1X5TA

Solution structure of the second rrm domain in splicing factor = 3b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
GSSGSSGIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor 3B subunit 4
publication title Solution structure of the second RRM domain in splicing factor = 3B
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x5tA01
3CCMS 2LQ5A 2FC8A 1ZZFA 1Q82T 3B4MA 2CPJA 2KI2A 3G4SS 1M5KC 2ADBA 1FXLA 1N88A 1DZ5A 1NO8A 1UW4A 4LMZA 2L08A 2N3LA 4Y0FA 1X5PA 2CPEA 2LKZA 4WFAQ 3MXHP 5DDQC 4PKDB 5LXRA 3CF5Q 1X5SA 5CA5A 2VOOA 5DDOC 3HHNB 1U1OA 2LXIA 2DNGA 2VOPA 1WEXA 3NS5A 1U1PA 4C4WA 3J7YU 2M8DB 2LA4A 5D78A 4F26A 2O3DA 1KOHA 1RK8A 2J0QD 2OJ3A 5GAGU 2GO9A 1ZH5A 3CCQS 2N7CA 5HO4A 2DGWA 3SMZA 1URNA 1QM9A 2E44A 2F9DA 2KRRA 1QVGR 1JJHA 2KN4A 2RUGA 2WBRA 3SXLA 5LJ3Y 4WKRA 3TO8A 2MMYA 2XS7A 2CQHA 2BZ2A 2MB0B 4ED5A 2DGUA 2DNOA 5GVQA 3IRWP 3JB9k 5JVGQ 4TU7A 2MJUA 1X4AA 3I55S 2DITA 1YIJS 2KVIA 3LPYA 2RRAA 1WG1A 1X5TA 3CULA 1FO1A 2M70A 4Z2XA 2MY7A 5H1SV 2MSSA 3NNCA 1YHQS 2CQ1A 2X1FA 1M1KT 2PE8A 2CPZA 2M4MA 4LJMA 1F9FA 2MQLA 1K9MT 2K8GA 4C7QA 1YI2S 1VBXA 2HGMA 3CUNA 5GMKa 1XN9A 2CPYA 2XNQA 2DHAA 4YB1P 3OW2R 1Q7YT 1WHYA 1Q86T 2CQ0A 1Q81T 1M5OC 1FJEB 2CQCA 2DNRA 1B7FA 4IOCQ 2CQ3A 5LSLA 1M5VC 5D77A 1OIAA 2MQQA 2KRBA 2PEHA 2OIHA 2MYFA 1U2FA 2KH9A 3NNAA 5GAEU 5DDPC 1G2EA 2RU3A 1U6BA 3BO3A 1S79A 5LJ5Y 4W92B 2KYXA 2MZTA 2MZSA 3K0JA 1VQ7S 2LCWA 3P49B 2M88A 3THTA 5CYJA 2MQPA 4CH1A 1YWXA 3MDFA 2EK1A 1H6KX 4U67Q 2I2YA 1VQ6S 1VC5A 2FY1A 2DNQA 4FXWA 2MKCA 3S8SA 3S01A 5GADU 3G9CA 3H2UB 4F25A 2DNZA 4PR6A 2DNMA 4FXVA 1D8ZA 2DNLA 3G6ES 3NS6A 2DNYA 1VC6A 1DHMA 3CCSS 3SDEA 1FJ7A 2DNNA 2CJKA 2KM8C 4CIOA 2KM8B 2V94A 2CPHA 2MZRA 5JVHQ 1YJWS 3CMES 2MKKA 1M90T 2DGQA 1VQ9S 2RS2A 1VQMS 2MQNA 1YJ9S 1HA1A 3EGZA 1UP1A 4QU6A 1WG5A 2AD9A 1R8HA 2KXNB 1H2UX 2KHCA 1WEZA 4W90B 3PIOQ 1O0PA 4WFBQ 2DH8A 3DXBA 3G8SA 2DGTA 4PRFA 5IFMA 1SJRA 2CQGA 3ULHA 2X1BA 3B4DA 1X4FA 2CPXA 2FPHX 2MKJA 3TP2A 1YITS 1VQ8S 5FJ4A 2DGSA 5IM0B 4IO9Q 3CD6S 2M8HA 4OZ1A 1X4HA 1DRZA 2HVZA 2FC9A 2E5GA 2MKIA 5DETA 2XSFA 2OTLS 2CQ4A 2MJNA 2OTJS 2SXLA 2NLWA 4CH0S 2ADCA 1X5OA 4UQTA 1FNXH 2FHOB 1PO6A 3H2VE 5HL7Q 3MD1A 3U1MA 3CTRA 3BO2A 1JMTA 2GHPA 1NU4A 3G8TA 2XNRA 2M0GB 3PIPQ 2DISA 2M7SA 2DIVA 1U6FA 1NJIT 2YKAA 3R27A 1VQKS 2CQBA 1YTYA 1WEYA 3R1HA 1WHXA 2M52A 1UFWA 2D3OR 3BO4A 3D2WA 2DHGA 3UCGA 2MGZB 1WHVA 3CCRS 2ZJQQ 3EX7B 1K8AT 2HGNA 4TU9A 1VQ4S 3I56S 1FJCA 2DNHA 2LECA 3Q2TC 2N82B 3CXCR 3CMAS 3VAIA 2AYBA 2OSQA 1WF2A 4C0OC 3MUTP 1WI6A 1WF0A 2MZ1A 1FHTA 3HI9A 2CPDA 2J76E 4QU7A 4TU8A 2QEXS 1OPIA 2QA4S 2LMIA 3MURP 1HD1A 3UD3P 5EN1A 1OWXA 1VQ5S 2CQIA 2JVRA 1X0FA 3P5TL 3VF0B 1DBDA 5DM6Q 1VQLS 1N54B 4WFNQ 2RQ4A 2LEAA 3BS9A 2MQMA 1VBZA 1PGZA 2CPFA 1JJ2R 1ZZNA 1FT8A 2L9WA 4IOAQ 4BS2A 1U1NA 2YTCA 2ERRA 3RW7A 2M9KA 3Q2SC 1RKJA 1L3KA 4RU2A 2XS5A 3VAJA 2LEBA 3UD4P 2F3JA 3VAKA 2MHNA 3UE2A 2DNPA 2DGOA 3BEGB 1A7GE 2DB1A 4YUDA 1QVFR 2KXHA 4WCEQ 1VBYA 5GAHU 1IQTA 2DGVA 2DHSA 3RW6A 2AYEA 2U2FA 3CCUS 2HYIB 2LA6A 2JRSA 3N9UC 2X1GA 3MUMP 1KC8T 2DNKA 3L3CA 2CQDA 2KG1A 2G1DA 1U1RA 2D9OA 1P27B 5IM0A 4QPTA 3CCVS 3UCUP 2UP1A 3US5A 4OZ0A 3MD3A 2RRBA 1SJ3P 3CC2S 1W2BR 3FEYB 3G71S 3UWTA 5DDRC 5LXYA 3CPWR 2J0SD 1X4CA 3U1LA 2AYGA 2DO0A 3ZZZA 1N52B 1SXLA 1SJFA 3NNHA 1KOOA 4LIRA 1WTBA 2CPIA 2F9JA 3VAMA 3NMRA 2G0CA 2MKSA 2G4BA 1WHWA 2A3JA 2LXUA 2MXYA 4EGLA 2J8AA 2KG0A 4V19X 3J7ZT 2BOPA 3R1LA 1S72S 1N8RT 2CQ2A 3UCZP 5ITHA 2YH1A 3P3DA 1M5PC 2MKHA 2MSTA 2U1AA 2MGZA 2AYMA 3LQVA 2MZJA 3CC7S 4UY8T 3TYTA 1VQPS 1KD1T 2E5JA 2M2BA 3MOJB 4F02A 3ZZYA 1KQSR 3CCJS 3CCES 2EVZA 4CQ1A 1JJ4A 1H2VZ 2MY8A 1H2TZ 3S7RA 1X4BA 2KFYA 5IQQA 2KXFA 3CCLS 2KU7A 2ZJPQ 2B0GA 2XB2D 1WG4A 3DLLQ 4J5OA 2VONA 1SJ4P 1U1QA 1K73T 1R8PA 2LYVA 1WI8A 4M5DB 2Q79A 1CVJA 2JWNA 2EK6A 4IUFA 1A9NB 1BY9A 1VC0A 2RQCA 5DM7Q 2I38A 2MQOA 3MI7X 3P6YC 3IWNC 4WF9Q 4A8XA 2RVJA 2X1AA 4P6QA 2CQPA 3VAFA 2KT5A 3VALA 3V4MA 5MLCV 2DIUA 3MUVP 1WWHA 2DK2A 2L41A 4Y00A 2NZ4A 2QFJA 1X4EA 3G96A 1VQNS 2DH9A 2JVOA 2DO4A 2E5IA 2RNEA 2JX2A 1VQOS 2DGXA 4WIIA 1SJQA 1U1LA 5CXTA 3VAGA 1OO0B 2K3KA 2ZJRQ 2HZCA 4TLQA 3THPA 2DHXA 5BJRA 2N3OA 2YH0A 4ERDA 2MZQA 1U1KA 2D9PA 2DH7A 2E5HA 2RT3A 2VODA 2RS8A 2HGLA 1HL6A 2YWKA 1WELA 3VAHA 1X4GA 1YJNS 1X4DA 4ZKAA 4QQBA 1WF1A 2OSRA 5LSOA 1U1MA 2XS2A 1AUDA 1D9AA 3SDEB 3S6EA 4YOEA 3EGNA 1HD0A 3FEXB 1UAWA 3CC4S 1P1TA 2MPUA
chains in the Genus database with same CATH superfamily
