1X5TA

Solution structure of the second rrm domain in splicing factor = 3b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
GSSGSSGIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor 3B subunit 4
publication title Solution structure of the second RRM domain in splicing factor = 3B
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x5tA01
2DGXA 5LSLA 4TLQA 2LEBA 2KHCA 1VC0A 5DDQC 5DM6Q 2KYXA 5LXYA 3BO2A 2X1GA 1KQSR 3EX7B 4ED5A 3NS5A 3JB9k 2DGUA 3OW2R 3CCQS 3H2VE 2F3JA 2M52A 1B7FA 2CQPA 2XNQA 2DK2A 1VQ9S 3CC4S 2ZJQQ 2ZJRQ 3BEGB 5D77A 2RU3A 1ZZNA 3I55S 2DNQA 2HGNA 2M70A 3UD3P 1U1QA 2XS5A 2KI2A 2KM8C 1HD1A 3CXCR 4WKRA 2CQDA 3ZZZA 4M5DB 3UCZP 1VBYA 1OIAA 1YJWS 3IWNC 1WEYA 5DDPC 1JJHA 1R8PA 5GVQA 1VBXA 2LECA 2SXLA 2MB0B 1JMTA 2LQ5A 3NNHA 1FJEB 1WI6A 3TO8A 1OO0B 2DNGA 2MGZA 1VQNS 2CPIA 1M5KC 5IFMA 2UP1A 1QVFR 2D9PA 1X4DA 2MKIA 1VQLS 4IOCQ 4WIIA 2MQOA 2E5GA 2VONA 2PEHA 3MUMP 4YB1P 1FO1A 5GAGU 2NZ4A 1O0PA 2XSFA 2CQBA 3CUNA 4PRFA 2RUGA 2OSRA 2I38A 3J7ZT 2KVIA 2B0GA 1U1LA 2I2YA 3G71S 1VQ8S 1OWXA 4ERDA 2KU7A 2V94A 3THTA 3MURP 1KD1T 2DH9A 2D9OA 1FXLA 3CF5Q 2LXIA 1WG1A 2F9DA 2DGWA 2MYFA 1WF1A 2MKKA 5CA5A 1WHVA 4ZKAA 1SJ3P 2L41A 2AYMA 3VAKA 2YH0A 1YWXA 4TU9A 3CPWR 5CXTA 3G9CA 3P5TL 5CYJA 4CIOA 2OTJS 3NS6A 4C0OC 3U1LA 2MZJA 3B4DA 1X5TA 5HO4A 2MSTA 3G4SS 1D8ZA 3ULHA 2K8GA 4EGLA 2U1AA 4QU7A 2DNLA 1CVJA 3RW7A 2HYIB 3N9UC 3PIPQ 2VOOA 2HGLA 2J0SD 3UCUP 2K3KA 2DNPA 3P3DA 3I56S 2XNRA 1X4BA 1N88A 2YKAA 5DDRC 4FXWA 3HI9A 2AYBA 2MY8A 1P27B 2CPEA 1WHXA 2WBRA 2HZCA 3US5A 3S8SA 1UFWA 2LEAA 4PKDB 2DIVA 3V4MA 2N7CA 1YITS 1M5OC 1L3KA 2CQ1A 2MKSA 3UE2A 4C7QA 5LXRA 3G96A 2CQGA 1WWHA 2YTCA 3R1LA 3CMES 2DHSA 2EK6A 3Q2TC 2RNEA 3MUTP 1H6KX 4OZ1A 2CQ3A 1UW4A 2GHPA 2ADCA 2J76E 3BS9A 1H2UX 2MQQA 1A7GE 1S79A 2M88A 4A8XA 2OJ3A 2RT3A 4CQ1A 2DIUA 1AUDA 4F25A 2RRBA 2DNOA 1JJ2R 2DISA 2MJNA 3S6EA 1U1NA 2DH7A 2XS7A 5EN1A 2DGQA 3PIOQ 2MZTA 4RU2A 4QPTA 2A3JA 2M2BA 2KG1A 3CCJS 1N52B 2LCWA 2PE8A 5IM0B 2ERRA 1VBZA 1XN9A 2DGSA 3L3CA 2CPFA 2MKCA 5GADU 2Q79A 1NO8A 3DXBA 1JJ4A 3MD1A 1KOOA 2E44A 2CPDA 3NNCA 1VQ7S 3U1MA 4TU8A 4BS2A 3SMZA 2EK1A 3K0JA 2U2FA 5H1SV 3THPA 3G8SA 1PO6A 2CPYA 1X4EA 4W92B 4J5OA 4C4WA 2DGOA 1Q86T 2MQNA 2MXYA 2DB1A 2DO4A 2E5HA 1URNA 3EGZA 3VAJA 3MOJB 2N3OA 1M1KT 3P6YC 1WHWA 2MQPA 2MPUA 3MDFA 1N54B 2KRRA 3CD6S 3RW6A 1RK8A 2O3DA 3SDEB 1YJ9S 4WCEQ 3Q2SC 2J0QD 2XS2A 1X4GA 3VAHA 1YTYA 2KFYA 1N8RT 2CQHA 3D2WA 4F26A 1FJCA 1YIJS 2AYGA 3FEYB 2FHOB 4TU7A 2E5JA 3CCES 1WG5A 2MZSA 1Q81T 2OTLS 4UQTA 3VAGA 1IQTA 1R8HA 2CPJA 2MZRA 1WI8A 1M90T 1G2EA 2BOPA 3CC7S 2M8HA 1X5SA 1QM9A 3G6ES 1X0FA 3HHNB 4LMZA 1FJ7A 2X1BA 2DHAA 5DM7Q 2CPZA 1YI2S 2L9WA 1YHQS 3ZZYA 1HD0A 1NU4A 2MJUA 1F9FA 1M5VC 3MXHP 5LJ5Y 4YOEA 2DH8A 2KH9A 5LSOA 1K8AT 1BY9A 3LQVA 3CMAS 3DLLQ 2CPXA 2CQIA 3LPYA 2YWKA 1WF0A 1WTBA 1SJ4P 2CJKA 3TYTA 1SJRA 2KRBA 2FC9A 3J7YU 1W2BR 1SXLA 2X1AA 3CCUS 5DDOC 2MKJA 3VALA 3VAIA 4IO9Q 2CPHA 1WHYA 3VAFA 3G8TA 2M7SA 5IM0A 2DHXA 1P1TA 2OIHA 3EGNA 1S72S 1VQ6S 5GAHU 2JX2A 1VQMS 3MI7X 2RQCA 1ZZFA 2MQLA 2NLWA 5D78A 2CQ4A 2DITA 3TP2A 1FT8A 3CCMS 2RRAA 1NJIT 3R27A 2DNHA 2AYEA 2CQ2A 4V19X 3CCVS 1FHTA 3UWTA 2JVOA 3FEXB 1VQ4S 3BO3A 2QA4S 4W90B 1U1PA 4Y0FA 1DBDA 2QEXS 1A9NB 5DETA 2D3OR 1UAWA 4WFBQ 4PR6A 1FNXH 1HA1A 4FXVA 2N82B 1PGZA 2RS8A 2JVRA 2MSSA 3B4MA 3SDEA 3P49B 2JRSA 2LA4A 4Z2XA 5JVGQ 5FJ4A 1Q82T 2LXUA 2FPHX 4CH0S 2KG0A 3R1HA 2MZQA 4WFNQ 1U2FA 4YUDA 1X5OA 1WEZA 1YJNS 2DO0A 1WEXA 2G0CA 1VQKS 1K73T 2KXNB 4QQBA 2MY7A 2DNKA 2HVZA 5MLCV 1M5PC 5GMKa 2VOPA 2GO9A 2HGMA 1WELA 2LA6A 4UY8T 1X5PA 2G4BA 1H2VZ 1VC5A 4WFAQ 3CCRS 1VC6A 2M9KA 2KM8B 2N3LA 2ADBA 4Y00A 5HL7Q 1RKJA 4IUFA 3CC2S 1U6FA 2LYVA 4CH1A 5JVHQ 3S7RA 2MKHA 2M4MA 5LJ3Y 2OSQA 3VF0B 1H2TZ 1SJQA 1X4HA 2VODA 2F9JA 3UD4P 2LKZA 2FC8A 1VQ5S 2E5IA 2MGZB 2AD9A 4OZ0A 5ITHA 1U1MA 5GAEU 3H2UB 3S01A 1Q7YT 4IOAQ 2CQ0A 2MMYA 2MHNA 1D9AA 2DNZA 4U67Q 2KT5A 5IQQA 2FY1A 3UCGA 1DRZA 2XB2D 2M0GB 2DNMA 1WG4A 2DHGA 2MQMA 2DNRA 4F02A 1SJFA 4QU6A 2L08A 3BO4A 1KC8T 1UP1A 1U6BA 2CQCA 2DNYA 2M8DB 2DGTA 2X1FA 2DGVA 2KXFA 3IRWP 4LIRA 2DNNA 1QVGR 1ZH5A 1X4FA 2ZJPQ 2EVZA 2J8AA 2YH1A 5BJRA 2MZ1A 1DHMA 2KN4A 1U1RA 1U1OA 2JWNA 1U1KA 3CTRA 1VQPS 4WF9Q 4LJMA 1X4AA 2RQ4A 1DZ5A 3NNAA 1K9MT 1HL6A 2RVJA 3CCLS 4P6QA 1WF2A 3CULA 3NMRA 2LMIA 1X4CA 3SXLA 2RS2A 1OPIA 3MD3A 3VAMA 2KXHA 3MUVP 2BZ2A 1VQOS 3CCSS 2QFJA 2G1DA 1KOHA
chains in the Genus database with same CATH superfamily
