1X5YA

Solution structure of the fibronectin type-iii domain of mouse myosin-binding protein c, fast-type homolog
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
111
structure length
111
Chain Sequence
b'GSSGSSGPTSAPQHLTVEDVTDTTTTLKWRPPDRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIRESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myosin binding protein C, fast-type
publication title Solution structure of the fibronectin type-III domain of mouse myosin-binding protein C, Fast-type homolog
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 8
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5yA01
4Z76A 8FABA 1EA9C 3JTTB 1XF1A 4HK3J 1NCBH 2HJFB 1CWVA 3EYUL 4P23B 4GAYA 4U4BA 1FL5A 2VH5L 1JPFA 2VITB 1WFTA 3KLAB 4UAOB 1TJIL 1ACZA 4NO2A 5D2LA 3U9UB 4GRMA 2UZIL 3OKNB 3RNQB 3NAAL 1VFMA 1UM6H 3JVGC 4K94C 5TPWH 4EZMA 5JW5B 5HYQB 5JXEC 4L8SC 1JRHH 1JGDB 3QJHB 5F3HB 3GSVB 4F80A 3D69A 3O6ML 1X5KA 3IJYB 1CFNA 5CSBA 4AT6B 1G9ML 3RWEA 4KROC 4HWEH 4ZTPH 3FT2B 4WCYL 1KTRL 4CDGC 1KELL 5A2FA 1HNFA 1LP9E 1JPSH 4J3OC 1JHTA 1A5FH 4M7KL 3C60B 4ODSL 1T83C 2FGWL 5K9KB 1U8NB 5MENB 1FE8H 1Q94A 1TETH 2E7LC 2NZ9D 1HHIA 1U8MA 4WI6A 4Q6IC 5DR5L 2NLJA 3PP3K 4NKIL 5K93A 1M05B 4WHCA 3QIUD 2Q20A 3BYYA 4I2XB 1UG9A 5FYLL 4JZOB 1TZGH 2XIDA 2XQYG 3MGOA 4TRPH 1A2YA 3I9GH 2E7HA 5ISZE 5L8LB 1KT2B 3MOAL 3UBXB 1FZKB 1TVBA 1ZHLB 5GHWH 4X6FB 1J05B 4OF0A 4Y4KC 5T5NF 5KG9A 1IBGH 1YMHA 4BQBA 3V52L 1AXTH 3DVNB 3DV4B 3EFFB 1S9KC 1JV5A 4KXZI 5JDSB 3A6CH 2BOBB 4U1KA 3RHWK 3CFDB 2AJSL 3RL1B 1P9MA 2C7UA 4FQLH 2V9TA 3VFMB 1PYWA 4XPHL 1MCHA 2RB8A 1JYWA 4IM8A 5E94B 3VI4E 4J3TA 3GBNH 3L6FB 1A0QH 1XGYL 4H88L 2EXWC 4FQCL 5F9OL 1MWAB 1RZ7H 1YMME 3V7MA 4QRSA 5FXCH 2VKWA 4I9WE 5E2WH 4YEEA 4PG9B 5JQ6H 3MRDA 2Y9RT 4Q74A 2F54A 1QFOA 3GMPB 1Q72H 1RIUH 3PHQA 2Q8BL 4F57L 4DVRL 3H7BB 2HRPH 2GJZA 3LKQA 2C4FU 2RGSA 1HYRC 4NO0B 5L7XL 4F8TA 2VLKD 1N5AB 1OTUC 1RUKH 1OARH 5CWSA 3LIZL 1EHXA 5D4QA 4ZS6D 5B3JF 5DJ2B 5H94A 2UVEA 2IANA 3R1GH 3QZWA 2Y6SD 5HHXL 4MB3A 4CVZB 3B6SB 3HE6C 4JHWL 5CINL 1FGVH 4NZJA 3BT2H 3DXAE 4KVCL 4OCXH 1CVSC 1JNLH 4LSRL 3MMEB 1BIHA 1V8HA 1KPUA 1PZ5B 2E5EA 3VFRA 3C5ZD 2V5SA 4U7SA 5GSVA 4WW2C 2FJGA 1J8KA 1G6RL 5JORB 1CG9A 2NTSP 5HGDB 3WD5H 1FNAA 2PTTA 4LVHB 4S2SB 4GKSA 5HI4C 3SDDA 5I1EL 4WO4C 1LO2L 4CL7A 1OGAD 1ZLUK 1BOYA 3MPCA 1HDMA 1NAMH 2EE2A 2VOTA 4HFWA 4P2OB 4XNUH 3H9SD 1WAAA 1WBXB 1I1CA 4HC1L 4OGZA 1S7SB 4ERSL 2NXZC 4L3EA 3A67H 1CD9B 4Y16B 2X41A 3TVMA 3L3JA 3QIWB 4NUJB 1FJ1A 1F4YH 2P43B 2PYEE 3NOIA 5C0NC 4CNIA 1E6JH 3EO9H 4G42B 3B9AA 4L8DB 3CAFA 3TO2A 1QQDA 3EOBB 4QOKE 5C3LD 3MRQB 3L5JA 3K4AA 4MCYA 4YAQA 3IU3A 3TNMB 4GMTH 3U48A 1YEHL 3KYAA 4MMXC 5GJSL 2K9UA 4JDVA 2UYLA 3UPAA 2R2EB 4CU6A 5I16A 4O02L 5AD0B 1NFIB 3RTQB 4NFBA 3QXDA 4JVUA 3OZ9L 5DHXB 1B3JA 3BE1L 4OSUH 5HD8D 3HRPA 4OUUB 3WBDA 1J0JA 4OIIL 2CH8A 2FD6L 1KBGL 5AAMA 2X4RA 5SX4I 2VDKH 3FZUC 2CGRH 3VGEA 4RMQA 2LV4A 4S1DC 5KVFL 4I48A 4BELD 4ZAKD 4RZCA 5CD3A 1LDPH 4PJ5A 2DYPB 1WBZB 2BDNH 5C0RH 5KSBA 3SDXB 3TO4A 3WNLA 4R8WH 1MHEA 1ZV5A 5CBAB 1KB5A 5D7JA 3D5OF 4PJXB 2OLDA 3GMOA 1GGCL 4QF1B 4Y1AA 3ZSSA 3FQXB 2QQLH 4DCQB 2FECI 3DHJA 4N0CD 5A2JH 3V6OA 1UJ3A 1OLZA 1X4YA 5IW1A 3E6FB 1MI5D 1PY9A 3EO0A 5C0AD 4P5TB 3D0VB 5EU5A 2ZP0T 1NDMA 1I9IL 5IEHA 1M6OB 2BCKB 3SCMA 2JIXD 3RIFK 4Z77A 1U8KB 5F1NB 1DL7H 1IEBA 4EIGB 2LTQB 3IDJB 4OV6F 5AZ2H 2EDOA 1LO3H 5HGBB 3VFNA 1RZFL 3VDAA 2X2YA 1J10A 1RZJL 3CFJB 2NW2A 4DKEH 3MLWH 4KJQC 4BSJA 1ZEAL 1TVHB 2MCG1 3O3DA 5J13C 5TE4L 3P4NB 3MLPA 5E95B 2BNQB 4F33B 5HYSG 3MRPA 3LOWA 3IDGB 3Q1SH 4QHUB 2ZCLH 5EFIB 3VFWB 3V5KA 4GG6A 3ESVF 4D2NA 3MCG1 3H8NA 3AUVA 3VRJA 1MVFA 2NTFA 3DGGB 3QIBD 4OGXL 4ZUSA 4L3CA 1T80A 2NY3D 4XPGH 1Z3GH 1ZHBB 1T5WA 3MRLA 5F9JB 5KSBF 4C56D 1P6FA 2VC2H 4N1HB 3GSNH 1KJ2B 5E6IA 4XNXH 1K5NB 1PKQA 3NFNB 2HN7B 4J8RB 2OL3B 4BH8A 3RL2B 3D3VD 1URLA 4ORZC 3UROR 1HEZA 3FO9A 4G6FD 2H32B 2VIRA 3DUSA 3MOQA 1RMFL 2AJVH 5CEZE 3OKLA 4TUKH 1ORQB 4ZD3L 3WIFA 3ZDZE 2D7TH 3FQRA 2CXKA 2KPNA 3RPIB 4NCC2 2I9LB 5B4MC 1FZOA 1KIRA 4B7LA 3DO3A 1G7HA 5SWZA 3S36X 4QHLB 3KXFE 1YNKH 2OSLA 3GK8L 2VL4A 1MJ7L 5IQ9A 1FE8L 1G7MA 4UV7L 3ULVC 4CRPA 1N5YL 5TDNA 5IR1B 1T1WA 2K3TA 2I60L 1T7XA 4LEXL 4NQVB 4J23A 4NSKB 3QA3A 5BO1H 1H0DB 1WWBX 2AK4B 5FYJH 4QTHA 3TA3B 1V5JA 4JRYA 2CUIA 2A77H 4MXVF 3PGFL 1WBYA 4LARH 3B9KC 1NBYA 4GG6F 3HC0A 3OKOB 2DLGA 3DROA 5GHWL 2EECA 4MZ3A 2X40A 2FZ3B 3PV7A 1U92B 5C9JB 5D1XB 1R3JA 5L2KE 5EC1B 2A6DB 2V9QA 3ROLA 4JFFE 5EIQA 4JQVA 4Y4FB 4HUMB 4P9MH 4P2RA 2PO6A 1DCLA 3KYOA 3FKUS 4R2GD 1DLFL 5KANG 4Y19A 5ACZA 5J6GB 1SJEB 5BVPL 4D3CL 1OAZH 1INEH 1A6AA 3L9RB 3MRGA 4E41A 1RURL 