1X5TA

Solution structure of the second rrm domain in splicing factor = 3b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
GSSGSSGIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second RRM domain in splicing factor = 3B
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Splicing factor 3B subunit 4
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x5tA01
2RUGA 3CUNA 1L3KA 1U1NA 3G4SS 2MQQA 1M5KC 2MZRA 2XS5A 3JB9k 1M5PC 2DHSA 2KM8B 3CCSS 5GMKa 3MOJB 2CQ1A 4ERDA 3ULHA 4F26A 2FY1A 1N52B 5LSOA 5DDOC 4C4WA 2QEXS 2DNRA 2FPHX 1DRZA 2KXNB 4IOCQ 1X4FA 2NZ4A 1WEXA 4WCEQ 2DIVA 3CCJS 3K0JA 4F02A 2LA6A 3PIOQ 3R1HA 3MD3A 1R8PA 3G9CA 2E5GA 1KOHA 2HZCA 3UCZP 3VAHA 1ZZNA 3N9UC 2ZJQQ 2RT3A 2YWKA 1VQLS 2RVJA 3EGNA 2MSSA 2DO4A 1F9FA 4PRFA 2AD9A 1Q7YT 4CQ1A 5D77A 2MJNA 4Z2XA 3VAFA 4IUFA 2MZSA 5IM0B 3MXHP 1UAWA 1X5TA 1NO8A 4QPTA 2N7CA 3CCES 1KC8T 2BZ2A 2J8AA 2DGTA 3B4MA 2WBRA 2KRBA 1HD0A 2OIHA 1X5PA 2MZTA 3NS6A 1M1KT 2XSFA 2VOPA 1VQKS 1DZ5A 5DDPC 3BO4A 1SJQA 4WKRA 3DXBA 2LA4A 1FNXH 2JVRA 2CPEA 4FXVA 3BO2A 1H2TZ 1FHTA 2RS8A 2V94A 2M88A 2UP1A 1U1OA 3P5TL 1VQ8S 2FC8A 2MJUA 3SDEA 3G96A 2HYIB 1FJCA 3CULA 2LXUA 2DB1A 2MQNA 2DO0A 1UP1A 2RRAA 1U1RA 2LKZA 4M5DB 2ZJRQ 1WELA 2CJKA 1SJRA 1YJWS 3OW2R 2F3JA 2F9JA 3BO3A 2MKJA 3S7RA 1SJ3P 3FEYB 5GADU 4P6QA 5DM7Q 1X4DA 3ZZYA 4CH0S 1D8ZA 5MLCV 1OPIA 2CQ2A 3CMES 2ADBA 3UD3P 4IOAQ 5LJ5Y 3CCUS 3UWTA 3DLLQ 2K3KA 4U67Q 2AYGA 1B7FA 2KM8C 3SMZA 4V19X 5IM0A 2J0SD 4YB1P 1WHWA 3RW7A 2OTLS 3CXCR 2YH1A 1P27B 2MKHA 3MD1A 2CQHA 4PR6A 3G71S 1M90T 2LEBA 2DNKA 3I56S 3CPWR 2BOPA 1U6FA 3HI9A 2G4BA 4IO9Q 5GAHU 1K9MT 3U1MA 1WHYA 2KG1A 2XS7A 2DIUA 2X1BA 4QU6A 1UFWA 4Y00A 2RU3A 4ZKAA 2HGMA 3CC2S 5JVHQ 2OTJS 1OIAA 1QM9A 2DGXA 2DGWA 3J7ZT 2RNEA 4UQTA 2CQ0A 4A8XA 1H6KX 3UE2A 3CCMS 1WG1A 2YH0A 2MQOA 2KT5A 1VQ7S 1G2EA 1X4GA 5DDQC 4LIRA 3NNHA 2DNOA 1VQ6S 1URNA 2AYEA 2DHXA 1X4EA 3BEGB 5DM6Q 1Q82T 1HD1A 2MKCA 3R27A 2CQDA 2MZQA 1X0FA 2KHCA 2VOOA 2D9OA 2KU7A 3Q2TC 1X4AA 3NMRA 2DGOA 4LJMA 1U1KA 3VAIA 1VBXA 1WG4A 1VC6A 5GAGU 4ED5A 1YIJS 1FO1A 2G1DA 2QFJA 3B4DA 1VQ9S 3CCLS 1U1QA 2FC9A 3EX7B 1AUDA 2MKKA 2AYMA 4FXWA 2DITA 1WF1A 2LQ5A 5D78A 5JVGQ 4WFAQ 5IQQA 4LMZA 2K8GA 2M52A 2DNQA 2JRSA 4CIOA 1WHXA 2GO9A 2M70A 2MXYA 1JJHA 2RQCA 2KRRA 3L3CA 5DDRC 2AYBA 1JMTA 2MY7A 2LECA 2CQIA 3S6EA 3TYTA 2ERRA 3SXLA 1A9NB 5ITHA 4TU7A 5BJRA 2J76E 5HL7Q 3MUMP 1RK8A 1S79A 1UW4A 2M4MA 2DGSA 3V4MA 3NNAA 1R8HA 2CQCA 2M7SA 1WI8A 3CTRA 2JVOA 2O3DA 3NS5A 1N8RT 1N54B 2M2BA 2X1FA 3HHNB 2CQBA 2KFYA 2DH9A 5CYJA 1U1PA 1KD1T 5FJ4A 3VAMA 3LPYA 4RU2A 1IQTA 2NLWA 1WF2A 3MUVP 2DNNA 2MY8A 1H2VZ 2KXHA 3G8TA 3CCQS 2OSQA 2JX2A 5GVQA 2DNLA 4CH1A 1O0PA 4F25A 1YJNS 2X1AA 1YI2S 2XNRA 2J0QD 3S8SA 1WG5A 3IWNC 2MPUA 1NU4A 2KN4A 2CQPA 2LXIA 2RQ4A 1VBYA 1K73T 3P6YC 2F9DA 1WEZA 1A7GE 1XN9A 1Q81T 2MB0B 1U2FA 3IRWP 2DNZA 3VF0B 1QVGR 5CXTA 2CQ4A 5EN1A 1YITS 2CPDA 4WFBQ 1FXLA 1H2UX 1YWXA 2MQLA 4WFNQ 4C7QA 2X1GA 1U6BA 1W2BR 2DH7A 1JJ4A 4YUDA 4OZ1A 5DETA 2DNPA 1U1MA 2MYFA 5LXRA 1VBZA 2PEHA 2OJ3A 4TU8A 2MKSA 1WTBA 1HL6A 2N82B 2ADCA 2YTCA 5LXYA 2VODA 2KH9A 2DNHA 2MZ1A 2DK2A 1X4BA 1SJFA 2DNMA 2B0GA 1VQNS 2DGUA 1SJ4P 2CPZA 1RKJA 5GAEU 2LMIA 3RW6A 1ZH5A 2I38A 4TLQA 1VQMS 1U1LA 4OZ0A 5LSLA 4J5OA 2QA4S 2N3OA 1NJIT 3U1LA 3Q2SC 3THPA 2MZJA 3H2VE 3R1LA 3LQVA 1Q86T 2E5IA 3G8SA 3UD4P 4QU7A 3TP2A 2VONA 3MI7X 2E44A 3H2UB 1YTYA 3VAJA 1PGZA 1WF0A 3UCUP 2MGZB 2M8DB 4W92B 1JJ2R 4Y0FA 4YOEA 2CQGA 1FJ7A 3J7YU 3US5A 4WIIA 1BY9A 5HO4A 2D9PA 2HVZA 4PKDB 2CPHA 2KYXA 3MUTP 3SDEB 3VAGA 2MSTA 3UCGA 2CPYA 2KG0A 2EVZA 2OSRA 2LCWA 1M5OC 1N88A 1FT8A 3VAKA 4TU9A 2L41A 1ZZFA 2CQ3A 2E5JA 2KVIA 3G6ES 1K8AT 2M9KA 4BS2A 2MMYA 2U1AA 2RRBA 4C0OC 1WWHA 1X5SA 2DGQA 2LEAA 1OWXA 1WHVA 1KQSR 1X4HA 1WEYA 2HGLA 3CF5Q 2EK6A 1PO6A 2CPXA 2DNGA 2SXLA 1D9AA 2L08A 2D3OR 3NNCA 2DNYA 2M0GB 3S01A 2DHAA 2CPJA 3VALA 3THTA 2CPFA 2XNQA 2L9WA 1CVJA 2RS2A 4WF9Q 2CPIA 2G0CA 1X4CA 2YKAA 1FJEB 2XB2D 2MGZA 1OO0B 1VC0A 4UY8T 3ZZZA 4QQBA 3MURP 2LYVA 1YJ9S 1P1TA 2FHOB 1VQ4S 1VC5A 2MQMA 1DHMA 3P49B 2HGNA 3MDFA 3BS9A 3I55S 2Q79A 2MQPA 2I2YA 2KI2A 1YHQS 4EGLA 2DGVA 2PE8A 1VQPS 3EGZA 2EK1A 2GHPA 5IFMA 1M5VC 3TO8A 3CCRS 2N3LA 1S72S 3CMAS 2U2FA 1WI6A 2ZJPQ 3P3DA 3CC7S 2MKIA 3CCVS 2A3JA 3FEXB 3PIPQ 2M8HA 2XS2A 5LJ3Y 2DISA 2E5HA 2KXFA 2MHNA 1VQOS 3CD6S 4W90B 1HA1A 1DBDA 1VQ5S 2JWNA 1SXLA 1QVFR 1X5OA 3CC4S 2DHGA 2DH8A 5CA5A 5H1SV 1KOOA 3D2WA
chains in the Genus database with same CATH superfamily