5JUMA 5LSLA 2KHCA 5HMXA 5DM6Q 4UQGA 3EX7B 3AQPA 1Y5IB 4ELVA 2BV3A 4CH7A 3K57A 4WE1B 4CM2A 1ZZNA 2OEKA 3ITHA 1JLFB 1FFWB 1Q95G 2UVUA 1FWLA 2X51A 3BYRA 3A1YG 3H5XA 2HHVA 4N41A 3AY0A 1FJEB 4A8OA 1EIYB 1HLWA 2CFXA 2DNGA 1F3FA 3H4BA 1JKHA 4LF5F 1X0PA 4IOCQ 4DF4A 2BABA 4WIIA 4OJ1A 1QY7A 3KK2A 3M2VB 3HMJG 4KC5A 4MIWA 2AIRB 4DQQA 4KGZB 2VG6A 3IGVA 4ANEA 4DPWA 2DH9A 3OQ2A 2YKPA 2MKYA 5CAAA 2V6AA 4JV2A 3KXDA 2ZH9A 1N5YB 4TVAB 4QU7A 3OR1B 2BXJA 1N5TA 2O5DA 1PJ6A 4OZ5A 2OO4A 3RZAA 1N88A 2KVQE 3R3TA 2XCPA 2CRLA 2MY8A 1DLOA 3S8SA 3DGPB 2VG5A 2BYCA 1VJWA 3V4MA 1UJ4A 2XWYA 1JLBA 3E3XA 1NK0A 3WX4A 3MUTP 2Z2ZA 4XK8C 3BJYA 1A7GE 2WONA 2HNZB 1QUPA 1ZBTA 4IQXA 3CD5A 1HKAA 2DH7A 2HRUA 5SZTA 2ZFHA 4ECXA 3EJMA 1RQ0A 3R5GA 2E5LJ 3QGPA 2V63A 1BMQB 2HNDA 4LFCJ 2BE2A 3PYDA 4DR5F 4W92B 1T9XA 3T9ZA 3B54A 3HHLC 3KWMA 4Y2MA 4J9MA 3R97A 3W7BA 4ZMMA 2ZDOA 5AE1A 1N54B 3T6BA 1T9WA 4C98A 3SSSA 1X4GA 2K7JA 2BVZA 2XYGB 1YIJS 1F1BB 4HI2A 4NZ7A 3K5MA 1X8DA 1B0PA 4LMZA 2ZH6A 3FBFA 1XEZA 2H5IB 2AEJA 3V5RA 2W8KA 3MXHP 3BBCA 3JYTB 1HQEB 1K8AT 4O3NA 1GNKA 4USIA 3V6JA 2UXDJ 4CLTA 4RNOA 1N34F 2GIFA 2VA2A 3RB3A 3Q8RB 2HBYB 2A2CA 2DEIA 3SV4A 1SQEA 4DR1J 3NBPA 3EGNA 3IG1B 2GJIA 1FDNA 3ETMA 3TP2A 1NM2A 1DARA 1KWMA 4MAKA 2L48A 2PMHA 4TYAA 1FRKA 4OI2A 4JI4F 2DPIA 5FDLA 1FI4A 2XYHB 1H74A 1NB7A 5DETA 1V3RA 3AHPA 4OJHA 3KUGA 4QYZK 2RS8A 3R7BB 2AJQA 2MSSA 2BW7A 1MWZA 5L9NA 1U8WA 5K20B 1FFGB 2LXFA 1NHUA 3SYZA 2J5AA 1EX8A 5C42A 2GNKA 1CLFA 2J9DE 5KFQA 3OD2A 1GTHA 2ZM6F 1VIOA 3ITHB 3D54A 5IS2A 4H4OA 4NLUA 3CDUA 1Q7LB 5LJ3Y 4Q8FA 1S10A 2FC8A 1S6PA 2AD9A 4ZVOB 3QJJA 1U1MA 1NAQA 5GAEU 1JKHB 3P8BB 5DZ6A 4WFYA 4J37A 4RU9A 2FY1A 2UU9F 3K5PA 3KK2B 4K8RA 4B08A 1Q4RA 5HATA 4PQAA 3M2UA 2VG6B 1YQHA 1BQNA 4DS5A 2QV6A 4Q2MA 2DGTA 1RYSA 2Y0BB 4OYIA 3RG6A 5GAHI 1GXLA 4XPCA 1IWGA 4WF9Q 1PG5B 1K9MT 3T6JA 1R7IA 4OQJA 5DG8A 4F0KA 2XLJA 4OI4A 5KTQA 4LFAJ 3FUYA 1PAEX 1KVJA 2XGQA 3FJ2A 5LXYA 3A8IA 1DLOB 3TEGA 2EC2A 2VG5B 4LIWA 4ZPCA 3ZC4A 2UXCF 1JLBB 2ZH1A 1P9YA 2KI2A 1S4EA 2H48B 4C11A 4ZIVA 3UQSA 2HFSA 2WONB 2V2ZA 2DXFA 3KNGA 1UJ6A 1QAJA 1U24A 2ZBCA 5D0GA 1QVFR 4LF9J 1L3VA 2CUYA 2JJ4D 2E5GA 2BANB 4OV1A 2VH7A 2HNDB 2BE2B 4B3TF 4LR7A 1VQ8S 1KQKA 4NLRA 1YWXA 5HO4A 3MPYA 4LRCA 2IAJA 2VOOA 2UUAJ 2CVEA 1VIXA 4QCLA 1FDAA 1HW9A 4ECUA 4ILLA 3M8WA 2PC6A 4FP9A 4DPXA 1U25A 5HVGA 1WC1A 2CJQA 2DRDA 5LMUJ 3O5TB 2FVSA 3C66A 3Q8QB 1VCTA 2CNKB 2HQDA 3T41A 4E2FB 3CMES 3ZTRA 5U47A 1UW4A 4HT7A 4ZVPB 2YNHA 3HVWA 1RISA 2RRBA 2DRAA 1F5AA 3S6EA 2HEKA 2VKRA 1C0TA 4QW9A 2WW8A 2E7VA 2BQ3A 4C9DA 3JQJA 3NBPB 1JXLA 3R5JB 2PFFB 4BDPA 3FQLA 3N6NA 1NSAA 5EX3A 3KHRA 1RHRB 3SMZA 1PBAA 4ED3A 1QSSA 4FBTA 4CLKA 3MMBA 2UUCF 1JLAA 2U2FA 4IFYA 4QWEA 1A0OB 1VRTA 3G87A 2KB2A 4KHRA 5FDLB 2B9YA 4RKUC 2N3OA 1M1KT 5HK4A 3BREA 1NDKA 1LW2A 1UA1A 3DKDA 1RYRA 1B4SA 4NYOA 2AW0A 2AF6A 4K4UA 4DV0F 2RILA 4ETXA 3OLAA 3LALA 2HHHF 2FHOB 4RR5A 3MWBA 1VBKA 3GYXB 3B8HA 3GYGA 3LGHA 5C42B 1FXDA 3L7OA 1X5SA 3FMWA 4U7UK 2AHOB 3OL7A 2B56A 2LQBA 1AB8A 3BDEA 5KFRA 4EZ9A 3K8WA 4K4SA 4HACA 1HR0J 1RAAB 5HANA 4EO8A 4H4OB 3AXKA 5B0AA 2IHR1 3FBEA 3QWUA 4ALZA 1S6PB 2CZ9A 3CO0P 3BBBA 1JNRB 2D41A 3JAMY 2ZE2A 4EBDA 2EEYA 1CJTA 3IO1A 3RB4A 2MKJA 3KUHA 1TKDA 3CJ3A 3PACA 4LBPA 5A6WA 2O67A 5KFKA 1GFWB 3ZZ0A 1FDBA 3MI7X 3CDEA 1BLUA 1ZZFA 3M2UB 1QE1B 1YRXA 5D78A 1RT6A 4YR3A 4DR2F 1BQNB 2D74B 5IOLA 2QL9B 2AP6A 3OTBA 4JI2J 4ILRA 3GIJA 1RZMA 3PY8A 4DF8A 1DBDA 2H5EA 3GLJA 1SKSA 1S0NA 2W7AA 4NLXA 3BB5A 3D0HE 1D0EA 2FPHX 3R1HA 3NCQA 2KG0A 2ZITA 2P9EA 4Y28C 2UV8G 2HS3A 1UTAA 3MHYA 2HSEB 4ZP7A 3CDBA 2VFRA 2FDNA 2R7OA 4YB5A 4ER8A 4UY8T 4O4GA 1H2VZ 4GKJF 2OAUA 3MZIA 2N3LA 1U26A 5HI7A 1X9MA 1EP4B 1TKZB 4CO5A 1Y7PA 2NSCA 1S9GA 5LMNF 2VODA 2GQQA 2RIJA 3DOMA 1MMDA 2VPWB 2HHXA 5KFTA 3BR8A 2EG2A 4BWMA 2QSFA 2YNIB 3JTPA 2YQ3A 3ZZPA 1PC5A 4FZVA 2W7PA 1IN0A 5IXUA 1IKXA 3IMQJ 4OX9F 4UT4A 3DLGB 3TI0A 2DNRA 3QSIA 4H54A 1N33J 4DLEA 2X3GA 2IYGA 5E3QA 3UI3A 1V5VA 1X4FA 1FA0A 4X64F 3FMBA 3I0SA 3VWSA 1HPZA 4PXBA 5L1JA 1HL6A 4C97A 3M6VA 4LVNP 2OUGA 2IAJB 4DL0C 2V50A 2ZZMA 2W2PP 5F3ZA 4CLZA 2JLEA 1BWEA 4YMEA 2FLPA 1T11A 3ONQA 3CCQS 2M52A 2H9ZA 2XNQA 4QWDA 4R8UA 3BF4A 5DLFA 3CC4S 1KHWA 1TTHB 2OGUA 2QGFB 3MPWA 2KM8C 3SFUA 3GIMA 2HVHA 4QOTA 1HD1A 2CQDA 4HH0A 3KLGA 2YNHB 1LEOA 2AX0A 1JMTA 4ZIWA 2DY9A 1C0TB 2DXDA 4QBUA 4CZCA 4IKAA 1F9HA 5GAGU 5DGBA 1FJGJ 4KRWA 5DQHA 1WSVA 4I6AA 5F8HA 1UKUA 4KYZA 1HMVA 3HSDA 3MMBB 4J9UE 1JLAB 4IFYB 3W8PA 1VRTB 3KLEA 1WF1A 4OYOA 1R8AA 2KZMA 2AYMA 1VHFA 2A10A 4DSKA 4CIOA 2QTWA 2BKOA 2MZJA 1D9DA 1TMMA 1S59A 1LW2B 2HHSA 2XHWA 5IT0A 4G1PA 3HI9A 3J81j 5KFYA 3ENQA 1H72C 1UFWA 1T05A 2VFTA 4B17A 1Y9OA 1RAHB 4HACB 3R1LA 5B0DA 5ETLA 1B3TA 2DHSA 2GGPA 2Q6CA 2EK6A 4IO1A 1NK6A 4USTA 3T1YF 1AUDA 1HBUA 3Q8VA 2ZE2B 1CJTB 4C3LA 1WOOA 4Y34A 1VLOA 5J2PA 1PILA 3L3CA 4DQSA 4KPYA 5GADU 1T95A 5HMWA 4KE5A 1CJUB 1RT6B 3U1MA 1R8BA 3TJ8A 8ATCB 4F3QA 3G8SA 1PO6A 2AZ1A 1D9FA 4L3NA 1NK9A 2DB1A 2E5HA 2HHWA 4M1KA 2KRRA 1RT2A 3T5KA 3C16A 2KFYA 1KFSA 2HZAA 2RMLA 1MU2A 2LQJA 2N4CA 2OTLS 5IV4A 2WSFC 3CC7S 2HFNA 3OR2A 1QM9A 3I87A 4F0MA 1RWVB 4O4GB 3TX8A 1N48A 4CTAA 2YQ0A 1TKXA 4PPZA 2XSJA 1HHSA 5KFOA 1S9GB 3PRBA 1Q16B 2CQIA 3CJKB 5KFFA 3DOMB 1ZA2B 3MAQA 3BPDA 1YBTA 2FC9A 1NSKL 1UWAA 4HT5A 3EDQB 5FLXU 2J9CA 5J1NA 3SFGA 2CPHA 2XMTA 2WVEA 3KK3A 3LP1A 1IKXB 1HBOA 1X60A 4OYXA 1H73A 2XMAA 1TK5A 2C42A 4NA2A 2W24A 1AUSL 2DNHA 4A8FA 4N8NA 3FEXB 4DR3J 3FQKA 1HPZB 1A9NB 3IP0A 2IYIA 3RYLA 1Q53A 3ZNJ1 3GZ7A 1LWEA 6AT1B 2N82B 4RNFA 4HYKA 1GMWD 1Q82T 3PJWA 5E2QA 1PSDA 2GVDA 1IBKJ 1M5PC 4R8UB 2I9SA 3R2DJ 5GMKa 3VVTA 2HGMA 1X5PA 1TKTB 1FFSB 1N5SA 3PYEA 2VV5A 1PYOB 2YKMA 4NMXA 4YB7A 3KLGB 4NYPA 5D4LA 1NHKL 4X65F 5J2NB 