1X5YA

Solution structure of the fibronectin type-iii domain of mouse myosin-binding protein c, fast-type homolog
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
111
structure length
111
Chain Sequence
GSSGSSGPTSAPQHLTVEDVTDTTTTLKWRPPDRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIRESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myosin binding protein C, fast-type
publication title Solution structure of the fibronectin type-III domain of mouse myosin-binding protein C, Fast-type homolog
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 8
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5yA01
1DBKL 2Z35B 1HNGA 4ZSOB 4D2NA 1TIUA 4OQTH 3OKNB 1QA9B 3BXNA 4JO1L 5DJ2A 3T2OA 4KI5F 2VC2L 1QFWM 4JPIB 5HGAB 4RWHA 1JZ6A 1B2WL 1YNKH 2Y5TA 4QCIA 4V1DB 2EICA 4YBLC 5E94A 2W0PA 3RUGA 1I7ZA 5LWYH 2NY6B 1HSBB 4W6XB 1I9RH 3EOBB 4KAQL 4F37K 3S5LB 3QCTH 4NZDA 4OAWB 3OGCB 2P8PA 3D39A 3BP7A 4Z7UA 4OZ4A 3W2DL 1F4YH 1BLNA 1UXSB 2GK2A 4I0KA 5I66A 4NCDA 2RHEA 1YY9C 4NC0B 4OFYA 3CFKA 1YMHA 2VDNL 4G42B 4TSBL 5ESAA 3C8DA 3TH3T 2R29H 2YN5A 3S35X 5IHUL 1DQLH 1LP9B 3F5WA 5FCUH 4JRYE 3LS5H 3ZHKA 5KSBE 4JAMA 4NQDB 4PY7B 4GRLD 1CICD 3GBNH 3GUTB 5CCKL 1HOCB 1QHOA 3DX7A 4P23C 1ZHNB 3OJ2C 4GXVH 1P4IL 4S1RL 3TH2T 1NC2B 2EDLA 4OZFG 1LK3H 3O4LB 4OV5A 5IWLC 1OY3B 4Y4KC 3C8KB 4HJJH 1FFRA 2VXSL 1G7LB 1YN6A 5CBAA 2VJXA 4OKDA 3KPQA 3BIKB 5T33L 3WFEL 3ZKMC 4DGVH 4MGXA 3ZE0E 1DBKH 3OR6B 1EVUA 4I9WD 2ENSA 4OUUA 1U8IB 2ARJB 2CLZA 3MXVL 1A8JH 1N7MH 4HUMB 4L3EA 5EUOA 1HHKA 2OZ4L 3EYUL 2F5AL 3SO3C 4K71C 4GKZB 1N59B 4EOWH 2VMFA 4NT6A 3BKJH 3SE3C 5CP7B 3U9PL 4YHOL 5E99L 3LH2H 4YEFA 4U3XA 5GRWA 3RJQB 5LGKA 2VAAA 2XZQH 2P1YA 4EN3B 2QV2A 1P4BH 3KLSA 3B4NA 1N3NB 2GJ6E 4H25A 5EBMB 3G6DH 2QBWA 4OB5L 4XVUC 5DS8A 5L9DH 4HZLA 2FH6A 4JFEE 3IDYC 4BH8A 5TDOB 4X4MA 3VG0L 1F42A 4FG6D 5IHZA 1MCLA 5I1IL 3WDJA 1MRDL 3K1KC 3X13B 3EYVB 3GJEB 4LCUB 2HJFB 3QDMB 1PFCA 3V5HA 3O2VL 3KPSA 5F1OB 1PEWA 1EEQA 2UZIL 2A9NL 3VFVB 5KOMC 1P4IH 1S7XB 5DHYB 4G8GB 3AROA 4MJIE 4U7KA 4WRLA 2GY7B 5C9KA 2F8XC 2FO1A 5KTEH 4YHZH 5EIIB 3UTZB 1BF2A 1WAAE 1RZGA 1X44A 4LGPB 3QZWG 4PJDB 4XGZA 1R24A 1S7RB 5TH2B 3WFEH 5JW5A 1KXTB 3ZDZE 4YHKH 1HHGA 1P4LA 1G9MC 5ILTL 2XN9A 3BPNC 3U36B 1IC5L 1X5JA 5EBLA 3CFJA 5F89A 4U33A 3TEUA 5IVZB 5DUBB 5D1ZA 3DI2B 3ES6B 1S3KL 4LFHG 4RQQB 3SGJA 3MV9A 3UBXB 5BRZE 1CE6B 3GSOA 3RIFF 4HS3B 4JKPL 3U7YH 5I9QC 2QL1A 3RWCB 3QIWB 4OGXL 4ZODA 1JWMB 4HKZA 4KTEL 5E24E 2DM2A 1SY6H 5C07D 1KCUL 3ZKSD 5IT2H 4HUKB 4Y4FD 4OB5H 3DURA 2CK2A 5CMAA 1ERNA 1RUQL 2VE6A 2XWJB 1OTUD 1ORQB 2VUOA 3PWVA 4IRJC 1T1YB 4KKAD 4U1GC 3BGFC 5E00B 1MFBL 3ZE2E 5I1IH 1JZ3A 5JA9A 4YFLI 1RZJH 5CJ8A 2EKJA 5KSAC 4AIZB 4P59H 2J1KA 5D2LF 3O2VH 4PB0L 1S7VA 4ZSOA 2HFEB 4N5EC 1A3LH 1XEDA 4Z7WE 3P9MA 3OKNA 2A9NH 3VFSB 4B0MM 4QLRA 3OB0K 2O5XH 3RNQB 4OZIE 1CTOA 4FQIL 1FVEA 2BVYA 3WFZA 4ZS7H 5IEKB 1UJ3B 1CL7L 3GSNL 3G5ZB 2ARJQ 2Y7QA 2VQ1B 3ARGB 1RURL 5ILTH 1HSBA 1A9EA 5L2JA 3RVVD 3EOBA 3GSRB 3WS3B 1KJ2A 4OCLC 1IC5H 1CXIA 3MFFB 3L3IA 1A1MB 3BP5B 4YPGB 1UXSA 4MHHG 3CCHB 4JKPH 5D4QA 1F4XL 4BKLA 2VDOH 2CR3A 2XRAL 4G42A 4P9HC 3P77A 1SEQL 1FFOB 3IAQA 1PY4A 1QBML 5DLML 5B4MC 1KCUH 4Z95L 3GUTA 2EE6A 3C6LC 3NOIA 3DJ9A 3KYKL 3EFFB 1BREA 3LPGA 3I3BA 1N8ZB 4U7MA 1Q94A 1NGYA 1G7LA 1PX3A 2YWYA 5HBBA 1CFNB 3B6SB 3CFBB 2C9AA 3OR6A 4APQC 3QDJD 4PPTA 4PB0H 1WZMA 3V0WH 1MI5B 1T20A 3JTSB 1DANT 3C60D 1GZQB 1NC4B 2DQDL 5GGVY 2NY4D 1Q9WB 5I6XC 3IDGB 1FZOA 2DMKA 3AUVA 1U8LB 1EO5A 3Q0HA 4YXLH 3PGFL 1MQ8A 3VXSB 1YPZE 3GSNH 4OZHE 3BH9A 3K4DA 3BDXA 1OVZA 2A77L 1FGNL 2GSGB 1IGFH 2CJUH 3G6JE 3MLUL 3MBED 1N3NA 3UYRH 3WJJA 5EBMA 3MJ9H 1S7TA 3LDBB 1T0NA 4OT1L 4NO5A 3EYFA 3HC3L 2UUDK 2VL4A 2A6DB 4I0CC 1KV3A 1VKXB 5D2LA 4HS8H 3OKEB 4XAWH 2X05A 1B4RA 3T4YB 3EYVA 4K3GA 2HJFA 4NQVA 1C12B 3QDMA 2WIMA 1OAZH 3HG1B 3REWB 4JCLA 5DLMH 4LASL 3GSVB 5CD5C 4O2EB 2X4UB 3VFVA 5ID0B 1S7XA 4G8GA 3CSGA 1PAMA 2L7UA 1QSED 4MA7H 4AYFA 5D1XB 3UTZA 1P5UA 1VEPA 2MCG1 5TH2A 5DRXB 3IGAB 3NTCL 3W0WE 4D9RD 2AJVL 2YUVA 5EG6C 5F7WC 3CVHL 1RUPL 3BSZL 4K8RC 4O58L 4MDIB 3UC0L 2DQDH 2Q8BL 4PP2B 2XY2A 4OSUH 4WI2A 5DUBA 2CLRB 4JDZB 1CYGA 2OX5A 3PGFH 4RGOH 3W11C 5KVFH 2Y6SD 3J7HA 2HT2D 3FZUC 2ICCA 1J8HD 1T21B 3BAEH 5C09A 3QIWA 4NN7B 2VXVL 1U3HD 2A77H 4V2CB 1FGNH 1FL6B 3QUML 2F5BH 5DJYB 2VWEE 4KK5D 4PRBA 2DKMA 3D3VA 4DFIA 1T5WB 1E4XH 2CMRL 2XWJA 3MFGB 4Y8DC 3IF1B 1TZHA 2OP4L 4XNYH 5FM5O 2DD8H 5E00A 4HFUH 4N5UA 2X6MA 4F7PA 5HVWA 3ZMRA 3GMLB 4MD0A 1MREH 3UPAA 3CFEB 2NZIA 4HW6A 4J12A 4PJAF 1CDHA 3FHQA 4LASH 3MRQB 1MFEL 4JPWL 4F9PA 3VFSA 4M00A 1RZKC 2Y9RT 2I9TB 4K3JH 5J4MA 4WWKD 1FH5H 3QO1B 2LV4A 4LNRA 1QFUL 2EDNA 5IEKA 4R2GD 3O6FB 4NKMB 3NTCH 5J89A 3G5ZA 3BX7C 3QR2A 1OOAA 5IVOA 3L3DA 2BVUA 1OSZB 3MFFA 1JZ5A 3VFOB 3MNZB 2OMBA 4J3OC 3E0GA 4X99A 3FB7B 1D9KD 1A1MA 1V05A 3BP5A 4CAGA 2HH0H 4FXGA 3HZYA 4R8WL 2H26B 5B8CA 1TJGH 1FO0B 1MJ7H 1G1CA 3EGSB 4M7KH 3DYMA 4M6ML 1N4XH 2Z31A 3D0LA 4YDKL 4HKXB 3UEZA 4X9FA 4NQCA 4BSWB 1AJ7L 3CX2A 4WNQB 5HGDB 2CUHA 1MFDL 1CGWA 3QAZC 1N8ZA 4PJ9D 4RFEB 5FUCE 3OL2A 2BC4A 2DLIA 2P46B 