1MMNA 5AJ3F 1XR7A 3MFIA 3BN4A 3RG6A 1UW4A 4XIUA 1JLQB 3BB5A 5C5JA 3LWLA 2R7VA 2VV5A 2MLYA 2HS0A 2Z56B 3J7YU 2EFPA 2JHEA 5D78A 4KR0B 3AFGA 2J0QD 2UVWA 2PO4A 3ILLA 1WC5A 4FYWB 3CCQS 2E44A 3PR4A 1S0NA 4JV0A 2RJZA 3ITHA 2CNKB 3TA2A 2J9DA 3L7OA 1JLGB 3DLEA 2BM0A 1H3DA 4C0BA 4I68A 4PABA 2KB2A 1WSVA 2JSXA 3CUNA 4OYWA 4FF4A 4A8QA 2V4JA 2AEMA 3IR5B 3RBDA 4HR2A 5KT7A 4NZ7A 2F4VJ 4OI6A 2OIHA 2MYFA 5DQIA 4RBVA 4NZ6A 5DDPC 3R5DA 4A8YA 1Q5YA 1HWJA 3TVYA 2A1BA 3VGUA 3MCNA 4X4VA 4ZPBA 5IV4A 2YWHA 2ZITA 2KVQE 2CKWA 1HBNA 4PXCA 4XO0A 5IT9U 2LU1A 4ED2A 1FJ7A 3AOAA 4DL6A 4LRBA 1VQ9S 1GXUA 4FNIA 3MPUB 3HK2A 3MFHA 2I9SA 4TN2A 3M32B 4ID5B 4NASA 1L3TA 1JLQA 2KXNB 4YR3A 3LP0B 2W7AA 4ICLB 1GXLA 2XYPB 2IYIA 1SC1B 5KFBA 2VDIA 4CH0S 2ADCA 5L8RC 1QTNB 5CZVA 2NPIA 5GADI 3H2VE 3UI3A 1RWUA 1HPZB 2KFNA 2NXNA 3TJAA 1UJ4A 3PIPQ 2G2YA 3QWUA 3BF4A 4BHQA 3O3LA 5L39A 3OTDA 3DRPB 3GU0A 2O5DA 5D4PA 3BV8A 2ROPA 3JSBA 4I64A 5L1JA 4HDHA 3OL9A 2OSQA 5DGAA 4EYIB 4J7CA 3KK3B 1KBRA 1WF0A 5B0BA 4B02A 5BYSA 1TMMA 4X64F 1DFDA 1UWBB 3VTIA 5A6WA 2K1RB 2QZ8A 4OV6A 1Q79A 5D6GA 3DYAB 1OQ3A 1RYSA 3IP0A 3LGHA 1ZTWA 1JJCB 4F2SA 2V8VA 4DPUA 5H9EJ 2F5GA 4MK8A 1REGX 4EWTA 4JBCA 4OHYA 4GC6A 3L7UA 3HJVA 4DL0C 2DNPA 2KXHA 3M32A 4ID5A 2HQGA 1XR5A 1U2RA 2AYEA 3LP0A 1BQMB 3N9UC 3VVTA 4ICLA 4KE5A 1YBUA 3JQMA 3ETMA 3T1AA 3HPOA 4CLWA 3UCUP 1NSPA 1FRHA 3MD3A 4OYOA 3BKUA 3AOCA 1L3UA 2A3JA 3TUJC 1HPZA 2C1EB 3J7ZT 1OQ6A 1S72S 4CLSA 3UCZP 3DRPA 4XDDA 1UA1A 4EZ6A 4ZVGA 2U1AA 1WORA 2GAGC 4Q7AA 1YJUA 5M2UA 1PILA 2MKYA 2BX6A 2XWYA 3OVBA 4DQPA 4BC7A 4P72A 3IC1A 3KK3A 2AJQA 5BYQA 1B99A 2HBQB 2QT7A 4M5DB 2EK6A 3VQSA 1UWBA 3P6YC 2BJDA 4Y2IA 2K1RA 4ZJLA 1UZDA 2M5YA 1SI9A 3KG4A 3OFGA 5A2QU 1KHVA 2CA9A 4NLWA 4A46A 2B5JB 1BE4A 5CYQB 2NZCA 3UD5A 3I9ZA 4L74A 2OGUA 4U95A 5H9FK 2K3KA 3WBZA 4UT4A 2ZJRQ 3C46A 2EFQA 3N6LA 2BJ1A 3J7Z5 1U24A 1TAUA 5KFTA 3I31A 4YB7A 1OMSA 4DR1J 2B8QA 1HL6A 1BQMA 4F0KA 3G6XA 4ZKAA 3LP2B 3GJQB 1C0TA 1V3ZA 3BM7A 1HD0A 4ITSA 1EQ0A 4G65A 2G0IA 2ADBA 3NWRA 3MZIA 3IFEA 2N3LA 1ZETA 1FE0A 1X5SA 3IG1B 1H7XA 2UUAF 3GFXA 1N5SA 3LWMA 3VCDA 1VQYA 4RX6A 3RBXA 2OMLA 1JXVA 1GT8A 3MPWA 2AJFE 4OJHA 1S76D 3IRWP 3JB9k 1T9UA 1RBAA 2VQFF 1YIJS 1ZM9A 1X5TA 2QL5B 2BE9B 4NLOA 4WTOB 2EBGA 4M5DA 2K3IA 4RNNA 3OHAA 3V6DA 1BGXT 4DU7A 1K9MT 4KV8B 4LF5F 1B64A 1XN9A 2NUUG 3TANA 4PQAA 4TKTA 2J7KA 4OZ3A 1OIAA 2PEHA 2C3YA 4RW6B 2B5JA 1CJUB 5CYQA 2VL1A 1FI4A 2CJYB 3DLKB 1LFPA 2HMIB 3M8WA 2BE2B 4LF9J 1O5JA 5GADU 4ANDA 3D6MB 1EKRA 3PJ9A 4UUWA 3LP2A 1VC6A 1DHMA 5A8RB 4DUYF 4J9UE 1LWCB 2NS1B 4NCGB 2QN6B 1VMBA 1SVDA 4CI0B 4DR5J 1UP1A 1ELOA 1UVNA 1IKXB 2BJ8A 3MF5A 2XI3A 5IFMA 3DHXA 3IG1A 2Q6CA 1X4FA 4USVA 4AXJA 4DR7J 2ZC3A 2OTLS 1P1LA 5B7WA 3NGKA 2ZH6A 4P71A 3NOCA 3MHYA 4LT6A 3N79A 4EO6A 4UOFA 1G4CA 2YWGA 1U47A 3CTRA 2K2PA 5HATA 2KFZA 1U25A 2AJ1A 3FCVA 4K4UA 4ED8A 3MM7A 5EX0A 1RHRB 4KV8A 4OZJA 3CXCR 1RU1A 1GMWA 2UUCJ 5CCMA 3MUTP 5AXLA 1HW9A 3BH7B 2HQCA 4RW6A 1CJUA 2MZ1A 3PR5B 3DLKA 1HD1A 2OPQB 2HNDB 2BE2A 1PJ7A 1T94A 3UDEA 1UWAA 4CLKA 1HWUA 3TEGA 2VPXB 2CPFA 1FT8A 3RJMB 3TVZA 1FWLA 1S77D 1RHUB 3HSZA 5A8RA 2XY6A 1OY8A 1LWCA 4NCGA 1EB0A 2VF3A 4PPDA 1R6YA 4YUDA 4L6V3 5CH7B 1PBUA 2WVEA 1IKXA 3CJTA 2HYIB 2F4VF 2EC0A 2DXEA 3MUMP 3R97A 1RHKB 5D0GA 2G1DA 3V6JA 4GVLA 2ATCB 1XIQA 1RCXB 1UTAA 4B9MA 3T5HA 4LSLB 4LIRA 2ZH8A 2G4BA 1SQFA 2QA2A 4HHUA 4DLGA 4CM2A 2HBYB 1WKKA 3TQ1A 4XTTA 3Q24A 4JI4F 2CUYA 4JP8A 4K2JA 4YFUA 2EG1A 2ZHAA 5JJBA 4IFVB 3CCES 1H2VZ 3QO9B 3RUBL 1NK5A 4OZNA 4BDPA 3H59A 3D6FB 1LW2A 4U7UK 3T41A 3BBBA 1MLAA 1WC6A 2OPQA 1VC0A 2HNDA 3E3XA 2G0JA 3MI7X 2JZ5A 5J1EB 3LAMA 3VALA 1FXDA 2DIUA 2XZTB 3D28A 4M5LA 1Q8BA 4DFKA 4LF7J 2EW9A 4GKKJ 1C2PA 3AA8A 2JVOA 3GJSB 1S12A 4FBTA 2DGXA 4OI4A 3GONA 3RB0A 1KRPA 4ZVEA 1RYRA 3I4HX 1S0MA 1EQMA 3D68A 3E2EA 1MNEA 3MR5A 2WSEC 1S57A 5FD1A 2IA0A 1FVSA 2L9DA 2FD2A 2MPUA 4LF4F 4B3OB 4OI2A 2ZUAA 4LSNB 5JUMA 2AZ3A 2E1CA 3R6GB 2ZBIA 1PAEX 5IT0A 3M8ZA 3TJ8A 4U8VA 2CIMA 1T95A 2CWXA 2YPYA 2HAFA 3MM9B 4OYAA 1N0VC 2HEKA 4C97A 2Z2ZA 4D3GA 4X84A 4L73A 1VHFA 2Y1RI 2DXFA 2ACYA 1VBKA 2RUGA 2HPUA 3TO8A 1F60B 2QSFA 2DPJA 4IFVA 2PMHA 3QO9A 4CO3A 2C3PA 4XPCA 5JVGQ 3FQLA 2KVIA 1RADB 1JLFB 3M2RB 4YB6A 1NK9A 3OVAA 2MTLA 1QSSA 2CNOB 3NNCA 3QIDA 4I7FB 3SBMA 2UUWA 3LP1B 1YI2S 2ASDA 1LXNA 1FX4A 3PJWA 1N32J 1WHYA 4KBIA 5J1EA 1AYEA 4TY9A 3CEDA 3FVYA 2Q66A 3LW5C 1U2FA 3I5AA 1H72C 3NNAA 3G86A 3HLUA 3JS9A 2M88A 2ATLA 2HG4A 2JNJA 1HBOB 1RAOA 2JH3A 1WD6A 4L72B 1VC5A 3OPKA 1ICEB 1XC9A 2XMUA 3OL6A 4J9VA 4PR6A 4USTA 4ZP9A 5HVHA 5KFKA 3MMAB 5F8IA 3KK2B 2CJKA 1YJWS 4B3OA 2ASLA 4FKXA 3LA0A 1NUEA 4LSNA 4RZRA 4QYZJ 1H0HB 2R2RA 2V4QA 2BEFA 4ZP7A 2NR0A 1EP4B 3MM9A 1YITS 2DGSA 3D4JA 3OXFA 1NDPA 3GYGA 4C8MA 2J6SA 2PEBA 1FNXH 1F5CA 2HLTA 3V4IB 4F50A 1TQLA 5KFWA 1PKUA 4DV4F 1JLFA 3M2RA 4N47A 2XC9A 3L09A 2YX4A 1GQEA 2GNKA 4I7FA 1HBMB 2D3OR 3D2WA 4IRKA 3LP1A 1BMQB 1RZMA 3FSYA 2QRRA 1NHKL 2E7XA 3HFVA 2V2KA 4C0OC 4EO8A 2O01C 2YKNB 5KFQA 2VIHA 1OPIA 1EZZB 2JVRA 2VG5B 3PVXA 3P5TL 2XMMA 1RKIA 1HBOA 3NGDA 5K9FA 4GRSA 2OAUA 3KLFB 2HWTA 1KLNA 2HSEB 2Q1LA 2Z4PA 4M5KA 4QIFA 4C8KA 3MMAA 3UNGC 2QIFA 1YX2A 3Q2SC 1RKJA 3KK2A 3A12A 2XS5A 1O8BA 4KKOB 1LOUA 2FYXA 2DGOA 1HARA 3KJNB 3NRBA 5E3CA 3K5OA 4CLFA 4WZMA 3GE9A 2BVZA 1FRKA 1EP4A 4USUA 4JI5J 1AXQA 1SJ3P 3LALA 3FRZA 4ES1A 3EICA 4LF9F 2AYGA 4DWIA 3HMJG 1D9FA 3V4IA 3H98A 3B8HA 2WSCC 2ZUGA 2X3DA 1N8RT 3ADAC 2Z30B 1NPRA 1HBMA 4NXNJ 2IDEA 2CJ9A 3ZC4A 1ZM4A 4DR5F 4B9LA 4I1TA 2C42A 1U0HB 4QYRA 2I6WA 1QUVA 4HVZA 1JJ4A 3M30B 2JEJA 2XHCA 4CCHA 4WP3A 1WC4A 4DR7F 2IBOA 4NMXA 1T0TV 3SQGB 5LL6d 3IWNC 4OL8A 1RWKB 4RKUC 3T9ZA 2OO4A 1UJ6A 3KLFA 4K4TA 4I67A 1VIXA 1UL3A 2WCXA 1T9WA 2VFSA 2A2CA 4KKOA 1OO0B 