5D8HB 2XMUA 3GYNA 1LW0A 3BQ0A 4CM0A 3MEGA 3T1HJ 4TNOA 3HKWA 2RH3A 1D9AA 2ROEA 4CYUA 1R31A 2XMMA 4B9VA 1GXTA 2CXEA 4A4JA 2IDLA 4IRDA 3KLEB 2E1RA 2J8AA 4OV6A 3MFHA 2OPPA 2DRBA 4N47A 3H4DA 3M8SA 1FERA 1UFLA 3ILLA 2F7VA 1HBNB 5ETVA 2AKWB 2JSXA 2MLXA 3LF0A 1ZYQA 3CCSS 1VC0A 4ECQA 1RBAA 3D68A 9RUBA 2ZNYA 3BO2A 2EPIA 1T05B 2ASDA 3PNIA 1VQ9S 1YK9A 1HNIA 3GP9A 4RW6A 2ZKTA 4QPXA 1D09B 2FHJD 1S0VA 5K8MA 1HBUB 1ACMB 4QYZJ 2QYGA 3I5BA 3GFXA 2VDHA 5J2PB 2LEPA 2XSFA 3UO0A 4LF6F 3CUNA 3MMJA 4LQ3A 2FZGB 4JP8A 2KVIA 2V94A 4FDFA 4I6YA 1YRTA 2D9OA 3KHLA 5L9XA 3G82A 1HARA 2WVDA 3BM7A 3HSZA 2JNJA 1KKHA 1X5TA 1CVJA 2JFDA 5ETNA 4F04B 2BACA 1RT2B 1U45A 3C16B 4QWAA 1T3NA 1MU2B 2YKAA 2ZWPA 3T19A 3OTCA 2CPEA 2I0XA 1IR1A 2W2QP 1NJZA 3OR2B 4ZCMA 3UVJB 5IT9Y 1M5OC 5A0YA 3FDSA 2M5YA 1VISA 4LRDA 4N8OA 4CTAB 1TKXB 3OV7A 1S48A 4WWSA 2VUGA 3GPAA 2BR0A 3PYFA 1BHNA 4F25A 4C6AA 4IG3A 4DLGA 2ZNZA 2KG1A 4MIBA 4F8RA 3LP1B 1JIHA 3CE8A 1HBOB 3PM9A 3H98A 1WDTA 3MM5A 4ZPAA 4DX8H 4TU8A 1H98A 4IH6A 1ICEB 4KJIA 3M6WA 4JI4J 4NEZA 3FK4A 1GEHA 3CIZA 4WPAA 3QAEA 5A2QU 1LWCA 5KFEA 3ZZTA 2IIHA 4YS2A 1LWEB 1S4FA 5E3PA 4DPUA 1RSCA 4ES3A 3Q2SC 2XMVA 4FS1A 1F5CA 1FRJA 2YKNA 5HAOA 1J5OA 4RW7A 2QN6B 2GVDB 4M5GA 1MN9A 5DS7A 4WTYA 2W2MP 3HHNB 5KFLA 1QAXA 2CPZA 4DSFA 5K9FA 5H9FK 1TR0A 2YKMB 4MYTA 2AJ4A 4K7QA 2VBWA 1JLCA 1TU0B 3CMAS 1LW0B 4OYZA 4CCHA 4JI0J 4KSEB 3TWZA 4QIEA 4RNHA 3CJ8A 3GONA 2B4UA 2CYYA 4TLRA 4YB6A 1T9TA 2X1AA 3CCUS 2XY7A 3PKYA 1A6LA 1FVSA 4MKVA 4CYUB 3G8TA 2C2ZB 4ELUA 4UOCA 2R2SA 4LF4J 5B7WA 4UTGA 4K2XA 1UPMB 4HLBA 1TV6B 3CCMS 1FT8A 3CO9A 1K0TA 3UDEA 4F4XA 2EW9A 4FKXA 1U09A 2G2YA 2XZWA 2DEJA 1FD8A 3NCRA 2CNNB 4PR6A 1FNXH 2Y1JA 3NL0A 3FRYA 2J9EA 1PGZA 4I68A 4OZ2A 3KG4A 1U2FA 5AXMA 1EARA 1WEXA 2RJZA 3SSRA 1JX4A 4LF8F 4DV4F 2KT3A 1HYSA 3W5ZA 1RBLA 4PWWA 4FYVB 4PAAA 1HNIB 2F4VJ 4KH0B 2GMLA 4RW6B 2OH2A 4ZVHA 3QZ7A 4QIVA 4LSLA 4FS2A 4CLFA 2BUNA 2LKZA 2JDJA 2LP4A 4PG5A 4OZ0A 2B6AA 4GKKF 2MTLA 1J5EJ 4O44A 1Q7YT 2E1PA 5KFSA 1DRZA 2XB2D 4NXMF 2DHGA 2L3MA 4DX5A 1SIZA 5THWA 4NCAA 2FZKB 2W9CB 1NZ8A 4RNMA 4D3HA 3DNCA 2O1PA 1U6BA 1HWUA 3IRWP 2XEXA 3G82B 3O1LA 3UR3C 1LFWA 2VQFF 2NYHA 3R9LA 2UZAA 3H8YA 2XM3A 3CCLS 4LSNA 1FTCA 5F8MA 3KDNA 3TQ1A 3N4WA 2ZWOA 4DHVA 4RNNA 2QE5A 4FKYA 3ET6A 2IDEA 1NCLA 4CO4A 4DV1F 2BJDA 5A0YB 3R5CA 4DSEA 3I55S 3RR8A 2VBYA 3HHDA 3B82A 2HFOA 2QYCA 1FEHA 3NRBA 1KS2A 2C2RA 1WC5A 3Q86A 2EFPA 2MGZA 3CMQA 1SL2A 3HKZD 1QD1A 4IG3B 2GFFA 4HHJA 4LREA 2VONA 3J80U 3ZZUA 2V5HG 3BGOP 3MM5B 3NOGA 4OI0A 4NCBA 1U1LA 2HHPA 1SQGA 2I2YA 5D0HA 3KLFA 2WK4A 3PW0A 3PYGA 2MQ8A 3EYZA 2ROPA 3P5TL 1LWCB 4C48A 1NBEB 2AJ2A 4F50A 4OX8A 3BN7A 4HHUA 4LF2A 4DWIA 3PDNA 4KAIA 2HHHJ 2IJRA 3I9ZA 4IH5A 2YKNB 1J5OB 1EKSA 1YRUA 3MEEA 2AYBA 3US5A 4DR6J 4PKDB 3AJDA 4N56A 4C7QA 3AA8A 3G96A 4P7TA 4PEOA 2EWHA 1KLMA 1XMQJ 1JLCB 3AODA 1HQUB 2E5LF 3PEJA 1NJWA 4IRKA 2ZZTA 4CQ1A 2DIUA 1U0HA 4LFCF 2DISA 3L4BC 2VL1A 2V2KA 4QPTA 2A3JA 3CCJS 1FWKA 4Y2AA 2F5GA 4YHHJ 4DCPB 1NEEA 1O6XA 5KOXA 1B0TA 5EWEA 3T5JA 4PYDA 3THPA 5KT3A 2DGOA 4PUOA 1Q86T 2IA0A 1NMEB 2DO4A 3DHXA 3OFEA 3EGZA 1GX5A 4R0EA 2J6SA 3L7PA 4YR0A 1XNRJ 3T9NA 2HPUA 2MQPA 4KB7A 3VGVA 5D0EA 3M4XA 2HWTA 5I3QA 3CD6S 1WC4A 2OLWA 3AOCA 2CQHA 3I6PA 2BX6A 2ZD1A 3KJNB 1HYSB 2LDYA 3HXMA 4X4RA 2UXDF 2HK2A 3EZ5A 1HD0A 4BHQA 3GB0A 1FVQA 3RAMA 1RADB 2HG4A 5LSOA 3I9V9 4LSLB 2PI4A 4DR1F 1SKWA 4Q8EA 5ETOA 1WF0A 3MM7A 1YJRA 4V1Ak 5J1EA 3UNGC 2B6AB 2VHGA 2RDDA 4O44B 3ZZOA 3B78A 4FN5A 1KLNA 3OPKA 3MF5A 3UPFA 2BEFA 4OX9J 5GAHU 2LQ9A 3M9OB 2ABYA 4EYHB 1LXJA 2QL7B 4V19X 1U7LA 3IBCB 3EVWA 1WKKA 4ZJLA 5L1LA 4LSNB 4X4OA 4FYYB 4U8VA 7FDRA 2ZH4A 3B4MA 2C2NA 1TQLA 3KLVA 1FRHA 4YUDA 3CD0A 2WSCC 3ET6B 3GTYX 3GIKA 3NAHA 4AYBD 2YKOA 1XERA 5D15A 4A8MP 2YVSA 4DUZJ 1TFYA 2D3O1 3CJ5A 2ADBA 4ED0A 4H4KC 4G3IA 3S7RA 2OP5A 3ADAC 3PW7A 4B9UA 4ZCKA 2MGZB 4JV5J 1E6VA 1WKLA 2J0WA 4LBHA 2CKWA 4NYZA 2CQ0A 1TUGB 1D8YA 2GX8A 5C7PA 2UVWA 3IC1A 2B9WA 3ZO7A 3GCWP 4M94A 4QU6A 1UP1A 1S0MA 3KLFB 1RJJA 2DNYA 4DUYJ 1DQ8A 4M5KA 4LFAF 2AV5A 3CTRA 3AB2B 1VQPS 2NXNA 4YFUA 4KGKA 2GCFA 1B99A 4YP3A 3VAMA 4L76A 2YPZA 2VG7A 2WVBA 2Z0GA 3DMJA 2QSWA 1Y00A 1I51B 2GMJA 3MEEB 3TJ9A 4DV5J 4ED5A 4DFJA 4TYBA 2HIQA 5IC6B 3OW2R 3OFGA 3H2VE 1B0VA 2EFQA 3CJ2A 5HROA 4X66J 2HRTA 3THVA 1LQ9A 2C3OA 1YLXA 1KLMB 1N0VC 3VGUA 4LF9F 1EHWA 4YY3F 3T1YJ 1S0OA 1FX4A 3QYYA 4BCAA 2LECA 1U0HB 4R5PA 5A6PA 1VQNS 2BE9B 2WVFA 1M5KC 2KKHA 1RTZA 1TFWA 4ED4A 3TA1A 2D69A 2NZ4A 3PKMA 3NEKA 2KO1A 2HVDA 3O2IA 1I3OB 4Z37A 3LP2A 3AOBA 2BJ8A 2XTJP 3W66A 2UUAF 1IR2A 1WG1A 1XC9A 4PUOB 2R4FA 3CPWR 2H3EB 2OTJS 4C0OC 3U1LA 4UF4A 1D8ZA 3SSQA 2HYIB 3K5LA 4DL5A 1UEUA 5LMUF 3U1NA 2XZDB 2ZD1B 3OBIA 4MYUA 2QL5B 4CLWA 4DSLA 3RTVA 1WHXA 5E41A 4G1QA 3NGTA 1YITS 3HX9A 2MKSA 3G86A 4Q45A 1VRQC 4ATNA 4NLWA 3R2CJ 3CGIA 2R2UA 4LQ9A 4RW4A 1NB2A 1H2UX 3TAPA 1DQ9A 3MM7B 5EUHA 5J1EB 4Y2KA 3U7JA 3Q24A 1F9EB 1VBZA 4USMA 3M32A 4DQRA 3Q0AA 2DR9A 1RT3A 1VQ7S 1UW9A 1NUEA 2APOA 4MMOA 5EWFA 4DL3A 1W25A 3IS9A 1EETA 3JQKA 2GQ2A 3M2RB 1RK8A 2BE7D 2COLA 3TZXA 3W60A 5A2QY 3Q83A 4P71A 