2WBJC 4DVBA 5MEPA 2Y5TA 5I1LB 1U93B 2VLRE 3TIEA 5LWYH 4WTXA 1FVEB 3V4PH 5CZXD 2DLEA 3ARQA 4XP1L 3E3QC 1I9RH 3KPPA 3VJ6B 4WWKA 1BZ7B 5ICZA 4PR5B 4L8CB 1ZS8B 3HE7C 3PP4H 3SGKC 4OKVB 1RZKL 3I2CH 1QSFD 3RNKA 5CLTA 3QBTB 1YJDC 4HT1L 3R1GL 3BRFA 2DIBA 2BSSB 4I3SH 2L4OA 3KPQA 2DQCL 3O9WC 1DUZB 3QDGE 5IBLD 4XCEB 1I8LC 2R56H 4HFUH 3ILQD 4LLMB 2RQ8A 1AGBB 3CU7A 1MCQA 4UDTB 2HVKB 4PRHD 3UPCA 1JL8A 4ORGA 5IVZA 4BZYA 2VXTH 1FYHB 4LGSB 1QR1B 2IQAA 4ODVL 1JFQL 5E5MA 3UC0H 1J8HA 2GAZA 3B2VL 2H41A 1G84A 4RFEA 1WT5C 2X4UB 3C8KA 3N85L 2GQHA 3WJJA 3LN4A 3NGBC 1RJCA 3RWCA 1K9TA 4PGCA 3NCYP 3BPLC 2DRUA 4NBXB 2ZSVA 4RQQA 2VWEE 1ZLWH 1BFTA 4QXTB 4PJCE 4PV9B 3A67L 2QL1A 4DKFL 3VXUB 1K85A 1MWAH 4QRQA 4YC2C 2AXHA 3MCKA 4B53A 3O2WH 4D8PA 3DVFA 3WIIH 4K8RC 1Z9LA 4P5TC 1JPST 1NUFA 3PQYA 4PJIB 2VLJB 5FA3B 2A74A 4Z0BH 1R3KB 5IF0A 4DTGH 5C86A 2VNCA 5C0GB 3MNWB 1FFNA 2J8UE 4KTDL 1B0GA 1H3VA 3QUXC 3ZTJH 1O7VA 4MJ6A 4K3DH 2BMKA 3UTTE 3STZA 4H25A 4YO0B 1U95A 1V3JA 4PJFB 1AXIB 4LSQH 4EN3D 4B7IA 3STLB 2EE3A 1G7IA 3BP7B 1VHPA 4HUXB 4OSUL 2BVPB 2IQ9L 1MVUB 4MD5B 1FYTB 5DEFA 4NZUH 2VL5B 1GOHA 4APQC 3I6GA 4PJ7A 4XCYA 4YDJA 4UOJA 1I3GH 2VSDA 5D2LE 2FIKA 5FM5M 4KJPD 5D7IB 4QXGL 4L9LA 3C5JB 2GJ6A 3RQ3A 1F42A 3QYCA 2EDWA 3KYMB 4N0YL 4TULL 5I8KH 3ARDD 1OSZB 2BDNL 2YXMA 4Y4HA 4JY5H 5JA9A 5J1AB 3UTOA 3OXRB 5ITBH 4OD3H 4YXHL 3NPSC 2EH7H 3LQMA 3WIHH 3SGJC 2YPLB 4G9DB 2PNDA 5E2UL 1NCWH 1CICC 1DFBH 1F8TL 4U1LA 5IMOB 1ZSDB 2BNRA 3FFCE 3D2UA 3AXLB 3CLEH 1KLUA 1LO4L 4LASH 4ONGL 1UKTA 3QUMB 3IFPA 4IBLT 4U7KA 1D6VL 3QXUA 3NN8B 1ND0A 1BFOB 5EBGA 4ZYKA 3VXOA 3CNKA 4JPIB 2E27H 1VENA 1LD9B 2JJSA 1AO7A 4ISVA 1YN6B 4J1UA 1M7DA 2Q76A 2VXUL 1XGUA 2Z93A 2IEPA 3IRPX 3OR6A 2ERJB 4JFPB 4PJ7F 5CJOL 4ZSOA 1R3IH 5SWSA 1HI6A 4FQQB 1KJMB 2NW3A 5D1XC 2P8PB 1G0DA 3RGHA 3U4EB 2V2TB 4LF3B 4XCCL 1XGPA 4JPVH 3CSGA 3MLUL 3QUYC 2QQNL 2F54E 3HC4L 3R06B 1Z3GL 4QRUB 5I1DB 1EEZA 4KDTA 3FMGL 1HHGB 4YHMH 3TNNB 3IJHA 1NGXB 2VDNH 2NPLX 5B3NA 5DJDB 4U0RC 5LG1A 2YC1A 3FN0L 3HS0B 1A7PL 1W0YT 1IGFL 3T0WA 3VH8G 1OP5K 3T4AA 5ITFA 1MRFH 1YPZA 4Z7WB 2Y5EA 2FBJL 2IANE 3ARVA 2H45A 4OT1H 1T5XA 3RVUC 5FCSH 2DQHH 4TVPE 3K7UA 4RBPK 3ESUF 3MV9E 4LHJB 1RK1A 2EKSA 2PCPB 1D9KB 1KTDA 1YY9D 4CADB 1K4CA 1YZZA 3U2SB 4WY7L 2NY4D 1KUMA 1AFVH 3DUUB 3UDWC 3HAEG 1H8NA 2A9ML 3NZHH 1WAAE 3TFKD 1NBVL 1SYVA 1EH9A 3P9LB 1CE6B 4Y2OA 1ORSB 4AENB 5HYSB 5E8NB 4HLJA 1FNFA 1YN7A 3GBLA 3HR5B 1X4ZA 1HHHA 3NFPA 4L3EE 3WFBL 1WICA 1LE5B 5CILL 1H3TA 2XN9D 3QDHA 4FG6D 5GZND 3VXMD 5GIRA 1FNGB 4MGXA 2X4OA 2CJUL 1U91B 2OI9B 1T1YA 2XZZA 4U6HA 4DGVH 2YEZA 4Z7OE 2AJYH 3DTXB 2NY5H 1UVQA 4U1GC 5I2IB 1KJ2H 4G6AD 2H6PB 2B39A 5HGHA 4MJID 1NEZA 3D39E 1I9EA 2OL3H 1BZQK 4UTAH 1YPZF 5IM7A 2BSRA 1V7ML 3JV5A 3QUZA 3RWDB 1O0VA 4L4VE 3CDGB 5DTFB 3X12A 1IGTB 1CDIA 1HSAB 1YEEH 1IAOB 1JNHB 1MAJA 5FGBA 1QFPA 2VISA 2XICA 4KRLB 4MJ5A 4X5WB 5GJTL 3X17A 5L2JB 3QCTL 1MJJA 2VDOH 4PP2B 1ZK9A 4LLQA 1GZQB 1PLGL 2P5WA 1K2DB 2ZNWA 5ADOH 4JRYD 5D8JH 3S36H 3LN5A 3UJIL 1I8MB 3WN5B 2A6IB 4PJ5E 4F3FB 3C60D 5MEND 5KSBE 4C4KO 3GKWL 1D5IH 2FSEA 3VGBA 3JWDC 5FV1L 5IW6B 3LKNB 3L5XH 2Z31A 2ORBH 4YBHA 2NX5B 4Y1AE 4U6VH 2DBJA 1UXSA 3KYKH 2HJLB 1C5DB 4M1CD 3WO3B 3V6OE 1FV1B 4P2RD 1NAKL 1QKZL 3KPOA 2VXTL 3VXQB 2PW2B 2ADJA 5L9DL 2XY2A 3REVA 4PJ9B 5IJVB 4ZPVB 3ARUA 4RMWA 3EGSB 2FCBA 4LNRA 1XR9B 3M17A 4NDMA 3V0AC 1JGEB 5CUSL 5ILTL 1QBAA 4WJ5B 4JZJA 4LRNL 1T0PB 1DLHB 1HQRB 1XIWB 3VXSA 3R0NA 2LABA 5I1HL 1A8JH 1J7VR 2JE8A 1BM3L 4LSVH 4PY8I 3QXVA 1BIIB 3H9HB 2HH0H 4MAYD 5C0DB 2BJMH 4NM4H 3WIIL 5I1IH 5IIEB 1MUJA 2W0KA 3TPUB 1I3VA 2GSGA 1AP2A 4W6XB 3DMMD 2R23B 3B3IB 3MLSH 4P46A 1A3QA 4JQIH 2KQMA 2W91A 1U8JB 2ZKHL 5CGYD 1S7WB 4P3DA 4K3HA 1KEMH 1TJHH 3T65A 2F15A 4GG6E 5IJKA 2NYYD 2O61B 1ZHNB 3FRPA 5GS2H 4S1RL 1I8IA 2NNAA 1AY1H 4NO0D 3FCTB 4RMVA 2NY1D 2X70A 4EVNB 1YECL 1HILA 3GMNA 3OWEA 4PJBE 5EOQL 3GMMB 1JGLH 4PGBB 4G6ML 5JHDB 5EIIA 4X7EC 3QNXB 4ZFZA 4NKQB 3IF1B 4F2MA 2VZUA 4OCNC 4H0GA 2BSTA 4AH2B 3S96A 4M5ZH 2FR4B 3IETA 2W9LA 4LPUA 2VDRL 5MEQA 3ARFA 1NCTA 3I75B 3L3IA 2OTUB 5EUKB 3O2VH 5I1JL 1X5LA 5HHOA 1TQCB 1QA9A 1KCLA 3V6ZB 5L0QB 1KOAA 4IMLB 2ICCA 3CVIH 4JY5L 4MSWB 3IFLL 2A73B 4MNQA 1GGIH 1EEYA 5JQHC 3WEXA 4EOWH 4G9FB 2CR3A 3SE9L 4X98B 3ULUE 2VXSL 3F7YA 2D3VA 3U7WH 1Q9KB 3VD4A 4RX4D 2OZ4A 2WINB 1BVKB 5EA0H 3JUYA 5DRZA 2C1PA 3GNMH 3NIDE 4OCWL 3HNTL 5JTWA 3QEUB 2H9GB 1UKQA 1KPRA 3MUJA 2I07A 3AS1A 5FM5O 4LSPL 4WU5A 2Z91A 4M7JL 1AR1D 3K81A 1AD9B 1D5BA 3UTQB 4NFDA 2XTLA 1DUYB 4Y19E 2ZCHH 5SX5K 5DJZB 1XF3B 32C2B 1OW0C 3UTSB 2HTKC 1FL3B 5JA8B 1KPVB 5IHZB 4ODXA 4E41E 4OF7A 5FOBB 5IT2L 3IXTB 2E9JA 4JFQA 1L7IL 1IKNC 3GIVA 3BDYH 1TFHA 