5C9JB 1CFNA 4X5WB 5C7XL 2LVCA 1RQ5A 1G6VK 1UM5H 3FO1B 1NSNH 2L4OA 4OLZL 3QEGL 2RBLA 4LKXB 1C5BH 1MI5A 4X9IA 5B38B 4NC1C 3GGWA 4JRYD 5I1EL 4PTUA 1FJ1B 2ADJB 5GIRB 2NY3C 2FRGP 1CICB 1YEFL 3LKNB 4E0RB 2X1QA 1A02N 4C55A 2IH1B 2O5YL 5IVNA 1DVFC 2GSGA 1GIGL 1YMMB 5D93B 5SWQB 3I84A 5IQ7H 1DUYB 4FQQB 1DLHA 2V7HB 3GJFB 4S10A 2KZ1B 3FRUB 3QQ3B 2W0FB 3ZTNH 1I9EA 2H32B 2A6DA 1BVKA 1VKXA 4PJAA 3O9WC 4UT9H 2VB5A 4ONGL 3NPZB 3QCVL 1OM3L 3T4YA 3IDNB 1Q72L 5MP6H 3ARSA 4M6MH 4PLKC 3REWA 4YDKH 2GITB 1LMKA 4BFIB 4JY6B 4O2EA 5F6IB 2X4UA 1CGVA 3QEUB 1K6QL 1INQA 4LSSH 2A74B 2GJ6D 3V6OA 3VI3E 4JPKH 3EHBC 5D1XA 2GTZA 4H1LH 4Y0GA 3SE4A 4KHTL 4JFED 3FAXA 3RKDC 1U36A 3IGAA 2X1XR 4NQUA 4X8JB 1TFHA 4OD3L 1AE6L 1HEZB 3LRHA 1SBSL 3MXWL 4F2MB 2PXYC 1MJJB 3OAUL 1RD6A 3SDCA 3IRZA 3E2HB 3RX5A 1IC4L 4JKMA 1H9VA 3B83A 2YD2A 4MDIA 4NQSA 2AJSL 3NBNA 4M8QB 3VMOA 2VNCA 3TZVC 2HFGH 3AREC 4Z77A 5JMOC 2J3SA 2E7CA 4DOHB 1F5WA 1KCSH 2ED7A 1IEBB 4MJID 4Y5YB 4K94L 4O9HH 4F9LC 2EDWA 4RAUB 5E95B 3DNKA 3B9KD 1FL6A 3C87A 3P0VH 5FAAA 3WHXA 1GIGH 1BVLA 5DJYA 4QHMB 2HMID 1YZZA 4WTZA 5IK3B 4LF3A 4ZO8A 5INDB 2OM5A 3EYOB 6CGTA 5GRXG 3FO0H 4P2RA 1KEML 4PJ8D 1AHWB 3WE6B 1KELL 5GS2D 1KEGL 1MJ8L 4GW1A 5BMFH 1OAKH 3X14B 4PG2A 1IQWH 2YK1H 1KXQE 2RJMA 4KGLA 4AMKL 3QCVH 2VL5B 4N1CA 3GMLA 5BRZD 1OM3H 4PTTB 2QJDA 3CFEA 1Q72H 4OM0L 1A6TB 1G0YR 1F2XK 3QHTC 2NX5B 4GS7C 3MRBA 4U6VL 3ULUC 1CVSC 1MUJA 3QO1A 5T1KD 3FT4B 5IMLA 4U6YA 5C07B 1EEYA 4XPFH 1F6LL 2GSIA 4OD3H 3FOLA 1SBSH 1O0VA 5D7LA 1OAUL 1U8OB 2R9HD 3QH3B 3MZTA 5E6ID 2FIKB 5T5NF 3MNZA 3WIHL 3VWJC 4JREC 5DR5L 4TQEL 4X6DF 2FJGA 1J5OL 3G04B 1MHHB 3QEHB 3L3JB 5FGRA 4B50A 5KSVB 1XGRB 1FO0A 4K94H 4X80H 3TIDA 4UT7L 3V6FB 3RJDA 1MWAL 4ZUUB 1IT9L 4HKXA 4BSWA 4TUOA 1JHTB 4KXZI 1G9NL 1KEMH 5DFVD 5HGDA 3LN4B 1QQDA 3EYSL 2C4FT 1W72L 4WHTA 3CGTA 3QPQD 4FZ8L 4NQEE 4H8WH 2DBLL 4AMKH 3QXDA 4X5WA 3VD9A 3T2PA 4OM0H 3RPKA 1QVOA 5D7IB 3DX9A 4Z6AT 1IARB 3REVB 1SEBB 2I26N 5AUMA 3TPUB 3JVGA 5DO2C 3T0VA 2J12B 1OW0A 4U6VH 2PYFB 2ADJA 3V0VB 5GIRA 3BEVB 4QRUA 3NACL 1JV5B 4E5XB 1QSFE 3SE9H 2YD6A 1UCTA 4F15C 5HHME 5DJZB 3LKNA 4E0RA 4F7TB 4P5MB 5C0NC 2IH1A 3M1BB 1DANU 1BOYA 1U8MA 2YC1B 1YMMA 5SWQA 3GEWB 3WL9A 4D0DB 1Z0NA 2V7HA 1S7WB 4GAGL 3WIHH 3FRUA 4DN4L 1LO0H 3C08L 3BD4A 4Z7NE 2H32A 4WO4C 5HYJE 3TBTA 1AC0A 3C60B 2J4WH 2Q86A 3TWCH 2NMSA 1ZV5A 1MWAH 2H6PB 1IT9H 4XNZB 3BZ4B 3FFCE 1WWBX 4U1HA 4BFIA 4JY6A 4C4KO 1R5IA 1LEIA 2G2RB 3QEUA 3E3QE 1CQKA 5FA3B 4DUXA 5GJTL 1IM9D 5EPMB 2UWEE 3DUUA 2Z4QB 2XKUA 3VXOB 2G75B 3EYSH 5DZLA 1BQHA 5BVJB 1VGKB 4YK4B 2DBLH 3A6CL 3EZ8A 3P4OB 5LGHL 1OT2A 2MKWA 2D9QB 3CZFB 3SOBL 2DDQH 2XTJE 1HEZA 4NHUB 5HDBE 1IZKA 5J13C 4XPBL 4R9HA 5CUSL 1MJJA 1FE8H 1YEKL 5ISZB 5D7IF 4UQ3A 4RGNC 4M8QA 5AZEL 3CFCL 1HDMB 5KW9L 4L8SB 4JM2C 5C0CE 1IBGH 2VR4A 5DD3L 4Y5YA 4XCCL 2BNUB 5I74C 3QHZL 2JJSA 1QSEB 3QEQE 4UAOB 4WFFE 4O4YH 3W0WD 2WNGA 3BN9D 4UDTA 4P2OC 3EYOA 4JFQB 4BUHA 4GAGH 4ERSL 4Z0BH 5HSFA 4EUPB 3H3BC 4DKEL 3WE6A 2ZUQB 4C57C 1RIHL 1ROWA 4X6DE 1SMOA 2LFGA 1X4XA 4B7IA 2AJYL 1Q9KB 4PTTA 5IB1A 1A6TA 4YPJA 1SYVB 1FDLH 5K59E 4JR9L 2NX5A 5T1MA 4LOUC 1EAJA 1TJIL 4M7LH 3ZSSA 3GSXB 2CKBA 4OGYL 1J8HB 4XMLH 4NQXB 1U3HB 5CWSA 4NO3B 5HGHB 3ARWA 1NMCB 1JPFA 1S9WA 3FT4A 2I07A 1T1XA 2MNUA 5BV7C 2C7UB 3WIFB 5F21B 2O61B 2CKNA 5LGHH 3ZTJH 4L4TB 2G5RA 4MSWB 5FDWB 1NFIB 3DV4B 4LCYA 4MZ3A 1E28A 1QFWI 1U8OA 3QH3A 5EOCJ 3Q2CA 1OAYL 2FIKA 3IDXH 1MFAL 1KCRH 4IOFC 4N8CL 5CS7A 3CFCH 3TBYB 5KW9H 1FNFA 3G04A 3QEHA 3L3JA 3X3FL 5KSVA 1UYWL 3WBDA 1IKFL 4R26L 2VDKL 3HE7C 2VLRB 2PW2B 4ZUUA 4WWKB 5HI4C 3FQUA 1D5XA 2ZPKH 2ATKB 2EO1A 1CD1A 1F02I 4R2GB 2VISA 1P9MC 5GJSH 4LSTH 5DEGB 4XX1G 1CD0A 4DKEH 1KPRA 1XGYL 3LN4A 4EDWH 1JTPA 2WW8A 3ARDC 2BHUA 4OFKA 1C5CH 3VFRB 4GW4B 4JZOB 1D9KB 2GT9B 1M7IB 4BZ2L 5D7IA 2MWCA 1AO7B 1MH5A 2F53E 1SEBA 3I6KB 3REVA 3BQUD 5C2BH 5I76B 1F58H 1WK0A 3RFZC 3QULB 3NCFB 1BHGA 4O2FB 5CZVL 4P4KD 3TA3D 1JRHI 3BEVA 3ARZA 4E5XA 3QPXH 5GRJL 3VFNA 3MNWB 4ACPA 5A16B 1L7IL 3CX5K 1WSST 3RL2B 5CKGA 5F7UA 2AEPH 1RZFH 5DJZA 4YAQA 4F7TA 4XTRD 4KQ3L 4PJ9B 4PJ5B 2YC1A 5F7EH 4KQ4L 2Y06L 4D0DA 3T09A 1S7WA 3SQBA 1PZ5B 2DJ4A 2VZSA 3D6GA 3VXME 3EBAA 3TO4D 4UIKL 4Q6IB 4JFPB 5EA0L 4LLDB 4A6YA 4R26H 2IG2H 2VDKH 3IYLW 4JRYB 2SEBA 5KSBB 4MA1C 3GMOB 2P5WB 5DDHB 2H6PA 3G5YA 3GKWL 3I85A 3A67H 5EFIB 5D72H 3CFIC 2DIAA 3HMWH 3KYOB 2G2RA 3LPWA 5FA3A 5C0DB 1IGCL 5I8EB 5EPMA 3Q6GL 3MYZA 2Z4QA 3BGMB 5BVJA 3LEXA 4F3FA 2K7QA 1VGKA 1EPFA 3ZE1F 3DUHA 4Y2DC 4NSKA 3QUKA 3TT1L 4NHUA 4BZ2H 3OB8A 3MMEA 4LSPL 2QLVB 1XZ0B 4KROD 2ZCLL 1KC5L 5EOQH 4QO1A 1A6AA 5BZWB 5ISZA 2VDQL 4XP6L 5JIPA 3RZCC 3TFKD 1HDMA 1T66C 4YHNA 5HVHB 2WLYA 2OR9H 1KB5A 4POZC 1BPVA 1L7IH 4PG9A 4YDLC 4G6KH 2BNUA 2LU4A 1IZJA 1DBBH 3SDDA 3OTTA 4OZGB 2GJ6B 4WEUD 1CXEA 3LRSA 4BSVB 3D2UB 3B2UC 1KJ2H 4U1SB 4JFQA 4X4YB 4YE4H 1I8LC 2FX7L 3ILPB 2ITDB 4EQ2A 2VLLA 3OZ9L 5KANG 5HHQA 1A0QL 4YDIH 4RZCA 5BW7C 3MUHL 4UOW0 5JNYA 4NGHL 1Q9KA 1LK2B 1C16B 2F8OA 4X6BB 3ARYA 3GKWH 4Y8AA 5DJXA 4KDTC 2IAMA 3O2WH 2OQJA 1SYVA 4MJIB 4I4WB 3WO3B 3RQ3A 4NN5B 2LAGB 3VXTB 3QB7C 1XIWD 1OARH 