4MKVA 2NXUA 2N3OA 2VODA 3G6VA 1Y00A 1WELA 4HLBA 4M5GA 2W4DA 1NKCA 2UU9J 4R0JA 4LIWA 4HT7A 4ZLLA 2KI2A 1WKJA 3FEZA 1JB0C 2AKWB 2F40A 2CZ4A 2OUGA 2W7OA 5DDQC 1N36J 2BQUA 1WEXA 2XI2A 3WQPA 3OSNA 2LXFA 4LF1A 1U0HA 1L3VA 2KRRA 4RUHA 1FESA 5GAHI 5LT5A 5HVFA 2OKQA 3D1HA 5KG3A 3DOKB 3I32A 2UXBJ 2GZOA 4U96A 4KGXB 3CD0A 2BJ9A 1CEZA 4Z2XA 4RUCA 3WC2A 4OZ5A 4P2SA 2PE8A 4JOUA 4ED7A 3G87A 3ILIA 3SQGA 2B4VA 1NDLA 3J7A1 1S0VA 1EAYC 4ECWA 1Y0HA 5E3RA 2XY7A 2GMHA 2E66A 2C3UA 1RXOB 3Q8PB 3DXSX 5KG0A 2GJFA 3AJ2A 4O23A 4ECZA 2RDJA 2Z2LA 1S79A 1FFSB 4RNMA 3KLHB 3ZZ0A 3BPSP 2VDHA 2G1HA 4FXWA 3GCWP 3OT9A 3M9OB 1U7LA 4HTJA 3T19A 2P6TA 5ETRA 2VC1A 1JIHA 2JC0A 3D6HB 3LOUA 4UUXA 1VISA 3CJ0A 3NCQA 4MMOA 3EZUA 2ZDPA 2GS8A 4X4RA 2IY5B 4B08A 2DD8S 2QGFB 2Y0SD 2DRDA 4ANCA 3JTNA 4GKKF 2FPHX 2WOMA 2MKJA 1TTHB 6FD1A 5FJ4A 3EWGA 3M9MB 3CD6S 4OYIA 1Q8KA 1CJTB 5D4LA 3I5CA 4ETXA 2J6UA 3DOKA 1RA7A 4YR0A 1YBAA 3Q83A 3LUYA 2GVDB 4C9DA 2DBBA 1U6FA 5KG4A 1YTYA 1ZYQA 3KHLA 2M52A 1EX8A 2ZJQQ 2GQ2A 2J6TA 1T3NA 3MM6B 3QRQA 3HHLD 2N82B 2VKZG 4DV2F 1UVIA 1HLWA 2J9EA 1SL1A 3GIKA 2V2VA 2HRUA 4ZJQA 3HVRA 4TU8A 2D74B 2E29A 2NSCA 1VQ5S 3IR6B 3KLHA 5F3ZA 2HQ3A 1XTZA 2GHVC 4RWWA 1HNIB 4EBCA 4MAKA 2HFZA 2CJXB 2EI5A 4IOAQ 2LDYA 4WE1B 3HXMA 2JLGA 1HYSB 1R43A 1ROFA 1FCAA 2FJDB 5FIIA 3KJQB 1Y5IB 2AW0A 5RUBA 2BACA 2WVBA 4ZVTB 2R8JA 3R5AA 1VBYA 1N32F 3QZ7A 2HIYA 2LA6A 5L1LA 2DNKA 4ELTA 1KR4A 2KG1A 4JI7J 2Q43A 1S9FA 1ACMB 4C8OA 1P27B 2JEIA 2UP1A 2QYGA 3SZ2A 2WW8A 4PUOB 1VRUB 1K47A 3BGUA 2V2ZA 1CJTA 3UN3A 1UCNA 4K5RA 1T02A 3U1LA 4YY3J 1VRTB 4OI3A 3GYXB 2K7JA 3POTB 1MROB 2GVDA 4UW2A 2J0WA 4RR5A 4CO2A 4M5NA 1Y4ZB 3JAMU 3GG0A 3R5GA 3MM6A 1KD1T 4N5SA 3DCAA 2JDJA 4PYAA 4DL7A 4QR2A 1TKZB 4P74A 1IR2A 4X65J 1WI8A 1SL0A 1A9NB 4MIBA 4F4XA 3MR6A 1OYDA 1HNIA 5LOQA 4PEOA 5EHHA 4URSA 2UUBJ 4WE1A 1N4LA 4C2MA 1RT3B 1RWVB 2L41A 1HYSA 3OFFA 1XNRJ 2O66A 1U1LA 4HHHA 4ATNA 3BZQA 3B82A 5HROB 1AUDA 4YOEA 4NRTA 4DF4A 4JI2F 3TAMB 4PUOA 1VRUA 1WJ9A 1JNRB 3W5XA 2ZFHA 1SC6A 3MXHP 2OH2A 1VRTA 3IRXB 3FCWA 2OD4A 1MROA 3NS5A 3OQ2A 2RDIA 4MIAA 1KOHA 2OJ3A 4NLGA 3VQTA 1ZH5A 1QAJA 5KAKA 3NCRA 2FGOA 3IS9B 3T3FA 1QM9A 1X8DA 1IBLJ 1Y5NB 2KN4A 2BYCA 3BGOP 2UV8A 5T14A 1KQKA 1TELA 3MEKA 4ED5A 5A8WB 2DITA 3LGNA 3G82B 3PW0A 1NJWA 3CIMA 4JI5F 2R7RA 2IVYA 1YHQS 2HFUA 2QYCA 2N7YA 3UPFA 1VBXA 4LF8J 4MKBA 1I51B 4ED4A 1XNQJ 4JI8J 2BRLA 4OI0A 3C14B 3CJ3A 2WB1D 4E98A 2HLUA 3DFEA 2VFVA 2W2OP 3BSOA 3ISZA 3TW0A 2B3TB 5CYJA 2QC3A 2C2RA 1H6KX 1JX4A 5EWFA 1VQ6S 2CZVC 3SFGA 4K4WA 2YQ3A 1GX6A 5HROA 5J2MB 1FVQA 5ETQA 2VFTA 2PN6A 3TAMA 3GLJA 5B0DA 3W5YA 3SSRA 1S1XB 1MWYA 5DG7A 3BSNA 3IRXA 2J8SA 2CPXA 5HN0A 1X4HA 2FC9A 2E5GA 1HHTP 1FNMA 2OD6A 3AY0A 1QAYA 3IS9A 2YQ0A 2ZM6J 3J7AN 5A8WA 5FDLB 3G82A 1I3OB 2BJ3A 4M8LA 2HAIA 4ZPTR 1U26A 4S0MA 4NLDA 3QAEA 2AEFA 3I5BA 1FTCA 1NK7A 2H5EA 2HQIA 3NP5A 1UPPA 3HFZB 4KAIA 1N36F 3EVWA 3HHLA 4C8YA 5KFHA 3HHLC 4GVBB 2XBPA 2HHUA 5HANA 5CHCB 4YR2A 1YKWA 2J0XA 2EFOA 3UFCX 2CNLB 3A3NB 3CO9A 3QATA 4N76A 2B7CB 3M4XA 3EDRB 1HWKA 3HVWA 3TX0A 4N41A 3VAJA 1OYEA 1H98A 1A7GE 4M5IA 1VI7A 4QW8A 2NPFA 2DHSA 3PM9A 3M2VB 1LWFB 2RF2A 3OXGA 5B09A 2A0FB 1QSYA 4V19J 2GGPB 4FDFA 3RR7A 3QYYA 3IGVA 2OHDA 3G71S 3CT9A 2J0SD 3ZZZA 1RT4B 1N52B 5HMWA 4CRJA 4AQYF 1S5ZA 2LEPA 3NKYA 5FDLA 3EXYA 2B9WA 3AD8C 1S6OA 2WSFC 2FJAB 3UQSA 1SPBP 3PXGa 4C48A 3TYTA 1RT6B 3KHHA 3Q8YA 2KFYA 2KXFA 4OFZA 1WG4A 2UVVA 3W2VB 4GVBA 2B4OA 5LMUJ 1LWEB 1S7IA 4CT9A 3HX9A 1TU0B 3O6QA 1SCJB 1RT2A 1NK4A 5F3TA 3C2PA 4DR2J 3VAFA 2ZKTA 4DX5A 2IMWP 2ZWOA 2F7VA 5EWEA 2DH9A 3W66A 2E5IA 4WK1A 4H54A 4O3PA 2BANB 3LPEA 2HZCA 1RBOB 4TQSA 4ERDA 2RT3A 2W01A 3M2VA 2I5JA 5MAOA 1Q4RA 1NJZA 1LWFA 2XWXA 3ZTQA 2OSRA 1D9AA 3CD5A 3ENQA 2GGPA 2FC8A 1S1VB 3B4MA 4P2MA 5HJXA 4PWWA 2H4WB 1RT4A 1S6QB 4KGMA 1DARA 3M8QA 4FVCA 2GX8A 1IBKJ 2AJ0A 3K2YA 3DDIA 4NLTA 2N7CA 4F3MA 3M8PB 1RTHB 1M1KT 1RT6A 2EBEA 1KVIA 1WOSA 3FBFA 2RRAA 2C2EA 1MMLA 4K4VA 3W2VA 2WHOA 2MY7A 3R8YA 5K20B 3OL7A 1S6UA 2W7PA 5IC4B 1LW0B 3W3SA 4YY3F 5GMKa 2CQ0A 1M5OC 1M5VC 2ZBCA 1FDNA 4D3HA 1O51A 3NWGA 4I56A 4M5MA 3K0JA 4ZITA 3THTA 2CXEA 2BANA 3T1HF 3OFEA 1YWXA 2CRLA 2YKOA 4FYXB 3K7RA 2XZWA 2AV5A 3J80U 1U48A 1LWXA 3KDNA 1J2VA 3JSMB 4X65F 1MU2B 2KM8B 5HBMB 2UUTA 1BUXA 1S1VA 5SZTA 2VQEJ 1S6QA 1FE4A 2MEWA 4O44B 4WFBQ 2UUBF 3C19A 3HVAA 1HI8A 4NA3A 3PJXA 3QQCD 1XNRF 1TFYA 2BJ7A 2MJNA 2KHDA 1ZTTA 4WIQA 1IBMF 3M8PA 1RTHA 1OPZA 1MW7A 1CPZA 5HL7Q 3U1MA 5GMDA 5F8JA 2BBEA 4DV0J 4IR1A 2EC2A 2PMWA 4ED1A 2KYZA 1FJGF 2CNNB 1RQ0A 1H74A 2EFVA 3R1HA 3E51A 2G2ZA 5EWGA 1LW0A 1K8AT 3PX6A 4DUTA 3T6BA 2HGNA 2IC3B 1HQ2A 4OIXA 3Q2TC 1HKAA 2PC6A 4YHHJ 4YP3A 3Q22A 2QL9B 2CPDA 3ZZPA 1R0AB 1KTQA 3QGGA 4P75A 2J7UA 1C4AA 5LMNJ 3ZZOA 4U7UD 2DPIA 1PGZA 3PFOA 5H9FJ 3AH6A 1WOPA 2ZH1A 2Q3PA 1CJKB 4N7TA 3M1VB 4RJVA 1U1NA 3JSMA 1U6ZA 4PPZA 2E1AA 4KHPJ 1MU2A 5HBMA 3ZTSA 5KFLA 2LU2A 3HHEA 1IQTA 2W25A 3SQOP 1XNQF 4YEAA 4JI8F 2JRSA 2X1GA 5CCLA 1S4EA 3DRRB 3PYFA 5EX3A 3UNYA 2YVSA 2D9OA 1YJRA 1WC1A 4JYAJ 1DQAA 2B7BB 2R9LA 3J81U 2RRBA 3UWTA 4ETZA 2V67A 1YDLA 1SXLA 3D0HE 