3N1FC 2EXYD 4YHML 5EBWA 1SY6H 1H15B 3PJSA 1QBLH 2DQEH 1E27B 1AD0B 5DC0A 1X5HA 2DYPD 2VRAA 3W11C 3KJ6L 2DM4A 5JOPD 2FHCA 1KENL 4UINL 3OB0K 1UA6L 3BH8A 5H35B 5EU6D 5I8EA 4NBYB 1IT9H 1TLKA 2X42A 2D4DA 1GOGA 2F74B 1FCCA 4RIRA 2EYTA 1G9NC 4KKNA 3KVQA 2IBZX 1RJYA 4HIHA 2DQHL 1IGCL 4I4WA 2XNAA 1EBAA 1DQDH 1PSKL 3KPSA 5J6HB 2GT9B 4HUVA 2JELL 4JPWH 5BMFL 2IAMB 3QUMH 4KMTL 5DRWB 5GRZA 4HCRH 4LL9A 4M6OL 3KNBB 1E4KA 2SEBA 4KZDL 2DN7A 3D85A 1J8HE 1S7XA 5D7LB 3IDXH 1ZHKA 4F8QA 1OB1B 3HNVL 1YQVH 5E24E 1RVFH 2GITA 1FL6A 1FDLH 3HMXH 4K3EL 1WFOA 1PKOA 4FTVA 1X5JA 5IROA 1ONQA 5CZVH 1P53A 5ABDE 3ISWA 1I1AA 5HHVH 4NNPL 2BVOB 3QNZA 4OLVL 3G6AA 3ZTNL 1P6AB 5DVMA 4UI2A 4OZFA 2HP4A 4PJ9C 3ZKSD 4GRWH 3MJ8A 5BS0D 3GI9H 4HJGB 5BRZB 3JV6B 3PQYE 3QHZL 2FEDC 1KXVC 3O4LA 5E6YA 2X4TB 1NMBH 2GTZA 5D7KD 3VH8B 4D0CA 4G8GA 4F7TA 4K7PL 4BKLB 4QRRD 2DD8H 4PS4H 1WEJL 4Y5VA 3BH9A 1IGJA 1YEDA 4X8JA 4P2QD 4DZ8A 3L7EB 3QEQE 5KOVC 5DQDH 3DPBA 3DV6B 3JWOH 4U31A 4H8WH 1DQLH 5CKAA 1A7RH 4QTIL 5IB2A 3ORJA 4PJ7E 4ZOAA 3BPCB 4WV1C 4LKXB 3I6LE 1V7NH 2DS4A 3DX9A 1A6WL 4LCCB 5DD6A 4Q0XH 1BVZA 3O6LL 2GJ6E 3QH3A 5DHYB 1WISA 4I5BB 2PXYD 1M7IA 4HF5H 2QKIB 3MREB 5AUMB 1UB6A 1SYSA 2FECL 4JFYA 1RV6X 4HS8L 4LHUD 3KJ4C 3TBYA 1FO0B 3MNVA 4DZBA 4WUKL 4KHXL 3DVGA 3FL7A 1W72L 3EAKA 4KJYA 4ZOCA 5F7DA 4JFDD 3QZWG 2OX5A 3QDMA 1IGYB 4N8VA 3KYKL 1GIGH 2DWDA 4KK9C 5ELIA 3MBEA 1RI8A 4OIBA 2F19H 5EU4A 3RDTC 3NPZB 2B0SH 1J5OH 4WEBL 5L0QC 4YHNA 1OPGL 1I3RB 3S4SA 4AG4L 4Z7UF 1CT8A 1VADA 5GZOD 1S7RA 3RWGB 1CFBA 3C8HA 2NY7L 2BY2A 1CK0H 5EO9B 4Y4FD 2VZTA 3KHQA 3G5ZB 3WFEL 3EUUA 1XF2A 4IIQB 1TCRB 1AO7E 4KQ4H 4RMRA 5EOTB 4ZXBC 1SQ2N 3PL6A 5IFAL 4CUCA 3IDNB 4PG2A 2IFFH 1A6ZB 5FYKH 3I85A 1JI2A 4N9GA 3TN0C 4JQIL 3Q0HA 3MLTB 4KVNL 4X7FC 3BVNB 4ZSOE 2V7NB 1S7QB 2BOCA 4NQDE 4A6YB 3HC3L 1I7RB 2E3VA 4YHKH 5SWSE 3IGAB 3VMPA 4LDLB 3T0AA 2AI0L 3C6LC 2YD7A 3MOBL 4I0PC 3BX7C 1MRDL 1BLNB 4S1SL 5C0FA 2E7BA 2ATPB 2XFXA 4NZDA 1N3NB 4UV4L 3CX5J 4CJ1A 2J8OA 5JIKA 3SJVA 2YBRA 4JHAL 2YD8A 4YK4B 3EO1A 1FSKB 4J6RH 4C4KT 2HA1A 4FFZL 4HKJA 2G60H 2C3GA 4YH6A 5KS9A 4MD4B 1EHAA 1Q0XL 1DBAH 1YPZE 4POZC 2VMFA 1XZ0A 3KPNB 4Y7MA 3ILPA 2MJWA 4JJ5B 1JN6A 5D1ZA 4AEHH 3NCFB 5EZLA 3KPRA 1UM5L 2EDTA 2WBWB 3FFDB 3NFSH 1C08B 1NAMA 4RNRB 5KOMC 5CBEB 3DX8B 4GW5B 5F6IB 2QHRH 3TZVB 1QSEA 1KB9K 1NCAL 4XBEH 3O3EA 4MXQC 3VU2A 1OAYL 2ZUTA 3BSZH 5HHPA 2AJUH 3TIDB 1JTOA 4S1QL 5J9PA 3TH2T 1ZT4A 3GO1H 1CXHA 1OD7A 3K74B 4LSSH 2R0WL 3SGEH 2APBA 3VXUD 4RFNB 1MCRA 4ZUUB 1K8DA 2NY2C 3LD8C 3WL9A 5IV2B 4KQ3H 1MLCB 1SEQL 3AROA 3AS2A 4LKCA 4OFVA 1XCTB 4UDUA 1EHLH 5FUOH 4QGYA 3TC9A 4U33A 5GSRA 5JXEA 4L8SA 5E9DD 4M4PA 5FF6B 2IPUG 1Z2KA 1J1PH 3PWUB 1QLRA 1U41A 4GMSH 1EZVX 4JFOB 1YYMH 5I6XC 3I50L 5CEXA 3O8XB 1RJLA 3ARBA 1TPXC 1SBBA 2C5DC 4PRPD 5B21A 1QBML 1EO7A 4I77H 1BEYL 1CL7I 3F62A 4HUUB 2WIMA 4MNHA 1PEZA 3BP5A 5IB5B 1CIUA 1NDGB 2OJZH 1RK0B 2X4SB 1RIHL 1Z6JT 2HFFA 4HHAB 1RUPH 2W60B 5KS9F 1U3HD 4OZGB 4PB9H 4K9EL 5ESAB 2CIKA 3CU1A 1I4FA 5DD0H 2H2PC 2HG5A 3MCLL 5B38B 2C1OB 3IRZA 5T1DH 3RZCD 1FBIH 1VFBA 4HLZG 1CS6A 4MNQD 2HT3C 5BW7C 2R69H 4Y4KA 4ONFH 4KGJA 4WUUB 5FGRA 1QVOB 2DQEL 4KI5C 3GGWA 1II4E 4MS8D 1D6EB 1VPOH 2OZ4L 2P5WE 1QLFB 4GW1A 3FTGB 2GCYA 3VE0A 4QHKJ 1BJ1J 4XHJC 5I8CA 1P7KA 5A3ID 5LXGL 1IGIH 4R0LB 3RVWC 3I02A 1HXYB 1ZVYA 1WV7T 2WQ8A 1V3KA 4L8BA 3ZT7A 1KGCE 4XC1L 4F7MA 3SKNB 1RULH 2XPGB 4JN2A 5GGQH 2PETA 3LN9A 4XX1E 1S7TB 2Y07L 3KR3L 2IADB 2H8PA 3D87B 1L0YA 3QP3A 5DMIH 4PV8A 4OZIF 4HJ0C 2UV3A 2CLRA 5T1MA 1AQDA 1FNSL 5KSAD 4Z7NE 1KTLA 3T8XB 5KVGH 2HTLD 1YEIH 3UPRA 1FDLL 4E0RB 4HIJA 4PLKD 5CZVL 5E2VL 4LRIA 4OCYL 1D5ZA 1X7QA 1UZ6F 3WFHA 3QO0B 3OJVC 3QI9C 4OGAD 3T1FB 1KC5L 3HE6A 1K8IA 4FMKA 1CZ8H 3NIFF 5MP6H 4X4YA 3O45B 4ZO7A 2D9CA 1YEJH 3IKKA 4BFGA 3EKCA 4KY1L 4JZNA 1QRNA 2ITCA 5IOPA 4GBXB 3T3PE 3BN9D 5D6DA 5FB8A 4WW2A 4TUJB 5SWQA 3IS1X 2XACC 2EDQA 3ZYZA 2V5MA 4XNQA 4IIQC 4KKBD 4GOSA 1AXSB 4RAUB 5DF0A 4KK5C 3HI1A 2C4XA 4NQUA 2GY7B 5C07D 2Z8SA 3AB0B 3EJYD 4LCWA 4IS6A 4TOYH 1T0NA 1JNNL 3SE4C 1XCQB 3E8UL 4OFDA 1NL0H 2X7LB 3BO8B 1BOGB 5F7EH 5GGTA 2QSQA 3RVTC 1IC5H 3OR7B 3DJ9A 4WDIB 3EFDL 1OAUL 4TVSa 2J8HA 4OLXL 1CFSA 1HWGB 3OKKB 2V17H 4M62L 5LBSH 1RJZB 4YXKL 4CGTA 5HHOE 1OGAE 4JAMB 1NMAL 4GS7B 4K3JL 1QLEL 1ZA6B 4EI5B 4O58L 5F7KC 4CMMA 3WSQH 3OJ2C 4AZ8A 1F00I 1QFWI 5JPNA 4LLUA 2PKDA 1B90A 4PJAB 1UWEH 1S9VB 4NQSB 3CMOH 3WLBA 4HKBA 1KIPB 1FPTH 1EGJL 4WRLA 4L5FL 4BQCA 2R29H 5JO5B 1ED3B 2DLTA 4H26A 1PX4A 4GXUN 4WI5A 4WW2F 5C92A 5EOCJ 1AHWA 4PJDA 5DD5H 3TZVC 3JTTA 1JBJA 2OTPA 4OBRA 5KN5B 2FJHB 1VACB 1MIEH 1R0AH 4P23A 1KB9J 3QFJB 2QQQA 2VITA 4R3SB 5IB3A 1LK3H 1N64L 3KLAA 4FXGB 