1AI1L 4NQXA 2ILLA 3B9KB 1UZ6F 2D03H 3PXJA 1D7FA 3RVXD 3WIFA 4XP9L 3C5ZA 4L4TA 4U4BA 4OBSA 3WS6C 3VDAA 4X9GA 4R4FH 4LCWA 1CR9L 1WBZB 3MLWL 4LSPH 2Z8SA 5EU7E 5FDWA 3DV4A 1VACB 2XIDA 4KUZL 4NOFA 3RTQC 2O5ZL 4LRIC 3HE6C 2VDQH 3CK0L 5IV2A 5HI5D 1HXMB 5TGBB 3P3YA 1NLDL 1U58B 4P48A 3O3BB 4EI5D 4OZFA 2JB6A 3KPNB 3ET9F 4K55A 1HCVA 2VLRA 5JR1L 1WT5C 3DMMB 3BYTA 1NBQA 4G9DB 5T1KB 5GSVB 1X5IA 4LVHB 2RR3A 3MUY1 3LZFH 2XZZA 4ETYA 4Q7DA 3MLPA 4KC3B 5E9DE 3RVUC 1KTKE 2AK1H 3ARFB 2I60L 4JO3H 1TETH 4PRPA 3VFRA 1I8KA 2E6JA 4R7DB 4GW4A 1MQKH 3ZYOA 3R06A 5E6IB 2JK5B 4JZOA 4NGHH 2IADB 2DWEA 2X41A 4GAFB 4ZTOL 1AO7A 4G5ZH 4UUJB 4MCZB 4OLYL 3KPOB 2QSQA 4OZIB 3V7MA 5I76A 1HH6A 4P3CL 5GS0D 3QULA 3RWEB 5FHAH 1T7ZA 2C4FU 4GSDL 3RGVD 4I48B 2P45B 4ZFOB 3ULSB 5E8OA 3MNWA 2IPUK 5A16A 4K9EL 4KJYA 1AXSB 3RL2A 2DL9A 3ZKXB 5IP4A 3H9ZA 1JGUH 4GT7A 2P8LA 1YEIH 3BP6A 4NQED 1NDMB 1CR9H 4EDXB 3MLWH 4PJ5A 4KUZH 1UVQA 2VAJA 1FYHB 4GW5B 1VADB 4QNPF 1XCQA 5ADOL 1TVBB 1NLDH 2WQ8A 1WFUA 3HZVA 1TZGH 2BSTB 4I0PC 3O2DA 4QWWD 3V7AE 4M1DL 4Q6IA 2XA8L 4LLDA 4HGMA 4OFVA 3QZWA 1QSFD 4IDJL 1CGSH 1CI5A 1JPGB 5JR1H 2P5WA 3GMOA 4J1UB 5DDHA 5EFIA 5HHMD 2N4IA 4AY0A 3HPLB 5CD3B 4YO0B 4S2SA 3KYOA 1SMAA 3C2AL 5C0DA 2XG5A 2I60H 2MJWA 3TC9A 3BGMA 8CGTA 3PQYE 3U79A 4I3GA 5C0GA 3ZT5A 3L7FB 4DVRL 5I19H 1KIRB 5HYJD 1Q8MA 4ZD3L 1I4FB 3VGAB 4JZJB 1J9CT 1XZ0A 4XHJC 3TBSB 2HG5B 2ZJSH 1DQDL 4N9OB 3CDFA 5BZWA 3CXHK 3FFCD 1C1EH 4GSDH 4O5LL 2W1NA 5FUZL 4OZHB 4LLVB 1R0AL 3R8QA 1G6RA 4K9EH 4HMDA 3DETD 3H7LA 3G6JB 3VRLF 3WFCL 3IJYA 1PZUB 1IM9B 4YGAB 4XVSL 4BSVA 3D2UA 1SYSB 2W0KA 2XTJD 4V2BA 3U82B 5JMRA 2YPLA 3T0EE 3P40A 4X4YA 4JB9L 5ADOH 3LMJL 1Z3GL 3ILPA 3C5SB 4CJ0A 1QFOA 2QQKL 1RFDL 3PGDA 2BVTA 4X7SL 2XA8H 2FLRT 4TTDD 4IDJH 3HCVB 1XGPB 5C0CD 3L95B 1JF1B 3TVMD 1LK2A 3DYOA 2HLAA 4WHYH 4X6BA 5EO9B 1IGML 5I73C 1T3FB 3NIFF 3DX8A 3U7WH 2FB4H 2VDML 3QEQD 3RWGB 3BD5A 3RAJH 4WFFD 4JDVB 1YYMH 4PGBB 3U0PB 3KYMB 3PHQB 2X4PB 1LNUB 3PGCB 3W0WB 1MCOH 4I18A 1J18A 4ELKA 1E27A 3GMPB 5E8DH 1U92A 2J8UE 4ZAKD 3BKYH 4QTIL 1SQ2N 3BJLA 3VFMB 5KG9A 1WBZA 5IROC 1SJHB 4HK0B 2DKSA 1VACA 1GGIH 3QG7L 3S4SB 1JGDB 3DO7B 3QO0B 3FT3A 1HXMA 5TGBA 2HJKB 1QBLL 1RZJC 3O3BA 3EJJX 4WI6A 5AD0A 3KPNA 1HQ4B 1S5HB 1ZHLB 1FPTH 3U30C 3DMMA 3S7GA 3TCLB 3GI9L 2X9YA 4IS6A 4G9DA 5FM4A 1EHLH 2VIRB 1CE1L 4NYLB 1BJ1J 4TUJA 1HIML 4P5KA 3P9LA 5D2NA 2LABA 4EZMA 1RULL 5I8CA 2KDGA 4OIIL 4B53A 5GGRB 3ARFA 1JWSA 2A6KB 2ZCKH 4CVXB 1KG0A 4QTHB 3D18B 1QG3A 4R7DA 1TNMA 2JK5A 1WBYA 5FGBA 1JGLH 4Q9QL 1H3UA 5DMKB 3PV6B 1IGMH 4OCYL 2YKLL 3PWUB 4M5ZL 4UUJA 2DWDA 1YNTB 2B8OT 2WQRA 3RWEA 4ETQB 4MAUL 4N8VB 5I1AB 2CRIA 4I48A 3T04D 4M9OA 3OJDB 3UTQA 4CU6A 4AG4L 1UB6B 4ZFOA 1MNUH 3ULSA 2X1WL 5B3JF 1CXHA 4M1CD 1Y18B 1LEGB 1KIQA 3AM8C 5KS9E 5E08H 1NDMA 1UQSB 2A0LD 4EDXA 1FAKT 1I1AD 4NJAH 3QG7H 4GW5A 4YDVA 5BQ7A 1VCAA 2F53D 4HIXL 5E8PB 4WU7A 3U7AA 4KRPD 2MCPH 1FO0L 1KLGB 4HKJA 4WV1A 3BESR 5MI0C 4FQ1L 1S9XB 2FL5A 3MUZ1 2X89A 4J1UA 4JANB 4NN6C 3ECBB 2QEJA 1CE1H 1ES0B 3IFOB 3HPLA 4MJ5A 5CD3A 4TSAL 1HIMH 3CD4A 1DLFH 3DRQB 3QUYA 2FEDD 5EU6A 3FCTB 1ED3A 3IS1X 4Y16C 2FJFA 3VXMD 3T2QA 1TQCC 4Y4HB 3SGEH 3NH7L 4RAHA 4FQXA 1AGCA 2LVEA 4Z7VE 3HI5L 3KDMA 2YN3A 2MOVA 2YKLH 4M5ZH 4JZJA 3FQWB 5JQ6H 3OXSB 4QRQB 4R0LC 3TBSA 2HG5A 4UMGA 1TVHB 2V17L 1OPGL 1EFXA 1UJTA 4MAUH 2E7LA 4LLVA 1S9VB 3AU1B 3QXVA 3TYFB 2IWGA 4FMFA 4TULL 3IFPA 3WSQH 4P5TC 1NFDF 3JSSA 3RDTD 4MXVF 4G6JL 4WUKL 2IPUG 4BA8A 1LVEA 3C5SA 2GK0B 4L9LB 5I30L 1BBDL 1CZ8H 1FO0H 2GY5A 3U4EB 2AW2A 4N0CC 4XCFH 4XPAH 1XGPA 1GZPB 1T2XA 3WXVL 4LHUG 5DJ6B 3D48R 4F8TA 3O8XA 2HRPH 1DFBL 3TN0D 4JDVA 5MEOB 3O41B 4L3CB 1P1ZB 1CF8H 4XB8A 3U0PA 1Q1JL 1HWHB 4QEGA 2X4PA 4PJFF 1LNUA 4ZPTB 3QIBB 3PGCA 3S36L 5IMMB 3OAZH 4HJGB 5E4EB 1SM3H 1TTFA 3GMPA 4J3SA 1ZLUH 4PJCB 2IANE 3GRWA 3VFMA 1T22B 3D69A 5IF0A 1MFNA 1SJHA 3KPPB 3JWDL 5F71A 3EO0B 5BXFB 1Q0XH 1JGDA 2V17H 3HI1A 5DVNA 1P7KB 2XQBL 4JRXA 4HXAH 4AEFA 5F9DC 2HJKA 3PP4L 4MVBC 3SDDD 5FYLH 1Z5LB 4QT5A 4TN9A 4X5XB 2OBGA 1JYXA 1S5HA 2NW2A 1ZHLA 1XAUA 3I6GA 4JQXA 3DHMA 4M93C 4JN2B 4TULH 4E41E 1V7ML 1ONQB 4XRCB 3K3QA 2B20A 4UTBL 1TPXC 2CRZA 4JLRB 2H32H 43C9A 5GGRA 5I30H 5I1JH 2A6KA 4K7PL 4CVXA 4HT1L 4WFHE 4QTHA 1HK6A 5FDYA 3D18A 3QP3A 1DQTA 3AS0A 4DKAA 3WXVH 4RWYL 1WBXA 5EZIH 3NFNA 5ID1A 1W2KT 3PV6A 2OXGA 3QFJE 2F19L 4EI5B 5K9JL 3QRFM 4ODTH 3RU8H 4EXKA 4N0YH 3QNXB 3ARBA 4ETQA 1OSPL 3VXUB 5I1AA 1BAFH 3AAZA 4HPYH 3SN6N 2H9GB 1UB6A 2R1WB 1MCHA 1NJ9B 1PQZA 3IJSB 2VLME 2W59A 5E9DD 1A3RH 1CFSA 1LEGA 1NFDA 2AERT 4LQFH 4JQVC 3VGHA 1NLBH 3VU2A 1X5LA 4FQ2L 1UQSA 3DHJA 5GGUA 4EBQL 4CW1B 2ZUYA 5C8JA 1F3JA 3AY4C 2XQBH 3HR5B 2D31B 3MGTB 5E8PA 3EO9L 1LD9A 5AZ2L 1MAKA 1IEAA 4HEPG 3ALXA 4YEEA 4M61B 5ALBL 4FTVA 3LQAH 3SKMB 3WKMH 1GYAA 1AGDB 5F7DB 2A6IA 4CMHC 4JANA 3K1DA 5T3XE 43CAA 1YY9D 4RA3A 3ZDYE 1ES0A 3UROR 4MAYB 4HWEH 4PJFA 4ZYKA 4RAVB 5L88L 1FVDB 1HHIA 1M7DB 3DRQA 3MCLL 4NC1E 4NQEB 4Y19E 3FCTA 1U91B 1CGUA 1TJHL 4HT1H 5F9WB 1DR9A 3U0TA 4P23D 4Y4HA 5F7LB 3VGDA 1WIPA 3IRPX 4HCRL 1EUUA 4LAQL 2IBGA 4FABL 1J7VR 4NOBA 4Y4KD 2NTFB 2BNQE 2F19H 3WLBB 