2RUGA 2IJRA 4JB8B 1RT2B 2KTQA 3CUNA 1RBLA 2HFSA 2OP5A 3B54A 4USKA 4ED4A 1Z1ZA 3G4SS 5AXKA 1EZZB 2P9EA 3PFOA 2IVFB 5IQ6A 1E6YB 3JB9k 4C8OA 4AD6A 1PBAA 1SH0A 1D1UA 2XWYA 4CM0A 4IQXA 1WOSA 3QBCA 1HNIA 1JLGB 2HS3A 3SBMA 3EYZA 1TL3B 4NXNJ 2V8HA 1BE4A 4C4WA 1HNVA 1VHFA 2DNRA 2V63A 3B6BA 3MWBA 3ISZA 4QZVB 3OVSA 4DV5J 3B8HA 4IOCQ 4JI6F 4J91A 4RWWA 3GIKA 1GTEA 1JLFA 3MM9A 2GIQA 5C42A 1IN0A 2Z4PA 2HAIA 3DDNA 3UR0A 2R9LA 5D3GB 3K0JA 3BN7A 4IH6A 2HZVA 2LA6A 3MCMA 4B3TJ 4F02A 3R1HA 2HNDB 3FNNA 1NK5A 1VIOA 1IWGA 1KOHA 4HI1A 3T5JA 2CYYA 3DRSB 3CE8A 4W98A 4ZVPB 1FKOB 1BUXA 2ZJQQ 4QPXA 4DHVA 2DD8S 2YWKA 2UUCF 1Y5NB 2L48A 3SSQA 3CMQA 3MPWA 1F3FA 4RW7B 3EGNA 4CO2A 4ZJOA 1FE4A 3FBFA 4ZLPA 5KFHA 2BDPA 1Q79A 5D77A 4H4OB 3FSYA 2Y8YA 3C16A 4G1QA 3LAMA 3VVTA 2Y1LB 4JV5J 3H0PA 2YKNB 4HACA 2XYPB 3MPUB 4IKAA 1NO8A 3LGMA 4P2FA 2FD2A 1LWXA 4JV0A 2DXDA 4KRWA 5E0OA 4CLTA 3QIPA 1R0AB 3R2DJ 4X4VA 3PJ9A 4DPUA 2EFGA 4ZHRB 3B4MA 3MECB 4FBTA 1TMMA 3QPIA 1RAHB 3D1HA 4HT7A 2Z2ZA 1KFSA 2XHCA 1H7XA 3M2UB 2KRBA 5A6WA 5DQIA 2C28A 5CYQA 1S9GB 2R8HA 1M1KT 5B0CA 4IOBA 3MAQA 4PEOA 5DDPC 1LEOA 4LQ9A 3BO4A 2AJFE 1VS3A 1LWFB 4OJGA 1IKVA 2UVUA 5K20B 4X2BA 4FXVA 2FYXA 3TZWA 1FKPA 2QLFB 2RS8A 1UVKA 3HT0A 4TYBA 2E9RX 2M88A 4OI2A 2YX1A 4UOGA 3QZ7A 1U1OA 2QYCA 3P5TL 4O44A 1VQ8S 1PJ7A 4F0KA 4LRAA 1JLFB 3KJFB 4BDPA 4UUWA 3IAM9 3MM5B 3SDEA 4HTJA 3PRBA 3T9ZA 4CLWA 4DQQA 1NJYA 2XZWA 3HSDA 2HPUA 1CJUB 7FDRA 4F0MA 2HBQB 2LKZA 1HLWA 3LH2S 2K7JA 4XDDA 4ES2A 1SJRA 3N28A 1UJ6A 1Y10A 5LMNF 2HHHF 2B5JB 2R8GA 4J9NA 1FKOA 2F9JA 2XMKA 1PAEX 3LP0A 4HEA9 2BJ9A 3R7BB 4QWCA 1U48A 1EAYC 1SJ3P 1TFYA 2Y1IA 1QY7A 4MAKA 4JUZA 3WIUA 3AAWB 2I5JB 1KVKA 3RBDA 2KL8A 5HQLA 1HBUA 3C2PA 1IBLF 3C16B 3UWTA 1YLXA 2IC3B 2OTLS 4BLGA 4QIGA 4OYIA 4OHZA 4DPOA 2DEJA 2D3UA 2MKHA 2QL5B 3AXKA 1S1UA 4PR6A 4YUDA 1ZOTA 3FKBA 4CDIA 1HNWF 3EWGA 1DFDA 5HVFA 4ER8A 1H38A 3MEGB 2E1MC 1S9GA 2HRYA 2O66A 1PKUA 1IBMF 4C8MA 1YGYA 4KFBA 1S59A 1XQIA 1R43A 2GVDA 1PC5A 2YWEA 1Q8BA 3Q86A 2GA7A 1DTQB 1S99A 3U1MA 1LWFA 3OL7A 1ZAWA 3NLCA 3CDUA 3V5RA 2HLTA 2UXDF 1UVLA 4DLEA 2ZOFA 4RW4A 1WC5A 2AJ4A 3D67A 3ET6A 3UNGC 2GAGC 3VGTA 5JVHQ 5J2QA 2V9WA 4E8UA 4WWSA 5L8RC 4Q8FA 1TMJA 2DGXA 2H51B 1B0TA 3CVKA 4FBUA 2OFGX 3FCHA 5KFPA 1O6XA 5A2QU 2JLEA 1EP4B 2ZVIA 3D6TB 3MM6A 3HFKA 2FJBB 4DL4A 1JX4A 3GG1A 4A8XA 5KFCA 3M8SA 2J9DE 5BR8F 2UU9J 3KLFB 3T41A 3CCMS 3MFIA 1KFDA 2B5JA 1UL3A 1GH8A 3NAIA 2XMUA 1S1WB 1SI9A 1VQ7S 5IT9Y 5DDQC 4LIRA 2PD1A 5I3QA 2DNOA 2ROPA 1UFKA 1M5SA 5H9FK 4Y2MA 1X60A 4RW9B 4EZ6A 3OVBA 1U0SA 3BEGB 4ICLA 1Q82T 3R27A 2MZQA 1RT6A 5IV4A 2KHCA 4DR5F 4M8LA 4U6PA 1D9DA 5C5JA 1WTFA 2HG4A 1RAJA 2IC3A 2I9SA 4DQPA 3MF5A 4GKKJ 3M9NB 3TRGA 2DY1A 3OQ2A 3R8YA 1U1KA 2WVCA 1VCTA 2J9CA 1SC4B 3PXGa 1FNMA 4FDFA 5GAGU 2H5JB 4B9TA 5C25A 1HWLA 3BH7B 1T05A 1SL2A 3CD7A 3NCQA 4ID8A 1RBOB 1VIXA 3B4DA 3QSIA 2YPYA 4TQSA 5F8GA 2ZH3A 4K4TA 4AL6A 1U1QA 1N36J 2MKKA 1DAXA 3R7SB 2IBKA 2FQQB 2GVDB 3CCWA 3OXFA 4IFVA 4CYUB 1TL5A 1WF1A 4RUHA 1EB0A 2LQ5A 2WOMA 3BGLA 5EHHA 3M05A 4CLFA 3JAMU 4WFAQ 4EU0A 5JVGQ 1OSCA 3TAQA 2RRNA 2M52A 4X66F 1I5OB 1TKZB 2QLXA 1S6PA 3HD1A 4R8UA 1KWMA 3TX0A 2VHGA 2HIQA 4ZPTR 5J2QB 2DRAA 2P6SA 4ZLJA 3L3CA 2B6AB 5DDRC 1LWCB 2B7CB 2E1RA 2MY7A 4IDKA 4P52A 1ZYQA 2V2QA 1GXUA 2HHTA 2LECA 3NRBA 2B3TB 2GS8A 2EFNA 3BR8A 5F8NA 4JV5F 3ETMA 1F9HA 4ANCA 5IT4A 2EW9A 2W8LA 3SXLA 3D9BA 1FX4A 5H9EK 2VG7B 4C8LA 1R8CA 2B9WA 1BWEA 2ZH7A 3JQJA 1VYAA 2NQPA 1S1WA 1HWJA 1S79A 1W26A 3EPIA 1QE1A 4A46A 1BC6A 4M5KA 3PV8A 4Z37A 5I42B 4ICLB 1N5SA 2WSCC 3GFZA 2AIRB 2M7SA 3HSJA 4KGVB 4OLOA 4QIEA 3W63A 3CTRA 4DL3A 2JEIA 2JVOA 4I67A 1TL1A 3D66A 3D6MB 1EQ0A 4EEYA 3AOBA 1JXEA 5KG5A 2F65A 4EO8A 1H3DA 5IS2A 2FIUA 2XYHB 3CJ2A 2VQFJ 1IBKJ 2EKNA 3DKDA 1FRMA 3KK1A 3BR9A 3HHLC 4LFCJ 1VISA 3JSBA 3HHLB 4DUZJ 1FWLA 1GMUA 3PKMA 3ILOA 3PKYA 2BM0A 4YDXA 3MTKA 5KFSA 2D3ZA 2B4OA 2YQ3A 4DR5J 1RA6A 1BMQB 4CYUA 1LK5A 2W2MP 3GFHA 3DCAA 3ILIA 2V68A 4NLYA 4DSIA 5B08A 4AXJA 3PYEA 4ZVHA 4O3SA 1RJJA 1Y0HA 4NLOA 1H2VZ 1YQHA 3BN4A 5ETOA 4DV7J 3GP9A 2MTLA 2QX0A 3P5BP 1I1GA 4I2QB 1TVRB 3CCQS 2BR0A 2UVWA 4K4ZA 2GJFA 3FRYA 4KHMA 4J9QA 4F04B 1C0UA 3I0RB 4LBIA 1LNQA 1EHWA 1T11A 2KT3A 2BM1A 4YB5A 5GAHI 3AA8A 3KTQA 3SV4A 3QLHB 4QYZJ 2FVSA 3W65A 3BQ2A 4ZP8A 3KFWX 2VPXB 3S8SA 4M5DA 2MPUA 4AL7A 1BQMB 2HNYB 3MM8A 1WKJA 3JTNA 3PR5B 3ADAC 4FF4A 1NRKA 3KXDA 5DGAA 2Q1LA 2V8VA 3ZZPA 3CJ4A 4ZIVA 3FC9A 2YVSA 4JI7F 3S1TA 1RA7A 1J5EJ 4LFCF 4NLGA 4M95A 1WNEA 3AA9A 4X84A 2DPIA 2NSBA 1Y00A 2G9OA 2EKYA 2CQ4A 3ENQA 4NE9C 2FHJA 3WBZA 2W4CA 3J81j 3OTBA 4WFBQ 2ZDOA 3TUPA 4PQUA 1HNZJ 1S48A 3I96A 1LWEA 3V6JA 2MQLA 1OY8A 2LP4A 4JI6J 3IRXB 4NYOA 4C7QA 1U6BA 4RWXA 1W2BR 4C8ZA 1S1TA 1JJ4A 1WACA 1RLCL 1LFWA 2GC8A 5E41A 2KO1A 4ES3A 1FKAF 3DXSX 5CAAA 3GCWP 4NLSA 3QRRA 5LXRA 1D0EA 3IXQA 3ETOA 3U1NA 2FLLA 2V8PA 2J9DA 3MGJA 2G0IA 2QN6B 4LF4F 5KG3A 5KT3A 1LW2B 4IYQA 2CJQA 1JJCB 2WHOA 1XERA 3DU5A 2ZH2A 3ITHA 1HL6A 3R5GA 2N82B 1K0TA 1RADB 4LF8J 2DJWA 3N79A 2K2PA 1CJKB 4EYHB 4I2QA 4K0KF 2VODA 4YEAA 5G0RA 4P7TA 3NWGA 2KH9A 1FK9A 1JWWA 5CCLA 2HVDA 3IWXA 1G1XA 4QW9A 4J9SA 1YJ7A 4A47A 4ENOA 2BANA 4LBHA 4DUYF 2XY5A 1X9WA 4JI5F 2JH3A 4DV6J 4YB7A 1RHRB 2B0GA 2ZH6A 4LF5J 4TVAB 5AE1A 5HATA 5JUMA 2IRYA 2WBMA 2ZVSA 4Y2IA 1SJ4P 1F60B 2EWHA 3I9V9 2X51A 3M8WA 3TUZC 1RYSA 1CEZA 1JKHB 1G4CA 2LQ8A 2W8KA 3FZ2A 1UZHA 5T14A 3DYAA 3G6XA 4ZK7M 2I38A 4DFMA 4DR6J 1KLMB 3F44A 3HFZB 4MJKA 4ZN3A 1VQMS 3J80U 1VK8A 2GHWA 1EKSA 2ALZA 4GVBB 1U1LA 4KJIA 3LW5C 5LSLA 4F50A 3W2WA 2Z56B 2QL7B 2V4JA 1FVQA 1Y11A 4NWBA 4DV3J 3R5DA 2I8EA 3CT9A 3RBEA 3DLJA 2E66A 2XEXA 2QLJB 2IM2A 3OXGA 3OSPA 1NJIT 3M8ZA 2IPOB 4DSFA 2QLBB 1Q86T 3QSYB 4ZVUB 3C14A 3M30A 3UD4P 