5EZJA 4UBDD 4PB0H 2YXFA 1WIUA 5C7XL 1MCFA 2EH8H 5TQ2H 3D25B 3U9UA 2XI9A 1VGEL 4OZHB 5FYKD 2RCSH 5EO1B 1CDHA 5JW5A 5HYQA 4WI8A 4MVBD 3ZKXC 5ID1B 1JGDA 3QJHA 4PFEA 4LCUB 5CJQL 3GSVA 2QADD 4F7CB 3RUGA 4AT6A 5H37G 4YDLB 3FT2A 4BQ9A 1F45A 2AK1H 3QDMD 4GRLD 5F8QC 5K9KA 1U8NA 4E42B 1I9JH 4NUGL 3WKNA 2D03H 2Y23A 4CJ0A 4ZG1A 3SO3B 1A6TB 2XZCL 2ZUWA 3FQUB 5DDHB 2ESVB 1H3WM 1FO0H 3VFUA 1VERA 5CSGA 3IT8D 3QHFL 4Y5YB 2DQIL 4KI1A 3WXWL 4KHTL 3BD4A 2V2WA 4G6JH 5EDXA 4C83B 3BIBX 1KT2A 3BQUD 5GS0H 2X1OA 1CVRA 1FZKA 4XPFL 4DN3H 4KJWD 4X6FA 1MI5E 1XAUA 4JANA 4M9OA 3DVNA 3EFFA 4PJDF 3PDGA 5JDSA 1NMCB 2BOBA 5FECA 3CFDA 1CE1H 4Y2DB 4XVUC 3VFMA 1QOKA 4MX7B 5FO9B 4GW4A 5E94A 4Z7QE 4OLEA 4DEPC 4R9HA 3CJJA 1XIWD 4R0LC 1UH4A 1MWAA 5GRUL 5DJAB 4HAGA 4R96A 3AU1A 3MYJB 3PWPA 4FTVE 4PG9A 2GYSA 2AABL 3QPXL 5T3XH 3TV3L 3N50A 4PBXA 5E8DL 4OCSL 3GMPA 4A6YH 1AGCA 3EOAB 3GSWB 4NJAL 2ZG3A 4I0CC 3RUGF 1MCEA 2VWEC 2XQBH 3OV6A 4FQHA 3CVHB 4N5UA 5LCVH 1QSVA 2WBKA 3H7BA 3HUJF 3MLRH 1IEHA 3VXNA 3TBWB 4A2LA 1MF2L 5K9OA 2WIIB 4FABL 3EJZC 3O4LE 1N5AA 2H3NB 1YDPB 2J6EA 1ULVA 5ESVA 2XTJD 5DJ2A 3S35X 4EQ2A 1BF8A 1AKJA 1IVLA 3HG1B 1D7FA 2DM7A 4NKMB 2UWEB 4G8GE 4IOIA 4CVZA 3KPRD 1T66D 1RUPL 5DJCB 5TE7L 1SBSL 4V1DD 1A7QH 5L88L 1MFEH 2ZOKA 1AJ7L 3MMEA 3O3AB 1PZ5A 4R97B 1QSED 4GXVH 5HGDA 3B9KA 5JOFB 4XP9L 2IH1B 4CMHB 3P3YA 4S2SA 2VR9A 3BAEL 3LS4L 1EAPB 1S3KL 3O3BB 1HE7A 4Y5XB 4Z95L 4IRZH 1YNTA 3QEGL 1MNUH 1FIEA 4XT1C 2H2SC 1F6AB 3OQ3B 3L3HB 4P2OA 4U1HB 4C59B 5HHMB 4V2BA 1WBXA 1WVZA 3H2WA 3QCVH 4NJ9H 2YUVA 2DDQL 5F44A 1ACYL 2D7MA 5F89B 2AEQH 4HGWB 4K94L 4XH2A 5F8RC 3VFGL 3FJTA 3WIHA 5F7HA 3FO0H 3MRBA 3PP3H 4EDXB 1NFKA 1G7QB 4JHBA 4Y16A 3CCHB 1N6QH 3QIWA 2KH2B 3B9EA 4JCMA 2C26A 4ZODA 1NLBL 2WBJA 4L29B 4G42A 5GRXG 4AIXA 1TJGL 2YK1H 2F53B 4K3GA 3UTZB 4NCC1 1F4WH 3MRQA 4M6AA 4KAQL 5DJXB 5DMIL 3TNMA 3BP6A 3NACH 1T03H 3U0WL 1FLRH 5EULV 4HQQH 4ODUB 4AL8H 4EI5C 1T1ZB 3MV8B 2R2EA 1F2XK 3I3EA 2J4WH 2G9HB 3HE7A 3MFFB 3UJJL 4LLYB 1NFIA 3RGVB 3SGKA 1EXUA 3ULVF 2VYRE 4AIZA 5C0BA 5LGHH 2HKFH 1MRCL 2DMCA 3P11L 3GHBH 5I66B 4OUUA 4L4TD 1VEOA 2X1PA 3O9WA 1N0LA 3BKML 4OGYH 5EG6C 1CZ8L 3UTSD 1I8LA 3SEPA 1H5BB 1T2JA 4FQIL 1A1MB 4HZAA 1LWRA 5EZIH 3ARGC 5FUZL 4DK3A 1DVFD 4M9PA 5IEKB 4N68A 3VW3H 4AQOA 2YN3A 3F7VA 4WHYH 4NQCA 5IFJA 4RGNB 4MB4A 1WBZA 4Z0XB 5KSVB 2YHGA 3SDXA 4HWBA 1KJ3H 3BD3A 4PJXA 3THML 2ATKB 5DQ9B 4BZ1L 1LNUB 1QSFE 4QF1A 1FHGA 3FQXA 5DI8B 3SJVE 3LQZB 4DCQA 2DTSA 5F9DC 4KZEL 1Y6MR 4AEFA 4PRIB 1J1OL 5EBMA 1QSZA 4G6KH 5F7EL 5IQ7L 1CLYH 5F1OB 4P3CL 5KS9E 1NGYA 3QWOA 4HGKC 5IFHH 4P5TA 1DN2A 3D0VA 4YDLC 2YUWA 2BCKA 1OTUD 3HZYB 3GSXA 4I3GA 5F1NA 3OPZH 3N1GC 1CLOL 4ZFGH 4JG1H 2EYSB 3CDYA 2CIIB 3IDJA 4YBLB 1ZLWK 5I1CH 2FX7H 4PLJD 5HGBA 5JR1H 4OLZL 15C8L 5FKPB 4BSVB 3RJQB 1KV3A 3O81A 5MHSD 4LCIH 1EO8H 5T3ZL 3P4NA 3MV7B 3K0WA 1P7QB 2BNQA 4WO4D 4F33A 3VFWA 3IDGA 3BPNB 5EFIA 4APQA 1NMCC 5FCUH 1A6PA 4HK0B 3S7GA 1V3MA 3LKPB 3AAZB 2AKRB 5CP3A 1A1NA 3DGGA 5D7SL 5TGBA 3K8LA 5D5MB 2NZIA 2BNUB 5GGVH 5JPMB 5F9JA 4KKAD 3TBVB 1U6AH 1IQWH 2GSIA 2EE6A 5D71H 1KJ2A 1I7UA 4JRXD 3EZ8A 4PJXF 1K5NA 2V7HB 1L9MA 4PRDB 2HN7A 4H1LA 4UB0H 1QNZL 5HYJD 2CMRH 2BY1A 3MUGB 5DMGD 4U0QB 4OJFH 2H32A 2OMBA 5DSCB 3LKRA 1WWAX 1TNNA 2F8XC 3W9EB 3HI6L 1CICA 2LFGA 4AJ0A 2R0KH 4OV5B 3IXAA 3T0ED 5KANI 4GKOA 1OCWH 4LQFL 4HV8A 1BBDL 4GAGL 5A2LH 3UYRH 5F1IB 3CH1A 4P4KB 1QUNA 1MCSA 1UB5A 3MNZB 3SOBL 1UC6A 4N0UB 5IR1A 4LSTH 2XZQH 4NQVA 5EBLB 4R4NC 4MAUL 4WFGE 2JCCB 2IH3B 4NSKA 4G5ZL 1VEMA 2AK4A 3IDMB 3TA3A 3FZUD 2VUOA 4RGMB 1MHCA 4NBZB 2UZXB 1KLGB 1JZ2A 4NZTL 1EJOH 4JDTL 4DUXA 1U58B 5D6CB 4DN3L 5GS0D 2XZAL 2WANA 4NRXB 5ETUA 5ANME 1MFCL 4XAKD 3P73B 2FZ3A 3JXAA 1U92A 3H7LA 4XCFL 5C9JA 5D1XA 3TO4C 2R0LL 1MOEA 1RU9L 1C7TA 2A6DA 5FO8B 3D1MC 5T5FH 1NC4B 4HIEB 5DZLA 2YD9A 2FIRT 2Q1EA 1T2QH 3QRGL 4LSUL 2WQRA 5EN2B 2XKNB 5J6GA 3WKMH 3QG7L 2O5ZH 1OVZA 1YEKL 1JGUL 3L9RA 5B8CB 1OT2A 1U93A 1OM3L 3TYFB 3HFMH 4LVOC 1PEWA 2VZVA 1BGXL 2MNUA 4LPYA 3DYMA 4R90H 4ODWB 5B39G 1LO5B 1QFUL 4NHCH 5T3XD 3JV0A 4LLDB 4OB5H 1RFDL 1WK0A 1YUHB 4YUEH 4XNZB 3VJ6A 1BZ7A 1QRNE 3D9AL 3T2OA 1CU4H 4PR5A 2E7CA 4L8CA 4HKZB 5CKGA 1B0RA 4LFHD 3U4AA 4OKVA 3L5IA 2XWTA 3V4VL 2E9IA 1JWMB 4CKVX 1KCVH 4S11A 1E4JA 2BSSA 3V0WH 3QULA 5F3BA 5C6TL 1GC1C 5KAQG 2BXZA 4OM1L 3GJEB 4XCEA 4NQEE 1A7QL 2Q3ZA 4MJ4A 1AGBA 4LCWE 1IM9D 2I5YL 4UOW1 4DGIL 3QWQB 2HVKA 3V5HA 4GXVL 1INDH 4F15C 5IHUL 3QAZC 1QR1A 4W81A 2FWOB 4XP6H 3VD5A 1U8OB 1BX2B 3BKJL 2N56A 5GRWA 3LZFL 4NFCA 1P4BL 1TTGA 5E1HB 2X4UA 4FQXB 3OKEB 3O6FB 2CRIA 1ZE3C 1JHKH 3BKYH 3B5TA 4QXTA 3L3OA 2DLFH 3FO0L 4YX2H 5I1GL 3PDDA 4X7TA 5DVNA 5C2BL 3HZVB 5DXWA 5E8OA 