3OXSA 4IRSC 4HG4J 1TVHA 4OIAA 1QSFB 3I9GL 5DMJB 3ZKMD 1SVCP 3OPZH 5HHMB 1X4ZA 2HJLB 3LN5A 3AU1A 4HWZA 3MJ7B 4YJZL 2JE8A 2HLFC 2PXYA 4F7MA 3PQYD 4FQ2H 2D4FA 4X83A 1KPVA 4KTYA 4U1LA 1F4WH 4YIQA 1GGCH 4EBQH 3Q48A 2IFFH 6FABL 3EO9H 3QJHB 3BMWA 2GK0A 1J05A 1VPOL 3E1F1 5CEZE 5T1LA 4HBQA 1U8NB 5T3ZE 3U4EA 3NCBB 4Q58C 4XVUD 5FYJE 3FFCB 3BT2H 3TM6A 1RY7B 1GPOH 4PD4K 4XB7A 4XWGL 1F3DJ 1K85A 5CJXA 2DQIH 4YDJB 4NBYB 5L88H 3Q1SL 1I7UA 1X5ZA 4P99A 5IB2B 2X4OA 5DMYA 3MLTB 4I13B 1OGTB 3MCLH 4L3CA 1MCCA 1P1ZA 1YEEH 3T0ED 1LO3L 3QIBA 5TF0A 4XPTL 2E6QA 5TQ2L 3VH8B 1IMHC 1AGFA 2LTQB 3OG4B 4HJGA 2IBBA 3SDAC 4PJCA 3VD5A 3KXFA 1FL3B 4G9FE 4C83A 1NCNA 4Z76A 3I9GH 1P7KA 4PS4H 4GQPH 1E4JA 5HYQB 3QUXA 2E7HA 1XGUB 3M07A 4GLRH 4R90H 1Z5LA 2VQTA 2JIXD 3HKFA 2I25N 3QEQB 5JLZB 5HHXH 3F7RA 3QXUA 5E4IA 1ONQA 4XRCA 4YHPB 3VWJA 6FABH 4J8RA 1BF8A 1RK1B 4ZNEA 1FIEA 4B7LA 1NCCH 4DQOL 4D3CL 3UJJL 3MRNA 3HMXL 4ZAKB 1I1FA 1FSKC 1MJUH 4A6YH 1AXTL 5DJ0A 3ULUE 4JM2F 2BRRL 4XP4H 3DLQR 3UTTE 1YEHL 3FONB 4IRJD 1U41A 1MCIA 1OAQL 4GBXB 3TNNA 5D5ME 2GCYB 5EU5B 5KSUB 4UNVA 3QNXA 2G9HB 2EEBA 3QUZC 5KSAD 2NYYD 1MLCB 4K94C 3VXUA 1CGTA 3RA7H 3PHOB 5IFJB 2R1WA 4N5ED 4LSDA 3AGVA 1NJ9A 4IMKC 3SHSA 5K9QG 4GH7B 5J12C 2Q3ZA 1U9KA 3CXDL 3BJ91 4N68A 1ZS8B 5HHNA 2JTDA 3WFHB 2D2OA 1E4XI 1N0XL 3FFDB 1T7XA 3RY6A 1TVDA 1GGTA 1A7QL 1BEYL 3HR5A 4H8WC 3MGTA 1KB5H 1DCLA 2F74B 5DRNA 4MB5A 2BZDA 4AK1A 4PRHB 4M61A 3SKMA 4OI7A 1AGDA 3WIIH 2CUMA 2BVEA 3OR7B 2WBJD 3U83A 2AVGA 3KLHC 4DK6A 3DVFA 2OJEB 3MUJA 5I71C 1L7TL 1QLFB 4DJMA 4IIQC 2WWKO 3L5HA 4MAYA 1A2YB 4RAVA 3BEWA 1M7DA 2RFXB 4YUEL 1DSFH 5C08E 2NY2C 5FO8B 4YBQC 5B4MD 5DD5L 1AXTH 1I1AB 2BRRH 3ZKQD 2OR7A 3C6LD 1ZOXA 5FYJU 1Y0LA 4HIEA 1YEHH 2AV1A 1S9YB 4MJ6B 2NTFA 4KRPB 4PRIE 3VWKD 3H9SB 4NJ9L 2DQHL 4ZXBC 2YD1A 1B0RA 1KFAL 4APQD 1BD2E 3DXAB 3VI4F 4R4NC 5H35B 4ODSL 4XXCA 3V9FA 1OTSC 3NAAL 4PR5A 2C3HA 4PJEF 2BSED 3RI5F 1KJVA 2CXGA 4NUGL 5JZ7C 3QNZA 4X7FC 3F7YB 3UAJC 2DQUL 1OQOA 4LSRH 3WJLC 1A1NB 3VXMB 4OCXH 4HFWA 1A7QH 2XZAL 4JM2A 2FIRT 1P6FA 2BRQA 5J9PA 1UWGL 3QJHA 4OZFH 3HA0A 5DK0B 3O2DL 1U6AL 5K9KA 1MIMH 5L7XL 1PGRB 2ERJC 3MRIB 5F88B 2I27N 4YXHH 3LD8C 2MQCA 1BQLL 4OF6A 2VZTA 1I8IA 5IB2A 4YUEH 4PFEA 3ULVF 3MLTA 1OGTA 3O6LL 3EDDA 1ETZB 1JUFA 4RGNE 5E70A 5CD5D 5C70A 1QRNE 1BX2B 3OG6B 3X11B 3O3DA 3RIFK 4NNXB 1ZLWH 3U46A 4HPOL 1QZ1A 5CSBA 4QRRE 1NEZB 5FGCE 1FYTB 2J6EA 4LCCB 1JTOA 5D96C 1P2CB 4MQ7B 2HT3C 2EE9A 3BZFB 4Y5VB 3E6HB 4ODSH 4K8RD 4XC3H 5IMOB 3SCMB 4F58H 1H8SA 5JLZA 2D7NA 3TN0B 1VB9A 5J6HB 4NUGH 5I75C 2FATH 5A1AA 4YHPA 1NGZB 5HJ3B 3W11D 3FZUD 3IS0X 1RK1A 2FD6H 1KB9K 2IAND 4LRNH 2XZAH 4RFNC 3AXLB 3FTGB 5L2KA 1D5ZB 4AENA 4KMQA 4KGJA 3O2DH 1NAMB 1ZLVH 1MIEL 4JGMA 1SBBA 4OLUL 3MV11 5L7XH 4JY4B 1GGBL 4LMQI 3FONA 1BQLH 4GBXA 4GRMB 3MLRH 4Y2OA 4E41D 2GCYA 1BOGB 2P47B 2AV7A 3MBXL 5D70L 5C3TA 4PJBE 3O6LH 5ALCL 1D5MB 2A73B 4PJEA 3QIUC 2V7NB 3QWQB 2VH5H 4TVPE 5I2IA 4LDOB 4WFHD 3IDMB 1NAKH 4X0KB 4HIHA 1H3WM 1K8DA 1XF3B 2ITCA 3ESUF 2Q8AH 4U6TA 3A6BL 3RPIA 3QFJD 5EOCL 2IQAA 5IM7B 1WICA 1INEH 3OQ3B 1G6RH 1Z9LA 4PRHA 3K81A 4LL9A 4KI5C 2VLMD 1FZMB 3QCUL 3OR7A 4IOIB 1XT5A 3UTSE 1QLFA 2A83A 1LHZA 4DAGL 1A2YA 4UBDD 4YFLF 3DECA 4YXKL 2A2QT 3INUL 3CSYB 4Z7OF 3LOWA 1J0YA 2AGJL 2AJUL 4FFZL 4GXUN 4J23A 3F7QA 3BRGC 4AL8L 1Z9OA 4YBLB 5D1ZC 1IL1B 5HY9A 1RIVH 4MJ6A 3GSWB 3PNWB 5SWZE 3PG2A 3SGJC 3H9SA 4KHXL 2YMXL 3MBXH 2JKXA 3R1GL 4ZFOL 1II4E 5EZLA 3DXAA 4Q9RL 1RUML 4NFBA 3SDYH 4M48L 4Y19D 1I3GL 4JN1L 4KKLC 1DE4B 3SJVB 4DKFH 4IMLB 2NY3D 3F7YA 4XMKL 1G7HB 2C4XA 1F6AB 5A3IC 3A6BH 2G60L 4XBGB 4ZO7A 2F58H 4X7TB 2BNQD 5FOBB 4KY1H 2BVQA 1TZIB 3A0OA 1AY1L 2WIIB 1DVFD 3T65B 4Y4KB 2IQ9H 4ODUA 5GGTL 2ZKHL 3RVWC 4D9LH 1JVKA 1JGEB 1NBZB 1A6UL 3MRLB 5F88A 1MCJA 1K5NB 3QCUH 1A47A 4M7JL 1I8LA 3SKNB 4DAGH 1CFQB 3O9WD 2VABB 4K71B 1DP0A 3PQYB 2JCCE 4PLKD 2P5EE 2NY1C 4NFDA 2AGJH 3PDDA 2NY6C 2R23B 2OK0L 4FFYL 4KDTA 5DUML 3MV7E 5CEZD 4NNXA 1FG2A 3EHBD 3TT3L 1FNGB 5T3ZD 3NZHH 5ICYB 5DD6A 1A22B 2P7TB 1OGAE 5FYJD 1PSKL 3RKDD 4K3EH 2YMXH 3IFNL 3NCCB 1NEZA 4RISH 1FYTA 1OAXL 3R1GH 1RJCA 3FN0H 4H0IA 5H8DA 1U8QB 4YHML 4LEOB 3UO1H 5MEND 4Y5VA 2PXYD 3C6SA 4WI9A 2OTUA 4JJ5A 5IMOA 3WS6A 3SCMA 4D94A 5EN2A 4O2CB 5DJDB 3TZVD 3ARED 3WEXB 5J57B 2A1WL 5J6HA 4KDWA 1FFNB 5HDLA 3T0EB 2ADIB 1NCUA 2ORBH 4OF3A 1NGZA 1T0MA 2B0SL 5C0JB 4HGKC 5IFHL 2GFBB 4EIGB 3U48A 4XCNA 3FTGA 3G6AB 1AY1H 4G9FD 3IU4H 3S6CA 3S5LG 4KTDL 2JLLA 2Z91A 1IAKA 1UT9A 1WWWX 4KJPD 3GIZH 3K2MC 2BMKB 5F1IB 2YXFA 4XNUL 5I1KH 4LLMB 1DL7L 4WGWB 2DTMH 4HUVB 2KKQA 4KZDL 3BDYH 2BSSB 3BPNB 2JIXB 1A14L 1H8OA 3B9AA 1KPUB 4GRMA 2X4NB 5LGJB 1BOGA 3MOAL 5DJAA 2EKSA 1KIUA 3QQ4A 2R2EA 2FNBA 2A73A 4EN3C 2J2ZA 4J3WA 4M6NH 2V7NA 4N0UA 1N5AB 2J8UB 5I9QB 4Z8FL 2OK0H 3WJJC 3OBAA 4O00A 3ULUD 4LCIH 4LP4A 3GK8H 4XH2B 3GRWL 3TT3H 5TDNA 3V4PL 5I8KH 1XF3A 3UTTD 1W8OA 2B4CL 3D25A 4PJ7E 2HVKB 5SV3A 3BGFB 4HGWA 3FB8A 3MRCB 3RWJB 1MCQA 4JFOB 4R7NB 4S1SH 2E9JA 4ONHA 4K3HA 5BS0B 5IFHH 1MF2H 3DUSB 4MDJB 5C0RL 2DYPD 4DGYH 1FFPB 1E0OB 1JWUA 4Q2ZA 4KTDH 3T8XA 2ZG2A 5F1KC 1JF5A 2K3TA 4PREB 3VCLB 