3PEJA 4HACB 3RRGA 3KMSA 1FRLA 4QU7A 4QWBA 3TP2A 1PIEA 2UXBF 3MI7X 3QIPB 1OY9A 2E44A 2L9NA 2XMWA 1WD6A 2A10A 2VBYA 4IG3B 4WFYA 2J6UA 2JEJA 1UZDA 4WE1B 2FGOA 1YTYA 3BZQA 3J7AN 4RX6A 3VAJA 3DLEA 1Q8KA 1PGZA 2EBEA 1Q1KA 1CQMA 1OMSA 2WSFC 3E51A 4K5SA 4DSKA 1T9TA 3KDOA 3UCUP 1K44A 1VQYA 3KUEA 2M8DB 4W92B 5EX3A 3BGFA 5KFVA 3T6JA 3HPOA 3BGRB 2ZD1A 4Y0FA 1CS4B 3IR5B 4FVMA 4USJC 1RHQB 3KLGA 1TR0A 2CQGA 2VQEJ 1FJ7A 3J7YU 1IKWA 2DXFA 3FBBA 1CJKA 1N4LA 1JLCA 3Q0AA 2RDIA 5F41A 3D0GE 5G0RB 4Q44A 4KPYA 5HO4A 5HMZA 1N36F 3ENVA 4PKDB 3N4WA 2CPHA 3OL6A 2OELA 1TL7B 3CB4A 4P73A 3MM5A 3SDEB 3TA0A 3H42A 2CNOB 3D3CJ 1MWZA 3UCGA 2QFIA 5C24A 1L5UA 4I56A 1CJUA 2BRLA 2DTJA 1RDRA 5DLGA 1C1BB 4RKUC 4DV0F 1I94F 2ZZTA 1UW9A 4DV5F 2HRUA 3HMJG 3GZ7A 4DX8H 4GRSA 3JSRA 3BB5A 4CLZA 1CULA 1N88A 3FGVA 4ZVEA 4C3MA 2OH2A 1FT8A 3W2VB 3VAKA 4GVBA 4LR9A 4TU9A 2HBYB 1UCNA 2B9YA 3QGIA 4N47A 3WDOA 4DQRA 1VRUB 2C2OB 4ZLNA 2I5JA 2M9KA 1S9FA 2FLNA 4RW8B 2MMYA 2ZHBA 1TK5A 2BJ7A 2LEAA 2RRBA 2U1AA 4PWWA 1OWXA 2G2ZA 4C0OC 3QAEA 3NGDA 1KQSR 5ETMA 1B7YB 1X4HA 2HGLA 5HSPA 3OL9A 1PO6A 1YG0A 3NP5A 4CNZA 2CPXA 1OYDA 2AZ3A 1D9AA 2L08A 3ZZRA 5BR8J 2M0GB 1PSDA 2UU9F 6AT1B 4PPDA 2ZC4A 2H5EA 1HBOB 3PHTA 2ZH9A 2VQEF 3M32B 3A8EA 2C3YA 1WC6A 1FXRA 2XNQA 3L9ZA 2AW0A 4KAIA 3WX4A 5K8MA 2EFQA 1CVJA 3IC1A 3TUJC 4B3RF 4WF9Q 2G0CA 2YKAA 1TKDA 3W5XA 1NSQA 3EVMA 2OKQA 4QIWD 4KFBB 5J1EA 2P8IA 4I64A 3QRPA 3KLIB 3BGRA 1XR6A 4ZPWR 1RAAB 3ZZZA 4QQBA 1FA0A 2VJVA 2Z0GA 3MURP 1QD1A 1SB6A 1JXVA 1YJ9S 2YY3A 5E5NA 3H59A 5D0EA 3TARA 4I6YA 3GJQB 1VC5A 2AEJA 4CLUA 3P49B 1ZS6A 1RTZA 3T9NA 1P8GA 2I2YA 3H5XA 4Y6IA 2DR6A 4B17A 2KI2A 3D0IE 4TXSA 4HLBA 4NCGB 2CIMA 1W7WA 1BGXT 2EK1A 2G2OA 4J9UE 1AUDA 3MM6B 3R5JB 4ECRA 1QSYA 3M6VA 1DJ0A 2H1YA 2HQCA 3KHRA 3PW2A 4K4YA 2E9TA 1RTHA 2HIYA 3A13A 2G0JA 3P3DA 2MKIA 3L4BC 4NX9A 5K5MA 5A8KA 3C6UA 4N56A 2Z58B 3W2VA 2F4VF 1RT5B 2E5HA 4CCHA 4JP8A 4LT6A 1IBCB 2EI5A 4MYUA 4RW9A 3Q8VA 4YMEA 5HVHA 5KFBA 3LWMA 1QAYA 3K7RA 2ZC3A 5HJXA 3CDWA 2JWNA 1SXLA 5LMUF 1X5OA 4DOZA 2FVQA 2DHGA 1NCLA 2LQJA 3VTIA 2WK4A 3IS9A 3RB4A 2N7YA 5H1SV 4NA3A 2CNLB 3NWRA 5E3PA 1LQ9A 5E33A 4XDCA 1KS2A 1KOOA 4OZ2A 4BC7A 2HFOA 3D2WA 1T3OA 2QSFA 3SQOP 1WC3A 3EMTA 4N7TA 5LL6d 1U1NA 5KT5A 3K57A 1T03B 2GFFA 4NXMJ 3UVJA 4QOTA 2XHWA 2XS5A 3QJJA 2EC0A 3IBCB 2C2KB 1B0PA 2DHSA 3ZNJ1 3KYLA 2KM8B 2A0FB 2PT0A 2HFVA 4I7FB 2H48B 4KYZA 5J1EB 3CJQA 3H40A 3QT8A 5KFQA 2CQ1A 2FJVA 3KLIA 4DUZF 3UDCA 3C6TB 2WOMB 4KT0C 1GEHA 3NBPA 3VQTA 3NG8A 2DRDA 3FEZA 4KBIA 4KHRA 2NYIA 1N52B 1S4EA 2WAQD 3MMCB 1MWYA 5KFTA 5DDOC 2VQFF 3RAXA 2QEXS 4FYDA 4X65J 1TKZA 4CTAB 1T9WA 1RB0A 2FPHX 3MEKA 5KFXA 1M5HA 2NZ4A 4USVA 2BW2A 1LWCA 2J7KA 2RMLA 3OT9A 4IDKB 4LR7A 2DIVA 2VKZG 4WCEQ 3PR4A 3DRRA 3CCJS 4CWBA 5L38A 4DL2A 3PO4A 1XNQF 2F40A 3DOKB 2PFFB 1NK7A 1PAUB 1RT1A 3JYTA 1HHTP 3JTPA 4DV4J 4LF2A 4FP9A 4WKYA 5KT2A 3V6HA 2HZCA 5HK4A 4Y3CA 2IAJB 1T02A 2XCAA 1F1BB 3TEHB 2R8JA 4HKQA 1V6HA 3K8VA 2OPPB 3W8PA 4DV7F 4IFYA 3LF0A 3QIDA 5D4LA 1MLAA 1RT5A 2VKRA 1AT1B 5DG9A 1H7WA 3RR8A 5FDLB 1SC6A 4UOHA 2RDDA 4MKVA 1V9OA 2MSSA 4N41A 3EZOA 2BKNA 1F9FA 5FLXY 4EBCA 2NZCA 1IR1A 3R9LA 2MJNA 3AY0A 1F3VA 4I6AA 2E7VA 2N4CA 5L1KA 3PEHA 3TANA 3VAFA 5D8HB 3MR2A 2BJ1A 2H4WB 3QJPA 1O8BA 3BM7A 2K7KA 2JLFA 2QTWA 2MZSA 2RF2A 4H4KA 1UAWA 4HR2A 5DO2A 5IM0B 2N7CA 1RTDA 2AMCB 5E2QA 4P2MA 4N5SA 5J2NA 2MLZA 4MKAA 3VWSA 2BBEA 3KK1B 3LWLA 1KQKA 3GIRA 4QR0A 1SQFA 2DGTA 2J8AA 4ALZA 2W25A 5AXMA 5BYSA 2PN6A 2A18A 3ZXWA 1XMQF 2ACMA 2YX7A 1WUUA 4YY3J 1HD0A 1W2IA 4RUAA 1X5PA 1MMNA 1YSJA 3GILA 3SCLE 2AGPA 1XMOJ 1NJXA 3GV5B 5FD1A 2KVQE 1DLOA 1APSA 1H74A 2HQFA 2OAUA 2EC2A 2BJDA 4NMLA 5CQGA 4WKRA 3C6TA 1S6UA 3DXBA 1CPZA 2LA4A 2UUAF 2JNJA 3MMBB 5AE2A 2HFNA 2JVRA 3I4HX 4K7QA 1T9VA 2GVZB 3NOCA 3DMJA 1H2TZ 2VFRA 4RPFA 4M5GA 4DV3F 3PW4A 4CTAA 1HQUB 1TVRA 2DCLA 3O1LA 3C15B 3MZIA 3T3FA 1SKUB 2L9DA 2QIFA 2HQ3A 1SL0A 2HHWA 1Y3KA 2YKPA 3TZZA 3OVAA 5IC4B 3DRRB 1TK0A 5DJBA 1LKZA 2NPFA 3DOKA 3G96A 3KDNA 2HAFA 2GHVC 2QC3A 3WIVA 9RUBA 2DB1A 2ZHAA 3ENAA 2DO0A 5ETKA 2R7SA 1OY6A 3NGKA 4M5DB 1AUSL 1WELA 1ZA1B 2ZJRQ 2CJKA 4Q8EA 4DI6A 3A3NB 3OW2R 2UUAJ 4DUYJ 1MSWD 3O44A 5A76A 2HNYA 2IJFA 3MM8B 1L3SA 3TJ9A 2OPPA 2NS1B 2VH7A 2DR8A 2JOQA 2QMUB 3FEYB 2PC6A 4I68A 4PABA 3HULA 4PWDB 4CH0S 4ZN1A 2CDQA 4KH1B 2BW7A 5KG4A 5MLCV 3K8WA 4JI0J 2V2VA 1RXOB 2ZBCA 1N56A 3CMES 2P6TA 1NDCA 4LSLB 4IOAQ 5LOQA 5LJ5Y 3DN9A 2FHKA 1NBEB 3IG1A 1FRIA 2BACA 4U67Q 2AYGA 3DLLQ 1HYSB 2ASLA 2X7IA 1C1CA 4Z7CA 4DL7A 2J0SD 4YB1P 1WHWA 4HHUA 3RW7A 5SZTA 1RT4B 1FRJA 4CH7A 3GCXP 3PZPA 5E7OB 1NDKA 5KAKA 3MD1A 2CQHA 2CFXA 3EE3A 3BBCA 2IBOA 3UD5A 3K89A 4FNIA 4CRJA 4FYYB 1M90T 1H73A 4GKKF 3PX6A 2BOPA 5H9EJ 2B9XA 2NXEA 3HVAA 1RWWB 2VA2A 4WZQA 2YXLA 7AT1B 4MTPA 1RU2A 1RP5A 2VPYB 4IO9Q 2RU9A 4KHPJ 1BWVA 1R6VA 3GR1A 2G1HA 1WHYA 3JS9A 3SZ2A 2VC0A 1HNWJ 2HNZA 3NY0A 2KG1A 2AEFA 2V34A 2FJXA 4KHPF 2HBRB 2DIUA 3X1LB 4B3OA 1HQEB 3M8YA 4Y00A 3TWZA 3UQSA 1RAFB 2BJEA 3FMWA 4ZKAA 1KBRA 1X8DA 2R7WA 1E6VA 3DFEA 3CC2S 4JI8J 4K4SA 3VGUA 2QV6A 2RKIA 2Z57B 1GX5A 1OIAA 1QM9A 3M1VB 2CNKB 