4HUWA 1BAFL 5FYJE 2J6EL 4PJIA 2VLJA 4LAJH 5FA3A 4NHUB 1NBQA 1R3KA 2B5IB 1SMAA 5C0GA 1N6UA 5HPOA 1Q1JL 1WFNA 3ULVL 1T4KB 4ZQKB 5DK0A 3ULUC 1KF9B 4PJDE 2IGFH 1S9XA 5JHLL 4YO0A 4NNYB 1BPVA 1NGQH 5C0CB 4MA3B 3GSOB 5DUBB 3EYOB 2HKFL 3UO1H 2PR4L 4POYA 4U3XA 3S35H 3BP7A 1JUFB 3T1WA 2P8LB 1TQBB 2H1PH 4HUXA 3RU8H 4MA7H 2BVPA 1FYTA 4ZUVB 3X11A 4X4MA 3TYGH 3RWIB 1JYNA 4PJ8D 2CQVA 5MI0B 3CFKA 5LQBH 3EOTL 2AXFB 4Z8FL 2F9BT 3O2DH 3C5JA 5JW4R 3BEWA 5FOJA 4G8EB 3MXVL 4FFVC 5C09B 2AQ3A 1AE6L 3X14B 1TZIA 3EZJB 2WNGA 4JFED 4W6YB 1OSZA 2RBLA 1XGQA 4WUUD 4XVTH 3OXRA 4NC1E 2WBJD 3NABL 3WO4B 1YQ2A 3GMLA 4M1GH 3N06B 3K4ZA 5AAWA 5MENE 1S9WB 2F5BL 2YPLA 4WFED 3FOMB 4G9DA 3HRZB 4XNYH 2VR4A 2WWMD 4NZRL 3T2NL 3GIZH 1WGOA 1ZSDA 4KDWA 1HH6B 4I2XE 3T3MF 3AXLA 5DUMH 4JKLA 2FX8L 2QSVA 1B4JH 4WI7A 43C9B 1CR9H 3BISA 2I9TB 1RZIB 3QUMA 2X5PA 3SDAB 2BRRH 4XBPB 4YIQA 4HCRA 3GRWH 3SDCB 2ZPKH 1WTLA 1YJDL 1P69B 3NN8A 1BFOA 5C0BD 2P45B 1MCPL 3SE8H 5HHQB 4M02A 3WUWG 4JPIA 4O00A 4NPYA 3O9WD 2ED9A 1YN6A 1CTOA 4X9GA 3VXRB 3VDBA 1JZ3A 3NCCB 1CFQA 3HMXA 4EJ1C 1RZGB 5T1KB 3MGAA 4M03A 1HZHL 1PAMA 2XWBB 4JFPA 3CXDL 2W9DH 2OXGA 1BBJB 5DQJB 4YHOL 3MZGB 4HWBL 4PJGB 2P8PA 3CLFH 5DGRA 2CKBB 3EYVB 3BZ4B 1AI1H 3U0TB 3U4EA 3TT3L 4LF3A 4Z78B 2I26N 2CUMA 3BKCL 4NN5B 3WJJC 5I1DA 4JB9L 2AJXH 3ZHKA 2VSCA 3R0MA 2PUQT 3TNNA 4XMKL 1CL7L 3NCJH 5KVDH 4H20H 1F58H 4GLRH 3KWWB 5DJDA 3BMVA 3JBG7 3HS0A 4K8RL 4QRPA 1U8LB 2DF3A 1HKLH 2BY0A 2XRAL 4K8RD 3MRJB 1MQKH 4UNTA 1CF8H 2P5EB 5GGVY 3KDMB 4Z7WA 4ZFFB 4Y8AA 2VDLL 2ARJB 4HWZB 3ULVE 2EDNA 5I75B 1EX0A 3QDJD 5DD1H 3LEYH 1QBBA 3QUXD 3HB3C 3WDIA 2ICWI 4KK6C 2NY6C 4X6DF 3C09B 1D9KA 4LCYA 4D9RE 1IZJA 1MFBL 1A6VH 5KZCB 4CADA 3U2SA 3DX7A 4HSQA 4XCNB 3DUUA 3L3GB 4X6EB 1A9BA 4HX1B 4UTBL 4OFIA 3QIUB 4JY4B 3BPOC 3P2TA 1CE6A 2ZSWB 1ORSA 4AENA 5IUSA 3EYQD 4JGJA 2Q87A 5HYSA 5E8NA 5LGKA 2N7BA 4CW1B 3HR5A 4ZO8A 1XF4B 4I0KA 4K7FB 3ZKND 1U0QA 4KUCF 3KPLB 4MA8L 1LE5A 3O0RL 1JWUB 4GXUM 3EYFB 5LAXA 1FNGA 5H2BA 3FAXA 5FHAL 3S5LG 1U91A 4ELMB 3O6FC 3DHMA 1OL0A 3DTXA 5MERB 5C6WH 5I19L 2QJDA 2MMXA 1JVKA 5I2IA 3E3QE 2X89D 4M6NL 2H6PA 4KPHH 3G04B 4YZFF 4KUZL 4FZ8L 1IL1B 4GUPA 2R9HD 4PJHB 3BIAX 5EUOB 4TNWK 4Z7WF 1YYLH 2V5YA 1MFAH 4D0BA 1HOCB 2UY7A 3VRLF 3RWDA 1EIBA 5A43C 4D0DB 1JMXA 3CDGA 5DTFA 2B5IC 3E0GA 1HYSC 3HLAB 4NHCL 5GS1B 3V4UH 1IGTA 4JPKL 1JNHA 1F13A 5HPMB 4O9HH 1RAMA 2VLKB 2YSSB 4YUEL 5DLMH 5IESL 2RIKA 3NIGE 3TJEH 1BWWA 4PP2A 1X5IA 1GZQA 3NH7H 4HIXL 1CGSH 4TSBL 5J0BA 1K2DA 4YFLI 1P1ZB 5F97E 3W2DL 2MKWA 1IKFL 2HJKA 4JM4L 4QNPF 4NQCE 5BZWB 1I8MA 2A6IA 4F3FA 5HYIA 3ZDXE 5KBNC 1KCVL 3SDXE 2C3VB 2Q7YB 3F58H 4HIIB 3UAJC 5INDB 2QEJA 5I15L 3ZYIA 2AXJA 5IW6A 5MI0C 3L1OL 3LKNA 4PJXE 1OP5H 1EFXA 4GT7A 2NX5A 1PG7X 1KJVB 3C5ZB 4DW2H 2HJLA 1DBBH 3W39B 1C5DA 3QUYD 2Z35A 3LQAH 5D72H 1CLZH 1FV1A 1G6RB 1S7VB 4M7LH 1RSFA 3L5HA 3VXQA 3LMJH 3IFOB 3RWFA 4XP6L 3BW9B 5IJVA 4PJ9A 4ZPVA 2YD4A 1BWMA 3H9SB 3EGSA 1XR9A 3U6RB 1ITBB 3D18B 4YXLL 4LU5L 2CLVA 1QFWL 1RIVL 4X83A 3DLQR 1DLHA 1HQRA 4GAFB 1MAML 3GMRB 4JM2D 5BJTA 3UJTL 1BIIA 1EERB 1AR2A 4BJLA 2IPTL 4BK4A 2MCPL 5E4EC 5B39B 1B4RA 2NY0B 3PDOB 2Q8AL 5IIEA 3TPUA 1A14H 1E4XH 2B20A 4OF8A 1A7BA 3F65A 3G6DH 2R23A 1U8JA 1HQ4B 4M93B 3SDCC 4P4RB 2BNQE 1IM3B 3OGCB 3U36B 1DQTA 4WV1A 2RAMA 2R1WB 2O61A 1ZHNA 4ODHH 2HLFD 1VGKB 4HG4K 1EFQA 4LDOB 5A2KH 3S34L 1CBVH 3K3QA 3WYRA 4EVNA 3MR9B 1JGVL 4ODTL 3GMMA 2OR9H 3MRNB 2F8OA 1FNEB 4J4PD 4JO2L 1KYOK 5JIHA 4WIQA 3IF1A 5C08D 3TYGL 5EWIH 3UMTA 1IAII 4BUHA 1F11B 2YD5A 4RGOH 3WNNA 5ACLA 2FR4A 1J12A 2AJ3A 2JB5H 2XG5A 1I7TB 3QWRD 5C3TA 4FRWA 3NBNA 4ZAKB 6CGTA 3MUY1 1OSPH 2FATL 5AYUH 1PFCA 3RA7H 3RDTA 4XPBL 3IU4H 4YHLL 3V6ZA 4IMLA 2HFEB 4H0HB 1H8SA 2JLLA 4M8QB 2DQJH 3IFNL 3LEVL 4RAVB 5C71A 4NT6B 2ZUQC 1MIMH 1TXKA 2WSKA 5BOZG 4YLQT 2AEPH 2EEDA 4G8FB 2A73A 2GI7A 2R1XB 3QUZC 4U1JA 2GW5A 4G9FA 1FVCA 4X98A 3H3PL 1R5WA 4YWGL 1FIGH 5C0AB 2AK4E 3IJSB 4JO4H 4G7YL 1R24B 2WINA 2JIXB 3OGOE 4MXWH 1T6VN 5GXBB 5JLZB 2NZ9C 2A6KA 3SO5A 3FB6A 2LQRA 3B5GA 2IG2H 3QEUA 3W5NA 3FQWB 3C6LA 3GJFH 3JWDL 5JIIA 1YMMA 4NN7C 3DSNA 5KVEL 2Z31C 3VFTA 1E4WH 3U0PB 4RISH 1DBJH 1AD9A 2Y25A 5FK9B 1DUYA 4HW6A 4HH9B 1U3ZA 5FFLA 3OAYH 32C2A 1U8PB 5F96L 1FL3A 4KTYA 3QPQD 1KPVA 5IHZA 5FOBA 3IXTA 1U3JA 2BHZA 2NY3B 2L7UA 5CZKA 4C56B 4JY6B 3BD5A 4WU7B 1INQB 2DQFB 1H15A 4L4JA 4HUNB 1E27A 4FP8H 3D3VB 4U3CA 4JKWA 4TYUA 3DXAA 3QUKB 4IRJD 4G6FB 1C5BH 1MQ8A 1KXTB 4AMKL 1A3RL 2M26A 4X7SH 2F74A 5IK3A 4J3XA 2R2CA 3PIQB 1MLBA 5ALCH 4ZPTB 1NEUA 1I85C 5J6HA 1BZ9A 3WUWB 3MJ9A 3VI4F 2IAMA 4P9HC 4ZS6C 3VWKD 2MPAH 5DRWA 3WHE0 2FX9L 4X80L 4HXAH 3KNBA 3OG4B 5GGRB 3VGHA 2Y6SC 4E9LA 4FQ2H 