYNA 4ICLB 1SH0A 2ZH4A 3E01A 4TLQA 4DG1A 4OI2A 4J9NA 3DLEA 2A2CA 5G0RA 3HSJA 2R7WA 4F02A 1GT8A 4ZIVA 1PAEX 3PYDA 5C2CA 2BANB 1EP4A 4IG0B 4F4KA 4OJGA 2QX0A 4W4MA 4BHQA 1NEEA 3ENWA 2G0JA 1LNQA 3IC1A 5DZ7A 3C14A 1KQKA 4MMOA 2JFKA 3QPIA 3RB6A 3L4BC 2HS4A 4DR3F 3IBCB 3TAPA 2R7RA 1QE1B 2HAFA 4ILRA 3KK2A 2LVWA 1CJVB 3BQ1A 2LCWA 1NK7A 3KHLA 2R7TA 3BSCA 4HHUA 3L7OA 4DUYJ 1I94F 1S4EA 2QIFA 4LSLA 4ZVFA 3FVYA 2AX0A 2B9XA 3MM5A 5LMUF 1T05B 5ETRA 4JI1J 2R7VA 2MZQA 5I3UA 3HFKA 1KHWA 3O3LA 2HNDB 1VRTB 1YBTA 3ELHA 3JXOA 3HKZD 1WSRA 1VLYA 3MUVP 4P74A 1SJ4P 2B9EA 3NWGA 5IZHA 1XBWA 3OLAA 2OPQB 3EDRB 3MZIA 3JYTB 4DLEA 1JLCB 4C8LA 4PAAA 1QJHA 2QLBB 5J2NB 2GQ2A 2HFNA 1X0PA 2DJWA 4NZ0A 4R8UB 3T6JA 3LW5C 2AHOB 4OX8A 1N5YA 4JYAJ 4QCLA 4ES1A 4N7TA 1QSLA 1OQ3A 3MPVA 3LUYA 3U1LA 4OV1A 1X8DA 2B8QA 2V8HA 2YKQA 3G8QA 4C0HA 4ELVA 8ATCB 2G2OA 1SC1B 4CO1A 4N56A 1YJ9S 3NGDA 4B3MJ 3I4PA 1JNRB 3PRVA 4OJ3A 4AD6A 4E0DA 3GIMA 4QW9A 2E5GA 1GNKA 2HGLA 1FKPB 3KHHA 2FD2A 2ZOMA 2ADCA 2X1AA 4DR5J 1PO6A 2BE2B 3LP2B 2ALYB 3D1QA 5D0RA 3I6PA 5MAOA 1QAIA 1Q79A 5C7PA 3P45B 4L76A 2CQPA 4G1PA 3TVYA 2MKJA 3LPEA 5U47A 3EGZA 1UVMA 2UXBF 3W9IA 1P8GA 2F8MA 2BEFA 1ROFA 3EM1A 3D6MB 2J8SA 4XAKA 5E3QA 1TUWA 4RUAA 4KH1B 5I4MA 4FVCA 1F60B 2W01A 3RRKA 2F9JA 3UDLA 3NNHA 4A48A 3SV3A 1S9GB 3MD3A 3D1HA 5ETNA 3SFGA 1CJUB 2LP4A 3JSYA 4ZN1A 1TK5A 3W2WA 5K20B 2R7XA 2CNLB 2DHAA 4L73A 4QQBA 4OYOA 4QOTA 5KT5A 1V5VA 2ZWPA 3GCWP 3NOGA 3HHKA 4DR1F 4ZOSA 3SSQA 5LT5A 1FO1A 2KYZA 3JSBA 2YBVA 4RW9B 2V4RA 4F26A 1SIZA 1X4HA 2YWEA 2ZUAA 2YH1A 2AU0A 4F7VA 1FNMA 1F3FA 3ILJA 4KT0C 4OI4A 3I87A 2XO6A 4CLPA 2VKRA 5LXYA 4DCPB 3W9JA 2BW2A 3MURP 1RZMA 3AJ2A 3J81U 2LU1A 2C3UA 4CNYA 4CZCA 5HVGA 2Y0BB 3H40A 1IKWB 1AUDA 2VA2A 2FVRA 3Q83A 2LQ9A 4ZPVR 4O3OA 2WONA 4MYTA 4YB1P 3MR5A 2YKPA 1LWFA 2HAIA 4LSZB 1PYTA 2GIFA 3VGTA 3BBCA 2UVUA 3MAAB 4WKYA 2DGXA 2RDJA 4GO7X 4K50A 3IS9A 5ETTA 4ZJLA 3J81Y 4OHWA 2DNMA 1ZYQA 5D77A 1HBNB 3OTEA 1CBKA 1Q8LA 2DO0A 2RSQA 1X31C 5E3AA 5K9FA 2DITA 3UN2A 2PA8D 1WC6A 4UOGA 3TZZA 2CQCA 3MEGB 4OYXA 2IVMA 1DBDA 4OFZA 3E3XA 1NK8A 3AY0A 4IR9A 3ZNUA 4OYPA 2JH3A 3S7RA 3BS9A 1UVNA 3B4DA 3PTWA 4NA1A 4OX9F 3KXDA 1U0HA 2KJWA 3TEGA 2L3MA 2DR9A 2M70A 2ZE2A 3DGPB 1MU2B 4O44A 1FHTA 2X1BA 5IM0A 1RWKB 4OLOA 2K3KA 3Q0AA 4NYPA 3SV4A 1FWKA 2IY5B 2W9CA 1FKOB 1VYAA 4JV2A 3D0GE 3I0SB 3JQMA 4Q43A 3RAQA 4YFUA 2ZZMA 4ZVPB 4J9VA 2ZBCA 1YBAA 4U7UK 2DGTA 2LQBA 3K59A 3RB3A 1MROA 3PFEA 3M9NB 2KTQA 4FXDA 5C42A 2E29A 1PBAA 5KFGA 4DF8A 3DYAB 1HWUA 3FEXB 2I0XA 1S9FA 4YR2A 1FJGF 3A3NB 3HD2A 3GV7B 2QRRA 5KOXA 5DDOC 3R1LA 4Q7AA 1NJYA 3DXBA 2R8IA 3KLFA 3AODA 2Y0SD 3MAAA 3F44A 4HI2A 1HQUB 3FBBA 1VCTA 3DM2B 3CJKA 2XMVA 3PYEA 1RAHB 2W24A 2VHGA 3M2UB 5F3ZA 1TL5A 5D4NA 3QGIA 2KRRA 1X9MA 5HP1B 1IKYA 1O6XA 2JL9A 1YK9A 3I56S 2HKEA 4LF9J 2VBWA 3MTJA 4F2RA 1HQUA 1FF2A 3PW0A 4NLGA 2RAQA 5IOLA 2R8JA 2BW7A 3B8HA 3ITHA 2I6WA 1J5EF 2A2DA 2DK2A 5KG3A 3EUNA 5T14A 3HVWA 3L09A 3CEDA 5L39A 3R7BB 2P9GA 2JFDA 4Y3CA 2QGFB 1T3NA 4K5SA 4DV4J 2Z0GA 1SKUB 4DDFA 1DQ9A 1HNIB 1XN9A 3M2RA 3H5UA 5HMZA 1OIAA 1K9MT 4C0BA 1DRZA 2QSFA 2VOPA 4H4MA 1NJIT 1FRMA 2A6MA 3UD4P 2F4FA 2LQJA 3AB4B 1QUPA 4KKOB 4PPDA 4AUKA 4H54A 1IBLJ 1B64A 3BB5A 3Q89A 4GKKJ 4HHJA 3DLGB 4N76A 2JEJA 2IFXA 3AA9A 2VFTA 1HNZF 3DXSX 1FTCA 2AGQA 2HSEB 2VF3A 4TXSA 1R8CA 1YLXA 3KKFA 1WF0A 4CTAB 3BDPA 4IUFA 2XNRA 2DCLA 1GMWD 4C97A 4NXNF 2GV1A 1R8PA 4MH8A 1RHJB 5KFXA 3VGUA 4OX6A 2EXUA 4ECXA 4X65J 4TQSA 4IH5A 1S0NA 4E8UA 2NXEA 4NPOA 4RW6A 1IR0A 2BXJA 4NWBA 