2X7IA 2F8EX 4LR8A 1HR0F 2B4VA 1RT4A 2FLOA 3TRGA 3H7HB 1M90T 2RSQA 1SCJB 1FD2A 5KFXA 3VQTA 2XZTB 5L8RC 2QRRA 1BWVA 4A8YA 1WC6A 4W98A 2WHOA 4P2SA 4ELTA 1M5HA 4WFXA 2OMLA 3CCWA 1K1SA 3K5NA 3CW2C 1JB0C 1SJ4P 2P9CA 1E6VB 2FD2A 1NH7A 2KRBA 2K06A 1YVFA 4NLOA 4W4MA 4OYAA 4CO3A 1L3TA 5I3UA 3EE3A 1SXLA 3ELHA 5E3CA 4JI2F 1S72S 3DC2A 3W61A 1Q0NA 3SCLE 4GVLA 2NLWA 4ZHRA 2PEBA 2WCXA 3MR3A 1NPKA 4OHZA 4L72B 4XPEA 2JVOA 1VQ4S 3E8OA 4I0WA 2PA8D 2D3OR 3ISND 3AA9A 4ANCA 2VG7B 4NOHA 1P9QC 2LA4A 2POKA 2FJAB 4CH0S 2B43A 3R5DA 2MZQA 3RBZA 3EPIA 1QSYA 4ZP8A 2CIMA 2LU2A 3PFOA 4JUZA 2XWXA 3J81U 2IFXA 1Y3KA 1GH8A 2Z57B 3UFCX 5HROB 2DNKA 4AL5A 3D1OA 2VOPA 3HM9A 2VFVA 4RL1A 5F3TA 2BA9A 1HFEL 2R7UA 1Q78A 5AXKA 4NMLA 2OSQA 3SCJE 3CIMA 4N5SA 4R5PB 2R7XA 2PIIA 2IBKA 4LUBA 2Y3YA 2DNZA 3G2XA 1HWIA 3NGDA 3DLEA 1VFJA 4MJKA 5KFIA 4JYAJ 2VIHA 3LP2B 4F02A 1T94A 1NJYA 3D28A 2DGVA 2CZ4A 5H9FJ 4KQZA 3BGRA 3ZZRA 2QT7A 3NWGA 4KPCA 5F9NA 1QLNA 3IBWA 4ZPBA 4MKYA 3M7VA 1ZM3A 3UNYA 3ILOA 1BGXT 3OSNA 1CC7A 1OPIA 3MD3A 2BZ2A 1XMOJ 5CYMA 4AXJA 5KG0A 3GG0A 2ATLA 2V8HA 2W4CA 2WBMA 1KQSR 1DTQA 1GX6A 4G1QB 1KSPA 3BSCA 2QFIA 1G3OA 4LBIA 2HQ3A 3O3LA 2HGNA 4KO0B 4USWA 3C14A 1UVJA 4URSA 4RW4B 4ED6A 3NAIA 4GO5X 4UW2A 1FJGF 4FF1A 2CG4A 2LQ5A 4DN0A 3AQOA 2P5VA 3H90A 1VQLS 3M05A 4AQYF 4WP8A 2LFVA 2R2RA 1RGVA 2PEHA 3MUMP 1FKPA 3MAAA 1U48A 3M32B 3I5CA 1K44A 1RT3B 4JI3J 2A18A 3EGVA 5IWAF 3QO9A 2YH0A 3KK1A 1NPRA 3IS9B 1EETB 1JQGA 3BDPA 1C1BA 3CCTA 3LW5C 2DY1A 1ZAWA 1T9UA 1RT4B 2XNRA 2V8DA 3GQCA 3VR1A 1P27B 2HZCA 2YWGA 3GMGA 4FYDA 2RDJA 1VOMA 4F2RA 4WZQA 5CZXA 4FBUA 1SH3A 4QR0A 1VYAA 2GHVC 4M5DA 2GHPA 3TUZC 4Q44A 1OS5A 2OJ3A 2LU1A 4KKOA 2AX1A 1JJCB 2IC3B 2MJNA 2LLZA 4A48A 1U0SA 3N79A 1JNZB 3A3NB 1S12A 4O4RA 4ZHRB 3DYAA 2E44A 4IR9A 5KFHA 5CD4A 2R42A 2GS8A 2PSZA 3EVOA 3QBCA 5G0RA 2NZCA 4N77A 4MKAA 3FFIA 4WKYA 5RUBA 3WX8A 2IM1A 5GAEI 2PI5A 3RU0A 1OQ6A 4X4SA 2Z8QA 3DRSB 4NWBA 1RHQB 1RTHA 3BKUA 4OJGA 1ZM2A 4USUA 2I6WA 2HBQB 1RT7A 2Z56B 1HI0P 1YI2S 2L9WA 2R8GA 1R6YA 1WD6A 4RZRA 1XMBA 4S0MA 4WTOB 5ETRA 2DVIA 2ILZA 3RR7A 4GKKJ 3TJAA 4O0NA 4PG6A 3D6FB 4CLUA 5F9LA 5IZHA 2FLNA 1NKCA 3JSBA 3BBFA 4I67A 4IO9Q 4NXMJ 2V9WA 3VAFA 1AA1B 2M7SA 2Z2MA 2OIHA 3DLEB 5KT6A 4DR3F 1Y0HA 2Y1RI 3VZIA 2FLLA 4PZVA 3VHQA 4B9MA 2V69A 3OXGA 2IVFB 4LFBF 2ZBRA 2NXJA 3BGRB 3ISZA 1Q8IA 3K59A 2VQFJ 2ZC4A 2W9AA 4Y0FA 3K2YA 1UEVA 1FRLA 1UAWA 3GR1A 1IBKF 3AAWB 2EFOA 2QMUB 2JVRA 2GAHC 2JH3A 3SDEA 4Z2XA 5HMZA 1CJKA 1APSA 4EO6A 4XIUA 3ZFVA 1DTQB 4DV1J 1SIWB 4RBUA 2NUUG 2A6MA 5L38A 3KUEA 4KHPJ 4QIWD 3Q22A 5CYQA 3C14B 3T1HF 4ZN3A 2YX1A 3GR0A 4KGMA 3R6LB 2MKHA 2M4MA 4P2MA 1H2TZ 1UZDA 1XK8A 4PXDA 3QT5A 4TY8A 2MLYA 1DAXA 4ILMA 1ZA1B 2PD1A 2ZOFA 4JB8B 2IRYA 2UUWA 3N28A 3V6HA 4C8YA 3MAAB 1PYTA 1EAYC 3QAUA 3Q8YA 1ZM4A 4FF4A 1WOSA 5C2GA 4CO0A 3QPIA 3P45B 2HNYA 1C4CA 3OJSA 3QO9B 2HS4A 1RABB 2G9OA 1FK9A 1UJ5A 2WSEC 2RAQA 3KK1B 4P72A 1C1BB 2RVJA 4ID5B 1S1XA 2VQEJ 4P6QA 2OPSA 1PAUB 1TUVA 1VQOS 3OLBA 1QTMA 2G1DA 1GT8A 4DR7J 3GJQB 5DQIA 3A3OB 5DDQC 3RBDA 5BXIA 4EI2A 3G6YA 3JB9k 1B7FA 5B0FA 3OUYB 1IXKA 3HSGA 1ZM9A 3MAHA 5D77A 1JXVA 3NS7B 3MPDA 3BV8A 2EKYA 1PJ7A 5DO2A 4M5DB 2OPQA 2PT0A 3TANA 1VBYA 2ZUGA 3IN5A 2F40A 3BGUA 3W5XA 1UETA 3MCOA 4KKOB 3QGHA 3NNHA 4C8KA 3IA0A 4FPIA 2BM1A 1IM6A 1DFDA 1OY8A 3A13A 3QFHA 1SH0A 4USHA 2HW3A 1U49A 1LXNA 3DYAB 2PGCA 1RT1A 3G71S 2HFUA 1VRUA 2LQ8A 4DS4A 4JI8J 1IVZA 5B0CA 3FFIB 4NLVA 4EBCA 3D6TB 1KFDA 1RWOB 4ZVUB 3FCHA 3G4SS 1BC6A 3BYPA 3N9UC 4J7CA 3PIPQ 5CHCB 1ZAVA 2CJ9A 2K1RA 5M2PA 1N5VA 1RTHB 1BE4A 4ZJQA 4RW9A 1RWNB 3HK2A 3LGNA 3GJSB 5DDRC 3SI8A 2J0XA 3T5LA 1K47A 2EG1A 4LT6A 2KDOA 4MKBA 2H65B 3H42A 2HMIA 2XMJA 5B0EA 3DHWC 1IBCB 2RQMA 4NZ6A 5LT5A 4J90A 2J76E 3D67A 4DQIA 3P5BP 4FNIA 1YZ6A 4IOBA 1IUJA 1I5OB 3I5AA 3GJRB 1Q1KA 4CDIA 2XQCA 3BR9A 2Z4PA 1SV5A 4X84A 4DOZA 1NO8A 1CBKA 3MD1A 2ALYB 4HR2A 3CB4A 2XO7A 1N6QA 2QLJB 3LA0A 4ZCIA 2FUG9 3FKBA 1F2GA 3VAJA 2HBZB 3NG8A 1C1CA 1SL0A 1WHWA 2B9XA 1U47A 3R5BA 3M8PA 3QT7A 2I5JA 3MDFA 1R3NA 3SDEB 5A8RA 1P8GA 5MAOA 3NGUA 3VAHA 1CJKB 3D2WA 1KEKA 2E5JA 5AJ3J 4M5LA 1I94F 4RBVA 3RB6A 3G6ES 1CULA 2CWKA 4JI0F 2QMWA 2GC8A 1VQSA 5CYQB 4DG1A 4NZ0A 1NXIA 2DH8A 5KG1A 2ZDPA 3OTOJ 4LRBA 5FIIA 3GFYA 3I4PA 1SJRA 3MPUB 4LF4F 4TY8B 2IJFA 1IR0A 4QYRA 1IKYA 1C0UA 1KHVA 3TNVA 4M8LA 4Q2LA 4NLQA 2E1MC 3GIRA 1P1LA 2JX2A 2D3ZA 4ZVFA 3W9IA 4WP9A 2HNYB 4NLPA 1YDLA 1LK7A 3R27A 1T9YA 4K50A 2CQ2A 1FK9B 2K7KA 2XCAA 1U2CA 1FESA 2FVCA 2K2PA 4FYXB 5GMDA 3BO3A 3ISNC 5KFVA 3A3PB 3IBFB 3D1HA 1RAGB 3ZXWA 1S1XB 2OPSB 1RBOB 3HPOA 5T7LA 4K5RA 2CG8A 2RRNA 5B0GA 2AJFE 2DR8A 5GAGI 4M5IA 4WIQA 5D4PA 2F4VF 1T0TV 1G4CA 1N4LA 4ETZA 2MY7A 1NZAA 5MLCV 1HNVA 4PCQA 4LF7J 5F8JA 3EXCX 4YY3J 2UUBJ 1VC5A 3CCRS 1J5EF 1T7PA 3D3CJ 2KJWA 1WACA 2OPQB 2RU9A 1OYEA 5KT2A 1X31C 3VF0B 1SJQA 2C28A 2F1FA 3UD4P 1NK7A 4FXDA 3IAS9 1TK0A 1NRKA 1RHJB 3MFIA 5KFMA 4YEAA 4WU3A 6FDRA 1TUWA 3M1VA 2MMYA 5EGYA 2ZVSA 2H51B 3K89A 4U67Q 1XIQA 2M0GB 4HL9A 3AXMA 1CC8A 3J7YI 3EZOA 3TUJC 2FZCB 3VGTA 1RT1B 1S1VA 2DR6A 2NXCA 4DZDA 2YWWA 3OT9A 1Y3JA 1OSCA 4ZCLA 