2R2SA 3RB6A 3DI6B 2K1RB 2WW4A 2BANB 3J7ZT 2A2CA 3KKFA 2WB1D 3D6HB 4ZJLA 1T9YA 2CQ0A 1JLAA 1RSCA 2IM0A 1OSDA 3LOUA 5HQMA 5L46A 5CZXA 2Y8WA 1H6KX 3PJXA 3UE2A 4RNOA 2WTFA 1HQ2A 4LBPA 2VBZA 4OZ3A 4DR4J 4DWIA 2XCPA 2UXCF 1AZSA 4DX5A 3NNHA 2GGPA 2CWXA 5DQHA 3HM9A 1NKEA 4HH0A 3DC2A 2BUNA 3M2RB 2AYEA 4LF6J 1YX2A 2VIHA 3DOLB 2GX8A 3MMJA 4OMFG 3CJRA 3NXZA 4PG8A 4B3MJ 3QATA 1S9EA 4NZ7A 2D9OA 2QGFB 2D3O1 1TV6A 1ZBTA 4EFAC 3DGPB 3RGIA 4LJMA 2KJVA 3Q8UA 4OYBA 4PAAA 5KFNA 3M2VA 4X65F 3CD5A 3L7PA 1VBXA 1T7PA 4JV1A 3FBCA 1RT2A 1VJQA 1VC6A 2EG1A 1FO1A 1YIJS 1OPZA 4XO0A 4R25A 5LMUJ 4JI3J 2QFJA 2PO4A 4AYBD 4ED0A 3G82A 1VQ9S 1KNZA 3GLJA 2FC9A 2XSJA 2HS0A 3ISND 3EX7B 1CQNA 1HIYA 2AYMA 3EXCX 3H2LA 3OL8A 1ZA2B 3BBBA 1IXKA 2DITA 2IFXA 3HHLD 4TQRA 3T5HA 2YWGA 2Z2MA 1U24A 3ILJA 2RB7A 5D78A 2HKEA 5IQQA 1TL3A 3BGOP 3WZ0A 2XQCA 2YKMB 3U27A 2D41A 2DNQA 1HNVB 2JRSA 1WHXA 2M70A 2MLXA 4DDFA 1PCAA 4Q45A 1JLCB 2FB0A 3OTOF 1JJHA 1VLYA 2LDYA 3SQGB 5HLFB 2KZZA 1L3VA 1XR7A 2B51A 3TQEA 2UXCJ 2GCFA 2OEKA 4F36A 1RZMA 1TL7A 2CQIA 3AOAA 3HFVA 3QWPA 1HMVA 4JOUA 4LUBA 4S0MA 1GMWA 2H5IB 2R2RA 4O3QA 4AT1B 3V4IB 2J6TA 3OR1B 4MH8A 4TU7A 2XO7A 5DQGA 4OL8A 1YJVA 4P7VA 4WK1A 1P9QC 1TL4A 3RB3A 2IY5B 4WIQA 3CSKA 3O8WA 4DXLA 3MUMP 1WC0A 1CULB 1UW4A 1YK9A 3IFEA 3LGHA 2IVYA 1L3UA 3GONA 4P2SA 2RJZA 1C4AA 1YKWA 4RW7A 5E3RA 1KTQA 3M2RA 5KFMA 2IM3A 2CQCA 4M5JA 1XNRJ 1WI8A 5E3AA 1Q8IA 1S0MA 2UUCJ 4GMKA 1WC4A 2C3PA 4KKOA 1D09B 1N8RT 1N54B 2W2PP 4F4XA 2R8KA 3MTJA 2XLIA 5E3CA 1WORA 2HK3A 3EICA 3CO0P 5CABA 1V5VA 2B4VA 4NI2A 1S0OA 3CCTA 3CJ3A 4ZHRA 2CQBA 3IWLA 3M32A 3MECA 3D7SB 2CJ9A 2LVWA 5KFWA 2IMWP 2XI3A 1NK8A 1NXIA 1NZAA 3A3PB 3GFXA 4ZCIA 3J81U 1NLKL 1B99A 1BQNB 1TQLA 3G82B 1U1PA 2XSJB 3RUBL 4AUKA 4CNYA 1XWLA 3A8KA 4URGA 2R4FA 4DMZA 1IKVB 2VPWB 1UJ5A 3KHGA 4DV1J 2DNNA 4U8YA 4QIFA 1N32J 4L72B 5F0WA 1Y9OA 2HS4A 3DLKA 2N4DA 1X9MA 3G8TA 2OSQA 4C9DA 4M5MA 4HI2A 2QA2A 1JLQA 2DNLA 1MU2A 1TAUA 2P9CA 4MT1A 1ZM3A 1TKXA 3UN5A 3O6QA 3V4IA 2IRXA 2O5DA 3MHYA 1YI2S 2F4VJ 2XNRA 4ECQA 1MW7A 2FJWA 3V6DB 2VFTA 3BKFA 1WG5A 3TVZA 5IWAF 4O0IA 3D6FB 2ZITA 3KUHA 5L39A 3THVA 4DR3F 2AGOA 1XNQJ 4OYWA 3AJ2A 5F8JA 4O3NA 1NU4A 5JJBA 3KK3B 4YDDB 4G6VB 5EWEA 1U45A 2UVRA 1R89A 1KKHA 2CJYB 1URRA 2LXIA 2W2OP 4NEYA 1FDDA 1K73T 2A6MA 2J0WA 1A7GE 1NPRA 1R0CB 1RACB 3CNQP 1U2FA 4PWUA 5HLFA 2CG4A 2DR5A 3TAMB 1YJTA 4GKJF 5EN1A 3W60A 5GAEI 2VG5A 5B0FA 1HBNA 2GQQA 2PEBA 4J9MA 4OI6A 3TAPA 1SKWA 2LDIA 2VFSA 3D1QA 2FY1A 5ETSA 4PZVA 2RQMA 4F67A 4AQYJ 1CG2A 1S1UB 2ILYA 2GIRA 3OD2A 1O5JA 4KV8B 2IRUA 5LM7E 3U02A 5DGBA 2XMJA 1Y3JA 2XI2A 3MEGA 1KR4A 3V2UC 5KFFA 3AQOA 2KFYA 1VJWA 3GV8B 2OJ3A 3I32A 3LP2B 3TVYA 4TU8A 1SQEA 3KK2A 3LTOA 2GIFA 5D15A 2MKSA 4WP3A 4DCOB 4O4GB 5F8HA 2RQKA 1HI0P 3GFYA 3NBPB 2DVIA 2NXCA 2WVDA 2K3IA 2ZH5A 5B0GA 5KFZA 4M1KA 2BE9B 2V0NA 3AJDA 4H54A 2IMOA 3K5OA 3ONQA 2WVEA 3DNCA 1B4SA 4R0EA 4CLLA 4XPCA 2BE7D 5M2PA 4ECWA 1OS5A 2RHSB 4B9SA 1OYEA 1UEUA 4IR1A 1KP6A 3QAUA 2DK2A 2MZ1A 2CZVC 4ED1A 3ZZTA 4B3SJ 2VA3A 3OXLA 1CBKA 1ITPA 2YBVA 1RT1B 1B64A 1SV5A 1EP4A 4OHWA 4AQYF 3NL0A 1UVIA 5K8PA 3RB0A 2DGUA 1LFPA 1IUJA 3KLFA 5GAEU 1RKJA 2MLYA 6FDRA 1CJTA 4W4MA 2D74B 1ZH5A 2FUG9 4TLQA 4LF4J 2FLOA 4Y2KA 5C7PA 3NS7B 1D8YA 2X3DA 5BYRA 2VV5A 5KG7A 3TEGA 1QLNA 1DQ9A 2UXBJ 1VRTB 3MR6A 4IRDA 3FSIA 4RUBA 4OX9F 3EZUA 3H5SA 3LAKA 2XY7A 1IKXA 4E0DA 1VR6A 4YB6A 5J2NB 1NHVA 1HR0F 4KR0B 5J2PA 1B0VA 1WJ9A 4J90A 3UO0A 5C25B 5K8OA 4KO0A 4KV8A 2JEFA 4Y28C 1T05B 1PC4A 3NKYA 3X3UA 2D69A 4ILMA 1NK4A 3BSOA 4NLPA 1WF0A 1FDNA 1NB2A 1XR5A 1VBKA 3QO9A 4G65A 5EUHA 3KLVA 3KK2B 4IFVB 4F4WA 3L7UA 2OLWA 3IBWA 2C3UA 3R6LB 2XTJP 4P74A 2YNFB 1CC7A 2F5GA 4DN0A 3V81A 4NXMF 3DMJB 4OX6A 4WIIA 5D0RA 3PY8A 2PI5A 4B9UA 2Q43A 4NLUA 4OYZA 1FNOA 1I51B 5DG7A 1HR0J 1WKKA 3AODA 2D9PA 2HVZA 2HWTA 5ADZA 3TI0A 2B6AA 2ZH1A 2F7VA 2KYXA 1S12A 3KLEB 2ACYA 1N33F 3GPAA 1VGYA 3AQPA 3K5NA 1NKBA 1HKAA 1PYOB 2CPYA 2UUWA 5A8RB 3J81Y 2EVZA 3B78A 4ETXA 2J7UA 2VG7A 3GR0A 4CT8A 3CDAA 4OZJA 2QSWA 4LVOP 1M5OC 2ZH4A 1EARA 1K1SA 3AB2B 2L41A 4KTQA 2ZWOA 3ZNUA 1ZZFA 2WB4A 1S49A 2KVIA 3MEDA 4YFUA 1F5AA 2FVCA 2OD4A 5D0HA 3BQ1A 3NGSA 3KJQB 4JBCA 3LPEA 1RCXB 1WWHA 2JEGA 1N33J 1AYEA 1JLBB 3W9HA 2E1CA 1KQGB 4B9VA 2IDEA 5HBMA 2OPSA 2DNGA 3MAHA 2D3OR 4O0NA 2P9GA 3GSDA 3NNCA 2DNYA 1Y4ZB 5KFLA 2LFVA 2CPJA 2OPQB 3VALA 2XBPA 3FCVA 1HNXJ 2F8EX 4I4BA 2CPFA 4F2RA 5KFUA 4EO6A 4EBDA 4UQGA 3CW2C 1X4CA 3FFIB 2J5AA 1FJEB 2FGCA 5CCMA 2W9BA 4X4TA 1JLGA 2HSEB 2XMVA 4DSJA 4LQ3A 1JLEA 4B3RJ 2NPIA 4RZRA 1IJFB 4DL6A 2LYVA 1P1TA 2FHOB 2PMWA 3IA0A 4NZ6A 3N6NA 5ETTA 3V81B 1S0NA 3KG1A 4AL5A 2MQMA 5F9NA 3M7VA 1RBAA 4ETZA 2D7SA 3GTYX 1C0UB 2HWHA 2OHDA 2YKQA 2Q79A 4RNFA 3Q8RB 3KHLA 4EGLA 2VD3A 2J8SA 3M9OB 2R3VA 3QLHA 1UA0A 2L3MA 3POTA 4RBUA 3QGPA 4OV6A 3WC2A 3HLUA 5IFMA 2HNDA 4C8KA 2G2YA 4ZPVR 3SSSA 2HHVA 2HBZB 3BV8A 3DLGB 3CCRS 5KOXA 3OTEA 1F2GA 2GQCA 2U2FA 3GG0A 4TY8B 1YJRA 2ZUGA 5KFRA 3T6BA 5ETLA 3CCVS 3ZZ0A 3R5AA 3FEXB 4K8RA 4B3SF 2XS2A 3PM9A 1S4FA 1YBUA 2GGPB 3BPDA 2DISA 2KXFA 3H20A 3UDLA 4ECXA 4W90B 4X62J 4HHHA 1HA1A 2B4PA 