1A4JA 2D3VA 1H5BA 1X4YA 5IUSA 1GHFL 2FBJH 5F1NA 3RWDB 5ADPH 3GSWA 3PNWA 1KN4L 4W4OA 2D7OA 2FGWH 3MOAH 5MEQB 2B1AL 3IETA 2VZOA 3NFSL 3QIWC 2NY5H 2WBJB 1WISA 5C08D 5DO2D 1BFVL 4Z8FH 5GS1B 4TPRL 2MQ3A 3CC5B 3E6FA 2ENYA 3AS2A 3SJVA 2AEIT 2EH8L 3GRWH 1I9IL 1H3GA 5E2TL 2Q7YB 2EYRA 3V4PH 3V52L 1G7HA 4UILL 4PGJA 1F6AA 3DVNB 4ZFZB 1NANH 5ANME 2R56L 5BVPH 3QQ9C 4PRID 5FOBA 4FQCL 3ELAT 5H2BB 2RCSL 2EE2A 3BUYA 4Q9BA 3N9GL 2WIIA 2BHYA 2YWZA 2HVJB 3VWKB 3U6RB 3LEYL 2Z0BA 3G5XB 4RGMB 1PG7H 3MYJB 3V4VH 5BCAA 1CDGA 1BD2D 3TV3H 1NBZA 3UBXG 3MRLA 3Q5TA 4LEXL 2E7BA 3IDJB 3DSFH 4F9PC 1MLBB 3NCJH 4APQB 4PV9B 1MPAH 2A9ML 5IB4B 5IVXB 5DT1L 3CMOL 1DEEB 1WTLA 4WO4D 1NPUA 5TFSH 3JWOL 3SKNA 2FX9H 4G8EA 4HK3N 1UJ3C 1J1PL 5C0FB 4N8PA 4K9EC 4S0SD 5E5MA 2B2XL 2DQFB 3OAZK 4XPHL 1ZLUK 2R23A 3MCKA 2OZ4A 1AKJA 3KWWB 4Z7VB 4C4KT 5GRVL 3P0YL 2R0KL 1KOAA 4HUWB 1AP2B 1BGXL 4Z5RA 4MYWB 4NPYB 4JFDB 3NFPA 1FNGA 3LQZB 1M05A 2P7TA 2ED9A 3ALPA 5B8CC 2B1AH 1T04B 1VFBB 2KQNA 1A64A 3MRGB 5F7MC 5T3XH 3P4NA 3MRDB 1JF6A 2XV6B 1KTRL 2MPAL 1WCBB 2Z31C 1BFVH 3JXAA 4RX4A 3MOQA 4MWFB 3TJHC 3GMQB 3MA7A 4I5BB 3QQNA 4RGND 4O2CA 4XCYA 5IROA 5C0AE 3WEXA 1QRND 4TUKH 1UA6L 4LLYB 3V52H 4XPGH 2WUBL 4UILH 4JHZA 2Y07L 1WV7T 3BHBB 4XC1L 1PYWB 3MOBL 3O45B 5DURB 2E8ZA 1MVUA 4OGZA 4QRRD 2RCSH 3VXRA 3T3ME 2X70B 2DQJL 3L3OA 3LEYH 3B9VA 4P2OD 4FP8H 4LEXH 4QGYA 2BMKA 5F1IA 4KPHL 1MVFA 1NCDL 4LLMA 2YBRB 4HUVA 3L1OH 2WMPA 4G6FB 2PCPB 1J1PH 1EH9A 2X4NA 2X42A 1Y6MR 5IVXF 3B3IB 3SBWA 1I1CA 3MODL 2VXUH 4QRPB 4XPHH 1QLRB 3GB7B 1CFVH 4LOUD 1JPTL 2FWOB 1N5AA 2UZYB 3FT2A 2YPKB 3NIGF 4FS0A 1BGXH 1PG7X 5ESVB 2FO4A 3LDBC 5I1CH 4X6EB 2APTA 5E2VH 4PGDA 2XPGB 2V9QA 3T0WA 2IPTH 4U1JB 2X40A 2UVEA 5DMGC 4JFZH 4DEPB 2HVKA 1LEKA 4ZNCD 3HPJB 2EH7L 3GMNB 1F2QA 1CIDA 5CFHA 3CH8A 4IOFD 1AR1C 5K9OB 3RWJA 4TVPD 3V6OC 3VGBA 4JFOA 4R7NA 1J8KA 1A7RL 3CDCA 2ID5A 4KK9C 5D1XC 2EO9A 2FYYA 5BS0A 3SE4C 4N0FA 3TJEH 5KBNC 4MDJA 3HE7D 4OTXH 1W8NA 2HKFL 3QI9A 1V7NH 5HI4D 3MRRA 1A7NH 3IFLL 4PREA 3VCLA 2IALB 3VFGH 4WVRA 3SDCC 1N5YL 3QFJB 4KPHH 3F58H 5HDQH 3GHBH 3RWDA 3WNKA 3ARDD 3HC0B 5JPMB 3RVTC 3LKPB 5CEXB 4RNRB 2XQYK 5MEQA 5GGVH 2Z8WC 3UTSD 4F33B 3VXPB 1JBJA 4ODVH 4NN7C 1C08B 2X4SB 3CLFL 3OXRB 5CBEB 4MQTB 4GUPB 5GS1A 3NA9L 1JL8A 2CSPA 5HYIA 2H1PL 2OL3B 3CC5A 3NPSB 4S0TD 4WEMB 1QP1A 4IEFB 4F8QA 5HHOB 3Q6FB 4LHUA 4MJ4A 5DWUL 1FVCB 3PWPE 3DVNA 2HAZA 1JFQL 4ZFZA 2OSLB 5TE7L 2WUCH 4PG2C 3BPLB 2PW1B 5SWZD 2IMMA 3EO1A 3QAZB 2EH7H 1A6ZB 1CFBA 2HVJA 5D1QB 1JNHB 3G5XA 2WZPD 5GS0L 3B9DA 3OAYH 2VXQL 2ADGB 1NEUA 3IDJA 4OLWH 4PV9A 3MUGB 1ZHKB 5IVXA 1DEEA 3GO1H 2AQ2A 1NBYB 3KPMB 1BJ1H 1HKLH 3OF6D 4OCWL 4M62L 1IAIM 1RVFL 2DQFA 1IEHA 2NY3B 2J5LB 4BK5A 1LWRA 1W0YT 4WGVB 3IFLH 4XMPL 3SY0B 4RRPG 1U3ZA 4NO0D 4HUWA 1AP2A 3B5GA 3MRJA 1X7QB 4GAJH 4JFDA 4NPYA 7CGTA 4NBZB 2I5YL 1Z6JT 1Z9SA 2IH3B 2EDFA 1JI1A 5ECJE 4YZFE 4Y2DD 1D6VH 1J10A 5F96H 1T2QL 1VFBA 3MRGA 3FQXB 4N9GB 3UDWA 4BZ1L 4H88H 3CLFH 5FK9B 2FGZA 1DBAL 1R3IL 3DROB 1BJMA 2VLKA 2P5ED 3F7VB 3GMQA 4O51A 1P84J 3S97C 4ELMF 3RZCD 1NCTA 1T66D 4POZD 3L6FB 5DWUH 4YHLL 3MV7D 2YZ1A 2AK4E 1MRCH 5JO5B 1AIFA 3O45A 1OGAD 4DZBA 3S37L 1ZSDB 1QKZH 2X70A 3TBWB 1CBVH 3B2UD 5DC9B 1NGXB 4KJWC 2Q20A 3JVGC 1OW0C 2YBRA 4LK4A 1FORL 5MENB 3ETBF 1A9BB 5DD1L 3OJVC 3SQOL 1NCAL 2R2HB 1CICC 4LGSB 1RVFH 3TZVB 2V2WB 4EXPX 4QRPA 1CXLA 3CVHA 4PLJC 4HUXB 3QXAB 5SWSA 1OP3H 2FWOA 3HS0B 3N0PB 1OD7A 5EU3B 1I85A 3IAGC 3DVGB 5ESVA 4G9FB 4X6EA 3LHPL 4HX1A 4FXKB 5ERWA 2I5YH 2CK0H 5CJOH 4CU7A 3RL1A 1M4KA 1FAIH 5C0BB 2XPGA 3H3PH 4U1JA 3MROA 3QUMA 5B38G 2VO5A 4DTGL 4BZ1H 3M17A 3NIDF 1RUKL 3HPJA 3RTQD 4L5FL 1S7UB 4LVNC 5F7KC 2C1OB 4C56B 4D8PB 1R3IH 3HE6D 2VDRL 1CXFA 2VZUA 4X8XA 5FO7B 5F6IC 4WUUE 5HGGS 1U8KA 2P24A 4FN0A 2Q76A 3QHFL 5JIKA 4LSUL 1G7JB 2FHFA 2APWA 4HUNB 4UTAL 3PJSB 4E9LA 2F54A 3MGOA 5F6HI 4KMTH 3NGBC 1RHHB 1NUFA 5DVKA 4TRPH 3UTTB 1W0VA 1XMWA 4XZUA 2QKIB 4XAKE 5FF6B 4KV5E 4WCYL 4DW2L 2ICWI 3TF7C 4J4PA 4LSQH 4RMWA 2P43B 3SQOH 2XY1A 5LAXB 4LLUB 4RNRA 4Y5YC 4JREB 3VXPA 3DX6B 3LQAC 2JJSC 4PJIF 1J0HA 1C08A 3KNBB 2X4SA 4G8IB 2C3WA 2AJ3B 4GUPA 4L4VE 3SDXE 2GAZB 4MNHA 5HHOA 4WENB 2NZ9C 1FL5B 3Q6FA 3ZLQC 5IFAL 2OSLA 3T0DA 2J6EH 3MV8E 2PW1A 4LPWA 5FUOL 2C1PA 1IC1A 3EJZD 4X98A 1M71B 1RUKH 4FFVC 1A6ZA 3D85B 5D1QA 1JNHA 1G7IB 2BDNH 3BO8B 3MRKB 5KAQG 2EIZB 3PWJB 2ADGA 3BW9A 4I77L 3N1GC 4GG6B 1J1OL 5DRZA 3ULVL 1DDHB 3L5WB 3QHFH 1ZHKA 4ELME 4I0PD 4UTAH 2WK2A 3O3UN 5C08B 3K8LA 3VD7A 2IBZX 1HHJA 3KPMA 4FOMA 35C8H 5CHNB 5DI8A 3MRFB 3WDIA 5GQBA 1ZLWK 4H0GA 4OCRL 2MSPA 1OTUC 2AI0L 3SY0A 2VSCA 5BJTA 4HS6B 2D7TH 4WCYH 2DLFL 5DQDL 1TTGA 3B5HA 2BFVL 1ZGLA 3WKNA 3MLYL 1EO7A 2IH3A 1BD2B 3W82A 4R97C 1MRFL 4Q9CA 4HDIB 5GRUL 4KFZC 3FQXA 3MA9L 4JPVL 4N9GA 1C7TA 3OHXB 5J6GB 4P2QA 2X4RB 4UINL 5D7JB 1YY8A 4XHJD 1TCRA 5FK9A 2E9BA 5CIPB 3VXNB 3DROA 3FO9A 4Y1AB 2W38A 4TOYL 1NCBL 4OLVL 2EDTA 5IJVB 5F7HA 4OI9A 3L6FA 3HRZA 5IFAH 4I3SH 3IB4A 5DQ9B 1ZLVK 3S34L 5HYSB 1ZSDA 1QD0A 5FUOH 3SGEI 4PGZA 3TBWA 3HUJF 4MXWH 3MREB 1DN0A 2OJZL 1NGXA 4ALAL 3CVIL 3NIDE 1KN2L 5KVEH 4HIIA 5EORL 1HSAB 5DMIH 3UYOD 