3H5UA 1HI0P 1P9QC 4K7QA 3N6NA 1I6JA 1CC7A 3OTCA 1SBRA 4H4OB 4NXMJ 1XMOJ 2IM2A 3NGTA 8AT1B 3P3DA 1M5PC 5CD4A 5I3UA 3FBBA 5EUHA 4LQ3A 2F4FA 2V69A 3NEKA 2H51B 2HWIA 2IC3A 3ZZYA 3PRDA 4F67A 1FDDA 1NKEA 1VLOA 2HQDA 4P73A 4B9VA 1FF2A 2ZJPQ 3P8BB 4J5OA 1UVJA 3MPDA 5HLFB 1R0AA 3I0SB 2CADA 2RHSB 2RQCA 5DM7Q 4USIA 4OJ3A 1R31A 4U6PA 2KTQA 3OR2B 1UZHA 1CULB 1S6PB 2FVRA 3GFHA 3M1VA 1YJ7A 1B0TA 1T05B 1JLBB 2DCLA 3UO0A 1Q0NA 4DFPA 4DV7J 3CJ5A 1FD8A 4U7CA 1Q8LA 3IM8A 2D9PA 2B43A 1Q8IA 4NOHA 3QZ8A 4RW8B 4IH6A 2YWKA 3PEHA 1NH8A 3VAHA 3DRRA 2KZMA 4JI6J 4KO0B 1WF1A 2XYGB 3FMWA 2WZ1A 1S9GB 5U47A 2CWKA 2QG9B 4N8NA 2E9ZA 4ER8A 3M05A 9ATCB 4ZMMA 1X5PA 2R7UA 2W24A 4PKDB 3MEDA 2CFXA 4JI1F 4FXDA 2HURA 1QDUB 1NPPA 3W8GA 4XPEA 1NB2A 2BZ2A 2DGUA 4IFYA 3PACA 3GP9A 4QWAA 2UVRA 2M70A 1K44A 2XGQA 4H4KC 3OD2A 3TA1A 3EE3A 3OR2A 2DHAA 1Q86T 1S6PA 2DNRA 2WAQD 3TX8A 4HTIA 3CB4A 3N28A 4HH0A 1J5EJ 1JLBA 5ETNA 1DQ9A 3I0RB 2N4DA 5LJ5Y 2VBWA 4OHVA 3PX4A 4U67Q 4LF6J 2A6OA 2FY1A 2DNQA 4RW7B 4NMLA 2DNZA 2YNHB 1UVKA 4FXVA 4DR6F 4AUKA 4K4SA 4E0DA 1LNQA 4TY8B 5LMUF 2PMZD 1TKTB 1S9GA 5IV3A 2HBRB 3EPGA 2CPHA 5JVHQ 1V5IB 1S48A 2MKKA 3GIRA 4CM0A 1HA1A 4QU6A 3M8RA 4DR2F 2AIRB 4QWCA 1LFWA 3T5KA 2W2MP 3ZNJ1 2QSWA 4DV5J 3SSQA 1SJRA 1RP5A 1MN7A 3U7JA 4FN5A 2FVSA 4CO0A 1X60A 1WNEA 2QLXA 2SXLA 4Y6IA 1DTTB 1F2HA 1VK8A 2QA1A 4M1KA 1UVMA 4RBUA 4DV1J 2YKPA 3MD1A 2W4PA 2GHPA 2H48B 5A76A 3T1YJ 1U8SA 3A3OB 5CQGA 2QMUB 4ALZA 2DHGA 3SSSA 3IMQJ 3D1OA 2WTFA 4DL3A 3DLGA 1RT7B 4DR3J 4ENOA 3R2DJ 2AYBA 1IBKF 4K0KJ 3QAUA 3NGUA 3GSDA 3I0RA 2J76E 4LRDA 1NDCA 1R8BA 4K59A 1X0FA 5DM6Q 3UR0A 5F8GA 4IG0A 1VYAA 2DR7A 1VK3A 4RW7A 2EWHA 1JJ2R 2IPOB 2ZBQA 2YNHA 1MWZA 2YTCA 2W8KA 2M9KA 4Q0BA 1TKTA 1KVKA 2XLIA 1NK0A 3L95X 1S0OA 1FXRA 2EKNA 2IVMA 1M1GA 2VH7A 2VZ9A 3HJFA 2OFGX 5T41A 1X9MA 3W8PA 2IIHA 1JQGA 4KPCA 1T9TA 2RDDA 1GXTA 2PA3A 1MMDA 3US5A 5DGBA 1TVRB 4HEA9 2GQCA 1DTTA 3CCWA 5LXYA 2GIRA 3DM2B 3B54A 2WB4A 2F9JA 1FD2A 2C2OB 2MKSA 3CW2C 2OMOA 1S1UB 3FZ2A 2R7QA 5DQHA 5F8NA 1YJVA 2VQEF 3IO1A 1CS4B 3BBCA 3QFWA 4F02A 2ZVSA 4OJGA 1JLAB 2ASYA 5C2GA 3MECB 2JEFA 2B4UA 2V5HG 3RAMA 1YGYA 1ITPA 4C6AA 2JWNA 4DV3J 4IUFA 3L9ZA 3TVKA 2R4FA 1BQNB 4LFCJ 2ZVIA 4MH8A 2HHQA 5E0OA 2CQPA 3PHEA 1OSCA 3RR8A 4DV0F 3MUVP 2ZH3A 4Y00A 2ALZA 4CO1A 4DPTA 1VQNS 1S97A 4NEYA 3HT3A 4LVNP 2JLEA 5I42B 4C8NA 1TV6B 1UPMB 3GG1A 4TLQA 1F5BA 3Q8RB 4J9OA 2DH7A 1YZ6A 4KPYA 4QCLA 1LEOA 4C98A 1NRKA 3ZZRA 4YHHF 3SI8A 2HNYB 2XGPA 4RNFA 3TZYA 4BCAA 1CBKA 3FEXB 3ETOA 3IWLA 3PYEA 1GAOA 4EEYA 1TVRA 4OJ1A 2YKMB 4URGA 3DM2A 5K14B 4LMZA 3KYLA 1R8CA 5LXRA 3A8JA 4MKAA 5CA5A 4WFXA 3SEOA 5HK4A 4F4WA 1U1OA 4B9UA 3Q89A 2ZDOA 4NWBA 4KHPF 3LGMA 2NXJA 2ZZNA 1FERA 2O3DA 1RK8A 4PWDB 2GO9A 1RAHB 3K58A 3OR1B 1CS4A 2DGWA 1UW9A 1F6TA 3R5BA 4WKRA 2BA9A 3PFEA 1JLAA 3ELHA 2OPSB 4QJVA 5GVQA 3MOZA 4ES2A 4NLPA 1JLGA 3MECA 2NCKL 3V6KA 4YB5A 3R3TA 1ZPVA 1YRTA 3K5MA 4IQXA 3GPAA 3NXZA 3B78A 5H1SV 2GAHC 4C3KA 2MQLA 3IA0A 4B9SA 1GMWD 1BQNA 2XM3A 3HULA 4MKYA 3O8WA 3DLBA 1Q7YT 1JLEB 3F0NA 5LSLA 5D77A 5L1IA 2KH9A 4A8KA 5KT2A 2RAQA 4IQMA 4NXMF 3FJ2A 1XMOF 5B0FA 5I42A 4PWUA 3CJSA 4EBDA 3OTOJ 1TV6A 3GWCA 2HRYA 4IKAA 2CJAA 3IR7B 5DJBA 3BQ0A 4M94A 1X7VA 4Y2MA 3H2UB 2Q6BA 2F8HA 2DNMA 1B4SA 2DNLA 2HNYA 2B9XA 2DKOB 1J5OB 2AX1A 1M1HA 2DR9A 2H9ZA 2P9GA 3CMES 3ZXWA 5G0RB 2N4CA 4FF2A 2YKMA 5KFCA 2ZNYA 3EGZA 5K14A 2LQ9A 3ET6B 2AD9A 2RKIB 4LBHA 4DSEA 4E8UA 1DLOB 1TL5A 3EPIA 4DSJA 2WRMA 4LF2A 3LO3A 3GV7B 5D0HA 4PWDA 4ES3A 2VKRA 4DV7F 1Z2ZA 2XLJA 4Q8FA 1PO6A 1K1SA 4ED6A 1X31C 1JMTA 3M8SA 1T11A 2OPSA 1TUVA 2XNRA 2DIVA 2VFUA 3R27A 4FF3A 2JFKA 5E33A 4UOGA 5KOWA 1LKZA 2QMWA 4TU9A 1JLEA 2DNHA 3MAHA 3QSYB 3VAIA 4E2FB 3GSIA 1TL3B 4DG1B 1MSWD 2R2SA 3IBCB 1HMVB 5HJYA 3KKFA 3DYAA 4OYMA 2ZZMA 3R9LA 2ZKUA 4ECTA 3O2IA 5ADZA 4ANEA 4DHVA 3FZBA 1J5OA 7FDRA 4KC5A 5G0RA 3G8QA 4K8RA 4Q5VA 3QT5A 4OZ2A 2DGVA 3ET6A 4O4RA 2BQ3A 1V3RA 3PKYA 2RKIA 3W5ZA 3HCXA 1DLOA 3BGFA 1KC8T 3RB3A 3R6LB 1QUPA 4DQQA 1G3OA 1YRUA 4KHMA 3A8IA 1UFKA 2FHMA 1U02A 4BWJA 4TNOA 2YBVA 4LRCA 3CC2S 3FEYB 3CPWR 4LF6F 3THVA 1QSLA 3EVOA 1KOOA 2AMCB 1FFGB 3CDWA 5DQGA 2VPZB 4ZP8A 2DR8A 4DCJB 4LBIA 2BOPA 4OX9J 1RLCL 4YDDB 1NCLA 4ZVHA 4WK3A 3M6UA 2CJQA 2MZJA 4UY8T 4GC7A 2A18A 1SH3A 2LLZA 3H90A 1M0SA 3DOMB 1RT1B 4J9MA 2XB2D 2DT9A 3I6PA 1TL3A 3FRYA 3CE8A 4DG1A 3SV3A 1R8PA 4J9NA 3GCXP 1HMVA 1KQFB 2E1PA 1XWLA 3PYGA 4B17A 1BLUA 2FZKB 2QLFB 4WU3A 5J2QB 4DV1F 2RVJA 3SV4A 1RWWB 2H3EB 3IGNA 3T1YF 2AGPA 4ZP6A 3G96A 2CG4A 2BQRA 1VQOS 3GJTB 2HS3A 1TMJA 4ZCLA 1VDHA 5F8LA 5IT9Y 5C24B 1T8EA 4HL9A 3NGSA 1IUJA 2B9YA 2FJEB 2ZEJA 2OPRB 4M63A 1X4GA 2Y1IA 4QQBA 3ZFVA 4K0KF 2UXDJ 2DXDA 5SUHA 4C3LA 2RSQA 4CO4A 4UY85 5L38A 1FXLA 2ZZTA 1DZ5A 2V8GA 3KNAA 1NO8A 2VBYA 2LKZA 4MK7A 1URRA 2VOOA 1TZ0A 1U1PA 4X4TA 2H1YA 1V5VA 1QD1A 2IDLA 4KGKA 1ZS6A 1B7YB 4WZQA 1URNA 5LJ3Y 2YKQA 1PYTA 3TEHB 3S1TA 3GIMA 4DF8A 4B9TA 1U45A 3DOMA 2Y1LB 1RT1A 4TU7A 1WG1A 1NSQA 2VICA 1FO1A 2HWHA 4IH5A 2V9KA 5M2RA 4I6WA 2V34A 3PTWA 1Y5LB 1NM2A 1RCOB 1Y11A 2HGMA 3RZAA 3TUZC 2CDRB 2W1BA 3A1YG 1TR0A 4DZDA 1EJ7L 2D1CA 