1Z2LA 2J8SA 3GCXP 3MCNA 4QZVB 3TX0A 4ZPWR 1ELOA 4Q0BA 4F3MA 1LOUA 4KGVB 1HNXJ 2AMCB 3SQOP 2UXBJ 4RW9B 3TUIC 1XBWA 3FSXA 2BJ7A 1QAIA 4TY9A 3V81A 5F8GA 3NS5A 2J7WA 2DGUA 3QRRA 1R0AA 1S6OA 1PKUA 4J9KA 2HMIB 1S9EA 2DNQA 4J9RA 3DXSX 2JEGA 1OQ3A 5KFBA 2E9ZA 4PWDA 5DDPC 3RUBL 3PO5A 3D4JA 5F0UA 2E29A 1WI6A 3HVAA 3C6TA 2P8IA 2FHKA 3LANA 1UVKA 3HDSA 2UP1A 3EXYA 3I32A 2HFZA 1IWAA 4ZPTR 1SV5B 2JC0A 3MEDA 4PABA 1GMVA 4H4KA 1I1GA 3QJLA 3IR7B 4UOFA 2I1RA 4OHVA 1CG2A 3DN9A 4KR0B 1VJQA 1VK3A 4USJC 1N6QB 3HT0A 3IFEA 4DSJA 1KD1T 3DLBA 3HZGA 1HQ2A 1WHVA 5CXTA 3LOUA 2K3IA 3B4DA 5KG7A 1XWLA 2VF3A 3M8PB 3TAQA 2I5JB 4DR6F 3MCSA 3CJSA 5A8RB 2VPZB 4ZLNA 3GFZA 4USKA 1EKRA 2YX4A 1XMQF 2C2KB 3C2PA 2CWXA 1CULB 2NUHA 9ATCB 3PV8A 4DG1B 2CQGA 5EDWA 2RNEA 2W01A 1VK8A 4K5SA 3BS9A 1S79A 4YHHF 2M88A 4UY85 3V2UC 1BD6A 4B9NA 1LNQA 3RGIA 2E1AA 2DGQA 3PIOQ 4JI1F 1IKYB 1C0UB 2MEWA 3E51A 2VICA 2DGSA 3MR7A 3D7SB 4DR4F 4I64A 1XNRF 1D1UA 4RPFA 4WK1A 3RRKA 3HVRA 5HVFA 3QQCD 1X4EA 1KVKA 3MM6A 1I6JA 1URNA 5T7LB 4BBYA 1VLYA 1T3OA 4ED8A 1RKIA 2O3DA 3M6UA 4J9SA 2B8PA 4C11B 2VA3A 4P10A 1T03A 4U6PA 2C3MA 1Q8LA 2VKZG 1N5QA 2B3TB 3M8ZA 2FGOA 4DQPA 1S57A 4DU8A 3ZZYA 1RP5A 2IVYA 1Q8KA 1YJ7A 2KFNA 4YOEA 4DV7J 4B3SJ 4ZVEA 3L9ZA 5KG4A 3E01A 4RUCA 2CPXA 2CJKA 3SCKE 1RWWB 3M1VB 4NLYA 3MTJA 5KOWA 4U7UD 2BQRA 2PA3A 4I7FA 5KG3A 3VVUA 3VTIA 2QLXA 4KBIA 4MK7A 1QAYA 2QJ3A 1BQXA 4M95A 2QEXS 1R89A 3R7SB 4Q0BB 4L6V3 1ITPA 4LSZB 2H1YA 5HP1A 3TVZA 1PYSB 4DUZF 2PMZD 3ZTSA 2DO0A 3V81B 2G0CA 3NKYA 4X4UA 2RF2A 3QFWA 4K4YA 1N5YA 4IR1A 1S9EB 4JV5F 2ACYA 1YJTA 4WFAQ 2M9KA 5L39A 3F73A 2C2DA 3CC2S 1U6FA 4ECSA 5CCMA 2AGPA 4JOUA 5K14A 3C6TB 1RT5A 1RCXB 4AQYJ 1REGX 2GZOA 3KJFB 5KFDA 1GK8A 3U02A 1AROP 3PX6A 4IOAQ 4K0KF 4DUYF 2W8LA 1QUVA 2FIUA 4FYWB 1IKVA 2V34A 3BQ1A 3SCIE 1HWLA 4X62F 2HNZA 5IWAJ 3ENVA 4NASA 4P74A 2DNNA 4UZBA 5BJRA 1U1OA 2JWNA 3SEOA 1VGYA 2HQCA 3D6HB 1WKJA 2XGPA 2JEIA 4NX9A 4DV5F 2X3DA 1NDLA 5B09A 2KXHA 4X66F 3BH7B 2B9EA 1RTJA 4I4BA 1R27B 5DQGA 1XQIA 4ZN1A 2CDQA 2ZH5A 4ZPDA 4N76A 5D6GA 2ZJRQ 5A76A 3UD3P 4DL2A 3RAQA 3L95X 4C8LA 1NK8A 3C19A 4QIFA 2H4WB 1WOPA 1YJWS 3IWNC 3R8YA 4IG0A 1EQ0A 3UDLA 3TO8A 3C6UA 3U27A 3W64A 2QX0A 1V9OA 3W9JA 2MKIA 5B08A 4KIAA 2NSBA 1VI7A 4CLPA 3C15A 4P9SA 3JYTA 3NGKA 4NEYA 4JI7J 2V9KA 4PRFA 1L3UA 3HHKA 2B0GA 3AD9C 1F5BA 2IVMA 1GTEA 1LWFA 3JTNA 3DDNA 3MM6B 1B7YB 2AT1B 2AGQA 3H59A 3BKTA 1SJ3P 3IR5B 1HIYA 3MECA 1CS4A 5CYJA 4WP3A 3IG1A 3K5OA 2VC1A 2U1AA 4JI5J 2IM0A 4ICLA 1FDDA 4EFAC 3GWCA 1T03B 4EU0A 3UD5A 4P2FA 2DHHA 2CADA 3WQPA 4NLGA 2LEAA 3WHIA 4QR2A 4ITSA 1JXEA 2CQ1A 1W2IA 1ZPVA 2IMOA 5I4MA 1Z2ZA 2WTFA 2XMKA 4E98A 2NQPA 2A0FB 1IBMJ 3E01B 1UMJA 4Y2CA 3VZHA 4Y3CA 2H4YB 2ADCA 1U6ZA 2MQQA 4BLGA 1HNWJ 3O8WA 4F7VA 3A8EA 1JJ2R 2XY6A 1H7XA 4CLSA 4KTQA 4K4XA 4IQMA 2H54B 2Q1LA 2R8IA 3I0SB 1LKZA 4OI6A 2CPFA 4DV3J 2EBEA 3NXZA 4OHYA 1RDRA 4LFBJ 2EFNA 1PIEA 4I7FB 1N36F 3NY0A 2BRLA 3K0JA 4CNZA 4J5OA 1OYDA 3QIPA 5D4NA 5HQLA 1YKWA 4PG7A 3MOJB 2CNLB 4ZVRB 1NH8A 3QLHA 5HBMA 5IC4B 2MPUA 3PW2A 5IT4A 5HP1B 3R6GB 4A8QA 1IJEB 2R8KA 2J0QD 1R43A 1R6VA 4TU7A 3CCES 2RF2B 4UQTA 2MZRA 1G2EA 1Q79A 2M8HA 2QIFA 3P96A 4K4TA 1FJ7A 2X1BA 4KT0C 2HQGA 5DM7Q 3BSAA 2VFSA 2VB6A 2BOAA 4A46A 3PXGa 2W2NP 4GC6A 1CQMA 4A47A 3CJQA 2DPJA 2XYPB 1WTBA 5K14B 1HMVB 1VR6A 1RT5B 3BPSP 3D3BJ 1ZPWX 3BGLA 1P6TA 2DHXA 3BGFA 1IKVB 2Z2YB 4C3KA 2BJ1A 3LWMA 5H9EK 2JHEA 2ZH8A 3N6LA 2RQCA 4AXIA 4F4AA 1SQFA 2DITA 2G2OA 4OYMA 2EXUA 1DY3A 4KV8A 4W90B 3RJMB 2BANA 2ZBIA 1RI7A 1F3VA 1MSWD 5JMNA 4FXVA 5F8IA 2P6TA 2GGPB 2H5JB 4G1IA 4XAKA 1RTJB 1O8BA 4C3MA 1WEZA 1YJNS 3W2VA 3W3SA 4OYBA 1PCAA 2CAJA 4A8WA 1IQZA 4QQBA 2NR0A 4WYLA 1OY6A 2ALZA 3CJ0A 5HSPA 3MGJA 3OHBA 1ULRA 3DOLA 5DLGA 3SV3A 4HH1A 4RBTA 1RAOA 4AD6A 3HCXA 1AFIA 4IG0B 4ZLLA 4CWBA 3C6UB 2XBPA 1VQ5S 4JYAF 1RHUB 2RDIA 2R7QA 4KY3A 4ZVTB 4I69A 3MR2A 4ZP6A 3C15B 3TVKA 2QZ8A 2BQUA 3D1QA 2C2EA 4DV2F 2G2ZA 1LWFB 4DL4A 3W63A 5KFUA 1FEEA 1ZTWA 3DI6A 1XMOF 2BDPA 3MECB 4DCJB 1U1KA 1CS4B 4HDGA 1DZ5A 1UVMA 3NNAA 2V2VA 1ZAXA 4X4QA 3CJ4A 1WF2A 3PVXA 4ICLB 2DT9A 3TEHB 5K8NA 4M5HA 3X3UA 2MDAA 2XSJB 4EZ6A 4NI2A 4TLQA 2FJVA 2J7UA 4CO2A 4L74A 2X1GA 4P75A 3ZTOA 5D4OA 2R7WA 1BUXA 1HWKA 1C2PA 4U96A 2GV1A 2RU3A 3JSMA 1U1QA 4C8ZA 1VMBA 3KK3B 3ZZZA 4ZLPA 1AT1B 1YSJA 4C0HA 1X4DA 4JI3F 3K8VA 2G0JA 4O0IA 1TMJA 2MQOA 2CQBA 3BH6B 5I3PA 4F2SA 1NK5A 3F44A 3ILIA 4J9OA 3MURP 2DGWA 3QIPB 5F8NA 4DPTA 4UOHA 2AGOA 5HBMB 3QLHB 5KG2A 1XNQJ 2MSTA 3POTA 8RUCA 4EGLA 2ILYA 5F41A 2JEFA 1QE1A 2VFUA 2OFGX 5IV3A 1L5UA 2J0SD 3DDIA 3H20A 4C0BA 3I56S 2BKNA 1R0BG 2ACMA 3LUYA 1I94J 5HQ8A 3EGWB 3CVKA 1RE1B 3MEGB 4I6WA 4DBQA 3UE2A 4PXEA 4RW8A 3Q2TC 3PRDA 1U02A 2CQ3A 2XC9A 4J9PA 2D1CA 3HSJA 3TOQA 1GXUA 2VD3A 4Y2IA 2XS7A 1RCOB 2MZTA 2PMWA 1TP7A 2OPPB 2ZH2A 2IJNA 1EP4A 1TKZA 4M5MA 1MMNA 1RHKB 2YXLA 1OSDA 3HULA 3KG0A 1DQAA 2YNIA 1ROFA 2F63A 4KV8B 2MQNA 4NA1A 3HHLA 2NYIA 1RU1A 1OY9A 4U8YA 3MMCA 3DLGA 3Q8UA 2V68A 1UFKA 2CZVC 3PEHA 4ZJOA 4L75A 3W2VB 4ZPVR 2O66A 2L9NA 2GA7A 2MZSA 3M8RA 2CPJA 3EDRB 1WI8A 1RB0A 2MLZA 1FRMA 2G13A 3S1TA 1YHQS 