4W70A 1NGPL 5D7LA 4KUCD 3VGAC 1KCRL 3QQ9D 2EDKA 4NP4H 4Z76B 3ARFC 2LU7A 4S0TD 3T0VA 4XXDB 3CUPB 5HDBE 3W0WD 3SKJH 5DO2C 4D9QD 1UCBL 2FH6A 1JPFB 1LO0H 4D9LL 4M1DL 3G9VA 3C08L 2CKBH 1F2QA 4HJGA 4OQTH 3EDFA 3N9GL 3UBXG 5I17A 2X1QA 4YHZH 3GM0A 3QCUL 3JV6A 4RWHA 4PJIE 2VLJE 3T3ME 2N4IA 2WUCL 1NCUA 2YRPA 4PY7B 2X4TA 2EYRB 3ZT6A 1HHKA 3EYUH 5ENWA 1RUML 2VH5H 3VH8A 3BESR 2HKHL 5DHVA 4I18C 5K59E 5CFHA 2GHWB 2Y4SA 1BECA 3DECA 1TJIH 4PJFE 4LVNC 5AWNL 4QLRA 1MREL 3ZHDA 2APXA 1FN4B 5E8PB 3DV6A 2FYYA 3SGDI 3U46A 2E8YA 1FYTE 1Q94B 4X4ME 1U8MB 4M7ZB 5D1QC 3P4MB 3O6MH 5TQ0L 5CGTA 3KPMB 5JXAL 4O9HL 5LVEA 3CC5B 1G9MH 4LCCA 4DQOL 5JW4N 5D7IE 1A7OL 4WCYH 3HAEA 3MJ7A 1KELH 2BFVL 3MGOB 4KFZC 4HG4J 1WCBB 5DHYA 3EDDA 1NLDL 4HPOL 1M1SA 4M7KH 4ODSH 2FGWH 1TVBB 3MREA 5AUMA 3GUTA 3ROOA 5KG9B 3PXHA 3D6GA 5DR5H 4MLIA 5T1LD 2GFBB 4MA1C 5IG7B 4KWUA 2HTKD 2Z4QA 3O41A 1KYOJ 2ICEB 5FYLH 3RVXC 1IILE 4U05A 3GSUB 5E2TL 1IGYA 4PRHB 3NTCL 3E2HB 1YEFL 3MOAH 5E1AA 2YPLE 4EBQL 5D72L 3TBTA 3X3GL 3QI9A 3S5LB 3V52H 3F6IA 4NRZA 5BXFB 3DIFA 3LRGA 1I3RA 2AJSH 3W11D 4RWYL 3RWGA 3MROA 4XPHH 4UUJB 3RP1A 4KI5F 4N0CC 3G5XB 1XGYH 3ZHLA 1G9NL 5I0DA 2D2OA 3PE9A 4Z18A 4IIQA 4MDIB 4H88H 1TCRA 1TMCB 4FQCH 5F9OH 3BP4B 5EOTA 1YNLL 2GJZB 3MUZ1 4X4ZA 5K9JL 3LKQB 3IDNA 2KUTA 1A6ZA 1G1CA 2BX5A 4XWOC 2YOCA 3MLTA 1ADQH 2Z8RA 2V7NA 4FZEL 3SE4A 1S7QA 4A6YA 4JG0L 1I7RA 4GAJL 2Q8BH 4F57H 4YHPB 5EO0A 3IGAA 4DVRH 4L1DA 4ODHL 1IGML 5L7XH 1BLNA 2ATPA 1AGDB 1CBVL 4EN3B 1N3NA 3LIZH 1KPUB 5GSVB 2FJGB 1BQHG 4PGEB 3SDDB 4JKPL 5HHXH 5CINH 4JHWH 2CLZB 1HDMB 4QRPE 3PABB 4KVCH 1JE6A 4LSRH 4YZFE 5KTEL 3WFZA 3QIBC 1MEXL 3MYZA 3QEHA 4HS6B 3W82A 1DEEB 2NY3C 2FEDD 4Z7WE 3KPNA 1G6RH 3ARDB 5I1EH 4BFEA 3VRLE 5J1SC 1LO2H 3U79A 3CX2A 3IU4L 5AZEL 3TVMB 3PNWB 1SMOA 1DSFL 3L3JB 1C08A 3HNSL 5DT1L 4RNRA 4I8DA 35C8L 1FJ1B 2DQJL 5CBEA 3DX8A 4GW5A 3TZVA 4HC1H 1QQDB 2Y36L 5GRJH 4FQXD 3WS6A 1MSPA 4ERSH 2YMXL 3R4DA 1NCCL 3BN3B 4KRPC 1ZVSA 4O2EB 5FO7B 3TIDA 3RAJL 5DZOA 2OYPA 2ZUSA 4JDVB 1SJVA 2UYLB 4ZUUA 5EIVA 5IV2A 5L2KA 2WMPA 5I16B 4RFOL 5IGXL 1XCTA 1FORL 4UT9L 4LEOB 2ZUUA 2VQ1B 4JFHD 5CEZH 1YEHH 5FF6A 5GJSH 3PWUA 1CD1B 3ARED 5L8KB 3V8OA 4JFOA 2C3XA 1JNJA 3LKOB 4R4FL 3BI9X 3H3BC 3O8XA 1F90L 3QG6B 2X4RB 1E28A 5E99L 4O02H 4Z9KB 2ZUXA 3VWJC 2OMNA 4M7LT 2VLRA 4ONHA 3OZ9H 1E0OB 3QNYB 3MBEC 3BE1H 5IB5A 2X4SA 2X4NB 3ZDZF 1K4DB 3FO1B 4HHAA 2W60A 4OIIH 4OZGA 5ESAA 4P0DA 3RWJB 4PRNA 5HI5D 2FD6H 1KBGH 1UEMA 2OS7A 5D7JB 4K71B 5FYKE 2C1OA 5KVFH 1LK2A 1CGYA 3GEWB 3HZKA 1RHHB 3AMLA 4R2GC 4A2MA 5TE6L 5ISZD 4NN6B 2FL5B 5C09D 1UJ3B 4NNXB 1QVOA 4IRSD 4ZXBD 3EO0B 2AVGA 1QLFA 4PG2C 4YFLF 3FTGA 1OGTB 1NDMB 1GGCH 1CIDA 1FH5L 2A1WL 3EBAA 4FXKB 3TN0D 4N8PA 4XNMB 5CZXC 2V2XA 1T21B 2PN5A 4C55A 4R0LA 5EORL 4YBQD 2CR6A 1T04B 5DZNA 1CYGA 2IPKA 1C5CL 5GS3A 4N8CL 5EZOL 4DGYL 2NX5E 1T0MB 4WWID 4I0PD 4PD4K 4I3RL 3MA7A 1I9IH 1D5MB 1KIQB 1Z5LA 4I9WD 1S7TA 3VFVB 2NY4B 3RHWF 3MQIA 2IADA 3P0YL 3SDAD 1JPGB 1HN1A 4PJCA 5IBLC 3MRPB 2P7TB 3V5KB 1RZFH 4GG6B 1E6OL 1PG7W 1QG3A 3RVVD 1RZJH 5F1SA 3T8XA 1B0WA 1WUNT 3VRJB 2DL2A 4NP4L 5FYKU 4E0RA 1ZEAH 1IEAB 4ZUSB 4L3CB 4PUBL 4TSCL 3SKOA 3MRLB 2DJUA 4YHYB 5TE4H 1FC2D 3QO0A 4OZGF 5T1KD 5C6PB 3SKJL 5D1ZC 2XN9B 1S5IL 1GAFL 5E6IB 3H9YA 4TQEL 1KN2L 1FAIL 3VXMB 1LO0L 3WJLC 2Z92B 3O45A 3Q6GL 1PKQB 1EUTA 4PJEA 4OGXH 4GBXA 3DXAD 3UTTA 1HEZB 2IMNA 4OTXL 4TUJA 4MXQD 3B4NA 4MJIB 3OKLB 4PREB 4OI8A 3QQ4A 2QTEA 2F58L 3FT3B 4RAUA 1EVTC 5EH1A 1T7ZA 1UH3A 5TFSL 3MJ9L 1XT5A 4NKOB 3E1F1 5JHDE 1G7HB 3M1BA 5SWZB 3TP4A 3SQOL 2FDBP 1F4XL 1RMFH 2OSLB 2P5ED 3IDYB 4BSWB 5IQ9B 5TH2B 4ZD3H 1G7MB 1BOGA 4GFTB 5TDNB 1IARB 1LVEA 3OR7A 4V2CB 3IS0X 4IJ3C 3QA3B 4TNVK 4XWGL 3ARBC 2PYED 4JRYB 4PJCF 1WBYB 5KZCD 3GK8H 4JAMA 1MJ7H 2R2HB 3DROB 4QOKD 4UV7H 1N5YH 3K46A 1JPTH 2DAVA 1ZA6A 2I60H 4EI5A 3TF7C 2VZOA 2WK2A 4LEXH 3UYPA 4R26L 3FFCA 1K6QL 2PF6A 4PJAA 2NXYC 1NUDA 1S9VA 5FYLD 1NC2D 3PGFH 4NQSA 2F5AL 4P2RB 4G9FE 2PO6B 2J8UF 5F7UA 1CFVL 1KIPA 4PJEF 5JO5A 4M48L 1ED3A 5DEGB 4M3JA 1F4HA 1CDYA 1A6AB 3FT4B 1IC7L 3IAPA 5MEPB 1I1YB 3ARGA 3LKSA 5KN5A 2HFGH 2Y06L 3C5SB 4YNYB 1VACA 4XHJD 4N90E 3B8YA 2YUXA 3QFJA 4K23L 4X7CC 4EKXA 1DLFH 1NANI 3RVWD 1HSBB 3MRHB 4FXGA 4MAYB 5ERWB 5DFVD 3KPPB 4D3CH 5BVPH 2DMKA 4P49A 3ZMRA 5D2LF 3AY4A 1JTPA 3V9FA 4YDIL 1RURH 4KDVA 1XF5B 3D25A 3DMMB 4ELKA 3MA9L 4OZHA 3RBGA 1ADQL 2B1AL 4G80A 5JW3L 5EO1A 1A3LL 3UTSE 4XP1H 4N9OB 4LCUA 2OR7A 3KPQB 4HJ0D 3CXHK 5DA0B 2NY1B 3MBXL 1DBKL 3FHAA 4OLUL 4U1IA 3ZE0F 4QHMB 4NO3B 5DRNA 4AQ1B 1RZKH 1FVDB 4UNUA 4E42A 4LRIC 5IVZB 4HT1H 4ZS7L 1A6TA 5IB1B 2DQCH 1LHZA 5IHBA 1J8HB 3IAGC 5DDHA 2ESVA 2D4FA 3MV9A 3QISA 4U7MA 4TN9A 3C8KB 