2AZ1A 1KQFB 2NR0A 1J2VA 3GQCA 1YVFA 4BCAA 1JLBA 1HI8A 2IDLA 3JSYA 3O5TB 4G1QB 2BE2A 5KG0A 5CA5A 2YKNA 1IKYB 5I4MA 3PW5A 3IRXA 4PXDA 3D5MA 3OFHA 3GV7B 1S1TB 1MROB 1S7IA 1J27A 2CNNB 4NCBA 1L3KA 8RUCA 2A2DA 3H8YA 2R7QA 3FJ2A 1M5KC 2K06A 1GQEA 4FVCA 4LRFA 2VUGA 4LFBJ 4ED8A 3RAMA 5D6GA 2V6AA 3FFIA 3T5LA 5GMKa 2ZZMA 3MOJB 4U96A 1N0VC 1XMBA 4PUOA 1RWVB 3MEEB 4ERDA 3Q8SB 2M5YA 3SCKE 4DR1F 1IR0A 1JLEB 1VK3A 2YKMA 1GXTA 4USHA 4MKBA 1HARA 4NLVA 4V1Ak 3RBZA 4F26A 1U02A 5LSOA 2V69A 1MN9A 3Q83A 4P9SA 4ZVOB 4XPEA 2CADA 1K0VA 1FD2A 1FK9B 1FD8A 1X4FA 3H5UA 3W62A 3GSIA 2MEWA 1UA1A 1TELA 2BJ8A 2HZAA 1H0HB 4G1IA 3BREA 1RHMB 3PIOQ 3TVKA 4F4AA 3MD3A 1RT3A 3G9CA 5IOLA 1U7LA 2BMBA 2ZKTA 3OLAA 1NK6A 3HJFA 1T95A 4TY8A 3VAHA 1ZZNA 4JYAF 1JKHA 1V3RA 3OR2A 4PCQA 5D4OA 3DYAB 2KFNA 3HVRA 4A8QA 3KLHA 3JAMY 1UKUA 2HVEA 3VGSA 1CSJA 4KSEB 5F9LA 2R7XA 1VQLS 2RVJA 5IT0A 2R7RA 4AXIA 3W2WB 5A0YA 3OTCA 4PRFA 2RAQA 3K5PA 2DKOB 1IM6A 4ZPAA 5SUHA 1EJ7L 1Y5LB 4CQ1A 3I0SA 3O2IA 5HROA 2BE2B 4DR4F 3E01B 4F3QA 4ECTA 4OLPA 3VV2B 4JI2J 3DRPB 3MXHP 4GKJJ 3CIMA 3CCES 4RLEA 2H65B 4GVLA 1KC8T 4X4SA 4QYZK 2BZ2A 2CVEA 2HVHA 3BJYA 1LW0A 1NDLA 4QR1A 1F2HA 4WE1A 2WVFA 4C11A 4KGZB 4ZIWA 2WBRA 1R8AA 1G7CB 4KE5A 2OIHA 3NGUA 4QJVA 2MZTA 1FEHA 4UW2A 3NS6A 1HHQA 2FVRA 2XSFA 2B8PA 2BEFA 1VQKS 2O1PA 2X3GA 3A12A 3GB0A 4FYVB 4JV2A 2DRBA 2ILZA 1A6LA 1CS4A 3HZEA 4KGMA 1FNXH 1N6QA 1UVMA 3R7NB 2WZ1A 2CPEA 1UWBA 2HQIA 3GJTB 4OZNA 1IKWB 1NH8A 4MIBA 1FHTA 2DR9A 1TK8A 2D1CA 4ZVRB 4F2SA 1JQGA 2YNHA 4Y65A 1JLQB 2FC8A 2ZEJA 2VPZB 3LALA 5HI7A 2CVIA 3SEOA 1GNKA 2HYIB 4URQU 1RUSA 3OFGA 1FJCA 2G13A 2LXUA 2MQNA 1LV5A 4QYRA 1RT3B 4R5PB 4DQIA 2C2ZB 2V8GA 2CZ9A 1UP1A 2QG9B 1C0TB 3DRSA 4OYXA 2BOAA 4URSA 1YJWS 3GIMA 3GJSB 1M1GA 1UWAA 4FKYA 3E8OA 3SFGA 4ZITA 3S7RA 2XGQA 1QTMA 2DT9A 2HQGA 3OTDA 2ABYA 3RTVA 3DM2B 3ILLA 4N76A 3ZZYA 3HDSA 3N5FA 3HXMA 3I82A 3TR5A 4A8OA 4ILLA 2CQ2A 3H25A 3FRZA 3MPYA 4RW8A 4E2FB 1AROP 3TAMA 3UD3P 2ADBA 2YQ0A 3I0SB 4K4WA 3AH6A 2K3KA 1SQGA 3FVYA 3H5YA 2KM8C 3SMZA 1FWPA 2AU0A 3DRPA 4V19X 1F6TA 1AFJA 2AJQA 3MR3A 3J7Z5 1UEKA 5KT6A 2RH3A 1HBOA 4MIAA 4ELUA 1HHSA 2W9CA 1Q16B 3G71S 4DN9A 3M2UA 2LEBA 2DNKA 2VZ9A 3I56S 3UW1A 3CPWR 2HMIA 3KMQA 2NXJA 1RU1A 3RRKA 1FX2A 2HQDA 1TUVA 1U6FA 3EGVA 2FJAB 3LP2A 3PYFA 3R3TA 2R42A 2AF6A 3HI9A 4FYXB 2GZOA 1K9MT 1V3SA 2FJDB 2VU5A 4DPYA 4DV2F 2NXNA 3QWUA 1SIWB 1LK7A 2XS7A 1REGX 2X1BA 4DFPA 4A48A 1OJ4A 4AFFA 2Q6BA 1ROFA 4B02A 3G6VA 2RU3A 4RU9A 4DFKA 3NGTA 1GMVA 2HGMA 4R8UB 2UV8A 1IBLJ 2OTJS 2KB2A 2AJ1A 1S97A 2P5VA 4ZP6A 1RHKB 1S1XB 2IIHA 1QAJA 1MN7A 4NCGA 4Q2LA 1S0VA 4MKYA 4CO4A 4K4XA 1J5EF 2HHXA 4NLTA 1HPZA 5JMNA 1TP7A 1Q5VA 5THWA 3NCRA 2W24A 1X0PA 1WG1A 5KFEA 1V3ZA 3AT1B 4RUCA 4B9MA 2KT5A 4UTGA 3LP0B 4H4KC 1KEKA 2R2TA 1X4GA 5D4NA 3GMGA 4C0BA 2YKOA 5RUBA 1URNA 1R0AA 1NM2A 5I42A 1UJ4A 2VBXA 4DBQA 1HD1A 4JI5J 2FJEB 1NAQA 4P2XA 1J5OB 1R31A 4NASA 3KHHA 1TL1B 1VDHA 4ES1A 4DV1F 2HW3A 1VOMA 4CLPA 1NJZA 4DSEA 4B9NA 4HL9A 3PG9A 3P4UB 4P72A 3O3LA 5ETNA 1KVJA 1WG4A 4ZPBA 5AXNA 2CJAA 2QA1A 4HDGA 3BYPA 1H72C 4X4NA 1W25A 3OBIA 2OUGA 3HHLA 5J2PB 1P1LA 4YR0A 2DR7A 4BBYA 2HMIB 1U0HA 3W61A 3E2EA 1ZAVA 2AX1A 1K1QA 2IYIA 4DZ6A 4LF9F 3AXMA 1B3TA 3QGGA 1XBWA 2BKPA 1DQAA 2DCUB 1VHIA 3QO9B 4NRUA 2C1EB 4FXWA 3MAAA 3SCIE 1NH7A 5AE3A 1F0XA 4Q7AA 2XO6A 2W9AA 1Q4RA 4WFXA 1SVDA 4V19J 4LMZA 5CD4A 1F5BA 2F4FA 4LRBA 5B0BA 3F73A 2GO9A 4RW4B 4DX6A 2ZM6F 2MXYA 2EBGA 4DZDA 3ET6B 3R6GB 2RQCA 2OPRA 2YNIB 2QO3A 1EQMA 2KRRA 2Z2LA 2ROEA 2V4QA 1VI7A 2AYBA 1JMTA 1EX8A 3J7YI 2JC1A 3FSXA 4RW6A 2Y9HA 1NJWA 1RWUA 3HZGA 4Q43A 2ERRA 3N6LA 4LREA 1ZM9A 1KSPA 1FF2A 5B0DA 1A9NB 2HHUA 5B09A 1S57A 4FN5A 5BXIA 2DHHA 3L7OA 4MYTA 2J76E 5BJRA 1Q8LA 4K4VA 1BQMA 3N6MA 3R97A 4RNHA 3OSNA 1RK8A 4BC9A 2M4MA 1TTHB 2XLJA 3P45B 3JSMB 3NNAA 3EVWA 2QRRA 2VDIA 3PW0A 1I6JA 3HK2A 4TN2A 5C2GA 3EPGA 1J5OA 4X66J 2EPIA 2ALYB 2BJ3A 3NS5A 2KDOA 4CO0A 4LF9J 4DPTA 1WKLA 4X4PA 3G87A 4USWA 1LWEB 3IO1A 3IN5A 4DF4A 4ELTA 1RTDB 1XNRF 3A8JA 2QZ8A 4DG1A 2DEIA 5GMDA 3HHNB 5KFOA 3M8QB 4N8OA 4CI0B 2XYGB 2Y1RI 2OPQA 4WK3A 2OGUA 3D4JA 3RU0A 3W9JA 1NSAA 5IZHA 3PX4A 4Q0BA 3T1HJ 4ED2A 1X9SA 1FFGB 1FERA 3DDKA 3M6WA 4O3RA 4J9VA 4XIUA 2BV3A 3OFFA 1FVSA 1TKTA 4HH1A 1VRQC 1Z4UA 2LLZA 1RWXB 2JFDA 3VHQA 1KD1T 3VAMA 4L76A 4RU2A 4FF3A 1OQ6A 1RTIB 1LW2A 1GXLA 4QWDA 4YY3F 3EJMA 4FF2A 1IQTA 1NK9A 3U7JA 3MUVP 3H4DA 4LFBF 2B8QA 4OX8A 3SSRA 4JI4F 2MY8A 3CDBA 3JTOA 2KXHA 2GVZA 3PYDA 1FEEA 4U8VA 1NKCA 4I6WA 4RJVA 4MFBB 3EDQB 3MPVA 3C15A 4LF7F 3D1OA 5HAOA 4ANEA 3KJVA 1NHKL 4ECVA 4RW6B 1O0PA 3A8IA 3CGIA 2DXEA 4XTTA 2VASA 5A8WB 1YJNS 3C46A 3M6UA 3K5MA 1KONA 3I9ZA 2X1AA 1R8BA 1MNEA 2J0QD 5F8LA 3IWNC 2ATCB 2PMZD 1NEEA 2CG8A 1EKRA 1HW9A 2H9ZA 2NUUG 1FXDA 1KLMA 3AB4B 3M9MB 2KN4A 4ECUA 4USUA 1UPPA 1VBYA 2JC0A 3P6YC 2V4JB 2F9DA 1WEZA 5DS7A 2B56A 4OQJA 2DNZA 2AV5A 2Q6CA 3I4PA 1FRHA 3VF0B 4CLSA 5CXTA 2CPDA 5EWFA 3QQCD 3Q8QB 3IG1B 3NEKA 4NOHA 1IKYA 4ZA1A 2PFDA 4EI2A 3RRHA 3D3BJ 1JIHA 1FXLA 1C1CB 4GC7A 3PX0A 4JI1J 4QWAA 1XMOF 3KWMA 5E3QA 4CO1A 4L75A 5CH7B 3UN2A 4LF5F 5DETA 1U1MA 