3KG1A 2BRKA 1F9FA 3DOLB 5LJ5Y 3C8YA 5IT9U 2FVRA 3LQVA 2YWKA 1IM4A 3CCZA 2GHWA 4IH7A 4RJVA 4AL7A 2GIQA 1NSQA 1RU2A 3PW5A 1GQEA 2WB1D 4OHWA 4P52A 1TELA 3QSYB 1NJIT 3AJ1A 2AYEA 3DI6B 1SUQA 3UWTA 3KLIA 2OI2A 4NPOA 1Y4ZB 3I0RA 5L46A 4DL6A 3SIPB 4P7VA 1HA1A 4ZDNA 1QTNB 4KHPF 2UVRA 2HQFA 2W9BA 2JRSA 5JVGQ 4NI2B 1SPBP 4I2QA 3A8JA 3HZEA 4B9LA 4C8OA 4G6VB 1ZETA 2HLUA 2YBVA 3JSMB 5EX0A 2LA6A 3I4HX 3JQMA 2N7YA 2DYAA 4UUXA 3W8GA 2A1BA 3GFHA 5JJBA 1WNEA 1RLCL 1RWPB 2Y1LB 4OYPA 4ECVA 4AL6A 2QLBB 4RX6A 4QIGA 2IBOA 3OTEA 1RXOB 1XR5A 2V4JA 1N56A 4CI0B 2OKQA 2R7VA 8AT1B 4I1TA 1H0HB 2OEJA 4PG8A 5A8WA 2PFDA 5DG7A 4R25A 3QGGA 2VQEF 2HWHA 3G6XA 3C3LA 1N32J 1R8CA 2Z2LA 4RW7B 4OYWA 4DN9A 2WW4A 4DR7F 3K17A 2CVIA 3GV5B 2XHCA 3POTB 1UL3A 1TL3A 3ZTQA 3NMRA 1CJUA 2LMIA 1UVNA 1YBUA 3MUVP 3K58A 4AT1B 3GE9A 2DGXA 2LEBA 2HHUA 2QA4G 5HJXA 1RWKB 2YWHA 2CQPA 2J6TA 2DR7A 3LAMA 3BEGB 4Q7AA 3WC2A 3F56A 1HNZJ 3HD1A 5JXSA 4RW8B 4MH8A 4WKRA 2YNGA 1HI8A 1HHTP 3MTKA 3BKFA 3UCZP 1WEYA 2FJBB 4F4ZA 4UUWA 3W65A 2SXLA 3K7RA 3GV7B 2DBBA 4JI1J 2CPIA 2R8HA 1KTQA 1AZSA 3NMAA 2ZVIA 1YGYA 4URGA 2V8GA 4DR4J 4YB1P 5ETSA 1FO1A 1YBAA 4JI8F 1M5SA 3PJ9A 4ANDA 2BBEA 3HJVA 1KBRA 5C5JA 4ZOSA 2I38A 3CJKA 1N0UA 3TZWA 3W2WA 2V4QA 1PC4A 1F0XA 3R5AA 2LXIA 3HFVA 2MYFA 4CT9A 3HHLB 3VAKA 3RRHA 3Q89A 1T8EA 1J27A 2V67A 3VQSA 3MMCB 4OZLA 3AD8C 2YQ1A 4JI6J 1KRPA 3QZ8A 2DD8S 3LPEA 4UZCA 2V8VA 3TAMA 4F0HA 2EBGA 2QLFB 4AE5A 3KMSA 1MROA 3GV8B 2R9LA 1TL4A 3E2EA 3DLHA 5I42A 3FRZA 3HO1A 3VV2B 5FLXY 1O5JA 1WORA 4NL5A 1C4AA 4A8XA 1U4BA 4YDDB 1SVDA 3SQGA 1NHVA 1TKTA 4QWCA 2LCWA 2PE8A 2B5JA 1KQGB 5E33A 1UWBA 5J2NA 2YWEA 3D5MA 2KYZA 3CJTA 5ADZA 3NNCA 3D9BA 3IRXA 3KTQA 1SUQB 3KLIB 2OPRA 3I0RB 2XY5A 3NGSA 3FSIA 4CLLA 3P6YC 5AJ3F 4BC9A 5AE2A 3HLUA 3EPGA 4AUKA 2RD5C 4WJBA 4B3MJ 5F0WA 2W9BB 2XMWA 3LH2S 4I2QB 4WU2A 1S1WA 3DDKA 2BJEA 4OX7A 1MMLA 3FEYB 4WXOA 4X2BA 4E8UA 3VAGA 2ASJA 3OTOF 5AE3A 1HBNA 1UVIA 1IKWA 4DDFA 4DL7A 2Q3PA 3P4UB 4F36A 1S9FA 3WIUA 3OFFA 1AFJA 2YX7A 5DJBA 2KL8A 4X4PA 2ZHBA 2XG8A 4QJVA 4K0KJ 1SI9A 2VPYB 3J7YU 4ED7A 2V4JB 4USVA 1SB6A 3VCDA 3IR6B 5IM0A 5K5MA 2E66A 5A8WB 4X62J 2IRUA 3OXLA 4XDDA 2J6UA 1DURA 4M63A 3QIDA 2GVZA 3DU5A 5L1KA 1SC6A 4FVMA 1TL3B 5E3RA 4HDHA 5J2QA 3BN4A 4C2MA 4LF7F 4U95A 2HZVA 2UUBF 4ECWA 4WFNQ 4JV1A 3F41A 1X5OA 2PDAA 3TW0A 2EKNA 3CWJA 1F6TA 2KXNB 4BWJA 4NCGA 3Q8PB 2CJXB 3H5YA 1WELA 2Y0SD 2YNGB 2XI2A 3QGIA 1RKJA 5ETPA 2Y8WA 3CT9A 4B9TA 5KFAA 1VQYA 3H0PA 2FQQB 4A8KA 2UUTA 1AZSB 3UVJA 4DV6J 2JLFA 3JS9A 2I8EA 5HLFA 3UCGA 1WG4A 3FCWA 3OL6A 2QA2A 3W2WB 1SJFA 2L08A 1KC8T 1RA6A 2KT2A 2BM0A 1HNXF 2HKEA 4LRAA 4OI1A 2ZJPQ 2UXBF 2L9DA 3NOCA 4HTJA 3EICA 4LJMA 1X4AA 2RQ4A 3RRGA 4HKQA 2DJWA 4LF1A 2Y9HA 1L3SA 3QT8A 1IBLF 3ZTPA 5BR8F 1AW0A 5GMEA 2GJFA 1V5IB 3TAMB 5H9EJ 1LWXA 1KQFB 3TQEA 1MROB 5K8PA 1QJHA 2Q6BA 5I42B 1CPZA 2M70A 4TQSA 2R2TA 3TZZA 1T02A 3AB4B 3WZ0A 1JJHA 4WXWA 1R8PA 3SBMA 3DFEA 1VBXA 3IGNA 1ZS6A 4NLDA 4HVZA 5C25A 1EQMA 2D9PA 3SQGB 2Q66A 2D7SA 2B5JB 4V19J 4Y65A 1UWBB 3O44A 4QW8A 1N36J 3QNWB 2W7OA 5ETQA 5B0BA 2HBRB 1K0VA 3M9NB 4LF5J 2KU7A 3IRXB 2XLIA 1S97A 2VU5A 2OPRB 1IJFB 2ROGA 4GMKA 5A8KA 1JLQA 4K4WA 2NPFA 3M8QA 4XTTA 1UCNA 3PJXA 2FHMA 1EB0A 1TV6A 5KG5A 3DRPA 1S1WB 2QC3A 2NREA 2C3UA 2WBRA 3GG1A 1EJ7L 5ETMA 1IKWB 5LXRA 3Q8SB 5KFWA 2AU0A 5K8OA 1KR4A 1H6KX 1K1QA 2IMWP 2IM3A 3PR5B 5ETTA 4YN3B 2RKIA 4RU2A 2M2BA 2RUSA 1VS3A 2ERRA 5IM0B 1HW8A 3T1AA 4E0DA 3OVAA 2MKCA 4PWUA 1FE4A 3KLHA 4O23A 1VHIA 4EMDA 1NKEA 1MNEA 3DXBA 1JJ4A 3JSYA 2C3PA 2EK1A 3DMJB 4URQU 2GVZB 3MM8A 2ZC3A 3AT1B 2W9CA 5J2QB 2E7XA 5FD1A 4DR5J 5J1PA 1YJ9S 1NJXA 4ED1A 3RBXA 2V2QA 1N8RT 4F26A 1FJCA 4DZ6A 3FBCA 4DV7F 4B3SF 3OSPA 4MFBA 1TK8A 1R8HA 2BOPA 4NCGB 4F4YA 3AOAA 2P9GA 3GJTB 1S49A 2UVVA 1NU4A 3G6VA 3EMTA 2YNFA 3RBEA 3DLLQ 3DU6A 4B3RF 2CJAA 3UDCA 3CNQP 4NLSA 1V3SA 5T41A 4U7CA 1W2BR 2NCKL 4NXNF 3RB0A 2ZZNA 5HLFB 1WHYA 4B3OA 2JC1A 1V6HA 2FGCA 1P1TA 4A8SA 4X4TA 1KNZA 4KFBA 4M5JA 1N34J 1S99A 1RWUA 4DV2J 2CQ4A 4J9QA 5HVHA 4UOGA 3HFKA 3TUPA 1B64A 4OLPA 5BYSA 2QA4S 5EHHA 4WFBQ 1U8SA 4HTIA 3A12A 1CSJA 2QO3A 5LSRA 5D0RA 2EI5A 1Q5YA 2N4DA 2VC0A 1RAEB 4CLYA 4LRFA 4NRTA 2HURA 3GILA 1AXQA 3DGVA 4CRJA 2FVPA 1NLKL 1XTZA 1MWYA 3FEZA 4MT1A 2KM8B 2JLGA 3A4TA 5CQGA 5HL7Q 2AJ0A 3OL9A 4CH1A 1OPZA 3KFWX 4F4WA 4NE9C 5C25B 3J80Y 2ZM6J 4OX6A 3MCMA 2YKQA 2A2DA 3KKFA 2MHNA 1SC1B 2DTJA 1MG7A 2W4DA 1S7HA 1HQUA 1WUUA 2HWIA 4IRCA 4FPRA 1S1UA 1D3WA 2M8DB 2X1FA 4ED2A 4LIRA 2BMBA 1KN6A 6FD1A 2UU9J 5A8KB 4C8NA 1JLQB 4IYQA 2C2OB 2ZUAA 3M8QB 4MK9A 2QA1A 2B4OA 1UA0A 1FRXA 3B6BA 2RS2A 3DRPB 2HVEA 2QLWA 2W1BA 2HQIA 1FWPA 3DCAA 4GO7X 5F8LA 2DCLA 1CJVA 5CZVA 4RWWA 5AXLA 2NS1B 4HHHA 1AYEA 3OVBA 3AH6A 5I3UB 2OELA 3DM2A 2ZJQQ 3OJUA 3V6DA 2XLKA 4O3QA 3X1LB 3LTOA 3T3FA 1OIAA 4J9VA 2OEMA 4F67A 5GVQA 4JI7F 2MB0B 2UXCJ 3FGVA 3MPVA 4GVBA 2RKIB 2RB7A 1GAOA 2C2MB 4IDKA 1JWWA 4PQUA 3GSIA 3KLHB 5M2RA 2PO4A 3ICLA 2Z30B 2HAIA 2VPXB 3DLJA 4PXCA 3AD7C 3PR4A 3PHEA 2HHQA 1KP6A 1S7IA 3DRRA 2IA6A 1OWXA 4ERDA 4JI5F 2KTQA 4MIAA 3THTA 4ZS6A 4YR2A 4XO0A 1CEZA 4DPOA 1FX2A 