4WYWA 5LOQA 1XEZA 1S12A 3MM7A 2IVYA 3V81B 2XMKA 3NCQA 2VJUA 2QYGA 2AEJA 2KG1A 1Q81T 2FVPA 4M95A 3M8SA 2HHHJ 2RMLA 2JWNA 3HMJG 3G96A 1NJWA 3DLLQ 4RW4A 1WHVA 3UE2A 3LP1A 4F8RA 4C8YA 4F36A 1N36F 5HN0A 3TANA 1PSDA 1SJQA 1KFDA 5I42A 3Q8QB 3MM5B 1RDRA 2V4JB 4P2FA 2CJXB 3BPDA 2OP5A 4JI8J 1VQMS 3DLBA 2FY8A 1VQSA 3RBEA 2Q66A 1L3VA 2HVEA 1HNWJ 1NU4A 1RACB 1MWQA 2ZH5A 1CJUA 3FNNA 2EFNA 3LWLA 4ZVUB 3OBIA 3OTOF 5HVHA 3NP5A 3NG8A 1MSWD 4WU2A 3WC0A 5D4OA 4USKA 3QRPA 4B17A 3HO1A 4ZVEA 1TL1B 1HARA 4ZVSB 1BXNA 2ZE2B 1DY3A 4GC7A 4EWTA 4KHPF 4DUZF 3A3OB 3MMAA 1OYDA 4OMFG 5JVGQ 4DSFA 2C2RA 1Q86T 1GTHA 5EWGA 4NRUA 2P5VA 4X4PA 1VMBA 1HBUA 1CULA 2MZRA 4OI3A 1LXNA 1WSVA 3LWMA 3D2WA 2DNOA 3K89A 3CC2S 4USHA 1YRXA 1REVA 2DTJA 2RB7A 3AJ1A 4M8LA 2GAGC 3BO4A 2OPSB 2HYIB 5JXSA 5CA5A 4B9TA 2ZWOA 4O4RA 1H3DA 5HJXA 2FHMA 2J9CA 1GK8A 3POTA 4IFVA 1YTYA 2KN4A 2HZAA 5KFHA 4MKAA 1WEZA 4F2SA 1DFDA 2XGQA 1LWEA 1UJ5A 5T7LB 1PJ6A 3TOQA 3TQ1A 4HLBA 1YJRA 2XYGB 5K14A 4QYZK 2IJNA 3GU0A 3VCDA 3TRGA 1NSAA 2GVZA 2W2PP 4C8NA 1S9EB 3ZZRA 5KTQA 4DR3J 1VQKS 2ATLA 3I5AA 3EVOA 1N5YB 4QR0A 2DGVA 1RAFB 3CCZA 7FDRA 4TU8A 3EPGA 3OL9A 2BJEA 4URSA 5E0OA 1WELA 2ZD1A 4X62F 2YWGA 4DUYF 4FS1A 1GX5A 2HQIA 3KUEA 2DNQA 2MLZA 2IRYA 2ROGA 2VG6B 1URRA 5C25A 3MAQA 2YTCA 1HWIA 4HTIA 1YJNS 4J7CA 5F8NA 4TY8B 1MLAA 1KLMB 3MDFA 3CDEA 3HX9A 2V4QA 2UP1A 2BQRA 3AXKA 3MTKA 1M5PC 1M5VC 2XSJB 4KV8B 2VIHA 1RT7A 3HLUA 2VFRA 2HBZB 3SSRA 3CNQP 2WHOA 2H65B 2AMCB 4FZVA 4HH1A 4M5NA 2GFFA 1Q16B 4NASA 3QLHA 3MECB 4RW7B 4JI2F 3DLGA 5BR8F 2DNPA 1E6YA 1FI4A 1HQEB 5J1EB 5KFPA 4ZPTR 1Y7PA 1HHTP 2DXDA 1IBKJ 4F0MA 3FMBA 3MR2A 2UXDF 5KOWA 4Q45A 1M1HA 2H48B 2WW8A 3DOKA 3OXFA 4RBTA 2MTLA 3LGHA 3W5XA 2APOA 2UVVA 2K7KA 2JJ4D 4JI5J 2ZBIA 3TP2A 4CM2A 2RT3A 5H1SV 3GFYA 4YQWA 2XLIA 3CCMS 2ILYA 1Y5LB 5ETVA 2MKKA 3OW2R 3EXYA 2D9OA 4NLPA 5F8IA 3CCWA 4O3QA 4LBIA 2OO4A 3JQJA 4ZLLA 1RGVA 1N0VC 1RADB 2EC0A 3ZZOA 2XMMA 1VHIA 4WP8A 1BD6A 5KG0A 2DIUA 1T9XA 3I4HX 5GAHI 5HP1A 3M8YA 5LSLA 2MSTA 2QV6A 3N0VA 1RKIA 1RE1B 1Y11A 3QYYA 4F4XA 4LRDA 3QNWB 4RW7A 3T9ZA 1TL7A 1VQ7S 4ZJQA 2OI2A 2CUYA 2W4PA 3H20A 5HATA 1IXKA 3X3UA 3JAMU 4F4WA 5KFNA 4U6PA 1QSYA 4ZVOB 1FRHA 5DRKA 3MGJA 3PO4A 4Y34A 1DQAA 2NPFA 4UZBA 4R0JA 2EFVA 2HG4A 4CH7A 2CQDA 2MXYA 2QLWA 3MCNA 1U2FA 2V8PA 1S6QA 4DMZA 3FCWA 3HSGA 4OHVA 3C66A 2R7SA 4KY3A 1B0PA 1FJCA 2GJ2A 1WOPA 1YDLA 3THPA 5L38A 5LMUJ 2MJNA 3D4JA 5J2PB 1U2RA 3QIPB 4CYUA 3I0SA 1AZSB 2FJEB 1RXOB 3TNVA 4DV5F 2LEBA 4OZLA 1TKZB 3DLJA 3N6MA 3NS5A 3ZTSA 3SDEA 3SSSA 2MJUA 5DM7Q 1ZTTA 4LF9F 4P73A 1IR1A 2CNOB 2RUSA 3FBFA 2ZEJA 2H3EB 4KGVB 3TVKA 3CJ0A 3N28A 2M5YA 4QIFA 5L1JA 1LW2B 2B43A 4QIWD 2CVIA 2GA7A 3SIPB 4YP3A 1JX4A 1FKAF 2PIIA 1WOOA 3K8VA 1SUQB 1K73T 1PCAA 2ZJPQ 2BOPA 4FF1A 2HWTA 3FC9A 3RR8A 4NMLA 4M5HA 4ZDNA 2DR8A 2YXLA 4TN2A 1C1BB 3IWXA 2I9SA 2IPOB 4H4OA 3GSIA 3T3FA 4WYLA 1YRUA 1XK8A 5HANA 1U8WA 4DV1F 3MR6A 2RIJA 1IKVA 1IBCB 1RABB 1V6HA 1R6YA 3B4MA 4PPZA 3VQSA 3DRSA 4X4TA 3EYZA 2ZHBA 2J6TA 5F8JA 2ADBA 2LXIA 2YKMA 5BXIA 3H90A 1VQNS 3CDUA 4CLKA 5HO4A 1SXLA 2GVZB 4X4OA 4R0EA 4JI4F 4GKJF 2JRSA 3T9NA 2YKNB 2B5JB 4LUBA 3TWZA 4J90A 3G4SS 2XI3A 4XPCA 2ACYA 2FUG9 1YZ6A 2ROPA 4MJKA 3TEHB 2PEHA 2FLOA 3W2VB 4U9RA 1T05A 2Q79A 1T02A 1UEKA 2QG9B 2XHWA 3NEKA 4UOHA 4ZVGA 1CC8A 4XIUA 1EIYB 1QTNB 2EC2A 2ZNZA 3H8YA 2VH7A 1H7XA 4PABA 3C6TA 3KDOA 2KG0A 2RKIA 1XNQF 2WBRA 2BA9A 3M6UA 5DQIA 3OR2A 3KLVA 2MY8A 4OZ1A 1HBUB 4E2FB 5KFCA 2F9DA 3T6BA 1KDNA 4RJVA 2H51B 4PWWA 5CYQB 1WF1A 1KQSR 1N5VA 