3Q8SB 3DLHA 1QTMA 3ZZTA 3FBEA 2AF6A 5AT1B 2IA6A 5HQLA 3KUHA 2RMLA 5IWAJ 2WVCA 3I96A 3ZTOA 5KT3A 2HMIA 2KYXA 2MZSA 3LF0A 3EM1A 4X62J 4IYQA 4NYOA 3GZ7A 3TOQA 4RO0A 2QJ3A 3LTOA 2MKCA 2L3MA 4F25A 2R8KA 2OPRA 3TZWA 5BXIA 2UV8G 2KT2A 1SJ1A 1NPKA 1VQSA 2ZWPA 3IBFB 1WUUA 3MCMA 1XEZA 4F0MA 4HYKA 1T03B 2DRBA 4K50A 3MAQA 2EFNA 4DV3F 2MZRA 5C25B 4ZIWA 3C15B 1M90T 3NBPB 5KTQA 2VG6B 2CDQA 1GMVA 1JWWA 4LFCF 1SB6A 2CYYA 3HO1A 1WG5A 5F8HA 2HHPA 3KLIB 3PIOQ 2CQGA 3BREA 3QRPA 3TP2A 1X0PA 3HVTB 3QFHA 5I3PA 4F0HA 1SKUB 2UXCJ 4FPRA 2LP4A 1LK5A 1EIYB 1Y10A 4MYUA 1FRXA 1R0CB 5M2PA 1W2IA 2HHTA 4A8OA 2Z8QA 4O4GB 1RTDB 2YKAA 2YPZA 1UFWA 1HI1A 1VQ4S 4USWA 2HK2A 4XDCA 3UDCA 4DLEA 1XJWB 3CMAS 4ECXA 2DY1A 5KFOA 3J7YI 1RAAB 2B51A 3GILA 3UD3P 4ZPDA 1UEUA 2CQIA 3DI6B 5C7PA 4NYZA 1DBDA 3QGIA 3AT1B 5L9NA 2LEAA 2ZH5A 1PCAA 2IM0A 2BKOA 5JMNA 2GC8A 3EGVA 2ERRA 3RW7A 2WBMA 2YNFB 4PG6A 2ACMA 2K06A 4LREA 1FKOB 4DPWA 5DLGA 2HHHJ 5C25A 3C15A 3VAKA 3NBPA 2VG6A 5CABA 1IVZA 4N8OA 3CCUS 4RW4B 4Y2CA 4J9SA 3MGJA 1OY9A 4L75A 2XO7A 3CMQA 1HNWJ 3CCZA 5D4OA 3KMQA 3A3PB 3U02A 1U1RA 4P7TA 4X2BA 2OEJA 3HVTA 2EXUA 2BABA 3A13A 1VGYA 4NI2B 3OTOF 3FKBA 4FPIA 4DMZA 3PDNA 4LSLA 1EKSA 4ZPCA 2GMLA 2VU5A 2QLJB 4ZVOB 1WHWA 2XTJP 2E7WA 4NCAA 1G7CB 2FLNA 3MR3A 3VV2B 4O4GA 1RTDA 1SH2A 5AXMA 3BDPA 2YH1A 2VBXA 5KFGA 4HACB 3AODA 3L4BC 3WDOA 1T9XA 1SH0A 2RIJA 1KQSR 1M5SA 2FJBB 1GTHA 2XMAA 1K73T 2LYVA 3DI6A 4UTGA 3QLHB 1KVJA 1REVB 2C3MA 5KT6A 2ZBRA 2Z0GA 3GB0A 4Y2KA 1QE1B 2Y9HA 2ROGA 2HS4A 4ECQA 4J37A 1TK8A 4Q2MA 3DU5A 2YNFA 3I87A 1ZAVA 1N48A 2VUGA 1SJQA 3FDSA 1D8YA 4CDIA 2DHXA 3VGTA 4A48A 3JSRA 4G1IA 4RW4A 1P8GA 3T6JA 3ENAA 3PKMA 2DVIA 4OV1A 2VQFJ 3SDEB 3DGVA 1YJTA 3EGNA 1TL7B 1C4CA 4NI2A 3CJ4A 3U1NA 3QIPB 1NB7A 3H5SA 4LF5J 2X51A 5K8MA 4KRWA 2D3O1 2H5IB 1W26A 1RLDA 4EYHB 3AD9C 1W7WA 4CWBA 4B3TJ 4DR1F 1SUQB 4CYUB 2QFIA 4BBYA 1R89A 1Z4UA 4J9LA 3HZEA 4KH0B 3DHWC 4CZCA 2CPZA 4FZVA 1F9FA 3CDUA 3QLHA 1N5QA 4C7QA 1REVA 2VHGA 4YN3B 3E01B 5L46A 5K8PA 1CG2A 1NSAA 1RAEB 5E3QA 1TL1B 1QE1A 4IOCQ 3F44A 1IR0A 4ECYA 2IM3A 4OX9F 4I2QB 2QE5A 3MPVA 2CZ9A 4ILRA 2RU9A 4AXIA 2HVDA 4EU0A 5KOXA 2LCWA 5KT4A 5KFFA 2P9CA 2I2YA 3MM8B 4EFAC 2R7WA 3RGIA 1KEKA 4NRUA 1D8ZA 2OI2A 3CCSS 3SDEA 3HHDA 3QIPA 3W9JA 1FRIA 1VQMS 4IH7A 2QTWA 4B3RJ 1SIWB 5HP1B 5GAEI 1FK9B 2HNZB 1VR6A 3FFIB 3FSXA 1S1TB 5DETA 2OTJS 3D0IE 3DRSB 1XQIA 2KKHA 2FHOB 2NXCA 4OYBA 1KFSA 3LAKA 1RWXB 1HR0J 1SUQA 4RPFA 4CYUA 1NU4A 3G8TA 1JLCB 4A8WA 4C8ZA 2UXDF 4DX8H 2G2OA 5ETVA 3BDEA 1WEYA 2XMWA 1GX5A 2D7SA 3BO4A 3BKFA 2Y3YA 3ENVA 3E01A 2V4RA 4EUVA 1TL1A 1BC6A 3M6VA 3AJ1A 3QT6A 1SKWA 3GTYX 2YKNA 2AQ4A 4I2QA 4K4YA 4EBEA 4QU7A 1D3WA 5K5MA 5KT5A 2VG5A 5J1PA 4ZLPA 2D3UA 1AA1B 3MM8A 4QIGA 3OVSA 3ZO7A 2AJ4A 4DV6J 4M5JA 4JI4J 4J9QA 4JB8B 2WVDA 5T7LB 1APSA 2DB1A 3O1LA 3ZTPA 3V81B 1NHUA 1TP7A 5KFYA 2UUCF 3IM9A 5F9NA 4PCQA 5HP1A 3BR9A 4WTYA 5IWAF 1FK9A 2HNZA 1VJQA 3FFIA 3DNCA 1S1TA 4X62F 2MQ8A 1LV5A 3DRSA 5DDRC 3NL0A 2DO0A 1BXNA 3NNHA 3EDQB 1S59A 1JLCA 1OY6A 2AGOA 3ZTRA 3PO5A 1Q53A 4DPXA 4HT5A 4ILMA 3O5TB 2B8PA 4WP8A 4WFYA 4USMA 3M30A 1J27A 1NK6A 4CQ1A 5D3GB 2MY8A 2AU0A 4CLUA 2B56A 4QW9A 1YVFA 4PG4A 2KU7A 4ZLJA 2Z2MA 4DUZJ 1SJ4P 1FEHA 2UXCF 4LF4J 2MQOA 5LM7E 5HVGA 3KG1A 2WVFA 4MIWA 2IYGA 1DAXA 4P2XA 1TK5A 2E1MC 4ZPAA 4NA1A 3AA9A 5T7LA 3D1QA 3THPA 2W4CA 3V81A 4OQJA 1U1KA 3CDBA 4FP9A 2E5LJ 2HGLA 3R7NB 1DQ8A 1TUGB 1HNZJ 3EYZA 1ZBTA 3KG0A 2LQBA 1HWIA 1X4DA 3GMGA 4A4JA 2BW2A 1N0UA 2W9CB 1C0TB 2W2QP 3QJLA 2LQ5A 2LFVA 1K0VA 2NUHA 2CPJA 3G4SS 1NHVA 5J2PB 2QX0A 2H5JB 3K17A 3AQOA 2VASA 4RNOA 4F04B 4LF7F 1T9VA 5BR8J 1PC4A 1S99A 1HQEB 4C4WA 1D1UA 2HFSA 5G4DA 4F26A 1L3SA 2HW3A 1Z2LA 5LSRA 2GA7A 2HHHF 2HHXA 1KNZA 1GH8A 4CH7A 3DDKA 3SMZA 2F9DA 1QVGR 3TQEA 4KTQA 3IAS9 3H42A 3D66A 2CQHA 5D3GA 4ZVPB 1FRLA 4ZK7M 1HNWF 2MJUA 1X4AA 3LPYA 1XR6A 1HWLA 2GQQA 4DQSA 4O3NA 2CQ1A 3OJSA 1RTJB 3CJ8A 4ID8A 3V6DB 2YY3A 2CQCA 2YNGB 3NCPA 4G1QB 4PQUB 5F9LA 3NOGA 4PZVA 5GAEU 1PG5B 5EGYA 4RBTA 3KFWX 5C2CA 1VJWA 3GIJA 3S8SA 4ECSA 3S01A 3G9CA 3OSPA 1U0SA 3Q8VA 4ZCIA 3NS6A 1RA6A 3A4TA 4ZVQB 1CLFA 3D67A 3MMJA 4DV4J 2W9CA 5KFMA 3C6TB 2FJWA 1D09B 2EPIA 1VLYA 2H4YB 5J2PA 2RS2A 5KFSA 3PRBA 5AE2A 3RTVA 2KHCA 1WEZA 1NXIA 3G8SA 4IRDA 1Q5VA 4B9NA 4TQRA 3KMSA 3B4DA 3QWPA 1KN6A 3H4DA 1HQEA 2FY8A 4WFZA 4IO9Q 1EARA 3CCTA 2FGCA 4WXOA 4P7VA 5CYMB 2DR5A 1B0PA 2XSJB 3RBZA 3BO2A 2ZH2A 1WACA 4DS4A 2P8IA 2O67A 4OX7A 1VQKS 2CQBA 4M95A 1S7HA 1F1BB 5IXUA 1RTJA 3UCGA 1WHVA 3MM7B 1YZ7A 3MM5B 2EEYA 4UZCA 5DLFA 1FJCA 2FJXA 3RYLA 2ILZA 2YNGA 4G1QA 4IOBA 4PQUA 1UMJA 3MEGB 2HHSA 4DSLA 1NNDA 5CAAA 2DJWA 5B0EA 1OWXA 4X4PA 1S9EB 4B3TF 1RAFB 4DR4J 2ZE2B 1ZZNA 1RWPB 3NAHA 1TUWA 1TAQA 4Y65A 3BN7A 3DN9A 5F8MA 2NSBA 3PW2A 2HHWA 2QMXA 3C6TA 3QBCA 1XK8A 3MCSA 3K57A 4DI6A 2LEBA 1RTZA 4F3QA 1DURA 5GAHU 4KGVB 2PD1A 4AL5A 3HHKA 3DU6A 2C2DA 1ULRA 4AFFA 4FNHA 3RB6A 2MLXA 1GTEA 2HIQA 1F2GA 3RAXA 1I5OB 2HFOA 3OUYB 3TAQA 1FRMA 2ALYB 3HT0A 1F3FA 4X4QA 5CYMA 4K5SA 2XSJA 2RB7A 2CVEA 3POTA 4EGLA 2KG0A 1GMUA 4HHJA 2CQ2A 1C1BB 4K2XA 1UVLA 2MKHA 4CO5A 2AWZA 1U09A 