4Y88A 5HVHB 1PG7L 1R5VB 2IF7A 5D6DC 4PGCB 1XR8A 4ODVH 1JFQH 5TDPA 3C9NA 3B2VH 3ABZA 3RIFF 4D8PB 4WFHE 4Y2DA 1A6UL 5MEOB 3N85H 3U82B 4MX7A 5FO9A 2WLYA 5GRJL 2A74B 2FB4L 1FRGL 5IF0B 1EO5A 4BH7A 3BDBA 1GZPA 5D7LE 1B0GB 4DKFH 4KTEL 3RVTD 2QV2A 5DJAA 4UU9A 2NY0D 1UH2A 1X5FA 1YY9C 3I3DA 1JJUA 1J0KA 2H26B 4PD4J 4OIAA 2D7QA 2EDHA 3EOAA 3GSWA 5FHBH 4HWNA 4KTDH 5CEZL 3CVHA 3STBA 1U8IA 3U30C 3TBWA 3TFKC 5CEZD 1BQHB 3D39A 3MRMB 5BRZE 2WIIA 1DTUA 2H3NA 2FIKB 3GHEL 3UZQA 1YDPA 3BGFB 2VAAA 3P30L 4HKXA 3VA6A 4YHYC 4XPAL 3BJ91 3HG1A 2AW2A 4L4VA 2YRZA 2IQ9H 3KXFD 4KI5E 3F6LA 1IFHL 5JMOC 2YR3A 5DJCA 4Y4HB 3MRCB 2QBWA 2JK5B 3OXSA 1AHWC 4QXGH 3O3AA 3O2DA 3KG5A 3HI5L 4HPYL 4KKCD 5JOFA 2IH1A 1EAPA 4G6AC 4N0YH 4TULH 4P23C 3KPTA 2D9QB 3UXFA 1WAAF 2EDFA 5DUPL 3LDBB 3L3HA 4U1HA 2BNRB 4UAOC 5EU6B 5I71B 4BFIB 4DAGL 4MD0B 4YXHH 1B2WL 4WGWB 3DETC 7FABL 4HGWA 4JFFD 1UWGL 3V0VB 5E2UH 4EDXA 1G7QA 2HWZL 1F8TH 3CCHA 2MSPA 2YD1A 3S3SA 1AO7B 4AIOA 3MLXL 4Z7OF 4J1UB 2OJEA 1LO4H 2Q76B 4LBEB 2Z93B 4ONGH 2F53A 1HHJB 3UTZA 4NC1C 2MHAA 1D6VH 3C60C 5DJXA 3FN3A 4ODUA 5BZDB 1HI6B 3MV8A 1OTTD 2EDYA 3C8DA 3CK0L 1FFQA 4M43L 1WZKA 4XMLL 3MFFA 2VXUH 4LLYA 2G5RA 3RGVA 3FQNB 2FRGP 1RZ8B 5HBBA 4M1CC 2DKSA 3INUL 5CJOH 5I66A 1KEGL 5BS0B 3VFOB 2GK0A 5CP7A 2YC1B 4TPRL 3EYSL 1A1MA 3QDGD 3MFGB 4XCCH 1WZMA 4XVUD 3MLUH 1MJUL 2QQNH 4OCMC 3S98A 5ITFB 5T3XE 3HC4H 4PJBA 3BZFA 3FMGH 2JJVA 1ZWIB 2CD0A 2DQUL 4Z0XA 5KSVA 2C9AA 4K7PX 4QRRB 2W0PA 1OHQA 3FN0H 3V7AE 1A7PH 3BGAA 2WAHA 1IAIL 1WZ1L 1IGFH 4P2QB 1X6LA 3G6JB 2EKSB 5DQ9A 1T3FA 1LNUA 1KTDB 5DI8A 3LQZA 4LP5A 1LE9B 2FBJH 4PRIA 3JV4B 3QSKB 2NYYC 4URTB 2R8SL 1Y6NR 5ALBL 1H3GA 2VE6B 2YD3A 1BD2A 1SYVB 3HPLB 3EJZD 4P59L 4KGLA 3HZYA 4OBSA 5BV7H 2PXYB 1YN7B 1ETZB 4WY7H 1PVHA 3MLZL 2EYSA 3OF6D 3REWA 4LHUB 1GGBL 3ET9F 1JPTL 2A9MH 5FKPA 5DMYA 2DQTL 5GIRB 1NBVH 1ZLSH 4OZ4B 4JFDB 1W72B 4H0IA 5HVHC 3FB7A 3MODL 4DJMA 5GGRY 3WFBH 1G7JA 1ZTXH 4LVHC 1P7QA 5CILH 2XQYK 2RFXB 2Y72A 3OB8A 1CFTA 2H2SD 5C0IA 4HK0A 4P2OC 3LKPA 3AAZA 1C1EL 2AKRA 4PJBF 4TUOB 2CJUH 3I84A 4NWTL 1XFPA 3KLDA 1BHGA 3X13B 2HFGL 5DFWH 3TBVA 2A0LC 5F6HJ 3CGTA 4ETQA 1KFAL 5FDYA 1KTKE 3N1PC 2GK2A 3S88L 4Y16C 1REIA 4PRDA 2VISB 3QIWC 5JMRA 2EC9T 2BC4A 4RMUA 2X9YA 1MJJB 5KJRL 3MUGA 1MCDA 4OM0H 5AG9A 5DSCA 2OP4L 1V7MH 5A16A 1OF2B 5JZ7D 1C8PA 5LGJB 3W9EA 2J2ZA 4OZGE 2VDML 2FSEB 5GJTH 5JW4M 2AV1B 2LE9A 3QCTH 4JE4B 2HVJA 5ICXB 4M61A 1PLGH 4HS3B 3ZSTA 3BGFC 1UXSB 5F1IA 4P4KA 3RTQC 3D0LB 3UTPE 3ULUF 4NYLB 3UJIH 1H3UA 1G1YA 2R2BB 3PWJA 3GKWH 3GB7A 1GCFA 4HAFA 3S37X 2JCCA 2IH3A 4ZDHA 2YKLL 2X09A 3HKFA 3L5WB 3IDMA 3M17B 4JHZA 4XGZA 4NDMB 1MPAL 1G0YR 3NIDF 1KLGA 1MCWW 3O3UN 1U58A 4M5YL 5D6CA 3VRIB 2W07A 1NAKH 1QKZH 1J0YA 4UT6L 3VXSB 5I18H 1SM3L 3P73A 3KLSA 5L9DH 3LDBC 2DI9A 4LAQL 2GSGB 1GJIA 5CUSH 5ILTH 3DWTA 4LRNH 4P46B 2FGZA 4K2UL 2G75B 4OLYL 2B4CH 1MCIA 3ZL4L 2F54D 5I1HH 1BM3H 4ZUTB 1UJTA 3ARWA 3V6BR 3MRKB 1ZGLA 5B8CA 1JI1A 1I8IB 3WUZA 4ZO9A 2MWCA 3TYFA 1HILB 3GMNB 2Z9TA 4W68A 1AQKL 2ZKHH 1F3DJ 1IC4L 3PHOB 1LO5A 5E9DB 4WGVB 2A9NL 5GPRA 4LLDA 3OAUL 5FHBL 2LTQC 2X9WA 2IJ0C 2IAND 3LY6A 1YUHA 3NA9L 5DD3L 4F2MB 3ZE1E 1J0IA 4PJEE 4S1RH 4TVPL 4AEIL 2BSTB 2KDGA 2J88H 5HDQL 2VLLA 3PWVB 3IETB 4TVPD 4PRPB 1YECH 1MHHA 1FC1A 5EOQH 4OFYA 3QEQA 4G6MH 4WHDA 3WFCL 1HWHB 3T77B 1JWMA 3EW3B 5FA4A 4EDWL 3BEVB 5CIPB 1U3HB 3SDDD 1W0WA 5M94B 1QA9B 5D9SA 4KV5E 3GJEA 1MHPL 3X3FL 3OJMB 2VDRH 1CGVA 1S7UA 3RZCB 4EUPG 3S8WA 2KKQA 4MNQB 5I1JH 1EEYB 3WXVL 2NY5C 2R0ZL 3TJHC 1U8OA 4L3ED 4JO1L 4CBPA 3TVMD 4N5EC 3S9DB 1FFRA 2W0FB 4UQ2B 3WCYA 2XG4A 1U8QB 3OKEA 2GUOA 3O6FA 3IFLH 3MSPA 5IMLA 2EEBA 3TPKA 4PGDA 5DMKB 3FQTB 5HJ3A 3ZE0E 5DC9B 3SE9H 4OAWB 1MJ8L 1PQZA 4JGUA 1MFDL 2VXSH 4WHTA 1CDUA 4YDKL 3HZVA 4KXZH 4OD1L 3OJDA 4PJAE 2R1YA 4WU5B 4F9LC 2IALA 2VLME 5ID0B 4NHUA 1A7NL 1DQJB 1QP1A 4OCWH 4MHHI 2BVEA 3HNTH 1T4KA 4ZQKA 1Q9OA 5KSAB 4ODXB 4R4ND 4LSPH 5HVWA 2Z0BA 3J8F7 4MA3A 5C0CA 2N7AA 4OF6A 4M7JH 3TA3C 5DUBA 3EYOA 4ZMAT 3Q5OA 4XC3L 3QFJE 5JUEL 2P8LA 1JRHI 2XWJA 4ZUVA 1ZLVK 3NCMA 4NQDA 3PJSB 2HT2D 4PJ5D 4GRWB 1AGEB 3TO4D 1KB5L 4JR9L 5IT2H 2AXFA 4R7DA 5D7JD 5FEBA 4OZHE 1L7IH 4Y4FC 4XPTL 4Y1AD 3ZE2F 4Q9RL 3I3BA 4JN1H 4XP5H 2AXGA 2DBLL 3PWLA 3VFPB 2D0HA 3KJ6H 2CUHA 3F12B 5ESQA 1KENH 1VFOA 1KNOB 3C6SA 1L7TL 1UA6H 3KPSB 4UINH 5C07B 3DSFH 4G8IA 1AIFB 4LIQE 6FABL 3SCMD 2OCFD 4CVWA 3FOMA 1UM4L 2X9XA 2CDEA 2ESVE 1S7XB 4ZNEA 1IGCH 4OKDA 1HH6A 4X0KB 1G7PB 1PSKH 1F02I 4XRCB 2JELH 5BMFH 5J8OA 3U4BL 2I9TA 4KMTH 1I1RA 1ONQB 5DC4B 2Q6WA 2E6JA 5BV7L 5T33L 1YEGL 4XBPA 1I1AB 4M6OH 3G5VB 3SDCA 3QNZB 4HWUA 3MGTB 4KZDH 1GC1L 1HK6A 1A4JB 5BOPA 2VXQL 1D3CA 3MJ8B 4XZUA 