5M2UA 3MM8B 4PG4A 2L41A 4TU9A 3D0GE 4B3TJ 3OHAA 4DMZA 2O01C 3RW7A 5L1IA 2RHQB 4LR9A 3JXOA 5LM7E 4XDCA 2FJWA 3FC9A 3P3DA 4CNYA 5HMYA 2P6SA 2ZOMA 4F4KA 1X4BA 4RUHA 5HJYA 4MFBB 1IBMF 4FXWA 2WOMA 3QMQA 2E7WA 1HNWF 2N7CA 4DSIA 1WWHA 3LO3A 2YNFB 1OMSA 4OZ1A 4ZVSB 4ZVQB 4YDXA 3J7A1 4DV3F 3V4IA 2RHSB 3IWXA 5EN1A 5DZ7A 2ZH7A 4KGXB 2HAFA 1MLAA 4B3OB 1Y10A 1RUSA 3TR5A 5CD4H 1XN9A 4KFBB 2ZHAA 2FJEB 2Q79A 5HQMA 5D3GA 3BQ2A 1KOOA 4BS2A 5CYMB 5H1SV 4OLOA 3UN3A 3IWLA 5SUHA 1YX2A 4C4WA 3AFGA 4OMFG 1HBMA 3T5HA 4JBCA 1DTTA 2M3DA 3AJ2A 3QRPA 1H7WA 2UUCJ 2D3UA 2R3VA 4U9RA 3I82A 4K4VA 2VBXA 1TAQA 2YY3A 1WG5A 1NDPA 1FE0A 2ZKUA 2WRMA 3I31A 3LAKA 1X0FA 1FF2A 3N01A 3CSKA 2DHAA 1FXRA 1OJ4A 4FF2A 1BQMA 2AEFA 3JSRA 4DV0J 1WTFA 3HFZB 1FKPB 3ETOA 2KH9A 1CQNA 2GW8A 1ZOTA 3GIIA 2W2OP 3M30A 2VJUA 7FD1A 1KDNA 3VALA 3DLKA 4Y6IA 3M6XA 1VQ6S 1NKBA 1B70B 3IXQA 1S1UB 3N5FA 4ES1A 2RRAA 5EWGA 3QJPA 1FTRA 2P2CB 1RTDA 4Q43A 3CCVS 2ASYA 1RWXB 4FVCA 4WZMA 3EM1A 1W26A 1U1PA 1QDUB 3PTWA 4DR2J 5KFNA 3W1YC 1NSPA 4X4NA 3TARA 1KVIA 3FSYA 2AEMA 1CJVB 1K73T 3R7NB 4K4ZA 3HD2A 2HVZA 2HHTA 3EVMA 2GO8A 3DM2B 4ID8A 2GO9A 1SKRA 2G4BA 3V6DB 1Y5LB 5CH7B 1HI1A 1JLEA 4Y00A 1WSRA 2LYVA 4I2PA 5JVHQ 1PJ5A 1NPPA 2LVWA 5DGAA 1X4HA 1YJUA 1T9VA 4GVBB 4LVOP 5ITHA 3VGSA 4GKJJ 3GU0A 4IDKB 3S01A 1EZZB 4PQUB 5G0RB 1KTVA 4TXSA 4EEYA 2ATCB 5LMNJ 3WBZA 2AWZA 2CNOB 3OTDA 2OD6A 3DRRB 4PYAA 3ENAA 3HT3A 2CQCA 4PPDA 1RWMB 4DEZA 2EVZA 4DX6A 1PBUA 3LGMA 5T14A 1RT7B 2ZBPA 2DR5A 1E6YA 1G6BA 3ILJA 4X64J 2IM2A 1LFPA 2HIYA 4FNHA 3UW1A 2WOMB 7AT1B 4EWTA 4BC7A 2DK2A 3ZNUA 3NWRA 2C22A 3M2RA 4H4MA 2E1CA 2E9TA 2Q43A 2XS5A 3M8YA 1Y11A 3KJQB 3CXCR 4NLTA 4OHXA 3H5UA 4J9NA 3FZBA 1RAJA 4Q5VA 1OO0B 2EC0A 4KHMA 3W5YA 3QRQA 2B4PA 3V4IB 3FVYA 2B7CB 5IFMA 1Q5VA 5E3AA 3DRYA 1LV5A 1O0PA 4ZVGA 3KDOA 4O3OA 5D3GB 1W7WA 2OSRA 3IAM9 1F2HA 1XNQF 5KFCA 2HFVA 3I96A 4OJ3A 2F9DA 5KG6A 4HI1A 4F3OA 4FF3A 4ZKAA 1HBMB 1DTTB 3FZ2A 2WB4A 3KJVA 3G9CA 3PX4A 2GMHA 4GC7A 3NP5A 3HVTA 2KZZA 2K8GA 2DNLA 3UR0A 3TVYA 5KT5A 2K3KA 2WVCA 1Y5NB 3KOAA 3KMQA 3OXFA 4D3GA 4DX7A 1WDDA 5LL6d 4HEA9 4CP5A 5CCLA 1YG0A 5KT7A 1SC3B 2DCUB 1BQMB 1L3KA 2C1EB 1S1TA 1RACB 4IFVA 1Q8BA 5ETKA 3M30B 5KFJA 1U1NA 5BYQA 1FKOA 5KFGA 5J2MA 4OI3A 5CABA 3DLKB 4K2JA 3PRVA 5DG9A 1N52B 1NNDA 1XR7A 1RTIA 3L09A 4M5NA 3CDWA 2BKPA 2FJXA 1TVRA 2ZOGA 4EK2A 2EFGA 3H5SA 4DFKA 2CA9A 3H40A 3FCVA 4WFZA 1RTDB 3KHGA 3PHTA 1WJ9A 5AXNA 2R7TA 2FTRA 1LK5A 4DJBA 1TL7A 3HHLD 2RQKA 1UZHA 3LP0A 4JV0A 4GRSA 1G1XA 5E0OA 3IM9A 1R0CB 3J81Y 4ECZA 1SKUB 2J7KA 1NDCA 1YTYA 1G7CB 2DKOB 2AYGA 3N6MA 4DXLA 1Q81T 3D6MB 1RA7A 3KYLA 1NK4A 2MJUA 1JK9B 3D0IE 2NPIA 1JLEB 3BZQA 1M5VC 4I2PB 4B9SA 4WK3A 1BXNA 1BY9A 4Z7YA 2XI3A 4J9LA 3LPYA 3QWPA 3HF5A 2GQCA 2ASLA 3A8KA 1RHMB 3TYTA 2FVQA 3NLCA 3LWLA 1VRUB 5KFZA 2BJ3A 2ZH3A 5DDOC 4X4VA 4KO0A 1HHQA 1H3DA 3MR5A 2QMXA 1VQMS 4RUBA 4ECTA 2MQLA 3MMAA 1TAUA 1YJVA 2K1RB 3EWGA 3ENWA 3N0VA 5E5NA 2VDIA 1JLGA 5GADI 3BSOA 2W4PA 1V3ZA 5C24A 4R0JA 1QSLA 4OZ3A 4ECRA 4MTPA 1Z1ZA 5KT4A 1REVA 1GMWA 1E6YB 1IBLJ 5BR8J 5FJ4A 1TL5A 2W25A 4DCOB 3DRXA 2AJ1A 2VJVA 2R8JA 4CT8A 2R7RA 1J2VA 2FB0A 4DFPA 2B8QA 2C3YA 4H4MB 4NRUA 1VC6A 2FYXA 1S6QA 4IUFA 2YPYA 4EBEA 4YQWA 1RLDA 1U2RA 2BW2A 3WIVA 2F9JA 2J9DA 2E5IA 3D66A 3FNNA 3BSNA 2Y8YA 2F8HA 2OFHX 5KAKA 2AQ4A 1RAIB 2IRXA 4QR1A 3FBBA 1N32F 4X65J 5IQQA 2DNMA 1M0SA 2A6OA 2GIRA 1C1CB 4J91A 5DRKA 3OL8A 2V0NA 4DUTA 2OD4A 3EZUA 2DXEA 2BJ9A 2IC3A 1X9WA 3W62A 1QVGR 1MN7A 2ZHOA 1DHMA 2KN4A 2B51A 2LDIA 3KJVB 4OZJA 1XJWB 3HVTB 3IM8A 1M1GA 3CULA 1SH2A 4DU7A 3QT6A 1X4CA 3UDVA 2JOQA 1FNOA 4P2XA 4N7TA 2QFJA 3J7AN 1HNZF 3J7Z5 3L7UA 3H25A 2KYXA 2Y1IA 4TN2A 2F3JA 3NCPA 4EYIB 2KJVA 4RWXA 1HWJA 1S1TB 3DRSA 3PX0A 4G65A 4IFVB 1URRA 3MOZA 2FHJA 4O3PA 3DOKA 3C46A 3MM9A 2IY5B 1S76D 1O51A 3JTOA 1FKOB 5J2MB 1SBRA 3W9HA 3WC0A 4RUAA 1RTIB 1YZ7A 2JFKA 2RUGA 3HJFA 2VBZA 1TVRB 3OVSA 3J7ZT 3F0NA 1TL1A 1MWQA 1UPPA 3MEKA 1N33F 2VASA 2HS0A 1FXLA 3CF5Q 4JI6F 2CJYB 2HK3A 2MKKA 4LF6J 5CA5A 3TA2A 3NS6A 1TL7B 1HNVB 4QWBA 3ULHA 1FNMA 3LP0B 2IPOB 5E7OB 2FY8A 2HGLA 3UCUP 2DNPA 2E9RX 2R7SA 2WAQD 1X7VA 3PFEA 1F60B 4RO0A 3QATA 2HRYA 2DIVA 2Z58B 2OHDA 4DFMA 1X9SA 4WE1A 3RAXA 1Z4UA 2YTCA 3PZPA 1S77D 3PG9A 1JLFA 4ZITA 2FJDB 4B3RJ 2ZEJA 2RT3A 2DNOA 4OIXA 1WC3A 2KHDA 4NXNJ 1ZTTA 1S1VB 4MK8A 5IQ6A 2JZ5A 2PN6A 2AZ3A 3M2VA 4C8MA 2XULA 4KH1B 3MMAB 4O3RA 1FCAA 2CPDA 3TZYA 1MW7A 4WYWA 2WZ1A 1JLGB 1SJ1A 4ECYA 2CPYA 4B3MF 3MR6A 4AFFA 5C24B 2MXYA 4DI6A 3NGRA 2UV8A 1RAFB 1REVB 1R0AB 2MHEA 2HLTA 3KNAA 3OR1A 3GSDA 3RW6A 4EUVA 1S5ZA 4WCEQ 5C2CA 2XS2A 4PWDB 4OL8A 1IQTA 3DGPA 4ID5A 2VZ9A 1SL1A 3MEDB 4WBFA 1S6QB 2F4FA 2ZBQA 4NA3A 3JAMU 4DPYA 4ENOA 4RLEA 2V4RA 3PW4A 3OFHA 3OUYA 3G8QA 4TQRA 3VAIA 3KHHA 3CD7A 2F8MA 5KFPA 1M1HA 3UN2A 3TA0A 2HVIA 2YWFA 4L73A 4CO1A 2GAGC 2GJ2A 4Z7CA 2OMOA 5LOQA 4L3KA 3EUNA 1FHTA 3PO4A 2KFZA 4P73A 3WDOA 1XR6A 2CJBA 1TZ0A 4TKTA 3M9MB 4I56A 3P49B 2LXUA 5HN0A 3HHEA 2NXEA 1DJ0A 2F65A 5BYRA 1VQKS 2RE1A 2QG9B 5G4DA 1WC0A 3CJRA 1GMUA 1SC4B 3H2LA 3CDAA 3SZ2A 3O6QA 4DV6F 3PCOB 3V6KA 1HQEA 4LF8J 4DV4J 3Q23A 3DOKB 3MM9B 4OZNA 4ZLJA 4O3SA 2JEJA 3H2UB 5AT1B 2JL9A 4OFZA 1FKAF 1FRIA 2CDRB 4ES2A 2KT5A 2G0IA 3UN5A 2MQMA 4ZP9A 3N5BA 2B7BB 1UVLA 1TL1B 4B02A 2NXUA 1UEKA 2EFVA 3BO4A 2KXFA 1ZH5A 3CEDA 1KONA 1S6UA 2YH1A 2MZ1A 1U1RA 2XO6A 4ZA1A 1VDHA 2G1HA 4ZK7M 4K59A 1H38A 3SXLA 2V8PA 3HP6A 1KOHA