3HHLB 1VQYA 4P9SA 4DUTA 4C8OA 3HZEA 1QVFR 4OYMA 3V2UC 1CG2A 3BR8A 3H7HB 2ERRA 3V4IA 3T5JA 4WJBA 3SDEB 1VBZA 2B4PA 1Q4RA 3KTQA 3L95X 3DRSB 3KG0A 2ZH1A 1J5OA 2E1AA 1S1VB 1SPBP 3UDCA 4C4WA 4ENOA 2V6AA 2D3UA 2B4UA 4DX5A 2YNIA 2HQCA 2F40A 3ULHA 2QEXS 5A0YA 1WF2A 3ZO7A 3CB4A 2O67A 4W90B 1HMVB 1ULRA 4ZPBA 4K4XA 3HHLD 1WOSA 3TI0A 2UXCF 2A1BA 2VFVA 1MN9A 1YJVA 5I3PA 1GTEA 2IC3B 4ZP8A 5KFFA 3D5MA 1ZM2A 2EWHA 3DKDA 2CKWA 2KB2A 2LU2A 4ZK7M 1CS4A 3MM9A 4F25A 4DR6J 4DL7A 2CPIA 3H25A 1LK5A 2N4CA 3BR9A 3Q8SB 2ZZTA 3MCSA 2W2MP 1X4DA 2PA3A 2DNGA 1O8BA 3I5CA 4ECYA 1S72S 4MAKA 3Q8VA 2ZKTA 4LSLB 5E33A 2KVIA 2OH2A 4FP9A 3ILLA 2PO4A 2P8IA 4HT7A 4EFAC 2NS1B 4JUZA 1FE4A 3CMQA 4H4OB 3TUPA 4MFBB 2GX8A 1NHUA 3E51A 4O3NA 3VF0B 4TYBA 3OFHA 4RWXA 4ZVQB 5DG8A 3T5LA 4WTOB 2H54B 2WB4A 3NLCA 3NMAA 3C6UB 1PGZA 3G82B 3UN3A 2HGMA 4RUHA 3GV8B 2C42A 1N6QA 1FFSB 2QA4G 2FJAB 5BYRA 2MQPA 3CD0A 2NR0A 2WVEA 4AL7A 2NZ4A 4B3SJ 3T19A 4ZPCA 1H7WA 3RB4A 4P6QA 2P6SA 2VG5B 3DU5A 1Z4UA 4Y2AA 4BWMA 1Q5VA 3R9LA 2RU3A 1TFYA 3NS6A 5KFYA 3R2CJ 3KWMA 2EI5A 1JXVA 2L9WA 4F50A 2I1RA 3KJNB 1YJWS 1J2VA 1D3WA 3SI8A 5EN1A 1KR4A 1YKWA 3UD5A 1OPIA 1ZETA 2HNYA 3FEYB 3GIJA 2FJWA 1X4GA 3ISND 3QBCA 3MMBB 4ZLJA 5IS2A 4WTYA 5CQGA 4IH7A 2KZMA 4AL6A 5A8WB 1E6VB 2G1DA 1PJ5A 1UWBA 1S5ZA 3LF0A 4LF8F 1F2GA 2EK6A 4DPWA 4I2QB 3FK4A 2X3GA 3UVJB 3GJRB 4X64F 5J2QA 2ZNYA 1C4CA 2ZD1B 4X66F 3VAJA 5ETLA 4ZP7A 4ETXA 3EGNA 3D0IE 5KFRA 1UW9A 2GVDB 1P1LA 2DR6A 3B82A 3SQGB 1HQEA 3PR5B 1VOMA 2Q43A 3NKYA 4C0OC 3NL0A 3VAKA 2VG5A 2E9TA 1N0UA 1RBAA 4X4NA 1G6BA 1RB0A 2DRBA 2K1RA 4N8OA 5M2RA 4Q0BB 5KT3A 5HQMA 3C15B 4CYUB 1B0VA 5DDPC 3GIRA 1N48A 1X60A 2FJXA 2E1MC 2VDHA 2CWKA 2V0NA 2NPIA 2R7OA 1OWXA 3IGNA 3QT7A 4FXVA 1TMJA 1AA1B 4FS2A 3TQEA 5C42B 2JLFA 4QWDA 2DGOA 4K4ZA 2BJ7A 1TMMA 3HVTA 4NI2A 1LK7A 4X65F 4PG7A 2GIRA 1V3SA 3PM9A 3R6LB 2IM2A 4HYKA 1X5TA 2BM0A 1OSCA 1VHFA 2KM8C 4DL4A 1B0TA 2HQFA 4X62J 1RA6A 5KFBA 2WONB 5F9NA 1NZ8A 2CVEA 4JB8B 2VPWB 2HHHF 2X1FA 1NPRA 4DEZA 2GVDA 4C3KA 1I1GA 5EHHA 1NK5A 3AHPA 2W2QP 2XO7A 3PKYA 1H74A 1AW0A 3R5DA 1CJTB 3HKWA 2J0XA 2HVHA 4I2QA 4MT1A 5AXMA 4AFFA 1SVDA 3CJRA 2OMOA 4UUWA 4YB7A 4C11A 4CH1A 4ECVA 1T0TV 1N4LA 1MW7A 3EZ5A 2W2NP 4ILLA 3BSNA 1YRTA 3W5YA 5D6GA 1SQEA 3M32B 4JI7F 1UVJA 1L3TA 1CLFA 4IRDA 2Z2MA 3FCHA 1YGYA 3ENQA 1HWKA 3IR5B 2HNYB 5K8OA 2MEWA 3MWBA 5FJ4A 2CJYB 1J5OB 2NQPA 3VR1A 1WC5A 1NAQA 1T9WA 1RWVB 3BKUA 2RDDA 4NLRA 1FFWB 1OY8A 3KUGA 4K4YA 2NLWA 1S1XA 4NLTA 4PWDA 2YVSA 3B54A 2DRAA 1HPZA 5EDWA 3PZPA 1RJJA 4QPXA 2LQ5A 4OYBA 4Y2KA 3MFIA 1YIJS 4DUZJ 4DPTA 2FVQA 3SEOA 4DHVA 2XTJP 3V4MA 1IQZA 4LR9A 3MAHA 1KSPA 1TKXB 2UVWA 2MQOA 2LECA 3RR7A 4DSJA 2AYEA 1EX8A 5GVQA 4RO0A 1SQFA 3OR2B 2GHPA 3EZOA 3GJQB 2IYGA 1T9VA 1WJ9A 2AKWB 4C98A 3R5AA 1FRKA 3RBZA 3Q8PB 4XDDA 2X1GA 5C25B 1T03A 1D9DA 4P71A 4DR7F 1FXLA 3BGFA 5FDLA 5B0GA 1SJFA 1S6UA 3BN7A 2CQHA 2V9KA 3MPDA 4LRAA 2BABA 4FN5A 5CABA 4ILMA 1RU2A 1CQMA 3R3TA 2ABYA 1UVKA 3CIZA 1ZOTA 1TKTA 3CCLS 1SKRA 2IA0A 2ZITA 3S6EA 4ZCIA 1BWVA 2HWIA 1EAYC 2HFUA 2PEBA 3FBEA 4RW4B 4DL2A 2BQUA 4ZPDA 3PR4A 4P2XA 2FTRA 4NYZA 3BQ2A 2J7KA 2G2ZA 3HSZA 1V9OA 3RGIA 3AOBA 1KP6A 4CWBA 5GADI 2I2YA 4DU8A 3CGIA 1BWEA 1U02A 3ETMA 4JI3F 1U25A 4NXMF 3BSAA 3H42A 3CJTA 3ILIA 5AXLA 2M3DA 3CJ2A 1R8AA 1FX2A 2C3PA 1T95A 2KO1A 2W4CA 3O1LA 4A8MP 2XM3A 5B0EA 1VC0A 4X4SA 3C16A 5F8LA 2RS8A 3GR0A 2QLJB 2B4OA 4LVOP 4WP3A 5KFLA 4F4ZA 1T8EA 5B09A 3QGGA 4M94A 1FWLA 3PG9A 3EJMA 4UTGA 2YPZA 1RAEB 3K5PA 2BANA 3MI7X 4AXJA 5HLFB 1AFJA 3LP1B 