2DNPA 4IG3A 3CJSA 1RTJB 4Q0BB 3DU6A 1QJHA 3JQKA 1XK8A 2QL9B 3UFCX 1VBZA 2PEHA 4UUXA 2HEKA 4JYAJ 4K59A 1S1VB 3QGHA 5EDWA 2GAHC 4DR7J 3PVXA 3OJUA 4ATNA 2AJ2A 4NEZA 1N0UA 5ETRA 5I3UB 1HQEA 1S7HA 3HVWA 1GAOA 4JI2F 1FRKA 4YHHF 3K17A 2VL1A 2ADCA 5LXYA 1E6VB 3TA2A 1XC9A 3I0RA 2GMJA 1UTAA 2ZOMA 3N5BA 3KJVB 3MM9B 4ILRA 2UUBJ 2IHR1 1JNRB 4KQZA 4USTA 3ZFVA 4K50A 2QJ3A 5A8WA 4DEZA 3BDPA 2DNMA 2BA9A 4ZMMA 1UVNA 1VQNS 1SL1A 4CZCA 2WW8A 4RNNA 2MKYA 1KHWA 2CPZA 2W2QP 3H7HB 2VICA 5CHCB 2C2DA 4DR7F 4X4UA 2AWZA 4L74A 2LMIA 3RW6A 1AZSB 1RHJB 1VFJA 5D0GA 3KLHB 4A8SA 1SH2A 2FDNA 2LU1A 3VGVA 3JXOA 8AT1B 4OX9J 3BQ0A 2E29A 2QA4S 5CYMB 1PYSB 1U47A 1TU0B 1LXNA 2KYZA 3U1LA 3TJ8A 1YBTA 3SFUA 2MZJA 1RWOB 4ED3A 3UI3A 2I6WA 2E9ZA 3LQVA 2CA9A 4HVZA 4CM2A 1ZPVA 3G8SA 4YR2A 2J6SA 2JDJA 4DR2F 1NHUA 5DLFA 5F8IA 5F3TA 3W8GA 3IM9A 1T9XA 3H2UB 4NZ0A 4PXEA 4WU3A 5DZ6A 3OLBA 1LW0B 3OPKA 3I6PA 4OZLA 5AXLA 3QYYA 1RTJA 5F8MA 4FPRA 1I3OB 4CLYA 3SYZA 2XGPA 1TUWA 2CXEA 4NRTA 3C3LA 3W3SA 5GAHU 1T94A 2V9KA 3DOMA 5CYQB 5J2MB 3ZZOA 3BKUA 1RQ0A 2C3MA 2CRLA 1JJ2R 1HNZF 3KG0A 2W2NP 3ZTRA 1EETA 3HKWA 5A6PA 5H9FJ 4C97A 5L1JA 4EWTA 2FHJD 4NLWA 3R5CA 1NUEA 3US5A 5BYQA 4C48A 3T19A 1BY9A 2PSZA 4C2MA 3FK4A 3MMAB 1T8EA 1QAIA 3FCWA 2YNHB 4TYAA 1KTVA 3L95X 2R2UA 4C8YA 1HWIA 1B7FA 4NYZA 5LMNJ 2KZMA 2XULA 1Q7LB 2XZDB 1U2CA 1RT7A 1KHVA 3HVTA 1Q5YA 3GIJA 3VAGA 4ECZA 1FWKA 3WX8A 4NXNF 2WSEC 4J9RA 2ATLA 1C0TA 1RE1B 3AD7C 2LCWA 4BWJA 3KG4A 4YS2A 4AE5A 5B7WA 1Y7PA 5KOWA 5A8KB 5CD4H 3C6UB 1ZTTA 1Z2LA 3Q22A 5KT7A 2DPJA 4RBVA 3TJAA 3DLBA 1GTHA 4RR5A 1ZETA 3DM2A 2HFZA 3G6ES 2QE5A 9ATCB 1RABB 1WSRA 2CAJA 5KFYA 5L9NA 1XEZA 4BS2A 1TFWA 1ULRA 1SBRA 1HBUB 5B0EA 1F9EB 4DSLA 5AT1B 2GQ2A 2YWWA 3IGVA 4WXWA 4C98A 3C14B 3M30B 4ANDA 3D54A 5HQ8A 4DPXA 2SXLA 3HX9A 2XC9A 4A8YA 2FZGB 2DHAA 4QIVA 3DDIA 4PYAA 1NZ8A 1HW8A 5EWGA 5CZVA 3HCXA 4NPOA 4C3KA 4OZ5A 3UVJB 2YWHA 3DLEB 3EM1A 2W9CB 2NREA 2CPIA 4OI3A 4Y2AA 3KOAA 4I7FA 2EG2A 3CCZA 1U26A 1C2PA 4P71A 3MCNA 4U9RA 3LO3A 1VC0A 1HNXF 3NMAA 1DTQA 2V8DA 4UY8T 4DR6F 3KLGB 1N48A 1PILA 2ZBPA 1H98A 2GMLA 2ZDPA 2COLA 4IQMA 4WBFA 2F63A 3MMCA 4X62F 1VQ4S 3DLKB 4L3KA 4EK2A 1RWKB 3DGVA 1D9FA 1DHMA 3DLHA 3EZ5A 3C8YA 1IJEB 3I87A 3MDFA 2JSXA 2QLWA 4WYLA 2MQPA 3I55S 1YHQS 2ZZNA 5LSRA 2J0XA 2PE8A 2QMXA 1REVA 4OX7A 2V67A 1TKXB 3EGZA 1RT7B 3HVTB 3JYTB 3TQ1A 4U7UD 5C24B 4L73A 1M5VC 3OHBA 4YN3B 2HFUA 1HPZB 1C1BA 1S72S 1UETA 2E1PA 5IV3A 3SCJE 4BHQA 2ZJPQ 4A8KA 1RI7A 2CKWA 2O67A 4KB7A 2XG8A 4ZVGA 3WQPA 4F4KA 5LJ3Y 1FFWB 3PW7A 2E1AA 3CD6S 5FDLA 2HRTA 1VQ5S 1VRUA 4M94A 1NB7A 1RT6B 2VB6A 3PRDA 3RBXA 2QT7A 5HANA 4X64J 3CC4S 2W1BA 2DH8A 1HBNB 1N5YB 3LP1B 3CDEA 1U25A 3RYLA 4OJ1A 2RF2B 1FFSB 1UFLA 2YQ1A 4UZCA 3OJSA 4ZLLA 4K0KJ 5HMYA 1UEVA 3K58A 3J7A1 4CLKA 4RBTA 4RNMA 1T9UA 3AOCA 2ASDA 2GO8A 3CJ8A 2MQQA 2UUBF 1Y5IB 5T41A 2JLGA 2MZRA 1KRPA 3EVOA 1UVJA 2R7OA 4DV6F 2RE1A 1M5PC 1X7VA 3D68A 3CCSS 1AFIA 4DQSA 4OI1A 3Q24A 1GX6A 4O4GA 2VC1A 3F0NA 3ULHA 3AHPA 3J80Y 3MMBA 4MMOA 2R7TA 1NNDA 4NLQA 1FE0A 2FZCB 2V4RA 1HFEL 2RUSA 3PDNA 1S6QB 1HQUA 5KG6A 1QAXA 2FZKB 2OPRB 2YNIA 3IAS9 2KXNB 1CC8A 1DRZA 1IBMJ 1WEXA 1TAQA 1V5IB 1WSVA 2IJNA 2OI2A 5G4DA 2DY9A 3W5YA 4YQWA 2BQUA 5KFDA 1DQ8A 2Y0SD 2ZKUA 4KGXB 1R8PA 3DRYA 3TNVA 2NSCA 4J7CA 2E5GA 3DHWC 3UNYA 3UCZP 2RILA 4MK8A 3I5BA 4CP5A 4YR3A 3BF4A 3FBEA 3N9UC 4NYPA 1RTHB 3HKZD 3BDEA 1FTRA 2BYCA 4ID5A 2RT3A 4H4MB 3JSMA 1N32F 4OI4A 4ZDNA 4PWDA 2ZWPA 2DO4A 4M63A 5KFJA 4EZ9A 2HLUA 2OEMA 5FLXU 3ZC4A 3T1YJ 1R7IA 2AD9A 1Q7YT 4LSLA 3PO5A 3M8PA 5B0AA 4Z2XA 4TKTA 2WVBA 4ZCLA 3ZTQA 1N5YA 4IH7A 3LP1A 3DHXA 4IUFA 4LF7J 3T1HF 1X5TA 4LVNP 1U6ZA 4QPTA 5K14B 3VR1A 4WP9A 5J1NA 3TUIC 3FQKA 3P96A 3TZXA 4IRKA 1RCOB 2DBBA 2VG6A 1BLUA 7FD1A 2Y1JA 4X4OA 2GJ2A 1WOPA 4ZVTB 3F56A 2BVZA 3PRVA 3GU0A 1MMDA 1TKTB 3H98A 2VOPA 2BKOA 4K4UA 1DZ5A 4DR2J 3HSZA 4RL1A 3QFHA 2EFVA 2ZUAA 3CJKB 1RTIA 1SJQA 4OV1A 3ZZUA 2C2RA 2HNZB 3QT7A 5KG2A 3D0HE 2YNFA 3MCSA 3QMQA 4JI0F 3W9IA 3OUYB 3ICLA 2LQ9A 3BO2A 1KVIA 1U4BA 4JI1F 1SKSA 1L3TA 2V94A 2UP1A 4MFBA 1D3WA 2O01C 3PJWA 4KY3A 4ED6A 3AJ1A 1FESA 2J9EA 1WC1A 2LU2A 4I2PB 4K5RA 4NL5A 4A8MP 1Q0NA 1RGVA 1S6OA 2HHHJ 3DI6A 2MJUA 1K47A 3TX8A 3E3XA 4GC6A 3CULA 1BXNA 4FZVA 4OYMA 2RRAA 3PCOB 1U1RA 1YZ7A 3GJRB 1CLFA 4DUTA 2XZTB 2EXUA 2R7UA 2F3JA 1SJ1A 1RLDA 3BO3A 2MKJA 4ID5B 2C2NA 4IFYB 5KTQA 3CO9A 5GADU 3C66A 4A8WA 4P6QA 4M5NA 5DM7Q 1RAEB 1NSKL 1X4DA 3MPDA 2BQ3A 1D8ZA 1KN6A 1OPIA 1Z2ZA 2XLKA 3UDEA 4CT9A 3WHIA 4U7UK 2VFUA 1UPMB 4TLRA 3UDVA 3M8PB 3CCUS 4J9LA 2OD6A 4NLRA 4KIAA 1TV6B 2E7WA 2C3OA 4MIWA 4X4QA 4LSNA 4I1TA 3DGPA 3Q8PB 3HJVA 3TOQA 5IM0A 4U7CA 2C2MB 4OYPA 3M2VB 5KFGA 3VZHA 3CXCR 2YH1A 1P27B 2YNGA 2PA8D 1YJUA 2W7AA 5K9FA 5KFIA 4UT4A 1C4CA 4EMDA 5J1PA 3MFHA 4FS2A 3I31A 2AHOB 2RD5C 2UUTA 4I0WA 4XAKA 5DRKA 1S1VA 2G4BA 2V5HG 2W9BB 2W7OA 4KH0B 1TUGB 4IG0A 2J7WA 4O3OA 2OMOA 3OUYA 3ITHB 3ZTSA 1T3NA 1FJGJ 2RHQB 4L6V3 5I3UA 4QU6A 1Q95G 1UFWA 5KG1A 3HF5A 4WYWA 2ZE2B 4A8FA 2E5LF 2VFVA 5KFAA 5T7LA 3ZO7A 4DLGA 1NMEB 4DR3J 2APOA 3F41A 4I2PA 1UMJA 4F7VA 2ZBQA 3PFEA 2DGWA 5DG8A 4UOFA 