3L7PA 3MTJA 1F0XA 3MM5A 2M2BA 1IN0A 2G9OA 4B3RF 1TKZA 2HRTA 3TA0A 4HI1A 1SL2A 2EKYA 2B0GA 3MEGA 2BMBA 1LW2B 3RRHA 3WX4A 3GFYA 1UFLA 1S9EA 2ZE2A 1HR0F 5KFIA 5IC6B 3DC2A 4H4MB 5MLCV 1YBTA 1RT3A 3MR2A 2PFDA 1X4EA 2DO4A 4NXNF 4FVMA 4DCPB 4GO5X 2HQFA 4WIIA 2PFFB 1EETB 1ZA2B 4RL1A 4J9RA 1BD6A 5KFRA 2RQKA 2ZH9A 2YH0A 2VD3A 3MR7A 3PV8A 4QBUA 2VJUA 2RHQB 1UAWA 3OUYA 4F4ZA 3UW1A 4QPXA 3PCOB 4RLEA 3BJYA 2HK3A 2A2DA 3CDAA 3VZIA 5A8KB 4Y0FA 2CPEA 4LVOP 4TYBA 3FBCA 3PYDA 2RRNA 3HKZD 3VWSA 2DNGA 5ETMA 4DV6F 3X3UA 1C1BA 1XMQJ 5D15A 4V1Ak 2G13A 5FLXY 4FS1A 3QRRA 1WSRA 2B9EA 1QAXA 3TUIC 3SXLA 2VA2A 2MB0B 2UU9F 3I4PA 2GVZB 3CULA 4ECVA 3R5CA 3KJVB 3D3BJ 3C8YA 1IWGA 3F56A 3OLBA 4Y2AA 2XO6A 3TJ9A 1RABB 1Y3JA 1FNOA 4HDGA 3TARA 1W25A 3N5BA 3C14A 3D0GE 4PYDA 4H4MA 3AXKA 1HBUB 2MQQA 3UDLA 4F36A 3JQKA 2RU3A 2AX0A 4KYZA 3KLGB 1X9WA 2AT1B 4ZPWR 1EETA 4R5PB 1MN9A 2GHWA 2EK1A 5E3PA 1RGVA 3OTBA 2UXBF 3HF5A 4A8SA 2OELA 3CVKA 5J2MA 3W9IA 2FIUA 2X3GA 5ETLA 5B0CA 2WW4A 4JV1A 2DNYA 4DUZF 3P96A 4PG7A 2DNNA 5E3AA 4G3IA 3CJRA 4KGZB 4CIOA 4B3SJ 2V94A 3AQPA 1S1XA 3O44A 4NLRA 4X4UA 4YQWA 4NLQA 2DRAA 2XCAA 5A8KA 1KDNA 1O0PA 2DH8A 5D0EA 3DXBA 4PRFA 1IXKA 2FHJD 5IT4A 5J1NA 2FQQB 4DV2J 2X1BA 3ZNUA 2CQ4A 5KFEA 2NXEA 2LQJA 5K8NA 4O3SA 4B3MJ 4NL5A 5JXSA 4FBUA 1NMEB 2E5LF 5KFUA 1GFWB 4HH1A 1HNZF 3TWZA 2FLOA 2X7IA 4FYVB 4KT0C 3JAMY 2GVZA 3KJVA 3OJUA 4GKJJ 3T9NA 2FJVA 2JFDA 1CQMA 3QJPA 3D6TB 3JTOA 1RWOB 3I56S 2A6MA 4MJKA 3H40A 5HMZA 1HBUA 5BR8F 5ETTA 4CP5A 1PBAA 3AXMA 2ILYA 1WI6A 3KWMA 3N01A 1PSDA 3UN2A 3KLGA 2QEXS 2HVIA 5DG9A 3K5NA 3I9V9 4WXWA 1WC3A 2GO8A 4R5PA 3QNWB 3N5FA 3BS9A 3F73A 5DS7A 3AHPA 5ETPA 4WJBA 4PAAA 4Q2LA 3RU0A 4DSKA 4DU8A 3K89A 3G6YA 2B6AB 1L3KA 4P10A 4MTPA 2J7WA 5KG6A 4ZJOA 4LQ9A 2FVCA 2ZOMA 3RW6A 2YXLA 2RUSA 3UVJB 1PIEA 2GIQA 4Y3CA 3VHQA 1RAIB 3WIVA 4RUAA 3PRVA 2KJVA 1IR1A 4N77A 3JSYA 1R7IA 2GV1A 4ZVSB 3NLCA 1ZM2A 4QWDA 1HQUB 3NMRA 4U8YA 2XMKA 2MXYA 2W2NP 3TI0A 1IM6A 5GMEA 3R1LA 1RWMB 3SFUA 1V9OA 2VBZA 4JI0J 9RUBA 1A6LA 1V6HA 3VGVA 2PDAA 5ETOA 3U27A 1XBWA 2AYMA 3SCLE 2OP5A 4IDKB 3P45B 4M5HA 3P5BP 4JI7F 3CCLS 1LWEA 1YLXA 2ZC4A 1UEVA 4LFBJ 2Q79A 8ATCB 1N5TA 5IQ6A 2M3DA 4LR8A 1BY9A 3W60A 4JI2J 2RE1A 2V8PA 4A8XA 1WWHA 2DK2A 2PI4A 3MMCB 1YQHA 2B6AA 4W4MA 2OEKA 3HD2A 1WOOA 1AUSL 3DRYA 5CXTA 1FRJA 1LXJA 5KFVA 1E6YB 3NAIA 2RS8A 4DDFA 3UVJA 4X4SA 3TNVA 5H9EK 4CLZA 1Q16B 2FUG9 2JEGA 2C22A 3CC4S 2C2MB 1Q82T 1RT5B 4EK2A 4DR4F 1SC4B 3MMBB 7AT1B 4IG3B 1HQUA 4WFAQ 2BV3A 1PAUB 4LRAA 3K8WA 1LK7A 1BWEA 2P2CB 2I1RA 1IKYB 2YNIB 4GMKA 3KHGA 1IWAA 4ED0A 4QIEA 4CLTA 5HO4A 3CDEA 1TL4A 2WBRA 3H7HB 4IDKA 2DNOA 4DPOA 2PA8D 1UKUA 3HFKA 1UETA 4DBQA 1I94J 1P6TA 1JK9B 4LJMA 3CD7A 2P9EA 3C66A 2K8GA 1IKVB 2EFGA 3PNIA 2V8DA 4YB1P 2C2ZB 4CLPA 1IQZA 3MMCA 1IJEB 1NZAA 5DZ6A 5HQ8A 2XEXA 4W92B 2MZTA 1T3OA 3P49B 1V3SA 3KXDA 1IBLF 4FKYA 4LFAJ 4XK8C 4OI1A 2KO1A 1E6YA 4X66J 4LR9A 5ETSA 2V2QA 3EZ5A 3VGSA 1R6VA 3FK4A 4OX6A 4RW9B 2KM8C 4JV5J 3VR1A 2XY5A 2GMJA 2PGCA 1RT5A 1IBCB 1JXLA 3PW5A 2R3VA 4LF8F 1FX2A 1K0TA 2R2TA 4O44A 4G6VB 3MMBA 4IG3A 4W90B 1YSJA 4URQU 1RJJA 1RHMB 2BKNA 2IJFA 3K8VA 3ULHA 3DOLB 1IKYA 2YNIA 4KSEB 4LSZB 2FHJA 1QLNA 4UOCA 2WOMB 2DEJA 3FCHA 2IFXA 4PG8A 4WBFA 3EVMA 3GYNA 1VCTA 1NK8A 4DX6A 2E1RA 4DN0A 2M0GB 2YQ1A 4WWSA 2QO3A 3RBEA 2V63A 3M2UB 2MGZB 3CCRS 1RAGB 3EX7B 4CNYA 1IKVA 2JC1A 2XYHB 4ZOSA 1ZPWX 3GIIA 4WU2A 1RACB 1XMQF 4KQZA 3HI9A 2R8HA 1TKXB 4DPYA 2E9RX 4BWMA 2V50A 1N54B 2ZM6F 4WYWA 5CZXA 1CJKA 4DS5A 1X9SA 1S4FA 5KG2A 4AQYJ 4I0WA 4RW9A 5HAOA 5KG7A 1Z1ZA 3EJMA 4P2FA 4J9PA 2MHNA 3BR8A 4WCEQ 4I2PB 2U2FA 2YX1A 4ZN3A 4KFBB 1RAJA 1NJYA 1KFDA 4UQGA 3DOLA 2ZNZA 1DY3A 2VG7B 1N33J 4P52A 3KUGA 1N34J 4NZ0A 2XCPA 5CD4H 2B4PA 4OZ0A 4FYDA 2VB6A 3JXOA 1X4CA 4QWEA 4NLSA 4C3MA 3WHIA 4HI2A 5L9XA 4OHWA 4C8LA 3SCJE 2IRUA 5FLXU 4F4YA 7FD1A 4V19X 4QR1A 1C1CB 3CJ2A 3QGPA 1NJXA 4H4OA 4B3SF 4DN9A 4L3KA 3M2UA 1WKLA 5DRKA 4KY3A 4P9SA 2MGZA 2RQMA 3GQCA 4ZCKA 3CC7S 2PT0A 3ISND 5IS2A 2R7TA 1X4BA 3DMJB 3R5JB 2HVHA 1OSDA 1S1WB 5KFPA 5HLFA 2HFVA 2FB0A 1U4BA 4OYZA 3I0SA 2FTRA 1CVJA 1TKXA 2NYIA 4B3MF 1UEKA 4ZVRB 2POKA 5I4MA 5J2NB 1WDTA 3A8EA 3KLVA 1CULA 2JLFA 2QA4G 2FLPA 2UVUA 3C16B 3OBIA 3HSDA 1T05A 4DL4A 2P5VA 5HMXA 2NZ4A 3M9NB 4NEZA 4GKJF 1AZSB 3V6HA 4RWXA 3OXLA 3J80Y 3DRXA 2YX7A 3QSIA 3T5JA 3P4UB 4OHXA 5F41A 5IZHA 4I2PA 4RW8A 4KFBA 3CGIA 3Q8QB 4KO0A 1Y3KA 2IVFB 5A0YB 1ZA1B 2VG7A 4AL7A 5KFXA 1R3NA 1P1TA 3CCMS 4ELUA 4DQRA 1M5KC 4TLRA 2V8HA 4PXBA 4MT1A 4U9RA 3ENWA 3EGWB 1NLKL 2LXIA 2IJNA 1C1CA 3FNNA 2ZHOA 2LA4A 1N5YB 5DZ7A 2KT3A 2L9NA 3DGPB 1VOMA 1AFJA 2VJVA 2UZAA 1LQ9A 3T1HJ 2MMYA 2IBKA 4YMEA 4IR9A 3RAQA 3DMJA 1S1WA 4DL5A 4ZN1A 2QL7B 2HHVA 2ZOGA 3H5XA 1FWPA 3GJRB 1FTRA 2F8MA 2HZAA 5J2NA 3EZOA 3T5LA 4YS2A 2CPYA 4CT8A 2QLWA 4XAKA 1Q81T 4DOZA 4AE5A 2D3ZA 3C16A 2H65B 1HIYA 3SIPB 2FZCB 1AT1B 4NX9A 5HMYA 4CLLA 1AZSA 2KJWA 3QT8A 4JI0F 5L1KA 5F0UA 1VQ7S 3CSKA 2MQPA 2F1FA 2W8LA 1IBMJ 1XMBA 2R7SA 1G6BA 4DSFA 4AL6A 3QPIA 4FYYB 3PHTA 1AB8A 3G6ES 4TY8A 5A0YA 3HSJA 1H38A 3C3LA 2NREA 4LFBF 1YK9A 1FJGJ 3R2CJ 4PG5A 