3DC2A 2GQQA 1FFGB 3I9V9 2EFGA 4CO3A 2J7UA 2MZTA 4YR3A 1K47A 2VICA 1NKEA 4B3TJ 4F3OA 1XMOF 1FXDA 2MHEA 4RW8B 5EX3A 2G9OA 4HDHA 1XR5A 3SXLA 3TA1A 2UXDJ 3D9BA 3CCJS 2YKAA 2QFIA 4KGXB 1VRUB 3A8KA 3LAKA 2QLFB 1IBLF 1X5PA 3RBDA 2LQ8A 2R42A 1F5CA 5DETA 3DRXA 5KFQA 3UCGA 2ALZA 4J9KA 3WZ0A 1ZAXA 3OTCA 3W2VA 2W25A 2MGZB 3JS9A 2UV8G 4IFYB 3UO0A 3PIPQ 2E1CA 4B9LA 2LKZA 2C2ZB 4TU7A 1DAXA 4I6YA 4QJVA 5E41A 2CPJA 5KFSA 2HQ3A 2W9AA 3AJDA 5G0RB 3J80U 1CJKB 1BUXA 1S77D 3ZTOA 4Q8EA 1DTTA 4ZP9A 1EB0A 1RCOB 1Q0NA 2HVZA 1RWNB 2KKHA 2YH0A 3QJJA 4PRFA 3R7SB 5DG7A 4A8QA 1WI8A 4Q44A 1HIYA 5E7OB 2NREA 2K7JA 5D15A 3IR7B 3M2RB 1NK6A 1RTIA 1TUGB 1RTHB 2IRUA 1UWBB 2FZGB 2RRNA 1NHKL 2YKOA 3KUHA 4K5RA 5IC6B 4GC6A 1QAJA 4IDKA 3G6VA 4KB7A 4DLGA 1UEVA 1DARA 1IUJA 5JMNA 4A8KA 2J0QD 2GO8A 1K1QA 4OZJA 3W64A 3OPKA 2N4DA 3FBCA 3KLEA 1YZ7A 1TKDA 3AAWB 4DSKA 3ZZPA 4CQ1A 4K4VA 1V3RA 3QFWA 1PJ7A 4FYDA 1YJ7A 1ZZNA 2VJVA 4G6VB 5A6PA 3Q8RB 3GB0A 2J0WA 1RWUA 5DZ6A 3QT8A 1IN0A 3RG6A 4DWIA 4WF9Q 4CO2A 5KG1A 5KFMA 3K5NA 4WCEQ 1UEUA 3LO3A 1NLKL 4ZITA 4DI6A 4ED1A 1NJXA 1N36J 5CYQA 1MMLA 3ZZTA 3G6YA 1RISA 2VQEJ 3RW6A 7FD1A 5AE2A 1TTHB 3CCSS 3QQCD 1HNVA 3N5FA 1QDUB 2CZ9A 3HVAA 5CHCB 4QWEA 1UA1A 1TR0A 1EETA 3DNCA 5J2MB 3N6LA 3A13A 5CZXA 2OGUA 3BKFA 3PCOB 1HI0P 1VRUA 2IDLA 4MKBA 4DR6F 3VGVA 3GR1A 3D67A 4NEZA 1GMWA 2J8AA 1QSSA 1Y10A 3BH6B 2WTFA 3M1VA 1C1CA 3DOLA 3KNGA 2D3ZA 3LQVA 2WVFA 4M5IA 4WXOA 1NXIA 4LRCA 4LJMA 5CCMA 1UFKA 2B7CB 1NH7A 2LYVA 2O1PA 3MEEB 4EO8A 5HLFA 2VBXA 2P9EA 4KBIA 1HHQA 1GX6A 3HT0A 5A2QY 3QFHA 2K2PA 3PEJA 1TZ0A 1F1BB 3KLIA 3H5YA 2ZJQQ 1FRLA 1RHRB 4UZCA 1LWEB 3DFEA 4WBFA 4YS2A 3DOMB 3HP6A 4X4UA 1YG0A 4JI0F 4DV6F 3LP2A 2M88A 2MLXA 2W7AA 1Z1ZA 1TU0B 2DNNA 2Z2LA 2UUBJ 4PQUB 1U1OA 2GMHA 1SI9A 4PG4A 3M9MB 2RQCA 3P6YC 2O5DA 2BOAA 1N32J 1S0VA 4XPEA 3BZQA 4HT5A 4PZVA 2ZZNA 4M5LA 1D9FA 1ZM3A 8AT1B 4K4WA 4ELTA 3PJXA 1WHYA 2JX2A 4K4TA 3BGLA 4OYAA 2UU9J 4LF4J 2OKQA 5J1EA 4KFBA 4RNFA 3SQOP 4WKRA 1IWAA 3UR3C 2QL5B 4BBYA 2N7YA 2RF2A 3OSPA 1GFWB 1S0MA 3W3SA 2VFUA 1BQNA 3UPFA 4A8SA 3P4UB 4IRCA 3ZZZA 4NL5A 4QZVB 3KDNA 3P96A 1N5QA 1AZSA 2HNDA 2MY7A 2O3DA 2ZDPA 3OTDA 3BF4A 4J9UE 2Y8YA 2NUHA 4TVAB 2R8HA 1U7LA 5D0EA 1RT3A 2XYPB 3Q2SC 4RBUA 4ZKAA 1ZH5A 2FYXA 2KYXA 3M8PB 1ZBTA 3KK2B 3FRZA 3US5A 3IBWA 2FJVA 4DR2J 3W2WB 4J9QA 2BJ1A 4OZNA 3TW0A 3LGNA 2HHPA 5AJ3F 4KC5A 3C14B 3W8PA 3SZ2A 3CCTA 1VBYA 5KT2A 2UXCJ 3J7AN 3DDNA 4UUXA 3VTIA 4YOEA 4I67A 5ETPA 4ZMMA 4DV0J 3HHEA 3GPAA 4YDXA 3RW7A 2V34A 1WACA 4USMA 9ATCB 2YQ0A 3TZWA 3ZZYA 5A8KB 4OJ1A 4JI2J 4B3OB 2I38A 4DCOB 4DFMA 1NDCA 4FYYB 3LALA 2XWYA 3KK3A 1UKUA 1IBKF 2PFFB 4RW9A 3NMRA 2EBEA 1LWXA 2MPUA 2BRLA 2V5HG 3C16B 3IR6B 3G71S 1YHQS 4OYWA 4DPXA 1PYSB 3H2UB 4IG3B 3HM9A 4LF6J 3C19A 3RAMA 4NLYA 2OPSA 2IAJB 5HBMA 4OHYA 1ZAVA 5ETMA 3UR0A 1ZPVA 4ZP6A 1MWZA 3DRYA 1UPMB 5F41A 3UDVA 4B9SA 1K0VA 3W7BA 4B9NA 1HKAA 4LF1A 3HD1A 1XQIA 2NSCA 4DN0A 3KJFB 3MCOA 1S1WA 2XI2A 1HI8A 3HZGA 2PMWA 2ZC3A 1T11A 4OZ0A 3PY8A 1AXQA 1JJHA 3AFGA 4ZHRB 4G1IA 3CDWA 2ZBQA 1SL2A 3NNAA 3E8OA 3QLHB 4YUDA 1WD6A 4LF7F 3FEZA 1JJ2R 2FVCA 4XK8C 1UFWA 2HZVA 2QE5A 4NE9C 4CH0S 5B08A 2QA2A 1RT2B 3ZTRA 2HHUA 3QIPA 4DJBA 1D8YA 4OZ2A 3BQ0A 1UTAA 1NSPA 2AJ2A 4I2PA 3ZZ0A 4C3MA 4RNOA 4PUOA 4DL5A 1WNEA 1HD1A 4I7FB 2GAHC 2V68A 3DDIA 3R5CA 1C0UB 3JAMY 1NKBA 4IKAA 1R31A 3H2LA 2C2NA 4PXCA 2MSSA 3BBBA 3FUYA 4PXEA 2ATCB 2UUBF 2HRUA 1RSCA 4RX6A 3TYTA 3CC4S 4X66J 1RT1A 3OFEA 1RWOB 2W2OP 4CT8A 2ZH3A 4J91A 3C8YA 1Y5NB 2YNFA 3NGRA 4QWAA 3JYTA 