3I2CL 2B1HH 4QXGH 3ULVH 1UWEL 5J13B 1CDYA 1PKOA 2AKRB 3V95A 1UG9A 1CQYA 5C0AD 1RI8A 4PJIA 1GC1L 4GG6F 5EUKA 4GRWB 2DQCL 4M5YL 2KL6A 1T89A 3V0AC 1CLZL 4ORGA 1PKQB 1U8HB 3P0GB 2V2WA 1QRNB 4JKWA 4OCRH 4PJGF 4K23H 3QXAA 3ALWA 1T7VA 3GM8A 1CU4H 5EU3A 1RUAH 4QRRB 3DVGA 2DLFH 3BIAX 3KJ6H 5FGCB 3MLZH 5C0BA 2P48B 2XA3A 5HHVL 3MA9H 5IBUB 3H9HA 2R69H 2X9WA 3I75B 5DFTA 4XNZC 2VN4A 4C56A 1DJSA 5FO7A 5D7SH 3WNOA 2PYEE 1E6JH 3P30H 4UU9B 4DKDC 1G7JA 1KCVH 2H3NB 2J88L 5ITFA 1MCRA 2OCFD 2QSCL 4I2XE 1NAML 4YFEA 1N6UA 2OJZH 1XF4B 3K0WA 3CVIH 1IKNA 4LU5H 7FABL 2E7MA 1W0WB 1WEJH 2JJTA 3DRTB 5F3BB 4X6CE 2AABL 2DL2A 5C0EB 1N64L 4GO6B 5FF6A 1CK0H 5IOPB 1ND0B 1F3DH 3X12A 3MLSH 4NDMB 5EC2B 2Y36L 1JZ4A 3QNYB 4YWGL 3P11L 4YLQT 5HPMA 4NZRL 2EIEA 4G7YL 5IESH 4LGRB 4IHOB 5I1HL 3KNBA 4UAOC 4NIKB 3ILQC 1J0IA 4HUUB 4M4RA 2GJZB 3EDKA 2R8SH 4ZPVA 2HFFB 3PHSA 4D0CB 1FN4A 3FQRA 3ZT6A 1CLYH 2XKNB 4JQIH 2PO6B 3HUJA 1IFHL 4NKDA 5DEFB 3HI6L 3QDGA 5HHVH 1S7QA 1M71A 5ESQB 3ARPA 3ARDB 3D85A 2AEQL 1G7IA 3BO8A 5DTFB 3GMMB 4XVTL 4DVBB 3PWJA 1H3PL 5LVEA 4GG6A 3WJLA 3TCXA 1DDHA 1MHCA 1W72A 2J88H 4XVJL 3H42L 1NMCC 4NWUH 4PJGA 5ETUA 1FZJA 3W39B 3LIZL 1JGVL 2VDLH 3KGRA 4M1GL 3C5ZC 3PWPD 4YH6A 5FYKH 3VXQB 1YYLL 4LLWB 3UPRB 1ACYH 1WITA 3BPOB 3KPLB 5DRWB 2UYLB 4MNQA 2W9DH 4OCSH 4EUPG 1JZ7A 1KBGH 4UV4H 4XBEH 1A7PH 1CD9B 4JFFE 2W0LA 1BM3L 4HS6A 2AABH 2PUQT 2XXMB 4Y16D 5D6CB 2R0ZL 3SGDI 2Y36H 4YWGH 1I9JH 2NW3B 4QHUA 4NZRH 5T5FH 3QJFA 1L4IA 4R4BA 1MHPL 5J6GA 5D7JA 1BZ7A 2KZWA 2WBKA 4QOKB 4PJGE 1OCWL 3VXNA 3P73A 2GTWA 4Y1AA 3KYNA 4TVSa 4U1KA 1QPPA 4MA1B 4J6RL 5DZNA 3MV01 2DOCA 5H37G 5DQ9A 3EUUA 3HC4L 3HZKB 4L8BB 4P2YA 3ZO0A 4KJQC 3STZB 4P5TD 1MAML 3MREA 4CUCA 4XVTH 1GH7A 1E6OL 5DQJA 1G7MB 1C5DA 1H3PH 4Y2DB 3RUGE 1BP3B 3MNVB 2H45A 3LKOB 3SKJL 5ICXB 3STLB 4DN3H 3EDJA 3D39E 4WI8A 4Z7UE 5E2WH 4WDIA 5FXCH 4N0CD 1D5BB 3LIZH 1MCBA 1T5XB 2JCCB 1JGVH 4M1GH 1PKQA 1U8HA 2YHGA 2AK4D 1OHQA 1OLLA 2ZSVB 1AGEA 1RZ7L 2FCBA 5DC0A 1OB1B 4JO1H 4RMQA 3OMZA 3RX8A 3P4MB 1QEWB 5GZOC 1OGAB 9CGTA 1F97A 1DQJA 2VC2H 3OGOE 1EXUA 1B2WH 1CD8A 1YNLL 2RB8A 4QHLB 4Q6IC 2YSSB 4PYGA 3R0MA 2R1YB 3QIUA 5F9JA 1MHPH 4KAQH 5JHDA 3I75A 1P7QB 5IG7A 2IEPA 3SGKA 3W2DH 1OCWH 1N0LA 2M26A 1B3JA 1GSMA 2UVFA 4WJ5B 4FHBD 4LIQL 4MVBD 2BVPB 4L3EE 4GKNA 5EUOE 2G5BA 1N2RA 3GSQB 2BNRB 2H3NA 2VDNH 3C9NB 4TSBH 4H26B 5DK2B 1YA5A 3HC4H 1A6WL 4NP4L 3L7EB 5IHUH 3PL6B 4GQ9L 2GJJA 4FFWC 2CPCA 1WJ3A 3RHWF 1MAMH 3HNTL 5CCKH 2MHAB 3JBG7 4S1RH 5EZOL 3CH1B 3N50A 1LP9F 2Z9TA 4KUCF 5GGRY 5I15L 1W0WA 1EAPB 1U2CA 1G9ML 3SKJH 2VXSH 2YPVL 2ZUSA 2ICES 5F7NC 5IB3A 5IOPA 4PJHB 1J86A 4MNGB 5T33H 4E42B 4WUUD 5HVHC 5EC2A 1YQVL 2OTWB 3QNYA 8FABA 4X4ME 3EYQC 3MXVH 4KWUA 4IHOA 2OZ4H 3EYUH 1B0GB 1FZKB 5KVDL 2F5AH 3O4OB 4HUUA 1T1ZB 5AAMA 5ENWB 3KPSE 2HFFA 3IDIB 1QUNA 1JNLL 3U9PH 4YHOH 5E99H 4HHAA 1UM4L 4KI5E 1YNLH 2XKNA 1WVZA 2PO6A 4XAKD 4ZOAA 5HYFA 3HAEB 5DEFA 3BZEA 3CFDB 4L4JA 4NO2B 4K7FB 2DI9A 1T7WA 5E7BA 3CLEL 4MA8L 5M94B 4NN5C 5KJRL 4YC2C 4KVNL 1UCBL 3PWLA 4LIQH 4WWID 2XN9E 4L4VD 3VG0H 1M6OB 4P9ML 3B9KC 1MRDH 4GAYB 4L8CA 1TITA 1U8PA 4I18C 3W39A 2Z35A 1J0ZA 3MV9E 2EXYC 2WINB 4P46B 1MELA 4IJ3B 3MV8D 2UZIH 1QA9A 3KPLA 3H2WA 2UYLA 2N7BA 3ARRA 5DRWA 5EZOH 5K33A 3OKLB 3GI8L 4X6FB 3HLAB 2HWZL 3QISA 2Q6WB 5BOZG 1MCFA 1EO8L 4JPIA 5HGAA 3FO2B 5EU4B 2ESVB 4V1DA 2PF6A 2NW3A 4PJDF 3I02B 4M7ZB 4PJHF 2XXCB 2WSKA 4HMEA 1T1WB 3DMMC 1EJOL 3V5DB 3S5LA 4OAWA 3OGCA 3QWRD 4IRSD 3MO1B 4QOKA 1WWAX 1S3KH 4P9HL 4ZSOE 3MJGX 1Q0YL 3LVEA 5D2NC 2VUYA 2DI8A 3ARFC 3GM0A 1QLEL 4OGXH 2R9HC 4KTEH 5DYOB 3WHE1 3HZKA 1T03L 1LP9A 4FNLL 1CXKA 5FGBC 4M43L 5AYQA 4NQDA 4PY7A 5GZNC 3STZA 1HOCA 1ZHNA 4NKIL 1HYSC 2X7LB 4X7DC 1NC2A 1G7MA 4MA8H 1RUQH 1D5IL 5KJRH 1FBIL 3MGAA 3O4LA 2BCKB 3C8KA 1FCCA 1IM3B 1MFBH 5IGXL 3BIKA 3BP4B 1MSPA 1U93B 2PNDA 4U0RC 4JO2L 1D5BA 1T5XA 1JNNL 3ZKXC 1U8IA 2ARJA 5GRVK 4JG1L 2F8VA 1UM6L 2AS5M 3THML 3VJ6B 1OB1A 1MOEA 1EZVX 4GKZA 5DXWA 1N59A 4FQIH 3SO5A 1BBJB 1QEWA 3P4MA 2V9RA 3LKQB 2HWZH 3QA3B 1EFQA 2L0DA 5CP7A 1CL7H 3ORJA 3CSPA 4QHLA 5KN5B 2YSSA 4KVCL 4WV1C 2W65B 4EN3A 1KTDB 1RURH 5INCB 3SDAD 1FIGL 3IXTB 1P7QA 1HI6B 5C0AB 2QADB 2QQNL 1YC8A 1J0JA 2Z93B 5EB9A 3CUPB 1RJLB 5TDOA 2JJUA 4WJ5A 1Q0YH 1FP5A 3QUYC 2W92A 1MCPL 4J7RA 2X9XA 2XOTA 5I73B 1UKTA 1F4XH 1F8TL 2FLBT 3GSQA 1QLEH 2BNRA 2XRAH 3C9NA 4H26A 3X13A 3GJEA 5DK2A 4HLZG 1RAMA 4LCUA 1SEQH 2ZUUA 3VFTB 1QBMH 3PL6A 2NXYC 3SKOB 1HXYB 4ZUSB 4M43H 4Z95H 4FQXC 3JZ7A 1NDGB 2MHAA 4NKIH 3KYKH 4QY8B 3CH1A 3VGAC 4JZJC 5DHYA 4OF5A 5F3HB 1D5IH 1F11B 4PBWD 1T0PB 5EIIA 2E7LC 4AH2B 4MB4A 4PJDA 3F12B 1S7RA 4K8RL 4PJHA 4MNGA 4E42A 2DAVA 2PYED 3IDUA 1R3KB 1UFUA 4JO2H 4OD2B 1RPQA 1X5YA 3DTXB 3VGFA 3WFDL 4JG1H 1HYRC 2J7LA 3THMH 5D2LE 3U36A 5SX4I 5IVZA 3QDME 2GUOB 1T1ZA 1GXEA 3ES6A 3HNVL 3KPRB 3QUZD 4RQQA 3U30B 2V2TB 3IDIA 3UBXA 1CE6A 4NHCL 4HS3A 2R0WL 3RWCA 4G8GE 1IC7L 5L6YL 4KVCH 1JWMA 4LAJH 1GGYA 4Y7MA 3OAYK 4CNIB 3MLUH 1FIGH 5IBLC 4PJDE 4NO2A 4K7FA 2XNAB 3KVQA 4ODBD 2X4QB 3O8XC 4OT1H 3HC3H 1ACZA 3TIEB 3OV6A 1TLKA 2AXFB 1ORQA 1MCPH 1T1YA 5GGSB 1GGUA 1M6OA 4DUWA 