1MWQA 1UA0A 5HQMA 1PJ5A 2MQNA 1YJ9S 1Y9OA 4JI3J 3JTPA 2EG2A 1SKSA 2DGTA 3BYPA 2QV6A 3J81Y 3A8KA 4QZVB 4K4ZA 1RBLA 1VQ8S 3MTKA 5IM0B 2XQCA 5BYRA 2M8HA 1N5YA 2ZD1B 3W61A 3D7SB 4I69A 4O3QA 3QJJA 3DGPA 4IRCA 1NH7A 1JKHB 4CTAB 3CO0P 4UQTA 5E7OB 2J9DE 3W7BA 1C0UB 1CQNA 2DISA 2ZH7A 1NJIT 2WONB 4R8UB 3IXQA 1UJ5A 2E9TA 4Y34A 2D69A 2PSZA 4ZA1A 1RT7A 3Q8UA 3ZZUA 2J5AA 1N6QB 4O3RA 2I0XA 4UF4A 4IO1A 2DEIA 2BJEA 3D3CJ 2Y1JA 1BQXA 3H20A 2H54B 3HHLB 4DL2A 2ROEA 2QA4S 2ZBPA 5EN1A 4LR7A 2C28A 4WPAA 3KNGA 2BE7D 4OX8A 1VQLS 4WFNQ 4I4BA 3MAAB 2CJBA 1VBZA 3AB4B 1R0BG 1SQGA 3OFHA 2VA3A 2KDOA 1I94F 3TZZA 4RU2A 4ZVUB 3UD4P 2F3JA 4NLXA 4DFJA 3C6UB 1RB0A 4I6YA 1QVFR 2R7XA 4QOTA 3H0PA 3H4BA 4C0HA 2MLZA 1HFEL 2CQDA 2FDNA 2FLLA 2RF2B 3BGLA 1K1QA 1U2CA 5IM0A 4Q45A 4QYZK 2ZD1A 4TYAA 4ZLNA 5LMNF 2AHOB 4F3OA 3OTEA 2R8GA 1JKHA 1RHJB 4CTAA 4LFAF 4CNZA 2Z2YB 2R7OA 3VVUA 3H25A 4X66F 1C0UA 1S1UA 2LXUA 3KK1B 1KKHA 2BOAA 1OS5A 2HFNA 2NQPA 2WONA 4R8UA 6AT1B 4JV5F 3Q0AA 2FVQA 1B70B 1WDDA 4KIAA 3SCIE 4Z7YA 3RRGA 4YDXA 3W65A 3LQVA 3Q86A 2VFRA 2E5JA 3K5LA 3CCJS 1N6QA 4Q43A 4LBPA 4OLPA 2AZ1A 1IKWB 4DSIA 4JYAF 3ISNC 1FDBA 3DLLQ 1PJ6A 2VONA 3OHBA 4NLUA 1XERA 5HI7A 6FDRA 3HD1A 3KDOA 1RT2B 3D5MA 4WF9Q 2XZDB 3MAAA 1SKRA 5THWA 3W9HA 3OV7A 2FZGB 4J9KA 3BBFA 3D9BA 4JI1J 2BXJA 1FA0A 3BPDA 2RNEA 4MFBB 3N0VA 1KLMB 4KJIA 1WC0A 4OYPA 3NS7B 5KFAA 1WTFA 4ZIVA 3C6UA 1E6VB 4Q44A 3WX8A 3X1LB 3MPYA 2MZQA 1QY7A 3CNQP 2E5HA 5D0RA 1RSCA 3JYTB 2BDPA 3M7VA 2IRXA 1YJNS 2I5JB 5D4NA 4F4KA 3S6EA 4Y28C 1NSKL 2W9BB 1PYOB 3ICLA 2BRKA 3MWBA 1ZZFA 1FFWB 5EDWA 3OL8A 1KTVA 2R42A 4RU9A 3PEJA 1RDRA 3CF5Q 1U49A 3KK1A 3M8QB 4MYTA 4F8RA 2A10A 2M8DB 2APOA 2V6AA 1IM4A 3OR1A 3R7BB 3MEEB 4R0EA 1SQEA 2V68A 1RWNB 1JJHA 4G1PA 2XS7A 3RB4A 1Q7LB 4JI6F 1IKWA 5I3QA 1T7PA 3I55S 4QIVA 2Y8YA 2AGQA 4DR6J 1N33F 3BGRB 1N34F 3PW7A 1MG7A 2MSSA 4MK9A 2WK4A 4OMFG 1RE1B 2I8EA 5IOLA 1H7WA 3GR1A 1VHIA 3OW2R 4F2RA 4HKQA 1FJEB 2CQ3A 1HHQA 3BQ2A 4K4XA 1NBEB 1G2EA 1BHNA 4DQIA 4MFBA 5GAGI 1U6BA 1KLMA 2XG8A 4JV2A 2RH3A 1E6VA 4DXLA 4CH1A 2FVPA 3QGHA 2XHWA 3MCOA 1HW8A 3TZXA 5E2QA 2HBZB 4JUZA 3JYTA 1SC3B 4WKYA 3TUPA 2XMVA 2D41A 3BKTA 3NY0A 2W9BA 5D8HB 3H8YA 2DGQA 2DY9A 5F0WA 3UN5A 2R8IA 3CJQA 1R8HA 4ECRA 1H2UX 3QT7A 3IWXA 3FGVA 1J5EF 2CVIA 4LUBA 4O0NA 2GIFA 4NPOA 2ABYA 3BSCA 2HVZA 2PIIA 8RUCA 2RD5C 3F41A 2NLWA 3MEEA 5B0GA 1X5OA 3K5PA 3ILOA 2QLBB 1S10A 3UDVA 2C3OA 2LVWA 3HP6A 2ZHBA 2GW8A 4EI2A 3PO4A 3AAWB 3BGRA 4RUBA 3FSIA 4FS2A 4AD6A 2JOQA 2V0NA 3NMAA 4UZBA 2COLA 4DV5F 1HNXJ 1QAIA 2LECA 2R2UA 2AEJA 2BR0A 5KG5A 2ZOFA 2JL9A 1KS2A 1CC8A 4L76A 1FHTA 4NE9C 3WIUA 2LMIA 5AJ3J 3MURP 2DTJA 2HZVA 4AT1B 3GV5B 4ECUA 4USKA 4A8MP 4NLVA 3CIZA 1N56A 1VFJA 2E7VA 2YWEA 2KZZA 2L9WA 1RHQB 4BS2A 1R27B 3KHRA 1JXEA 2V9WA 4TXSA 1SIZA 4A47A 4AYBD 3BEGB 1DTQB 3TRGA 4DR3F 5A6PA 4Q8EA 1KWMA 4EMDA 1NDKA 2OEMA 4ILLA 1U8WA 3AD7C 2OPPB 1W2BR 2XLKA 3M8YA 3LANA 3KOAA 1Q95G 1WTBA 3VAMA 3WZ0A 2G0CA 2J8AA 3OLAA 4R25A 1PC5A 1FDAA 2RILA 3I82A 2OFHX 2Z58B 4GO7X 2O1PA 1KHWA 2ZH4A 4N56A 1YG0A 2MSTA 3DLJA 5I3UB 4DX7A 4JI3F 1KP6A 2EVZA 1FKPB 2JJ4D 1VIOA 1H2TZ 5IQQA 5E41A 3PZPA 3R7SB 3G2XA 1U1QA 1CJVB 3B6BA 2BUNA 2Z57B 2DCUB 1HHSA 5HSPA 5J2QA 2YWWA 3PX0A 3W2WB 3J81j 3BYRA 4LRFA 1CSJA 1T9YA 2KT5A 3KLEB 1M5HA 4NLYA 1R8AA 2JX2A 3W1YC 1YRXA 1AROP 1AFIA 4TVAB 5DO2A 2MDAA 1Y7PA 4I6AA 5C24A 5AXNA 3VAGA 4W98A 1DTQA 5BJRA 3KJFB 3DDNA 3IAM9 4USJC 1FEEA 2GCFA 1F9EB 1ZOTA 3JQJA 1U1MA 3HM9A 2XS2A 5AXKA 2HKEA 3LH2S 4J91A 1S49A 1ZM3A 2OPPA 4F7VA 4ZHRB 1N88A 4RNHA 3W63A 2GFFA 2L08A 1RUSA 4NYPA 5DDOC 3HHNB 3MEDB 4Z37A 3NG8A 4USHA 2VOPA 2VPWB 3EXCX 3HSGA 4WP9A 4X64J 5GAGU 1RISA 3BSAA 3W64A 2VC0A 1ZAXA 3PW4A 4ZS6A 3UR3C 1FKPA 2C2KB 1TKDA 1GK8A 4J90A 2BKPA 5C42B 1VS3A 4OHZA 4IFYB 2IAJB 2BM1A 1F5AA 2F63A 3FC9A 1CJVA 1D9DA 2K7KA 1N5VA 2C2NA 2X1FA 3Q23A 2M4MA 3W2WA 5B08A 1SV5B 2XNQA 2LDIA 3KLEA 1B7FA 2IRYA 2L48A 2KRBA 4DJBA 3BO3A 5A2QY 1NAQA 3VZHA 2XULA 2PI5A 1D0EA 3MDFA 1P9YA 4EZ9A 3PY8A 2VPYB 3N4WA 3EMTA 2HVEA 3BH6B 1T03A 1NKBA 3H5YA 2DHHA 3N6MA 4L3NA 2DYAA 4ZVFA 4ZHRA 3GV8B 1BWVA 3KLIA 1B3TA 1EHWA 3ILJA 1ZAWA 4OZLA 4X4NA 3CJKB 2XMJA 1KSPA 1G1XA 1RU2A 5DG8A 1I1GA 4BLGA 2ASJA 1RTIB 4OZ1A 1DRZA 2MKIA 2XSFA 4ZDNA 5KFJA 4Z7CA 2AP6A 3M6WA 3HKWA 1KQGB 5K8OA 1O6XA 5C42A 2M7SA 4KH1B 2IAJA 3D54A 3W62A 5KFDA 1AW0A 3FQKA 1F9HA 1WHXA 4H4KA 5E5NA 4DCOB 3FUYA 1SV5A 3ONQA 4ED3A 1FWKA 2F65A 4PXDA 4CLYA 1Q78A 3DLGB 3TAPA 1WF2A 1DJ0A 4C11B 2NYHA 3TR5A 5KG1A 3CWJA 3RRKA 4DZ6A 1TK0A 3IN5A 3VF0B 1RI7A 1A0OB 2LQ8A 3AJDA 2RQ4A 5ETKA 2MQMA 4IG0B 1HNVB 3QMQA 1L5UA 3V2UC 2GJIA 1B0VA 2CG8A 1FKAF 3BQ1A 4NA2A 2UUAJ 1FKOA 4O0IA 4KB7A 4Q0BB 2XMTA 3UE2A 4DEZA 3H2LA 4OYXA 3KTQA 2CAJA 5KFNA 3GFZA 3CJKA 1PYSB 3L3CA 4O3OA 1RTIA 4QPTA 3WC0A 4BC9A 4PXEA 3CCVS 3HDSA 4ELVA 1OJ4A 2GJ2A 1GNKA 2FHKA 1NZ8A 3PG9A 3V5RA 1F3VA 1SJFA 2CPIA 2DR6A 4ZCMA 5B0AA 4OLOA 2IMOA 4FF1A 3KUEA 4KHRA 3SCKE 5KFZA 3K59A 5ITHA 4F4AA 4HACA 2IHR1 4ZPVR 1Q1KA 2IM1A 2W9AA 3DKDA 4QIWD 1VQPS 2IJRA 3MOJB 2Y8WA 4QWBA 4X4OA 1KONA 3AOBA 1IJFB 2Y0BB 3ITHB 3S7RA 4C11A 3IBWA 2P6SA 5AE1A 1QJHA 3DLEB 4NCBA 4DUYJ 4UOHA 2MHEA 3M6XA 2I38A 3EUNA 1TFWA 4QR0A 2X1AA 1HNVA 2V4JB 4P6QA 3HZGA 4WYLA 3V4MA 3E8OA 5AE3A 2YWFA 2QFJA 2AJ2A 1GEHA 3GR0A 4A8FA 2BW7A 2KL8A 3FMBA 2F8EX 3AB2B 4DFMA 1H73A 2OLWA 1VRQC 1HNXF 1HBNB 2J9CA 1NEEA 5LSOA 1TL7A 3NGRA 2W2PP 1JNZB 3SYZA