1WG1A 1EHWA 4IRKA 4NXMJ 3KOAA 5EWEA 1DURA 2QN6B 2ZOFA 3GFZA 3GG1A 3HHDA 3VQTA 1GEHA 4L75A 3BJYA 2PI4A 1U8SA 3PW5A 5K14B 2Q1LA 2XWXA 3J81j 3HT3A 2OLWA 2AQ4A 1XNRJ 3H0PA 1W26A 2E5HA 2H4YB 3BYPA 2I8EA 2BR0A 3TAMA 3G2XA 1B3TA 4QIEA 1XTZA 1CJVA 4WZMA 1VS3A 1DTQB 1Y4ZB 5ETSA 1L3KA 1RHMB 2E9RX 3RUBL 3K17A 4O3PA 1WHXA 2AYMA 4Q8FA 1RBLA 3BBFA 1URNA 3MM6B 3AOCA 1RT2A 5H9EJ 1Q1KA 4EZ6A 4NZ7A 4BWJA 4FXWA 1S57A 3KJVA 5IT4A 4K4SA 3VALA 3DLKB 3GTYX 3MOZA 3V4IB 2CQ4A 2PE8A 5IQ6A 2CQBA 4EBCA 2JEFA 4JI1F 4LVNP 2JEGA 4YY3J 4K59A 1NM2A 5IM0B 3T5HA 1TL1A 3DLHA 4O3RA 2FHJD 1TKTB 4A46A 3EXCX 3KJVB 3QWUA 2CQ1A 4A8OA 4DQSA 1T9UA 2JC1A 1S7IA 3DRPB 4ITSA 1UVLA 3LH2S 2K3IA 5A8RA 2HZCA 4RNNA 2IJFA 3C46A 3R8YA 3K7RA 3ISZA 2KFNA 2VL1A 2CPYA 4IO9Q 5IT0A 2IA6A 4N47A 5HBMB 2MKCA 4KPYA 2HLTA 3FQLA 4L6V3 2GGPB 2P2CB 3SCLE 2FLNA 2HHXA 1SH2A 3T1HF 2R4FA 1HNXJ 4B3MF 2D1CA 4EK2A 2C28A 1KHVA 5DLGA 5LSRA 5I42B 4MIAA 2KT3A 2BJ9A 3M30B 4DCJB 1K44A 2B8PA 3SMZA 4ZHRA 4XO0A 1G7CB 4CT9A 1L3UA 1RWXB 3MM8A 2HIQA 3PW4A 4K8RA 1YBUA 2IC3A 3D3BJ 4AYBD 2IM1A 1KTVA 2ZH8A 2AV5A 4PWDB 2WW4A 3NXZA 4DBQA 1FERA 2MQNA 4JOUA 1RT6A 1NDLA 4CLZA 1L5UA 3C3LA 2PMHA 1LQ9A 3OR1A 4QR2A 4URQU 2XY6A 3MF5A 5LM7E 1S7HA 2OPRB 2ZFHA 1SJ1A 3IG1A 3QAUA 3VV2B 2EK1A 2VONA 3KMQA 2WK4A 3BM7A 2OEJA 2M8HA 3QT5A 2RS2A 2V63A 4ZN3A 3NGKA 4Z7YA 1A9NB 5DDRC 4NMXA 3OHAA 2KZZA 4O0NA 3OJSA 1NB7A 3V5RA 4ANEA 3OV7A 7AT1B 1PAUB 3RU0A 3UFCX 3N79A 4YB5A 4FKYA 3UDEA 2AEFA 5HMXA 2DEIA 2OIHA 1U09A 3C2PA 2QT7A 4Y2IA 3U02A 1ZM9A 2QA4S 1CPZA 4F3MA 4KKOA 3BYRA 4D3GA 1WTFA 3R2DJ 5CD4H 2HRTA 2CG4A 4QU6A 2V2KA 1QD1A 2EVZA 1UP1A 3PDNA 1S6PB 3OT9A 1KLMA 5HL7Q 3PO5A 2AJ4A 3MR7A 2DEJA 4CLFA 2COLA 5KT6A 2AZ3A 1RLDA 4Y00A 3D3CJ 1WDDA 1FVQA 2AZ1A 4O4GB 2Z2ZA 4Q2LA 2DGWA 3VGSA 1UVIA 4LFAJ 3VVTA 3M6WA 4DOZA 2G2YA 1NO8A 1AYEA 1FEHA 1VRQC 2CPEA 2XQCA 2RF2B 5E2QA 2Y8WA 2BX6A 3AD8C 5A6WA 4Z2XA 2DNZA 2LEPA 4B3SF 2HS3A 2M0GB 5E5NA 1QM9A 1H73A 3DMJB 3CT9A 3CJKB 4KGZB 1Z2LA 1C1CB 3DOLB 2NCKL 3GONA 1EZZB 1TVRB 1VK8A 4X84A 3I5BA 3UVJA 2AJFE 3AT1B 2HFSA 1UZHA 2FZKB 5KFAA 3GIKA 4U8YA 2R2UA 1PC5A 4KYZA 4F0HA 3LOUA 3DYAA 2F8HA 2ZOGA 1G3OA 3FFIA 4I4BA 1HI1A 3B6BA 4WIQA 1B7YB 4Q5VA 2JLEA 2ROEA 1CULB 2OHDA 4FNIA 4FVMA 3WIUA 4JBCA 3W61A 3A8EA 1LFPA 3IFEA 3DGVA 4JV0A 2KXNB 4X64J 2HQGA 5L8RC 2MYFA 5HROA 2XZTB 3MM8B 5DG9A 2WRMA 2ZBRA 4HEA9 2B7BB 1Y9OA 2AF6A 4OYZA 2R2TA 3RB0A 1WC1A 3BKTA 3E01B 1MU2A 4OZ5A 3K5MA 2DNKA 4DV2J 3ILOA 2Y9HA 2J9EA 1NDPA 3F0NA 1H2TZ 2AT1B 1GMVA 1HR0J 2JSXA 1H0HB 3EPIA 4ED5A 2CFXA 3FGVA 1XR6A 1FD2A 1DQ8A 2DISA 4WXWA 2Y1IA 1JLAA 2AYBA 5SZTA 1TAQA 2HPUA 2UUCF 2YX4A 4I6AA 1U1KA 4B9UA 1R8HA 1U1NA 4UY8T 2Z57B 5DLFA 3KLHA 4MFBA 1XMBA 5KFDA 2C2EA 3OLBA 2E1PA 4R5PB 5A8RB 1G4CA 1RTIB 2PSZA 5BYQA 2YWWA 3KLIB 5L9XA 2E66A 5FLXU 4A47A 4HTJA 2ASLA 2HBRB 3MXHP 5CYMB 3SFUA 3K5LA 3BGRB 4DV4F 2LDYA 1QUVA 3CJQA 1FWPA 2GCFA 4FDFA 5F9LA 2RD5C 2XEXA 5C5JA 4J9OA 5J2QB 1P1TA 3MM6A 3QSIA 4GKKF 4HI1A 3S1TA 3D6HB 3H2VE 1I3OB 4WE1A 2VQEF 2AJQA 1YWXA 4Y2CA 2FZCB 4IFYA 1KWMA 1JLBB 4HL9A 5CCLA 3Q8YA 3LA0A 4DFKA 1UJ4A 2R8KA 1DLOB 1U1QA 4U7UD 4X4VA 2MHNA 1VIXA 4ECUA 3D6TB 1KVKA 2RNEA 3UCZP 1NJZA 3DOKB 2YPYA 4HACB 5RUBA 2QC3A 4LFCF 2MQQA 1B70B 1IKXA 4RBVA 3NBPA 4PR6A 1KS2A 1WORA 2VG7B 3DLEB 4MKYA 1S4FA 3EDQB 1QTMA 3D7SB 1IR2A 2EW9A 5DM6Q 3JTNA 2AGPA 4RU9A 2EEYA 2DR7A 4KHRA 1ZS6A 4LFBF 2DCUB 3ETOA 3D28A 3QT6A 2X7IA 1MWYA 2DB1A 3N4WA 4LBPA 2DNHA 2DH7A 2FPHX 3CJ5A 1X0FA 1HNIA 5DQHA 2VU5A 1KKHA 3PV8A 1OS5A 2YNGA 3W9HA 