chains in the Genus database with same CATH topology
3TUIC 5JUMA 5LSLA 1XBWA 2KHCA 2QE5A 3FSXA 5HMXA 1QAIA 3TAMB 5DM6Q 4UQGA 5H9EJ 4TY9A 3V81A 5F8GA 3EX7B 3NS5A 2J7WA 1KQFB 2DGUA 1MROB 4CO4A 3AQPA 4DV1F 1Y5IB 1S6OA 2BJDA 5A0YB 1R0AA 4ELVA 2BV3A 4CH7A 3K57A 5K8PA 4WE1B 4J9KA 1QJHA 2HMIB 3R5CA 2Q6BA 4DSEA 1S9EA 1ZZNA 3I55S 5I42B 2DNQA 2M70A 2VBYA 3RR8A 4TQSA 1CPZA 4J9RA 3ITHA 1JLFB 2R2TA 3HHDA 1T02A 3DXSX 3AB4B 3WZ0A 2JEGA 2UVUA 1OQ3A 2X51A 5KFBA 3A1YG 2E9ZA 3H5XA 3B82A 4PWDA 2HFOA 5DDPC 1JJHA 2QYCA 4WXWA 2HHVA 1FEHA 1R8PA 3NRBA 3DFEA 3PO5A 4N41A 1VBXA 3IGNA 1KS2A 2C2RA 3AY0A 5F0UA 4NLDA 2E29A 1FJEB 1WI6A 4A8OA 3HVAA 2EFPA 4HVZA 2CFXA 2DNGA 3C6TA 2MGZA 5C25A 2FHKA 3LANA 1UVKA 3HDSA 2UP1A 1SL2A 3EXYA 3HKZD 3I32A 4IG3B 2D9PA 2HFZA 3H4BA 1JKHA 3SQGB 2Q66A 4LF5F 1X0PA 2GFFA 4IOCQ 4DF4A 2BABA 4WIIA 2D7SA 4HHJA 4ZPTR 2B5JB 4V19J 4Y65A 2VONA 1SV5B 2JC0A 3MEDA 1UWBB 4H4KA 4OJ1A 1I1GA 3QJLA 1QY7A 3ZZUA 3IR7B 3KK2A 3M2VB 2V5HG 2I1RA 4OHVA 3O44A 1CG2A 3HMJG 3MM5B 4KC5A 4MIWA 3DN9A 4QW8A 4KR0B 2W7OA 4OI0A 4DQQA 5B0BA 4NCBA 1K0VA 3M9NB 1VK3A 2HHPA 2VG6A 4USJC 1U1LA 1N6QB 2I2YA 2KU7A 3KLFA 3IFEA 3IGVA 3IRXB 2XLIA 4DSJA 1S97A 1KD1T 2DH9A 3OQ2A 3DLBA 2WK4A 3HZGA 2YKPA 2OPRB 1IJFB 3PW0A 1WHVA 4JV2A 3EYZA 2ROPA 5CXTA 2ROGA 3P5TL 4GMKA 5A8KA 3LOUA 2ZH9A 1LWCB 2K3IA 1JLQA 1N5YB 4K4WA 3B4DA 5KG7A 2NPFA 3M8QA 4F50A 1XWLA 4OX8A 3M8PB 3BN7A 3TAQA 4DWIA 4QU7A 2I5JB 3PJXA 3OR1B 3PDNA 4DR6F 2BXJA 1N5TA 3MCSA 2O5DA 2FHMA 5A8RB 4KAIA 1TV6A 5KG5A 3DRPA 2VPZB 4OZ5A 3I9ZA 3GFZA 4IH5A 1S1WB 2YKNB 2OO4A 1J5OB 3RZAA 1YRUA 1N88A 2YX4A 3MEEA 1XMQF 2NREA 3R3TA 2XCPA 2CRLA 2AYBA 2C3UA 2MY8A 3C2PA 1DLOA 2WBRA 3US5A 3S8SA 2VG5A 2BYCA 1VJWA 4PKDB 2NUHA 3V4MA 3GG1A 1UJ4A 4N56A 2XWYA 1IKWB 1JLBA 4C7QA 5LXRA 3AA8A 3Q8SB 4DG1B 3G96A 3PV8A 4P7TA 2CQGA 5KFWA 2EWHA 3E3XA 5K8OA 2AU0A 1NK0A 1KR4A 1KLMA 5EDWA 3WX4A 2RNEA 3MUTP 1H6KX 1K1QA 1JLCB 1VK8A 4K5SA 1HQUB 4XK8C 2E5LF 3BS9A 3PEJA 3BJYA 1A7GE 1S79A 4YHHF 2IM3A 2M88A 1NJWA 2IMWP 4IRKA 4UY85 2WONA 3PR5B 2HNZB 4CQ1A 1QUPA 1ZBTA 2DIUA 3V2UC 1BD6A 4B9NA 4IQXA 4LFCF 3CD5A 2DISA 2VL1A 2DH7A 2RKIA 2V2KA 2E1AA 2HRUA 5SZTA 2ZFHA 2DGQA 3PIOQ 4ECXA 4JI1F 4RU2A 1IKYB 1C0UB 2A3JA 2M2BA 4QPTA 3CCJS 1RQ0A 4Y2AA 3E51A 1VS3A 2ERRA 5IM0B 1HW8A 3T1AA 2DGSA 3OVAA 4E0DA 2MKCA 4PWUA 4DR4F 1FE4A 3KLHA 3QGPA 4O23A 1NEEA 2HNDA 1NKEA 1MNEA 3DXBA 1JJ4A 2BE2A 3JSYA 2C3PA 4I64A 5KOXA 1XNRF 1D1UA 2EK1A 4WK1A 1B0TA 5EWEA 3RRKA 3T5JA 3HVRA 4DR5F 3THPA 5KT3A 3DMJB 1X4EA 4URQU 4W92B 3MM6A 1I6JA 3T9ZA 2DGOA 3HHLC 4PUOA 3KWMA 1Q86T 2IA0A 3DHXA 2DO4A 3MM8A 3OFEA 4Y2MA 1URNA 3EGZA 1GX5A 4J9MA 3W7BA 4R0EA 2J6SA 3L7PA 4YR0A 4ZMMA 2ZC3A 3T9NA 5T7LB 2HPUA 4BBYA 4KB7A 2MQPA 1VLYA 2ZDOA 2W9CA 3M4XA 1T3OA 4ED8A 5J2QB 2E7XA 5AE1A 2HWTA 5FD1A 5I3QA 5J1PA 1N54B 3CD6S 1RKIA 2O3DA 3M6UA 3T6BA 4J9SA 1YJ9S 4C11B 4C98A 3SSSA 1NJXA 2OLWA 1X4GA 2K7JA 2VA3A 4ED1A 2BVZA 1N8RT 2CQHA 1T03A 3I6PA 4F26A 4U6PA 1YIJS 1FJCA 2C3MA 2ZD1A 4DV7F 1Q8LA 4B3SF 2VKZG 3OSPA 4MFBA 1TK8A 1HYSB 4HI2A 1N5QA 1R8HA 2LDYA 2B3TB 2BOPA 4NCGB 4NZ7A 3K5MA 1X8DA 4F4YA 1B0PA 3HXMA 4LMZA 2ZH6A 2FGOA 2P9GA 4DQPA 1XEZA 4X4RA 2UXDF 1S49A 3V5RA 3ZZYA 2W8KA 3EZ5A 2UVVA 1HD0A 1NU4A 1RP5A 4BHQA 2IVYA 3G6VA 3GB0A 3MXHP 2KFNA 1FVQA 3RAMA 1HQEB 3JYTB 4YOEA 2HG4A 2YNFA 5LSOA 3RBEA 1K8AT 4ZVEA 3I9V9 4LSLB 4O3NA 5KG4A 3E01A 4RUCA 3DLLQ 2PI4A 4DR1F 2CPXA 1SKWA 4Q8EA 1GNKA 1WF0A 4USIA 3V6JA 3DU6A 4B3RF 3MM7A 2CJKA 2CJAA 1YJRA 3UDCA 5J1EA 4RNOA 1N34F 3UNGC 2B6AB 4NLSA 1V3SA 3SCKE 5T41A 2VA2A 4U7CA 1W2BR 4O44B 3ZZOA 3B78A 3M1VB 3RB3A 4NXNF 4FN5A 1KLNA 3RB0A 4NLYA 3OPKA 2ZZNA 3MF5A 3UPFA 3Q8RB 3MTJA 5HLFB 2A2CA 1WHYA 4B3OA 2JC1A 1V6HA 2FGCA 3SV4A 1SQEA 5KOWA 3NBPA 1P1TA 4A8SA 3EGNA 4X4TA 1KNZA 3IG1B 5GAHU 2LQ9A 4KFBA 2GJIA 1FDNA 1S99A 1RWUA 2BQRA 2CQ4A 3M9OB 4J9QA 2ABYA 3TP2A 4EYHB 1DARA 1LXJA 2PA3A 4I7FA 5KG3A 4MAKA 3HFKA 3VTIA 2QLXA 2L48A 2PMHA 4V19X 4TYAA 4KBIA 1U7LA 4MK7A 1QAYA 1FRKA 1B64A 4OLPA 4OI2A 1BQXA 5BYSA 2QA4S 4JI4F 2DPIA 5EHHA 4M95A 5FDLA 2QEXS 5L1LA 1R89A 1NB7A 4LSNB 4X4OA 5DETA 1V3RA 4Q0BB 3AHPA 1U8SA 4WFBQ 4OJHA 4L6V3 4HTIA 1CSJA 2QO3A 5LSRA 7FDRA 5HP1A 2RS8A 2AJQA 3TVZA 2ZH4A 2MSSA 3B4MA 4DUZF 1MWZA 2EI5A 5L9NA 1TQLA 2PMZD 3KLVA 1FRHA 4YUDA 3CD0A 2N4DA 2WSCC 2DO0A 2LXFA 3V81B 2G0CA 3NKYA 2VC0A 3GIKA 1NHUA 3SYZA 3NAHA 4X4UA 2J5AA 2RF2A 4K4YA 4NRTA 4AYBD 2YKOA 1N5YA 3GILA 1XERA 1AXQA 5C42A 2GNKA 1CLFA 2FVPA 4A8MP 4IR1A 1S9EB 2J9DE 2YVSA 5KFQA 4JV5F 1GTHA 2ZM6F 2ACYA 1XTZA 1YJTA 1TFYA 3CJ5A 1VIOA 1MWYA 3FEZA 4WFAQ 3ITHB 2M9KA 2KM8B 5L39A 3D54A 2JLGA 2ADBA 4ED0A 5CQGA 4H4KC 5IS2A 3F73A 5HL7Q 2C2DA 3CC2S 1U6FA 2AJ0A 4G3IA 4CH1A 3OL9A 3S7RA 2OP5A 1OPZA 4H4OA 4ECSA 5CCMA 3KFWX 4NLUA 3CDUA 1Q7LB 5LJ3Y 4Q8FA 3PW7A 4B9UA 1S10A 2AGPA