chains in the Genus database with same CATH topology
1MMNA 4CO4A 5AJ3F 4UY85 1XR7A 3TAMB 1Q82T 3MFIA 4PUOA 1VRUA 1RT5B 3BN4A 5L38A 1FXLA 1JNRB 1DZ5A 2V8GA 3KNAA 2ZFHA 1NO8A 1UW4A 4XIUA 4DR4F 3MMBB 2VBYA 1JLQB 1SC6A 3BB5A 4IG3B 1HQUA 2LKZA 5C5JA 2BV3A 4WFAQ 2OH2A 4MK7A 3MXHP 3LWLA 2R7VA 3K8WA 2VV5A 1LK7A 1VRTA 1BWEA 3IRXB 1URRA 2VOOA 1TZ0A 2HS0A 2OD4A 1MROA 2I1RA 1IKYB 2YNIB 3NS5A 4X4TA 1U1PA 4GMKA 3J7YU 2EFPA 3OQ2A 2JHEA 2RDIA 5D78A 4MIAA 3KHGA 4KR0B 1KOHA 2J0QD 2UVWA 4ED0A 2OJ3A 2PO4A 4KGKA 4QIEA 4NLGA 3VQTA 1ZH5A 3CCQS 5HO4A 1QAJA 5KAKA 4WZQA 3NCRA 3CDEA 2FGOA 1URNA 3IS9B 3T3FA 1QM9A 1X8DA 1TL4A 2E44A 1Y5NB 2WBRA 2KN4A 5LJ3Y 2YKQA 3PR4A 1S0NA 2BYCA 2UV8A 5T14A 4IDKA 3S1TA 4JV0A 2RJZA 3GIMA 1KQKA 4ED5A 3MEKA 2DNOA 4DF8A 4B9TA 4DPOA 1U45A 3DOMA 3ITHA 1RT1A 2PA8D 5A8WB 1UKUA 4TU7A 3TA2A 2DITA 3LGNA 2J9DA 3HFKA 1UETA 3L7OA 4DBQA 1JLGB 3PW0A 1WG1A 3DLEA 1NJWA 3CIMA 4JI5F 1FO1A 2HWHA 2R7RA 1P6TA 2IVYA 2BM0A 4IH5A 2V9KA 1H3DA 4C0BA 1YHQS 2QYCA 5M2RA 2N7YA 4I6WA 4I68A 1Y5LB 1JK9B 4LJMA 3CD7A 3UPFA 2KB2A 2P9EA 3C66A 2K8GA 2JSXA 1VBXA 2HGMA 3RZAA 3TUZC 3A1YG 3CUNA 1IKVB 2EFGA 3PNIA 4MKBA 4FF4A 2V8DA 1TR0A 4A8QA 4YB1P 2V4JA 3IR5B 3RBDA 2D1CA 5KT7A 3Q8SB 4NZ7A 3DLHA 1QTMA 3ZZTA 2BRLA 4OI6A 1IQZA 4OI0A 2AF6A 3CJ3A 2WB1D 2MYFA 2OIHA 3MMCA 4E98A 2IA6A 2HLUA 1IJEB 1NZAA 2RMLA 5DQIA 5HQ8A 3DFEA 4RBVA 2VFVA 4NZ6A 5DDPC 2XEXA 3I96A 5SUHA 5KT3A 3R5DA 2HMIA 4W92B 3BSOA 4A8YA 2KYXA 2MZTA 2MZSA 1T3OA 3ISZA 3LF0A 1HWJA 3TW0A 3TVYA 4WKRA 4IYQA 4NYOA 3P49B 1V3SA 2A1BA 2B3TB 5CYJA 1IBLF 3GZ7A 4XK8C 2C2RA 1H6KX 4OI1A 3TOQA 5EWFA 4ZPBA 1JX4A 1VQ6S 2CZVC 4X4VA 2KO1A 2YWHA 2ZITA 2MKCA 3SFGA 1E6YA 4K4WA 2CKWA 1HBNA 2L3MA 4PXCA 4F25A 2R8KA 2YQ3A 1GX6A 2OPRA 5HROA 2UV8G 2KT2A 5J2MB 4XO0A 1SJ1A 3EZ5A 1VQSA 1FVQA 2LU1A 4OX6A 4RW9B 1XEZA 4ED2A 1FJ7A 2VFTA 2KM8C 4HYKA 1T03B 2DRBA 4K50A 3MAQA 4DL6A 2PN6A 2EFNA 3VR1A 2XY5A 3TAMA 4DV3F 2GMJA 2PGCA 2MZRA 1RT5A 5C25B 1M90T 1JXLA 3NBPB 3PW5A 5B0DA 4LF8F 5KTQA 2VG6B 2CDQA 1VQ9S 1K0TA 1GXUA 3SSRA 1S1XB 4FNIA 1MWYA 2R2TA 1SB6A 2CYYA 4LFCF 3HK2A 3MFHA 1JWWA 2I9SA 4O44A 4G6VB 4TN2A 3HO1A 1WG5A 3M32B 4ID5B 3MMBA 2HHPA 5F8HA 1JLQA 1L3TA 4IG3A 2KXNB 4W90B 3KLIB 3PIOQ 4YR3A 5DG7A 1YSJA 3LP0B 4URQU 1RJJA 3BSNA 2IJFA 3K8VA 3IRXA 2W7AA 4ICLB 2CQGA 3ULHA 3BREA 2CPXA 1GXLA 3DOLB 1IKYA 2YNIA 4KSEB 3TP2A 1X0PA 5HN0A 2FHJA 3HVTB 5I3PA 1QLNA 4UOCA 2WOMB 2IYIA 1X4HA 3FCHA 2FC9A 2E5GA 2IFXA 4PG8A 5KFBA 1HHTP 1FNMA 2OD6A 4FPRA 1LK5A 3AY0A 1QAYA 4CH0S 2ADCA 3GYNA 4MYUA 1FRXA 5L8RC 3IS9A 5CZVA 2NPIA 1NK8A 5GADI 3H2VE 3UI3A 1RWUA 5M2PA 2E1RA 1HPZB 1W2IA 2KFNA 1UJ4A 4DN0A 5A8WA 2HHTA 5FDLB 2M0GB 4A8OA 3PIPQ 2Z8QA 3QWUA 4M8LA 2HAIA 3BF4A 4ZPTR 4O4GB 4BHQA 2QO3A 3O3LA 5L39A 2YKAA 3OTDA 3RBEA 1RTDB 3DRPB 1U26A 2O5DA 3M2UB 5D4PA 1UFWA 4NLDA 3QAEA 2ROPA 3JSBA 2MGZB 3CCRS 3I5BA 4I64A 3EX7B 1FTCA 1HI1A 4CNYA 1IKVA 1NK7A 2JC1A 2H5EA 2HQIA 3NP5A 1VQ4S 4ZOSA 1ZPWX 4KAIA 1N36F 3GIIA 4XDCA 3UDCA 4WU2A 4HDHA 5L1JA 3CMAS 4DLEA 4ECXA 3OL9A 2OSQA 5DGAA 4EYIB 5KFOA 3KK3B 3HHLA 4C8YA 5KFHA 1XMQF 1WF0A 4KQZA 3HHLC 5B0BA 3J7YI 3HI9A 2R8HA 2XBPA 2HHUA 4B02A 5BYSA 4X64F 2B51A 3GILA 3UD3P 4ZPDA 5CHCB 1UEUA 4YR2A 1TKXB 2CQIA 3DI6B 4NYZA 1DFDA 1DBDA 3QGIA 2E9RX 1UWBB 4BWMA 3VTIA 5A6WA 2J0XA 1N54B 2K1RB 2QZ8A 2ZM6F 2EFOA 4WYWA 5L9NA 2LEAA 3UFCX 2ZH5A 1Q79A 5D6GA 3DYAB 5CZXA 3CO9A 4DS5A 1OQ3A 1RYSA 1X9SA 1S4FA 4N76A 2B7CB 2IM0A 3M4XA 2GC8A 5KG2A 1HWKA 1ZTWA 4I0WA 2ERRA 3RW7A 3HVWA 2WBMA 2YNFB 4RW9A 5KG7A 4F2SA 2V8VA 1Z1ZA 4PG6A 5H9EJ 4N41A 1FKOB 4MK8A 5DLGA 3VAJA 5C25A 4EWTA 4JBCA 4J9PA 4OHYA 3VAKA 1H98A 2MHNA 3NBPA 4DL0C 4GC6A 2DNPA 2VG6A 1A7GE 3BR8A 2KXHA 4WCEQ 3M32A 4I2PB 4ID5A 1VI7A 4QW8A 1XR5A 2NPFA 2DHSA 1U2RA 4N8OA 2AYEA 2U2FA 3M2VB 3LP0A 3PM9A 3CCUS 2YX1A 4RW4B 4Y2CA 1BQMB 1RAJA 3MGJA 4KFBB 3N9UC 1KFDA 4UQGA 2XO7A 4J9SA 1NJYA 4ICLA 1LWFB 2RF2A 3DOLA 2ZNZA 3CCZA 5D4OA 4KE5A 3KMQA 2VG7B 3OXGA 3U02A 1U1RA 4P7TA 5B09A 4X2BA 1QSYA 3HVTA 3T1AA 4V19J 3HPOA 2BABA 3UCUP 4NZ0A 2XCPA 5CD4H 1VGYA 1FRHA 2GGPB 3OTOF 2B4PA 4OZ0A 3MD3A 3RR7A 4FYDA 3QYYA 3IGVA 2VB6A 4DMZA 3PDNA 4LSLA 3G71S 3CT9A 2J0SD 1X4CA 4QWEA 4ZPCA 1RT4B 3ZZZA 1N52B 4NLSA 4C3MA 2GMLA 4HI2A 5L9XA 5HMWA 4OHWA 4C8LA 3SCJE 1L3UA 1WHWA 2A3JA 1HPZA 2IRUA 3TUJC 4AQYF 2LEPA 2E7WA 4F4YA 4NCAA 1G7CB 7FD1A 2FLNA 3NKYA 5FDLA 3J7ZT 4V19X 3EXYA 4QR1A 1OQ6A 1C1CB 2B9WA 3MR3A 1S6OA 1S72S 3CJ2A 3QGPA 1NJXA 2WSFC 2FJAB 4H4OA 4O4GA 3UQSA 3UCZP 1RTDA 1SH2A 3DRPA 4B3SF 5AXMA 4DN9A 3BDPA 4XDDA 1UA1A 3M2UA 2YH1A 2VBXA 5DRKA 4EZ6A 3PXGa 4ZVGA 2U1AA 2MGZA 3GQCA 2RQMA 5KFGA 4ZCKA 3CC7S 3WDOA 2PT0A 1RT6B 3ISND 4Q7AA 3TYTA 1YJUA 1SH0A 5M2UA 1PILA 2RIJA 3KHHA 1KQSR 2XWYA 3OVBA 4DQPA 4BC7A 5IS2A 2R7TA 1M5SA 1X4BA 3DMJB 3IC1A 2KXFA 1OSDA 1S1WB 4OFZA