4BLGA 4RWWA 1F9FA 1WG4A 4MIBA 3W1YC 4QBUA 1G2EA 1BQMA 1TK0A 3CJ3A 2OPPA 3DI6A 2RRAA 3WX8A 4UT4A 3V6DA 2UUAJ 1RKJA 3FDSA 1RHQB 1VQLS 4QW8A 4LF7J 1SC3B 3H4BA 2AIRB 3HDSA 1S99A 2SXLA 1SJ3P 1DTTB 1JLEA 2WBMA 2YKNA 3M2UA 3MEDB 1HNWF 2BE7D 1EQMA 1HWJA 4USJC 5B0BA 5IXUA 3A8JA 1HPZB 2N7CA 5IQQA 1RT1B 2YKMB 2CDRB 4WU3A 1SKSA 2JZ5A 3CC7S 1Z2ZA 1N52B 2LLZA 2LXFA 2OMLA 1T7PA 5B0CA 2WCXA 2HHQA 4NLOA 2ZH2A 1NK9A 1I94J 3R5JB 2JOQA 2N3LA 2CYYA 2VBZA 2DH9A 2HVDA 2IYIA 4RUCA 3M8RA 3M2VB 2FLLA 1A7GE 2VQFF 4LBHA 4ED3A 1IBMJ 3NNCA 3M4XA 1IM4A 1JLAB 3CVKA 3A8IA 4PXDA 1L3SA 4OJHA 4RL1A 2EBGA 3UQSA 1CQNA 5KT7A 4O3SA 2CJBA 2DRDA 1YITS 4IR1A 1BQXA 4TKTA 3KG4A 5KFUA 1N33J 5KFKA 4JYAF 4K4UA 1WDTA 1GXLA 3MMAB 3CCVS 5A8KA 2K8GA 1S76D 5FD1A 3MECA 3VWSA 5C2GA 3DGPA 3IMQJ 4O44B 4O23A 1FRIA 3CJ4A 2GQCA 4CM0A 4B3TF 2F4VJ 2VG7A 2XC9A 2V2ZA 5K8NA 2RILA 2D69A 4RNHA 2KXFA 2KH9A 4GO5X 1TFWA 2YQ3A 2IM0A 3TUJC 5KFEA 5KAKA 2PI5A 4PKDB 5L46A 1EARA 4LF2A 3QGHA 2W8KA 3HVTB 1RU1A 5IWAJ 4PEOA 1FKPA 3R5BA 5KFWA 3IS9B 3J7A1 1CSJA 1X7VA 2KHCA 1FE0A 1QY7A 2UUTA 3QATA 5B7WA 3KK1B 5IT9Y 2EKYA 1FNOA 2F8EX 1SV5A 5GADU 4IQMA 1NB2A 2OSRA 2VPYB 5LMNF 1FEEA 3V6KA 4P52A 3TX8A 3UCUP 3MEEA 1VGYA 4KIAA 4C3LA 4ZCLA 3RTVA 4EEYA 3CTRA 3FCVA 2DH8A 4QR1A 1PYOB 5GAGU 3BGRA 2B0GA 1BY9A 2FC8A 4ID5A 2CJKA 3PEHA 2R2SA 3T1HJ 4O4GA 5DO2A 4B9VA 4DR1J 4AQYJ 3J80Y 2D9PA 4V19J 1BQMB 1MN7A 4LQ3A 2HK2A 1BLUA 4ZVHA 1RT3B 2H4WB 3HFVA 1SCJB 3P3DA 2A6OA 4EZ9A 5D4PA 2BJ3A 9RUBA 2C2DA 5K8PA 4JI5F 3CCQS 4I64A 5AE1A 2ILZA 1VQ5S 4PWUA 1JXLA 3JSRA 3THTA 1S0OA 3VAMA 2DPJA 4J9RA 2CJ9A 5D0GA 4TLRA 1YX2A 5GMEA 2RQKA 2Y1LB 3HI9A 2DBBA 5AT1B 1ICEB 2BJDA 2OEMA 5HMWA 1IKXB 4DZDA 2WOMA 2MZ1A 1RT4A 2M8DB 2CQ3A 3EICA 2GW8A 4H4MB 4M5MA 1D8ZA 3GIIA 1I6JA 1NBEB 2DXEA 1PKUA 2QMWA 4TY9A 4FF2A 1ITPA 3EVWA 2BE2A 3G82A 2FJDB 4PQUA 1T9YA 4NI2B 4DF4A 4MK7A 4ED0A 1S6QB 3UWTA 1KLNA 2PGCA 4DV7J 5EUHA 4OL8A 2DKOB 2L9NA 3M32A 4NA2A 4QYRA 4NCGA 2FY1A 3ITHB 4OX9J 1TV6A 4DQIA 4CLTA 1FK9B 3T1YJ 1UWAA 4IH6A 4WE1B 4YN3B 4ECRA 1RA7A 2XMWA 4LIRA 3ZC4A 1VBKA 4N41A 3JTOA 4NEYA 2XCPA 3Q24A 3EX7B 4G3IA 4DX8H 3GFHA 2ZBPA 1JLCA 2NUUG 3JSMA 2RQ4A 1GXUA 3MEDA 1IKWA 2ASYA 2CQGA 4KSEB 4YY3F 4U67Q 4DV5J 4ECSA 4NYOA 1P27B 1F9EB 1R8BA 2BZ2A 2HFVA 4AXIA 2HMIA 3X1LB 2CJAA 2LEAA 4QYZJ 1N6QB 2VASA 2KL8A 3K58A 2J7WA 4Z37A 1QVGR 2CXEA 1FJGJ 5LXRA 4CLYA 2DHXA 2OPPB 3DI6B 4TYAA 4LR8A 2B6AA 5DJBA 1KOOA 2A3JA 2X3DA 1HNVB 4B08A 1JLQA 5BYSA 3TARA 2F7VA 2NSBA 1GH8A 3CD7A 3N9UC 2Z2YB 4W98A 3K57A 3L3CA 2OTJS 1CEZA 1N32F 3M6XA 4P2MA 4C2MA 5FIIA 1JIHA 1RP5A 3OSNA 4DV1J 4N8NA 3CD6S 2CZVC 4IOAQ 2V69A 4FBTA 5KG4A 3U7JA 2XS5A 4P7VA 3G86A 2VUGA 4ZCMA 5L1IA 2PC6A 4AT1B 1U1RA 1SKWA 4EI2A 4UY85 5D3GA 3MD1A 1ACMB 1WKKA 5M2PA 2QA1A 2J6SA 1DZ5A 3QIDA 4DX6A 4USTA 3Q23A 4QU7A 4YDDB 1DLOA 2KXHA 2O01C 1CC7A 3C6TB 1HHSA 2IM3A 3EGVA 3O8WA 2AEMA 4BC7A 4CO5A 4WFNQ 3P5BP 1N5SA 2N82B 1ELOA 3G6ES 2KJVA 5GAEI 4QPTA 2R2RA 1LWFB 3CCUS 4DV2F 3PVXA 2HBQB 3G8TA 2W1BA 3D1OA 3GLJA 1U0SA 1XNQJ 4ERDA 3LGMA 5CXTA 2B5JA 3Q86A 3A1YG 4NLVA 5GAHU 4RZRA 3T5KA 2YX7A 2F63A 3CDAA 2C2MB 1JLGB 3FSYA 3QMQA 1NMEB 4OI1A 4C7QA 3A3PB 3DDKA 1WC0A 4P75A 2HWHA 2I5JA 4GMKA 4YB6A 2YWFA 5KG5A 5EWFA 2ZJRQ 1VQ6S 2CNKB 2MZSA 2C22A 3UNYA 1HW8A 2OUGA 3TZYA 4RW6B 4ZPAA 4Y65A 3T1AA 2C3MA 4WWSA 1XERA 2CQ2A 4BDPA 2DHSA 2RHSB 1KC8T 1QE1A 1REVB 4LF6F 4RNMA 2UV8A 1UPPA 4ZS6A 3GCXP 3TUIC 1R43A 3IXQA 3R7NB 3VAIA 3RRHA 3PW2A 3TA0A 4LFAF 3PYFA 3HULA 3IAM9 2V2VA 1TKXA 1UA0A 1IVZA 1TQLA 2QJ3A 