3PWNB 4GAYA 2NY5C 3KS0H 4POUB 1D3CA 4AIZA 2DBJA 1EUTA 3IJHB 2FZ3B 4P46A 2HFEA 3RRQA 3KLHD 1K3IA 5B39B 4MXQC 4ZDHB 2D7PA 5C09E 1F3RB 3OKLA 2WWKT 3O6ML 3WN5B 5L0QC 1XR8B 3RNQA 5GRYA 2VLJB 3HLAA 2NY2D 1IAII 5I1DB 4HC1L 1MCSA 1NUDA 4YBQD 1UJ3A 3FO2A 3D3VE 2ZCHL 4UQ2B 2ESVA 1ZGLP 1WZKA 2VQ1A 2AJVH 3ARGA 2IBZY 3CVHH 4JQXC 1RUPH 4FMKA 3AS1A 3BSZH 3VGGA 4O58H 1T1WA 1G0DA 3GSRA 3WS3A 2GYSA 4JZNB 5LBSL 1UZ8B 3UC0H 2Q8BH 4JM4L 3MO1A 1K4DB 2OL3L 4ZXBD 4YPGA 4QXUL 1QOKA 2EYSB 2APXA 3CCHA 4R4ND 1RMFL 4JFFD 2D0GA 3AMKA 5CINL 5L6YH 5JPNB 2Y72A 3RWHB 1OTSD 2VXVH 3NZ8B 1FFOA 4J2XA 3QUMH 4G6ML 4WIQA 1R3HB 1KENL 3S88L 3S4SG 1EERB 5I1LB 3VW3L 3UAJD 4WW1B 2IPKB 1FNEB 4G6AC 2X7LA 3EFFA 1XR9B 2CMRH 5FHBL 3N85L 2OP4H 4FRWA 3ARBC 1IM3A 3RWFB 2O93L 3B6SA 1ORSB 3KLAB 1PBYA 4MHHI 5FEBA 3CFBA 1OP3K 2QQLL 4HXBL 1I7RB 2W60B 4PJXB 5I1GL 1MFEH 4JPWH 1F90L 3JTSA 3VJ6A 4HBCL 1GZQA 2DM3A 1NC4A 1Q9WA 4HULB 3IDGA 3EOYG 5F1SA 3LKQA 1QFUH 1U8LA 3QA3A 4NQCE 3VXSA 5B21A 4GRLB 4UV7L 4P5TB 1QBAA 5CGYC 1YECL 1NUGA 4NNYB 4HF5L 4M4PA 2W65A 1KXVC 3D39D 3FKUS 2CD0A 2HKHL 5LBSH 5C0IB 2E27L 1EEZB 4N8VG 5HI3C 4JM4H 1VERA 4OFYD 3WCYA 3CUPA 4J3TA 3T0AA 4QXUH 1TMCB 2AK4B 4R8WH 1MI5E 1CTNA 2HT3D 3FN3A 3R8BB 1RMFH 3GBML 4MD5B 3OKEA 1S5IL 1C12A 3HG1A 5T3ZL 4Y4HC 3GSVA 2DB8A 5FYJL 1AJ7H 2R2BB 4HAFA 2CDFB 4QY8A 5ID0A 5F3HA 5LKNA 5FHBH 1MFDH 4U6XB 3N85H 4B5EA 4AH2A 3T0XA 5DRXA 4A2MA 5C7XH 1QFWL 1R3KA 3Q3GB 4L3ED 2JB5L 2D9CA 1EGJL 4XNXL 3DTXA 4OLZH 3QEGH 5FM5M 4PJAE 1OL0A 4QF1B 5I1EH 5ICZB 4PP2A 2GUOA 4Y5XB 2CLRA 4NM8L 4QRSB 3KPRA 3HG1E 4JDZA 4M93B 2V2TA 1WZ1L 1DBJL 5DVOA 4UV7H 2P8MB 1YEFH 1J88A 3U2SB 1T21A 3V6OE 3LSOB 2O5YH 5JXEA 3SE8L 1CDJA 2HKHH 2XNAA 2X4QA 5C1MB 1ZT4B 5CJXC 1T5WA 1RSFA 3TIEA 1FCGA 3IF1A 4RRPA 3VFPB 5AG9A 5EWIL 1PX4A 4JCMA 1H3XA 2VDPL 3KPSD 3PWNA 4ONGH 1HZHL 3QIBC 1RIUL 2WWMC 4KI5D 3IJHA 1E4WL 4HWBL 5E4EC 2HA1A 1JRHL 2JELL 3MRQA 1NGQL 1R5VB 4ZDHA 1K6QH 5I18L 3WN5A 2I9TA 5F7YC 4NKOB 2VLJA 3QFDB 3BH8B 3C5JB 4KHTH 3O6FA 3QUXC 4NKMA 4Y4FB 4OGAC 2HTLC 3CU7A 1QFWH 4HH8A 2XN9D 4LSVL 1KIPB 4P2RE 3RI5K 5JW3L 1AE6H 5IQ9B 3MXWH 5D1ZD 4A2LA 3IT8D 3OAUH 4L4VB 4MJ2A 1IC4H 3SDXB 3MV9D 1UZ8A 1OSZA 2AJSH 3VFOA 5E2UL 3FB7A 1INDL 1WZ1H 2H26A 2BJML 5AWNL 3MV8B 2H2PC 5KAQF 3EGSA 1ZTXL 5CAYB 1QR4A 3WFBL 3NZ8A 4F7CB 4PRNB 3QDAA 5I1LA 5A40E 1ZMYA 4U05A 4YGVB 4CBPA 2IPKA 3O11B 3ARQA 2AQ1A 1FNEA 2EEDA 4QRTB 4WNQA 1KELH 1KEGH 1XR9A 4H0HB 4TNVF 5D7LE 1MJ8H 3EFDL 1Q9OB 4RFEA 5C9JA 3RVWD 4RFOL 3TNMB 1RIUH 2YD7A 3K2UL 3FO1A 3F6LA 5DGRA 3IXAB 1I7RA 5KVGL 2VZ3A 4LKXA 1NGQH 4W4NA 5B38A 1FJ1A 3RY6C 2EDYA 1NANI 3IKCB 2N1KA 4LVOB 2NY1D 3FAWA 4GRLA 1CICA 2YUXA 4X9HA 2NY6D 2AEWA 1ZVSB 4JKLA 4NNYA 2MTPA 3SPVB 1OAUH 1HHHB 2EIDA 2PTUA 1DUYA 2CLVB 1TENA 4FQQA 5C0IA 1S7SB 1QPXA 3GJFA 5DR5H 3QQ3A 3WNNA 2W0FA 4MAYC 2BVOB 5TE6L 4TQEH 1OF2B 3QDJB 1J5OH 3WXWL 1N6QL 3ME0A 2BJMH 5GISL 2O26U 2GEEA 4G80B 4C54A 2QSVA 1ZTXH 2NY4B 4LBEB 4UT7H 2DMCA 3IDNA 5F9WC 3NN8B 4G3YL 1MAJA 2GITA 5FYLE 1ZEAL 2XYCA 2R2BA 3JUYA 1G9NH 4JFXB 1IGTB 1JNJA 2LU7A 2A74A 4JDTL 4ODXB 1YMME 3MBEB 3SDAB 1W72H 3OKYA 1HNFA 4FZ8H 4G43B 2CRYA 4XXCC 5IKCB 4X8JA 1KT2B 3PF2A 5D8JL 3AB0C 3RWIB 1UACL 3MACL 4F2MA 1A1OB 4NZUL 5ICZA 4Y5XA 3NACH 1IJ9A 1VGEL 4PD4J 2BXYA 4ZTPL 3N1QC 3PDOB 1NCWL 1IEBA 1AXIB 4EN3D 1BFOB 2P8MA 3MJ8B 3U2SA 1G84A 1Y6KR 4IRZL 3U4BL 5I16B 1PLGL 4M3KB 4Z78B 1ZVYA 4RAUA 3H6JA 4N0RA 4ODHL 4QHMA 5IK3A 5INDA 1QNZL 1FSKB 4WEBL 4NM4L 1ZT4A 4DN4H 1AHWA 3C08H 4BJLA 4OFPA 1A4KB 3OKOB 4N90E 3VFPA 3WXWH 1DBML 3QDMD 3O81A 3X14A 4O02L 1VEOA 2VL5A 3QBTB 2DM7A 4ZO6A 3QUZB 1R5WB 4G8GD 4TTGA 1ZEAH 2VKXA 1R5VA 4L8DB 3ROOB 4X6CB 5MERB 5J12B 5GJTH 4JDTH 2R4RL 1R6VA 4NKOA 3PP3H 3QFDA 3BH8A 5C07A 4AIOA 3A6CH 5J1AB 4GRWH 4Y4FA 3SOBH 3PABB 5IQ9A 4XPBH 5CUSH 4TVPL 4P3DB 1CDBA 1YEKH 32C2B 3D0VB 2VZVA 5AZEH 2DKUA 1FRGL 4RMTA 4MQXC 2PN5A 5IBTL 4ZTPH 2H8PB 5C09D 2NX5E 3QIWD 5JQHC 3VH8G 1MHHA 1CT8B 5DD3H 4L9DA 5I71B 1XGRA 4XCCH 3QHZH 4PGCB 1KJ3L 4X4XB 3V6FA 4LPCA 3BWUC 4KK6D 3D3VD 5JOFB 2OI9B 1EHNA 1QNZH 3MR9B 4MCYB 1JHTA 3O11A 4ERSH 1BZ9B 4GBXC 3QQ9D 3EAKA 1RIHH 3M8OL 2Y25A 4O02H 4Y88A 2FEEL 4NRXB 4JVPA 2HRLA 2AJYH 3TNMA 5I17B 3FMGL 3W5MA 4HCRA 3O0RL 3QSKB 5CJBA 1IQDB 4JR9H 3L3HB 1JMZA 3TPUA 1TJIH 4LHJB 4JFFB 4OGYH 2PYFA 5FO9B 4GFTB 2VR5A 3V0VA 1T83C 4TNWF 2NLJB 1JV5A 5LXGL 3BE1L 4RA0C 3ROLB 2FSEB 2W9EL 4HH9B 2NR6C 1ZANL 1ZVSA 4P5MA 3SPVA 3M1BA 2YD9A 1HHHA 3VRIB 3OKKB 5E2JA 3LEVL 1P69B 1OAYH 1J12A 3ULVC 1MFAH 1JYNA 4N8CH 2NNAB 2X09A 3ZT7A 5D7IE 1EZVY 1CIUA 3QDJA 4AEEA 5C6TL 3X3FH 1UYWH 2XZCL 1UWXH 2NY7L 1IKFH 1UH4A 2Z31D 3C60A 4G80A 4NQCD 1DQML 3TJHD 3ZDXF 3NN8A 4JO4L 5CKAA 2Y5TB 3BZ4A 1LDSA 3NMEA 3RUGB 5ACMA 1UB5B 4JFXA 5L8LB 1XGYH 3VXOA 2G75A 4FA8A 3M8OH 3MBEA 1BMGA 1BLNB 5I66B 5DJCB 3ISWA 3P4OA 1P6AB 1RZ8B 3CZFA 1MI5D 1NGPL 5IKCA 3CFKB 1YMHB 2BK8A 1KACB 1JYVA 2FECL 3F5WB 5KVMC 2YZ8A 5CZVH 5LXGH 4L8SA 5GRJH 3BE1H 5I75B 2PKDA 3WLWC 4OV5B 2W9EH 5F72S 5TE4L 1JP5A 1QTYT 1BJ8A 1ZANH 4FQLL 4AEHL 3KPQB 4Z78A 4KQ3H 1QSEA 3V8CA 5AAWA 3S35L 3V2AR 1XF1A 4JFEB 2Y06H 4KQ4H 4EUPA 4BQ8A 