4Q5VA 1RYRA 3SIPB 2W4DA 1DARA 2JHEA 3POTB 2RNEA 3RZAA 3CD0A 4UQTA 2PMHA 3WC0A 4JI4J 2UVVA 4JI3F 1ELOA 2IYGA 3DLGA 2B9EA 3AFGA 4LSZB 1WDDA 4HYKA 4NA1A 1JB0C 2YH0A 3RAQA 2MQOA 4DS5A 1G2EA 2CZ4A 4OHYA 5FIIA 3G2XA 3R5BA 1VQ6S 4HDHA 4CO5A 4QR2A 3TA1A 2DHXA 1R3NA 1HWKA 1SUQB 1X4EA 2RIJA 3CJ5A 4HT5A 2OFHX 2MKCA 3CWJA 2CQDA 3BYRA 5CYMA 1X0FA 2NXUA 2VOOA 3NAHA 1PYTA 2KU7A 3TW0A 2OO4A 4PPZA 3Q2TC 1HBMA 1X4AA 4LSNB 1BQXA 4JI8F 3NMRA 1JNZB 2DGOA 2HURA 3MCOA 3VAIA 3NOGA 4J37A 3M6XA 5M2UA 1RT4A 2HK2A 4NI2B 4ELVA 4ED5A 2EEYA 2H3EB 2GW8A 2QMWA 3MAAB 3GYNA 3ZTOA 2G1DA 3HP6A 4EYIB 4O4RA 2VJUA 1E6YA 2I1RA 2IM1A 3DOMB 5J2MA 4WTYA 2AT1B 3CCLS 3BBFA 4QW8A 1FCAA 2JFKA 4A4JA 3G6YA 2UV8G 4GO7X 4DL5A 3SI8A 1HNIB 2VDHA 2ZD1B 1EETB 3IBFB 4Y2CA 2XM3A 4FF1A 2C22A 1N5VA 1U8SA 3HD2A 1ZM2A 3A4TA 4WP8A 4ZP9A 2KHDA 4YP3A 2K8GA 1PJ5A 4DU7A 4PG6A 4CIOA 2ZH8A 1X31C 2R7VA 2ZE2A 2ZOGA 3IR7B 4GO5X 3RG6A 2AEMA 5KFKA 4LIWA 5T7LB 3GIIA 2RDJA 3MMAA 4DU8A 4WPAA 3GE9A 2RKIB 3M1VA 4N77A 5ETQA 5K8NA 1RAIB 4PXCA 4I69A 3VQSA 3S6EA 3TYTA 4ZVQB 1PG5B 3ELHA 4G3IA 1YRXA 4NCAA 3W1YC 1QDUB 4BWMA 5L1IA 4LR8A 5ITHA 2AX0A 3EXYA 3V6DA 2XY6A 3LUYA 1R6YA 4WTOB 2WCXA 3OR2B 2CWKA 4OYAA 3EGWB 5HL7Q 3M4XA 4FYWB 4C8NA 3EUNA 4OJ3A 3VCDA 2DGSA 3V4MA 3W64A 2JL9A 4WFZA 1GK8A 2V2KA 1R8HA 1IR2A 3T1AA 2ZM6J 3DOLA 2DYAA 3N01A 1IBKF 4FXDA 1XIQA 2HHSA 1S9EB 2B4UA 2O3DA 4Z7YA 5HMXA 2VG5B 3E01A 1ZAXA 3IR6B 1XJWB 5M2RA 3PACA 4WXOA 3HT3A 2M2BA 2RSQA 3Q8YA 3NCPA 4F0HA 2X1FA 1GMWD 3AD8C 2W4PA 4DX7A 1FDBA 1BHNA 1NPKA 2NCKL 4G1PA 3OV7A 4C11B 1GT8A 2DH9A 1NDPA 1YRTA 1YDLA 2ZBIA 3CIZA 1G3OA 1IM4A 3DRXA 2WONB 4KPCA 4XK8C 4E98A 1S5ZA 5CYJA 2MHEA 3LA0A 1P6TA 2EFOA 4MK9A 1DURA 4O3PA 3QJLA 3R2CJ 2GNKA 3HHEA 3QZ8A 5FJ4A 1AW0A 3LPYA 3CJ0A 5ETPA 2CDRB 2AJ0A 2NLWA 1ZPWX 2VBWA 5ETVA 5LT5A 1WF2A 1N6QB 2NYHA 4ZPCA 8ATCB 4KC5A 4JI7J 1AXQA 1UWBB 1FKPB 5A2QY 2FHMA 2R8IA 3T1YF 2YPZA 3L09A 4USIA 1ACMB 3OHAA 2BRKA 1U8WA 2BX6A 3I5CA 1ZM4A 3HHDA 4OJHA 4UF4A 5U47A 3SQGA 3W7BA 4O44B 4CO3A 4DCJB 3RJMB 1SC3B 4ZCMA 2JX2A 3QNWB 5GVQA 2QA4G 4FNHA 4CH1A 3V6KA 4NA2A 3QT6A 2ZNYA 3JQMA 3BH6B 4NLXA 4F25A 1HMVB 1REVB 2XWXA 3FUYA 1M1HA 5IC6B 4J9KA 2JJ4D 3MM7B 2AQ4A 1FDAA 4U95A 4R5PA 2UZAA 3OR1A 4OHVA 4ZJQA 4UOCA 2HVIA 1FRXA 4DJBA 1MMLA 3ISNC 4ED7A 1OQ3A 3B82A 4PQAA 4R0JA 4DL0C 1T0TV 1QSSA 4OHXA 2ZNZA 2CQPA 1S10A 4X64F 2RQ4A 1DY3A 2LQBA 5GADI 2JZ5A 3SV3A 4WZMA 3Q23A 1SKRA 1QUVA 1XN9A 1XTZA 2Y0BB 1Q81T 3M8RA 3IRWP 2MB0B 1YZ6A 1ZTWA 1QVGR 3ZTPA 2ASJA 1ICEB 1VRTA 4DPWA 2B7BB 2V2ZA 4ZVSB 4KKOB 1YITS 4FS1A 3T5KA 1H2UX 1RWNB 2BABA 2CUYA 2NUHA 1YWXA 3IS9B 4Q2MA 2GJIA 4C0HA 4WFNQ 1HWUA 2X1GA 2E5LJ 5IWAJ 2DH7A 1SIZA 1GFWB 3MR7A 4LRCA 1N5TA 2KT2A 3KNGA 3NGRA 4OZ1A 5D4PA 4ZPDA 1KDNA 3VZIA 3GYXB 4DCPB 5HVGA 4DFJA 1T03A 4DV4F 3LANA 5HMWA 2WONA 2MYFA 2LXFA 1CJVA 4HTIA 3FMBA 1BQNA 2W01A 1YBAA 1JXLA 4PG7A 4ECSA 3RR7A 2FY8A 3ENWA 1XMQJ 1WTBA 5IT9U 3TZYA 3BSNA 4B3TF 3IM8A 4N8NA 3BPSP 2FVPA 2OMLA 2YTCA 1S6QA 4DV2J 4F3OA 4M5HA 2C42A 1RHUB 5EX0A 4IO1A 2BXJA 2DNHA 1FTCA 4QCLA 1MU2B 1X4BA 3GWCA 3IMQJ 3KLEA 2UXDJ 5GMEA 1S1XA 1SJFA 2V50A 2MQ8A 1N34J 3MM7A 1MWQA 2M3DA 3QFWA 2YWFA 5MAOA 5A8RA 2KKHA 1VQSA 1HI1A 4FKXA 1DTTA 2Z30B 2IAJA 2GMHA 2Y3YA 5HN0A 1SPBP 4QWEA 2ASYA 1F5CA 2ZFHA 1SCJB 4DS4A 3D28A 3KK3A 2VF3A 4H4MA 4OZ0A 3IGNA 3PYGA 3MEDB 4J5OA 5IXUA 2PGCA 2H4YB 2N3OA 1FJGF 1M0SA 4IRCA 1RAOA 4X4RA 3UR3C 4OYOA 3CJTA 3Q2SC 3W5ZA 3THPA 1S76D 3AD9C 3H2VE 3R1LA 4P10A 2E5IA 3C19A 6FD1A 5KT4A 1U2RA 5K14A 2VONA 2E7XA 4J9PA 4DR1J 1N34F 4LF6F 2VG6B 1P9YA 5HP1B 3CEDA 4UZBA 1U0HB 1N5QA 1CJVB 3FZBA 4P75A 4QBUA 1NK0A 2MGZB 1HYSA 1DLOB 4YHHJ 3BGUA 4NLDA 2HWIA 3EDRB 3CJKA 1AA1B 3QT5A 1R0BG 5I3PA 4YOEA 2PI4A 1SH3A 3G86A 1KLNA 4D3HA 3KNAA 3W66A 1S6PB 3P8BB 1PJ6A 4DF8A 1WOOA 1SC1B 1U49A 4D3GA 2Q66A 3FQLA 2KFZA 1YRUA 4HHJA 4M5LA 1RKIA 1Q78A 3MUTP 5JXSA 4PXBA 1RWMB 3K2YA 4EBEA 1RAGB 2MSTA 1SV5B 2KG0A 4PG5A 4B08A 1RWPB 3HSGA 2F8HA 3PNIA 4TY9A 4IH5A 3BSAA 1DTTB 1TZ0A 3BKTA 3FDSA 4O23A 3G8QA 2EFPA 2OSRA 3OFEA 3UN3A 4NMXA 4LFAF 1CJTB 2PDAA 5DZ7A 2W7PA 1BD6A 5GAGI 4LRDA 1QE1B 2H54B 1VLOA 2OEJA 4RO0A 4UY85 2CQ3A 2E5JA 2AKWB 2LEPA 2PA3A 4DV0J 1I94J 4L3NA 3PTWA 1A0OB 1K8AT 4K2JA 4ZP7A 3VVUA 2XMAA 4Y34A 1X5SA 2DGQA 4PYDA 4ZOSA 1WHVA 2MDAA 2IVMA 1Q53A 1WEYA 4ZCKA 1MG7A 2EK6A 3CF5Q 3IP0A 5AJ3J 1IKXB 2ROGA 2XMTA 2Z2YB 4J9OA 4DG1B 3H90A 1O51A 4M5IA 1MROA 3A3OB 3M8QA 2IA0A 2YNGB 4WJBA 3S01A 1QSLA 2ZHOA 2C2EA 1R27B 3THTA 2A1BA 2P2CB 1NSPA 4KO0B 3UPFA 5HP1A 4LF8F 4ZS6A 2L9WA 2RS2A 4F8RA 3LGNA 4LFAJ 1G6BA 2XB2D 2MGZA 1QTNB 3A1YG 1LOUA 1RISA 2PIIA 1OO0B 3H4BA 3K59A 4PUOB 3MOZA 3MEEA 4IG0B 4K2XA 2BQRA 2AGQA 1IVZA 2POKA 3HO1A 4B3OB 4IR9A 2FLPA 2FTRA 1AB8A 2A6OA 4FPIA 2Z8QA 3K5LA 4EUVA 4OFZA 2Q3PA 2HGNA 1PBUA 2GV1A 4B9LA 2HHQA 3BS9A 3KUGA 4USMA 3N0VA 4ITSA 5C42B 5AJ3F 1LXJA 2K1RA 2YX4A 2DGVA 1IWAA 4ZVFA 1VQPS 5D3GA 1WDTA 3OTOJ 5HJYA 2GHPA 1NPPA 1QUPA 1VMBA 2XMMA 3HHKA 4LF1A 2I0XA 5F0UA 3Q89A 3TO8A 5EGYA 1JLAB 2N3LA 4MK7A 4B3MF 3CMAS 3QRQA 4KGKA 3GYGA 1WI6A 2KJWA 2AP6A 2HHPA 3I5AA 5F3ZA 1S77D 4OIXA 3CC7S 2F8MA 2A3JA 3BSCA 3PIPQ 2M8HA 3MR5A 2WRMA 1FI4A 2MHNA 1VQOS 4OI0A 1IQZA 2IA6A 4C6AA 1U09A 2CJXB 2CJBA 1DBDA 2ZBRA 1SUQA 5A0YB 5DM6Q 5C2CA 4ECYA 2QYGA 1EIYB 4C3LA 2B43A 1QVFR 4F4ZA 4H4OA 4PG4A 5HROB 4WU2A 4TNOA 4F4YA 1JK9B 4PQUB 5HBMB 1HBMB 2OPSB 5L9XA 4F3MA 5L1LA 2F1FA 1B70B 3PHEA 3KJNB