1B4SA 4A8XA 2DGUA 3UW1A 2XZDB 3K5OA 2BJ8A 2JLGA 1Y00A 4ED8A 5HROB 1XR7A 1JJ4A 3G6XA 4K0KF 3NRBA 4JI8F 2DGQA 3EWGA 1XIQA 4AL5A 1RTJA 2MKYA 4NRTA 3LPYA 4L3NA 1N34J 4C8ZA 1UCNA 5FDLB 4CP5A 1M5HA 1R89A 5HQ8A 3D6FB 2H9ZA 1VISA 3FFIB 3LP0A 4USIA 5DGAA 2YNHB 1JLQB 1NSKL 2HFOA 4PG6A 4USWA 4NX9A 1WI6A 3BH7B 2A10A 3O44A 1S1TA 5EX0A 3OUYB 2E44A 3IBFB 2ZM6J 1M90T 1UETA 3KLGA 1FCAA 2E5LJ 3EGWB 4NLUA 2BYCA 5JJBA 2J6UA 4DFJA 5J2NA 4X2BA 4KE5A 1WC4A 4HHHA 4JV1A 2WSCC 4LQ9A 6FD1A 2HFZA 1HBOB 4UQTA 3HHLC 4DSIA 1SL1A 5KFZA 2M52A 3OD2A 1VRTA 2X51A 1RHUB 1TKZA 3E2EA 1HR0F 1R27B 1X4BA 6FDRA 4M5DB 2CRLA 1RAGB 1HQ2A 5DGBA 3M7VA 1XNRF 4LMZA 2GGPA 3R5GA 1S49A 1TV6B 1FJEB 1WEXA 3M9OB 3KLHB 2CQIA 1O51A 2Q6CA 2FHJA 1HBMB 2AJ0A 3OFFA 4R25A 3VHQA 3TZXA 1J27A 1EETB 2QFJA 1U6BA 3CW2C 3ZZUA 2CNNB 4ECTA 2Z58B 2B9YA 1XMQJ 1LFWA 3DRPA 2AGOA 4CTAA 3UNGC 2U1AA 1NNDA 1HW9A 3OL8A 1FKOA 2GHVC 4W92B 2CIMA 1NK4A 3IM9A 3THVA 1ZM4A 2VV5A 3SBMA 3WDOA 2BDPA 1JKHB 3IN5A 4OI6A 2HVIA 1RK8A 3W63A 1S1XB 2YWHA 5HJYA 3P5TL 2FLPA 2A0FB 2E9ZA 3PFOA 2R8GA 5DQGA 3SYZA 1D0EA 2FB0A 4HR2A 1FK9A 1QLNA 1MMNA 2Z56B 4NA3A 4QIGA 4ZVRB 3TR5A 4DR4F 5B0FA 1KVIA 3OR1B 5B0DA 2KU7A 4F4YA 3ISNC 4LFCJ 2J76E 3PXGa 2ZUGA 1UJ6A 4M5DA 2E7WA 1HNXF 2F4VF 2QYCA 2V8GA 1KQFB 1NDKA 1H38A 1IKYB 4WZQA 1AFIA 1D9AA 4TNOA 3EMTA 4PYAA 4ECZA 3DMJA 3PX4A 5IT9U 2OPQA 5KFIA 4NOHA 3EZUA 4WIIA 3MPWA 3DM2A 2XY5A 2HNZB 2YNFB 4C6AA 1WWHA 4ZLNA 1M5KC 5CAAA 1TP7A 4JI6J 3W62A 2ZHOA 2J9DA 4MIWA 4A8FA 2JEIA 1NK0A 3NGSA 4KTQA 1FDNA 2OELA 1YSJA 1ZAWA 2XZWA 4OIXA 4O0IA 2Y1JA 1Q82T 3HHNB 3KK1A 2BBEA 2L08A 1H98A 3MEKA 4M5JA 4XDCA 2FC9A 4TY8A 2BM1A 1MROB 1FDDA 5KG6A 3QO9A 3LP0B 2C2KB 1S6PA 1U47A 1X4FA 4L72B 4ED7A 4JI7J 1HFEL 2EG2A 3CJSA 2AP6A 4LF5F 1NPPA 2XNQA 1RT4B 3HSDA 1VC6A 4HDGA 1KTQA 1RTJB 3NGUA 3O2IA 3U1MA 5DDQC 5IFMA 5JUMA 1K8AT 1U24A 4MKVA 4I6WA 4ZA1A 4NZ6A 1Q95G 1U48A 2VA3A 3DLKA 1DJ0A 4MTPA 4N5SA 1I51B 1SB6A 4P2SA 3QZ7A 1UW4A 4ED6A 4EGLA 2KVQE 1FNXH 1O0PA 2DD8S 1F6TA 4I0WA 1Q5YA 2L9DA 1YJUA 3L9ZA 4QWCA 2DT9A 1X9SA 4FBUA 5HSPA 2B51A 4LSNA 4UOFA 1S1TB 1SC4B 4OI0A 2DNRA 1HBMA 1BGXT 1NH8A 2B56A 3MMJA 3RRGA 1DTQA 2BVZA 3POTB 1S1UB 3G87A 4H4KA 1AUSL 1RTZA 1S48A 4IFVB 2M4MA 4ALZA 1R0CB 2GJIA 2OPRA
chains in the Genus database with same CATH topology
2VZ9A 2MDAA 4PXBA 1N33F 5C24A 1ZPWX 3ONQA 2NYIA 2I5JB 4F3QA 1KNZA 1VI7A 2XS2A 1LV5A 4B3OA 5KT4A 3HXMA 3MOJB 3S01A 3N5BA 3PKMA 1FESA 3KLGB 1Y5IB 4BCAA 2P6TA 3LANA 2FJBB 3OFGA 1JWWA 4KV8A 3FZBA 3T1YF 2MKSA 1N56A 1Q7YT 2RU9A 1HYSB 4C8MA 1IJEB 2EFQA 2BV3A 2FDNA 2VC1A 1NZAA 1V3ZA 2QLXA 3OVSA 4DL3A 3U27A 2Z8QA 1ZTWA 3CCES 1T94A 5DS7A 2ZKUA 2PD1A 3QZ8A 2BRKA 4ZCKA 2VB6A 1VQPS 2VOOA 2DGSA 1PILA 3HHLA 4ICLA 2OFGX 1X5SA 3DN9A 5T41A 4RLEA 2IBOA 2XMUA 2U2FA 2G13A 3N6NA 1K0TA 3PRBA 4AQYF 3CSKA 5I3QA 4G1QB 3KHRA 1VQ8S 4CCHA 1LWCB 1SBRA 4CI0B 1FVSA 2CPFA 1LW0B 4OHZA 3MR3A 3IWNC 1T03B 3OQ2A 4EBDA 2D41A 1Y3JA 2OD6A 3TO8A 1JLBA 5K8MA 1UFLA 4D3HA 4ECQA 2RVJA 4LT6A 1YQHA 2A18A 3CPWR 4B3RF 1NKCA 5E3RA 3ENVA 5KFJA 1LKZA 1LW2A 4MK9A 1PC4A 2VODA 3F41A 3FMWA 1Q53A 3PJWA 4NLQA 4NLWA 2BACA 3PW7A 3V81A 2PN6A 5FLXY 4KAIA 5CYMA 1U1LA 3CUNA 3VZHA 3V6JA 5ITHA 2ZC4A 2RKIB 4R5PA 2G0CA 1U26A 4NCGB 4EYHB 5J2MA 2GIQA 3AB2B 3R1HA 3BGUA 4WFXA 3AH6A 3OL7A 3G9CA 2IMWP 3CMAS 4I2PB 1IJFB 1RI7A 3UI3A 4PUOB 2YWKA 4PQAA 1VBXA 1JNZB 2IVFB 4M1KA 4KGKA 4FPRA 4URGA 1FT8A 4X4RA 3NCPA 4J9PA 1UAWA 4I56A 1VK3A 3IGVA 2FIUA 3OJUA 2KT5A 1SJRA 1H2UX 5E3CA 5BJRA 2POKA 1M5SA 2J9DE 