4L3EB 1HHKB 1UC6A 5JHLL 3L5XL 3OKOA 1B9ZA 4PUBL 3HMXA 4UIKH 5DMGD 5EA0H 2NY7H 2YA1A 3HG1D 5ISZE 1CLOL 2YA0A 1AR1D 2X2YA 1R5WA 2VAAB 5D1XD 5KSBF 4L8DA 3ROOA 2NTSP 3GSXA 1J8HA 1NL0L 5MERA 1IGCH 4H25B 3Q6GH 1LO4L 4UT6L 1U3HA 4NO3A 5HGHA 1F13A 1ULVA 2O61A 2C7UA 5I0DA 4Y5VC 3ZL4L 1KB9J 1KGCE 3TT1H 2FR4B 1FLTX 4PJ8B 3SDCD 1WGOA 3SCMC 4HLJA 3PABA 3ZE0F 2P4AB 4MSWA 2DLGA 1NFIA 1VESA 4P3DA 2ZCLH 1KC5H 5GS3A 32C2A 3V5HB 2V2XB 1X5XA 3VE0B 3RVTD 3D0VA 4XP6H 1X6LA 5BRZB 4OQTL 4LDLB 4ZFGL 3TBYA 3AVEA 2E6PA 4CDHA 4NRYB 4PGCA 1RZGB 3JV6B 4XGZB 1R24B 2PW2A 5JW5B 4WWKA 4P2RD 1YNKL 2XICA 2ATKA 1HHGB 1V5JA 1NEZG 1P4LB 3L3GB 4OZGF 4L4TE 1JPSL 5DEGA 1EHXA 1I9RL 2FX7H 4LCWE 5EBLB 3QCTL 4H20L 3OZ9H 5D1ZB 1A0QH 1XFPA 2APFA 1CLOH 3GSOB 3ARTA 1D9KA 4CDGC 5I17A 4Z7WB 2GT9A 1M7IA 3JV0A 1IQDA 4OF0A 1B0WA 3I6KA 4HKZB 2R29L 5FCUL 2VLRE 4O2FA 1AI1H 2NLJA 3ROLA 1WAAF 3NCYP 5D7LD 1LK3L 4XP9H 3I50L 4HJJL 4XCEB 3ZDZF 4GXUM 3ZE1E 5FV2A 5LCVL 2R15A 4PJ9A 4DGVL 3PV7A 4PRPE 3VRIA 3M45A 1NKRA 3T0BA 2O5ZH 3OKKA 5BOPA 5ABDE 5EBGA 1S7VB 3CK0H 2NNAA 1PZ5A 4ZFGH 1N7ML 3P9MB 4WW2B 3HB3C 1AO7E 3LKSB 4JFPA 4EOWL 3VD3A 1FVEB 3BKCL 1B6UA 2ADFL 5M95B 3BKJL 4JRYA 2VRAA 3HAEH 1BFTA 4LPVA 5E56A 4MMZC 1O7SA 3PDGA 5KSBA 3LH2L 3K74B 2Y7QB 2XZQL 5KZCD 1I3VA 1H5BC 2NY1B 1P4BL 1JPSH 4YHYB 1UB5A 1A9EB 5L2JB 2CH8A 4W4OC 1KJ2B 5I8EA 1AGBB 1H0DB 5EO0B 3G6DL 3VG9B 4PJ5E 3L3IB 4H20H 5L9DL 5DJCA 2QQQA 3SKUD 3ZE2F 1E4KC 4PY8I 1RZ8A 4KJWD 5MHSE 4BKLB 3W9EB 4ZTOH 1Y6NR 2FEEI 2ZP0T 4OI8A 4OLYH 3P77B 3RIAF 2EZ0C 2RGSA 4P3CH 4Z7WF 1G7QB 1UKQA 5FYLD 1YPZB 2P5WE 1T6VN 4OZIF 4W81A 2CRMA 1KNOB 4MS8D 4PLJD 5D6DA 1UZ6E 3I50H 1Q94B 1NGYB 5KTEL 4YHZL 1LO2L 1YMMD 4OZGA 5F6HJ 3GMRB 2GJ6A 5LCVH 2OYPA 4YHKL 4HAGA 4U1SA 4XNMB 4JFEA 1QRKA 1VFMA 1T20B 1FC2D 4JG0L 2ITDA 2ICWJ 1R3JB 4M1DH 1FZOB 3BKCH 4JVWA 1DQQB 2ADFH 4WW2F 1C16A 2PTVA 3U7YL 3WYRA 3BH9B 3KHOA 1X5HA 5IJKC 1L0XA 4LARL 4MJIA 4I4WA 4PB9L 1SY6L 3VXTA 3V7AG 3O6KL 3C2AH 4OZGE 1WAAA 1CFTB 5IT2L 3B9KA 1S7TB 1T0NB 4NO5B 2NXZD 2YPLE 3EYFB 3JTTB 4DVRH 4N90D 4XP1L 1U42A 4WFEE 4P2CG 2FR4A 4PJ8A 2BY3A 4ZD3H 5KANI 5D2LB 4ODWB 3E8UL 4HD9A 1RZJL 1ZA6B 4NQVB 1DQDH 4P59L 4U49A 3T0EC 2V2XA 1GAFL 3VE0A 1FC1A 5BRZA 4O5LH 3G08B 1A3LL 5FUZH 1U58A 2FECI 3VMNA 2VOTA 1R0AH 4NQTA 2O5XL 3RGHA 1YPZF 1LO2H 2V5SA 4OZHF 4NRYA 3WFCH 1AQKL 3JV6A 4ZS7L 4XVSH 5T1KA 2NZ9D 5GSVA 3G6JF 3L3GA 4JB9H 3LMJH 1Z3GH 2DMBA 3K4ZA 4QNPE 5TPWL 4JG0H 4AQOA 2QQKH 1RFDH 3D87B 3SBWC 4X7SH 2ZNXA 4FFVD 1DTUA 5E6IA 3KPTA 2NX5D 3EDFA 2IADA 4Z7WA 4POYA 2VDOL 1HQRB 4LARH 5C09B 5EDXA 4MCZA 4PB9H 5BO1L 2VDMH 3KPOA 4OZIA 4WHDA 3O6KH 4WI7A 3LB6D 1JHLL 4PRBB 5CSZB 3D3VB 3MLXL 1AXSA 1TZHB 4XP1H 1CN4A 5D2NE 1F4AA 4XCEA 5D7KE 1WF5A 4ENEC 4F7PB 4QTIH 4GMTL 4M8VA 1VENA 3E8UH 4MD0B 3HR6A 2NYYC 4R3SB 1VADA 1GAFH 3V0WL 1TVBA 2DIBA 4WW2A 1QBLH 3FL7A 2BERA 2BSTA 1GOFA 3LKSA 3BQUB 5GGTA 3QI9C 4LNRB 4FQJL 4YXLL 1AQKH 1JPGA 4U3CA 3V6ZB 2ZNWA 4P4KB 3GI9H 3TA3B 3VRLE 4BFGA 5JW4R 1MCWW 4YO0A 1IGFL 2CJUL 5TPWH 1RULH 3UYRL 3KJ4B 3L3DB 4OIIH 1AGBA 3MJ9L 1H0DA 5EO0A 4X99B 1WLHA 2WBJC 3L7FA 3BISA 4FXGB 1KIRA 3HZYB 3OWEA 5B8CB 4Q9QH 5F9AC 5C6WH 5GS1C 1I4FA 2R1XB 4LHQB 4OCYH 4HS8L 3W9EA 3TO4B 4XAWL 4CN1A 5BO1H 4K2UL 4PLOB 3DOSA 4DUVA 4WI4A 3NIFE 3PE9A 1OAZL 3D0LB 1G7PB 2Z31B 1G7QA 4AIXA 2XWTB 4NQCB 1JHLH 5EZJB 1LE5B 1YPZA 4BH7B 4AG4H 2CQVA 4OZHA 5F44A 3MLXH 1KNOA 1ZKAA 4MA7L 3G6JA 3VWKC 2BC4B 4RGMC 1IM9A 3GMRA 5EU6E 2ZOKB 4GMTH 2EDEA 1KULA 5FKPB 4LNVA 1SYSA 4XNMA 1KYOJ 3JWNC 4CVZB 4HIXH 3MC0A 2ZSWB 3GGWB 1F45A 4PTUB 4OSUL 1R3JA 4KROB 4FQJH 1DQQA 2ICWB 4FQ1H 3HCVA 2P44B 1BIHA 4RGOL 3L95A 1JF1A 5DHVB 5KVFL 1FV1B 5EO9A 1T3FA 3BAEL 4TSAH 3RWGA 2F5BL 2ATPB 1CFTA 4PGBA 3U1SL 1DLHB 3BZDA 3KYMA 3PHQA 5AEAA 4ZO9A 3W0WA 1E4XL 2KH2B 3HHRB 3JTTA 3UDWC 4NZJA 4KKCC 1LGVA 4XNYL 3NH7H 1BVKB 2DD8L 4HFUL 3HI5H 4PJAB 4X7CC 5ISZD 3PIQB 4HK0A 4K2UH 3NCYS 4ODWA 1G1YA 1MREL 1TQBB 1ZA6A 4UNTA 3S4SA 1I3UA 3DO7A 1OPGH 3QO0A 3IVKB 3G08A 2WAHA 1INQB 4K3JL 1HQ4A 1FH5L 2GTZB 2A6JB 5B3JE 3ILQD 1XIWB 1F00I 2HT4D 3TCLA 5FB8B 2CDEB 2FJHB 2D0HA 1KGCD 2VIRA 4NYLA 5DJ8B 4G6JH 3GJFH 4WUKH 1CWVA 4YFDB 3R4DA 3SDCB 4NQSB 1BBDH 4CVUA 4Z77B 5HYEA 2CR6A 2IAMD 2HH0L 2VR9A 4JRXE 5FA4B 1TJGL 5DMKA 1IE5A 1MJ7L 2R39A 1EDQA 1HQRA 1I85C 3PWUA 4BFBD 4M7KL 1YNTA 4QXWA 1DFBH 3WHXB 1OP5H 1RU9L 1BVLB 1N4XL 4N8VA 4LF3B 3U1SH 1Q1JH 2FX8L 3OJDA 4WTWA 3C5ZD 4L4TD 4RMRA 1NUNB 3MZGB 4P2RB 5CSZA 3VI3F 4CL7A 3S36H 4LCWD 4DEPC 3VGEA 1Y18A 4GW1B 4YX2L 5IEHB 1S78C 5IHLB 3JWDH 1UM5L 4R3SA 1NSNL 2FHBA 5JOPE 5F8RC 4PJCF 3MRPB 1C5BL 1EHAA 2E8YA 1ZE3C 3PP4H 4UIMB 4DFHA 2C26A 3MRBB 4HZAA 2VLRD 1G9EA 1KLGA 3BQUA 1MUJB 2FBOJ 4XWOC 5IMLB 4U6YB 1WFOA 1S9XA 1EEYB 3V6ZA 3RGVB 1YJDL 4P4KA 3TA3A 1V7MH 3ECBA 3UMTA 3CPLB 1QHPA 1SJVA 2GSIB 3IFOA 4UTBH 3FOLB 5D7LB 1NFDE 4J4PC 1I1YB 4MXVE 4PRPD 3MJ6A 2B5IB 5IQ7L 1JHKL 3U4AA 4K7PH 1IGYB 1NGWB 4FZEL 4KJQD 1X6NA 3ZTNL 3G9VA 2ARWA 2FJGB 1AO7D 4RWYH 2R1XA 4UBDC 4UT9L 3TIDB 3TO4A 5K9JH 3NPSC 3FQWA 4QRQA 4FTVE 5MP6L 5E8NB 1RU9H 1G7PA 2EDXA 2XWTA 1OSPH 5EZJA 1LE5A 2FX8H 4BH7A 4TUOB 5JIHA 2DQTL