chains in the Genus database with same CATH topology
2RUGA 1RT2B 2KTQA 3CUNA 2OP5A 1Z1ZA 3G4SS 5AXKA 2P9EA 3PFOA 2IVFB 5IQ6A 1E6YB 3JB9k 4C8OA 1SH0A 1D1UA 2XWYA 4IQXA 1HNIA 1JLGB 2HS3A 3EYZA 1TL3B 2V8HA 4C4WA 1HNVA 1VHFA 2DNRA 3MWBA 3ISZA 4QZVB 3OVSA 3B8HA 4IOCQ 4JI6F 4RWWA 3GIKA 1GTEA 1JLFA 3MM9A 2GIQA 5C42A 1IN0A 2Z4PA 2HAIA 3DDNA 3UR0A 2R9LA 5D3GB 3K0JA 3BN7A 4IH6A 4F02A 2LA6A 3R1HA 2HNDB 3FNNA 1NK5A 1VIOA 1KOHA 4HI1A 3T5JA 2CYYA 3DRSB 3CE8A 1FKOB 2ZJQQ 4QPXA 4DHVA 2DD8S 2YWKA 2UUCF 1Y5NB 2L48A 3SSQA 4RW7B 3MPWA 4CO2A 3EGNA 1FE4A 4ZLPA 5KFHA 2BDPA 1Q79A 5D77A 4H4OB 3FSYA 4G1QA 3LAMA 2YKNB 4IKAA 1NO8A 3LGMA 2FD2A 4JV0A 4KRWA 5E0OA 3QIPA 4X4VA 2EFGA 4ZHRB 3B4MA 3MECB 4FBTA 3QPIA 3D1HA 4HT7A 1KFSA 1H7XA 3M2UB 2KRBA 5A6WA 5DQIA 2C28A 5CYQA 1S9GB 2R8HA 1M1KT 4IOBA 3MAQA 5DDPC 4LQ9A 3BO4A 2AJFE 1VS3A 1LWFB 4OJGA 1IKVA 2UVUA 4X2BA 4FXVA 1FKPA 2RS8A 1UVKA 4TYBA 2E9RX 2M88A 4OI2A 2YX1A 3QZ7A 1U1OA 2QYCA 3P5TL 4O44A 1VQ8S 1JLFB 4BDPA 4UUWA 3IAM9 3MM5B 3SDEA 4HTJA 3PRBA 3T9ZA 4DQQA 1NJYA 2XZWA 2HPUA 7FDRA 3LH2S 2LKZA 4ES2A 4EYIB 2K7JA 4XDDA 2HHHF 1SJRA 3N28A 1UJ6A 5LMNF 2B5JB 2R8GA 4J9NA 1FKOA 2F9JA 2XMKA 4HEA9 3LP0A 4QWCA 1U48A 1SJ3P 2Y1IA 1QY7A 4MAKA 4JUZA 3AAWB 2I5JB 3RBDA 1HBUA 3C2PA 1IBLF 3UWTA 2IC3B 2OTLS 4QIGA 4OHZA 4DPOA 2D3UA 2MKHA 1S1UA 4PR6A 1ZOTA 1HNWF 1DFDA 1H38A 3MEGB 2E1MC 1S9GA 2HRYA 2O66A 1IBMF 4C8MA 1YGYA 4KFBA 1R43A 5GAHU 1PC5A 2YWEA 1Q8BA 3U1MA 2GA7A 1DTQB 1S99A 1LWFA 3OL7A 1ZAWA 3NLCA 3CDUA 3V5RA 2HLTA 2UXDF 1UVLA 4DLEA 2ZOFA 4RW4A 2AJ4A 3UNGC 5J2QA 5JVHQ 2V9WA 4E8UA 5L8RC 4Q8FA 2DGXA 1B0TA 3CVKA 4FBUA 2OFGX 3FCHA 5KFPA 2JLEA 1EP4B 3MM6A 3HFKA 2FJBB 4DL4A 1JX4A 3GG1A 4A8XA 5KFCA 3M8SA 2J9DE 5BR8F 3KLFB 3CCMS 3MFIA 1KFDA 2B5JA 1UL3A 1GH8A 3NAIA 2XMUA 1S1WB 1SI9A 1VQ7S 5IT9Y 5DDQC 4LIRA 2PD1A 5I3QA 2DNOA 2ROPA 1M5SA 4Y2MA 4RW9B 4EZ6A 3OVBA 3BEGB 1Q82T 4ICLA 3R27A 2MZQA 1RT6A 4DR5F 2KHCA 4M8LA 4U6PA 1D9DA 5C5JA 1WTFA 2HG4A 1RAJA 2IC3A 2I9SA 3MF5A 3M9NB 3TRGA 1U1KA 3OQ2A 2J9CA 3PXGa 1FNMA 5GAGU 4B9TA 5C25A 1HWLA 1T05A 1SL2A 3CD7A 3NCQA 4ID8A 1VIXA 3B4DA 4TQSA 2ZH3A 4K4TA 4AL6A 5F8GA 1U1QA 4ELTA 2MKKA 1DAXA 2IBKA 3CCWA 3OXFA 4IFVA 4RUHA 5B0CA 1TL5A 1WF1A 5EHHA 2LQ5A 3PVXA 2WOMA 3BGLA 1U4BA 3M05A 4WFAQ 5JVGQ 4EU0A 1OSCA 3TAQA 2RRNA 2M52A 4X66F 1TKZB 2QLXA 1S6PA 4R8UA 2HIQA 4ZPTR 5J2QB 2DRAA 2P6SA 3L3CA 2B6AB 5DDRC 1LWCB 2B7CB 2E1RA 2MY7A 4IDKA 1ZYQA 2HHTA 1GXUA 2LECA 3NRBA 2B3TB 3BR8A 2EFNA 5F8NA 4JV5F 5IT4A 2EW9A 2W8LA 3SXLA 2VG7B 4C8LA 1R8CA 2B9WA 1BWEA 2ZH7A 2NQPA 1S1WA 1HWJA 1S79A 3EPIA 1QE1A 4A46A 1BC6A 3PV8A 4Z37A 5I42B 4ICLB 1N5SA 2WSCC 3GFZA 2M7SA 4OLOA 4DL3A 2JEIA 4QIEA 3CTRA 2JVOA 4I67A 1TL1A 4EEYA 1JXEA 5KG5A 4EO8A 5IS2A 1H3DA 2FIUA 3CJ2A 1FRMA 3KK1A 3BR9A 3HHLC 3JSBA 3HHLB 3PKMA 3PKYA 2BM0A 4YDXA 3MTKA 5KFSA 2D3ZA 2B4OA 2YQ3A 4DQSA 1RA6A 1LK5A 3GFHA 4NLYA 3DCAA 4DSIA 5B08A 4AXJA 4O3SA 4ZVHA 1RJJA 1Y0HA 4NLOA 1H2VZ 1YQHA 3BN4A 3CCQS 4I2QB 1I1GA 2BR0A 1TVRB 4K4ZA 2UVWA 3FRYA 4KHMA 4J9QA 1C0UA 3I0RB 5GAHI 2KT3A 2BM1A 4YB5A 3AA8A 3KTQA 3SV4A 3QLHB 4QYZJ 2FVSA 3BQ2A 4ZP8A 3KFWX 2VPXB 3S8SA 4M5DA 2MPUA 4AL7A 1BQMB 2HNYB 3MM8A 3PR5B 3JTNA 4FF4A 1NRKA 5DGAA 2Q1LA 2V8VA 3ZZPA 3CJ4A 2YVSA 4JI7F 3S1TA 1RA7A 4NLGA 4LFCF 4M95A 1WNEA 3AA9A 4X84A 2DPIA 2NSBA 1Y00A 2EKYA 2G9OA 2CQ4A 3ENQA 3WBZA 2FHJA 2W4CA 3OTBA 4WFBQ 2ZDOA 4PQUA 1S48A 3I96A 1LWEA 3V6JA 2MQLA 3OL9A 3IRXB 4NYOA 4C7QA 1U6BA 4RWXA 1W2BR 4C8ZA 1S1TA 1JJ4A 1WACA 1LFWA 2GC8A 5E41A 2KO1A 4ES3A 1FKAF 3DXSX 4NLSA 5LXRA 1D0EA 3IXQA 3ETOA 3U1NA 2FLLA 2J9DA 3MGJA 4LF4F 5KG3A 5KT3A 1LW2B 4IYQA 2CJQA 2WHOA 1XERA 3DU5A 2ZH2A 3ITHA 1HL6A 2N82B 1K0TA 2DJWA 3N79A 2K2PA 4I2QA 4K0KF 2VODA 4YEAA 5G0RA 4P7TA 3NWGA 2KH9A 1FK9A 1JWWA 5CCLA 3IWXA 1G1XA 4QW9A 4J9SA 4A47A 2BANA 4DUYF 2XY5A 1X9WA 4JI5F 2JH3A 4YB7A 2B0GA 2ZH6A 5AE1A 5JUMA 2IRYA 2WBMA 2ZVSA 4Y2IA 1SJ4P 1F60B 2EWHA 3I9V9 2X51A 3TUZC 1RYSA 1CEZA 1JKHB 4EYHB 2W8KA 4DFMA 3FZ2A 5T14A 3KNAA 3DYAA 3G6XA 4ZK7M 2I38A 1KLMB 3F44A 4MJKA 1VQMS 2ALZA 1VK8A 2GHWA 1U1LA 4KJIA 3LW5C 5LSLA 4F50A 3W2WA 2V4JA 1FVQA 4NWBA 3R5DA 2I8EA 3CT9A 3RBEA 3DLJA 2E66A 2XEXA 1NJIT 2IM2A 3OXGA 3OSPA 4DSFA 1Q86T 3M30A 3UD4P 3RRGA 3PEJA 3KMSA 1FRLA 4QU7A 4QWBA 3TP2A 2UXBF 3MI7X 3QIPB 2E44A 2L9NA 2XMWA 1WD6A 2A10A 2VBYA 4IG3B 4WFYA 2J6UA 2JEJA 4WE1B 2FGOA 1YTYA 3BZQA 4RX6A 3VAJA 3DLEA 1PGZA 2EBEA 1Q1KA 1CQMA 2WSFC 3E51A 4K5SA 4DSKA 3UCUP 1VQYA 2M8DB 4W92B 5EX3A 3BGFA 5KFVA 3T6JA 3HPOA 3BGRB 2ZD1A 4Y0FA 3IR5B 4FVMA 4USJC 3KLGA 1TR0A 2CQGA 1FJ7A 3J7YU 1IKWA 1N4LA 1JLCA 3Q0AA 2RDIA 5F41A 3D0GE 5G0RB 4Q44A 4KPYA 5HO4A 5HMZA 1N36F 3ENVA 4PKDB 3N4WA 2CPHA 3OL6A 3CB4A 3MM5A 3SDEB 3TA0A 1MWZA 3UCGA 5C24A 1L5UA 4I56A 2BRLA 2DTJA 1RDRA 5DLGA 1C1BB 4RKUC 4DV0F 1I94F 4DV5F 2HRUA