4DV3F 5GMKa 4ED2A 4EYIB 3O6QA 2GNKA 4M63A 4F67A 4PG5A 1CVJA 2GHWA 2HHSA 1E6VA 2EFPA 1O5JA 4IO1A 5HMYA 2KHDA 1JXEA 3MMBA 4YEAA 1WHWA 4LSNB 4DPOA 3KG1A 4QWBA 2XLKA 2OD4A 2Q3PA 4KO0A 1R0AB 1FA0A 4KRWA 3FZ2A 4P7TA 5KFTA 2W4DA 4ZPWR 2WOMB 1N34F 4A8YA 3GFXA 1XWLA 4OX7A 4Y6IA 1U1PA 2JHEA 5E3PA 4HVZA 5J1NA 3JSMB 5KG2A 4E98A 2Q6BA 5GAEU 1Q78A 1RYRA 2XMJA 3KMSA 3JB9k 3M6VA 3H5XA 5D8HB 2DVIA 1Y0HA 1C0TA 3QO9B 4OQJA 1YJTA 2ZM6F 2HRYA 3WX4A 1KD1T 3I31A 2B6AB 3IRWP 5F8GA 1F0XA 1N5TA 5J1PA 3U1NA 1IBMF 1C0TB 2GMJA 2VG6A 3K0JA 3M8QA 2RE1A 2D3OR 1X9WA 5KFOA 2HMIB 4ID5B 1WG5A 2XBPA 3SCIE 2C3YA 2LA4A 3OTBA 3ZFVA 4EO6A 3GQCA 4N41A 3HK2A 1SC6A 3FSXA 5KFVA 2VQFF 3SQGA 3T3FA 1LOUA 4J5OA 4KGMA 3RZAA 4A4JA 1H6KX 2D7SA 2UU9F 5LSOA 4BC9A 1RAJA 2F1FA 3KLFB 5C24B 3WBZA 2HLUA 1YI2S 2E5IA 1F5AA 2XLJA 2MZJA 5JVHQ 3CULA 1YVFA 2PDAA 5A8WA 1TK8A 4FNHA 2J5AA 4IG3A 2YNIB 4J9SA 1VQOS 1LW0A 1KOHA 2KT2A 5IWAF 2M9KA 3IRXA 2LA6A 1KVJA 3Q2TC 2XGPA 1M5OC 3Q22A 2WSEC 1P9QC 5D78A 1MMDA 2MB0B 2UZAA 3VAFA 3DHXA 3J7YU 4ID8A 4DQRA 3K2YA 1GAOA 3H59A 3TVZA 1W25A 4IOBA 1VC5A 3P49B 4DQQA 2CPHA 4KHMA 3OXLA 2E7XA 1VQ9S 1SV5B 4DV0F 1TAUA 3PRDA 2OAUA 3C6UA 4IYQA 3TA2A 4ATNA 3I82A 1FDBA 3DHWC 4DL6A 2JDJA 1N8RT 3BEGB 3D0HE 2QO3A 3PX0A 5F8MA 1QAXA 4DR5F 3GILA 2LXUA 1JK9B 3K8WA 3MMCB 3GV5B 3ICLA 1W2IA 2J0SD 2E5LF 3J7YI 3QJPA 4RU2A 3S8SA 4JI6F 2K1RB 1HBOA 3PHEA 3H5SA 3HJFA 1NHVA 4R8UA 3PIOQ 4DS4A 4DN9A 3GMGA 4J9LA 2ZVSA 1X4AA 4A8WA 4TU9A 2ZH6A 2IMOA 3J7ZT 2OFHX 3QWPA 3M30A 3MM7B 5I3UB 3R27A 3I0RB 4KJIA 3QAEA 5A0YB 4CO4A 3I55S 2GMLA 3M2VA 4NLXA 4KR0B 1P6TA 2B9WA 2YNHA 3IG1B 4RKUC 4ECWA 3VZIA 1FTRA 1S1VA 2D74B 4IDKB 2XSFA 4DV7F 3CWJA 4I68A 2ASJA 3CO9A 3CD5A 1H2VZ 1TL3B 2RH3A 2MKHA 1U6FA 1T3OA 4C11B 2FVSA 2PT0A 2W8LA 3GYXB 1EP4B 4IG0A 1FRJA 2IHR1 1N5YB 1SH3A 3I96A 3PACA 2UVRA 2CPZA 2ASDA 4X4QA 3GWCA 1K1SA 2DR5A 4WK1A 1M0SA 2VC0A 2JVRA 5AXKA 3OHBA 4FF4A 2JC0A 3MMCA 3O5TB 1R3NA 3HVRA 2HHTA 5EGYA 2V8DA 5L9NA 1S10A 1C4AA 1S79A 2AJ1A 2MMYA 2L41A 3BO2A 1SL0A 3CIMA 4HKQA 2AX1A 1TL4A 4Q2MA 4CIOA 2YNGB 3NAIA 4YHHF 2AD9A 1Q8IA 1HD0A 2V4JA 3GE9A 4I7FA 5CYJA 3OL6A 2KFYA 4DQPA 2VBYA 3FQKA 3VAHA 3UD3P 3TAMB 4NLSA 3VAGA 1FRXA 3B78A 1U45A 1JLGA 5F8HA 4EU0A 4EBEA 1Q7LB 2HNZA 1S6OA 1JLEB 2B3TB 3V6HA 3MM9B 2WAQD 2NXUA 4KO0B 1R0AA 2XCAA 3IRXB 3H4DA 4NLDA 3F56A 1RT5A 2KFZA 2CQ0A 2AWZA 2LMIA 2QZ8A 3D54A 5CZVA 2YY3A 3L7PA 2AYGA 1C1BA 2IAJA 3CF5Q 1S97A 2VPXB 3MHYA 1KRPA 3BREA 3FJ2A 2W7PA 2XY7A 4H4KC 3KYLA 3QJLA 4G1QA 1SUQA 3N01A 4AE5A 4DSEA 1QAYA 1X4EA 4V19X 1B7FA 1JKHA 1KEKA 4NCAA 2M2BA 3NBPB 1VQ4S 2QMXA 3HPOA 1U4BA 1VIOA 5H9FJ 4PG8A 4OLPA 2DO4A 2XSJA 1XC9A 2HHWA 3FSIA 3MEGA 1OSDA 2VFSA 5L1KA 2FHKA 2UUAF 3H98A 2MKIA 3PNIA 3GG0A 2C3OA 2AW0A 5LJ5Y 3GSDA 4EUVA 1RYSA 2HHVA 4C8KA 5KG7A 1ZZFA 1C2PA 1TVRA 3RYLA 3J7Z5 4DFPA 4PCQA 4RW8A 3SCKE 5F3TA 5LJ3Y 2W9BB 3SCJE 1JLFB 2IRXA 2XMTA 3GZ7A 1IQTA 3KHGA 3NAHA 4KFBB 1NRKA 4IQXA 2KDOA 2BUNA 3PX6A 2XG8A 2Z4PA 3FRYA 5T7LA 2CPXA 2FHOB 5THWA 1IKVB 3OUYA 2GC8A 2GO9A 3BSOA 4CNZA 2DIVA 4MYUA 1LXJA 1LWCA 1S1UA 2ZDOA 3I9ZA 1FDAA 2DNLA 3TUZC 3I0RA 1RQ0A 3IAS9 4ETZA 3KK3B 1N54B 2VKZG 3F73A 2W9CB 4DSLA 4WFYA 1BC6A 1KN6A 2RQMA 1BQNB 1FD8A 2B4VA 4HH0A 2DPIA 4Y0FA 2MQLA 5MLCV 1JLFA 2RUGA 4OHXA 2V94A 2R9LA 2HW3A 3CXCR 3M1VB 4BS2A 2YX1A 3G8SA 1RT7B 4YMEA 1RTDA 2IBKA 2L48A 2WB1D 3BDEA 4WFZA 2MQMA 3CE8A 2RRBA 2DNYA 3M8PA 2ZHAA 4FF3A 1HBNA 1AROP 2BQ3A 2F3JA 4LF4F 1M1KT 1G1XA 4C9DA 2N3OA 1RTDB 2JVOA 1OQ6A 1APSA 3DOMA 3I32A 4DS5A 4UW2A 1RT6B