1PGRB 2YS4A 1KCSL 2NCMA 3HNVH 1ZLSL 3VXRA 4LHQB 4K3EH 2KZ1B 5F9AC 1UXWB 4Z7UB 4NNPH 2XWBA 4OLVH 2GTZB 1ZTXL 3ZTNH 4MLSA 1QHOA 4XVSL 4O51A 4H5SB 2NR6C 5DQJA 3G5YB 5E6ID 2GKIA 2CKBA 3BZ4A 5HGAA 4Y5VB 3RKDD 3U0TA 2P8MB 3QHZH 4Z78A 4X8JB 2D7NA 5I8OH 3CDFA 1LEIB 4BA8A 3WFDL 3LRHA 4LK4A 2LAGB 1MCLA 3KAAA 3KWWA 4K7PH 4XAWL 4JEGB 3P77A 1I7ZA 4PBVC 1WEJH 1WTGT 1Z0NA 1U8LA 5C70A 2YPKB 4AEEA 4OM0L 3MRJA 5SX4H 1Y0LB 5DJ8B 3L3KB 4FN0A 4WI2A 4ZFFA 3HG1E 3UEZA 1M7IB 5SWZD 2ARJA 4HWZA 5HI3C 4MNGB 2VXVL 4N0FB 3LRSB 1YC7A 4O2CA 1ZANL 2QADB 2DKMA 4JFYB 2DQGL 4QTIH 3ULUL 4MZ2A 4Q9QL 3TBYB 3ULUD 2APVA 4R4BB 3MNVB 1A6WH 2EIZB 3PGCA 4DZBB 5CGMA 3QXAA 3DVGB 5F7DB 3O6LH 3QQ3B 3CFCL 5DMJB 3QDMB 4GRLB 5DVKA 5FGCB 4XCNA 3L3GA 3V7AG 1U3HC 4HX1A 4LFHG 2BVUA 4HS8H 5DK3A 3QIUA 5HHME 2J1KA 4JY4A 2CRYA 4WUKH 4KHXH 1FQ9C 2D0GA 1W72H 4HBQA 1VADB 1S5HA 1S7RB 1T20B 3BQUB 4AYFA 4BQ8A 4IHOA 4CW1A 5KVMC 5A40E 5D2NB 4K7FA 5FV2A 1KXQE 4FNLL 2PO6D 4FFVD 3NA4A 3VA2C 5I18L 5LJYH 5HHNA 1JTTA 1JWUA 4WEBH 5E6ZA 4Y19D 3FRUA 1OPGH 2O5YH 4AG4H 3GJFK 4ELMA 5DJ0B 2F53E 4E41D 1ROWA 2NY7H 3FOLB 5D93B 4N9GB 5MERA 2B4CL 3OMZA 3WFEH 3CSBA 4QHNA 3MV8E 1IL1A 4PJHA 2EZ0C 1QEWA 3OAYK 5IFAH 4F7EB 4OUOA 5EUOA 1QO3B 5C0FB 2D7OA 4WWKD 4L3AA 1HOCA 1CXFA 1DE4B 4KVNH 1VDGA 5I1KL 3HLAA 2XA3A 5GS1A 3HC3H 4POUB 3H42L 4L9DA 2AI0H 2VLKA 2YSSA 3MOBH 5KSAC 1I85A 1OLLA 1MRDH 1UT9A 4S1SH 2J88L 2HTLC 1QACA 2ADGA 1P1ZA 4PLKC 3MACL 1NSNL 2XTJB 5SV4A 4UV4H 5BZWA 4RGNE 5F72S 4G43A 1NH6A 4JHAH 1JN6B 4OGAC 7CGTA 1VESA 2ERJC 4B0MM 3KPRB 3L7FA 2LVEA 2RJMA 4IEFB 3A0OA 5INDA 4V1DB 2OK0L 4UQ3A 4WW1B 1J8HD 4J3UA 2C3HA 4FFZH 5DS8B 1VKXB 3OTTA 1ZT1A 1KJVA 3BN9C 1Q0XH 5CHNB 1QSEB 3OKDB 3PWNB 4HMEA 4X9BA 1FFOB 1GPOL 3W39A 4PRIE 1G6RA 5HHPB 1S7VA 1OGAA 2E9BA 4U1SB 4KKBC 1UM5H 1UCTA 1ZT4B 5B38G 3GFUA 3H9SA 4Z7NF 1WIOA 2WP3T 1BD2E 1JF6A 5DYOA 3UYOD 3WL9B 3U6RA 2GTWB 1FZMA 3D18A 5E8EB 3EJYC 4TSAL 4WHYG 1NCAH 1QPXA 4HC1A 1MCOL 3PQYD 1DDHA 4UDUB 4UIMA 1OAYH 4P5MB 1BQLH 3JWOC 3GMRA 5GSRB 4S1QH 4L8SB 4H8WC 5FGSA 5EUOF 4DN4H 4X6CA 3Q3GB 4I18A 1BMGA 1QLRB 2R0WH 5B39A 5IKCA 3T3PF 1A02N 3PDOA 4OZIB 4JO3L 1RUAL 4KK6D 2NY6D 5CEYB 1SEQH 5GRVL 1D9KC 1Q0YL 4D9QE 1JZ5A 5E2JA 4KH2A 3MV7E 5M7QA 1QRKA 3IDUA 4P4RA 3BP5B 5D1QA 1IM3A 3OGCA 4Q6IB 3U36A 4NWUL 5EU3A 1VGKA 3QFDB 2CIKB 1N4XH 3T4YB 3TBSA 3I50H 4YPGB 3I6LD 5D5ME 3SKMA 3SY0B 3MRNA 1QBMH 3BUYA 4MJ2A 1BEYH 4PTTA 2GJ6D 1FNEA 3DGCR 4G3YL 4L4TB 5CIPH 4Y4KB 1RIHH 4HJJL 4EUPB 2AEIT 3VCLB 2HMID 1G6VK 4HMCA 2ZG1A 4K9EH 3GZKA 2E7MA 3FB5B 4KK8C 2B1HL 4JDZB 4Y4HD 3MCLH 4ALAL 1DVFB 1I7TA 1BQSA 2OI9C 1NGZA 1P7KB 1X5ZA 1ZT7B 4BZ2L 1CDJA 3BUTA 2YWZA 1NJ9B 4JN1L 3CPLB 4XP5L 4CVXB 1UQSB 4UBDC 3RWHB 2HFEA 4M8QA 5GISL 25C8L 3CFIC 4NT6A 2BNRD 2OZ4H 4F7MB 3HA0A 1UENA 3D2UD 3DARA 2K1MA 4G8FA 3DSFL 4JN2B 3P4LA 4NGHL 2R1XA 4X6CF 4P5KA 5LXGH 1G0XA 4GKZB 4HH8A 2H8PB 1HYSD 2MTPA 4N0UE 4PV8B 3J7HA 1MI5A 2QADC 5C0AA 2JCCE 2FO4A 3WLWC 3IJSA 4XC1H 1R24A 1AO7D 1KTLB 3UPRB 2JIXA 2JJUA 3H0TB 2UY6A 2APWA 2Y07H 3KR3H 4FXLA 5EU7E 4GQ9L 1KN4L 1QZ1A 3WN5C 3PF2A 3KLHD 1GXEA 1Q9LB 5DURB 4K07A 2HLAB 4OLWL 2G5BB 4X4XA 1K8IB 3N0PB 3MLYL 2WUBL 3FQWA 3T08A 3CFBB 3UAJD 4O5LH 5SWSD 5KAQF 1FNSH 4JZNB 2CDFB 3IYLW 1FAKT 3BQUC 2A6JB 4X5LA 4JLRB 5E2VH 3FB8B 4OCYH 5D2NC 3WHXB 2QQKH 4WO4B 4HH9A 1KC5H 3C2AL 5CJ8A 1U8PA 1LGVA 4F58L 3AS0A 3QIBA 4KY1H 5M95B 1F4AA 2OXHA 5EC2B 1LMKA 2VABB 3LAFA 3WS3B 5I8OL 5I30L 3WHE1 4LCWB 4C56A 3MC0A 2NXZB 4XXCA 4LSDA 4JFZL 1INQA 1XIWC 4QT5B 2XOTA 4JRXB 3L3DB 5FM8A 3GBML 3D3VA 5HYJB 4IOSD 1XMWA 2Y7QB 3UBXI 1D5XB 3DO7A 4MQ7A 3QRFM 1JNNH 3F5WB 3E8UH 4IMKC 4XP4L 4Y8DC 4JVPA 4QWWD 4J3VA 2DKUA 3T0EB 3PIQA 4K7PY 3NCYS 1CXKA 2YN5A 3EFDH 3WUWA 1OAUH 4OLXH 5CCKL 4Z7QF 4M62H 1FG9C 2KQNA 4YXKH 5GGSB 3OKMB 1S8DB 1NMAH 3ZE2E 1T66C 4K3JH 4OZFH 1QLEH 1OAKL 5FKAB 1P84K 4O58H 2FJFB 4AM0A 5KW9L 4ZFOA 2QSCL 3VWJA 12E8L 1K3IA 1QTYT 4XXDA 3CUPA 1EGJH 1TQCC 3U9PL 4L5FH 5IB3B 4X5XB 5EZJB 2DLHA 2O5YL 2BY3A 1P4IL 2BSED 4PY7A 2LAAA 4JFHE 3W81A 2EYRA 3HPJB 3OX8B 2AJZB 3QUZD 1EPFA 3TEUA 1N64H 4DOHB 2DTML 5CS7A 1DQML 3RUGB 2DLIA 5C7XH 2CK2A 5C0CE 3HUJB 5DJYA 3SDYL 2AGJL 1FN4A 1T2XA 5E8PA 2P5WD 1VGEH 5J11B 1OAQL 3MRFA 3DI3B 4KKLD 3SKUD 3P4MA 1Z9SA 3GDBA 5CJQH 2DQDL 3RBSA 3JZ7A 3KPMA 5DJ6B 4JRWA 3VFUB 1DQQB 2W9EH 3CC5A 1GHFL 3IAQA 4WI9A 4TTDD 2V2WB 1KACB 2Z31D 1WCBA 4WFFE 1KGCD 1QSFA 1MCKA 1S78D 3LHPL 5C09E 1HIML 5J13B 4BK5A 4NUGH 1NKRA 4ODBD 5GGUB 5BVJB 4JANB 4PLOB 2GFBA 2XZCH 5IG7A 5FECB 3DOSA 3QHFH 2DQIH 2ICEA 3WXWH 4KHTH 1WCQA 3S37L 4Q2ZB 1IM9B 3ZYJA 1BQUA 4FQ1L 1ES0A 3GSUA 2M8XA 1DVFC 4PRHA 3TWCL 1GYAA 4HUKB 4XTRD 4GW4B 4XPFH 3S5LA 3BGMB 3VXSD 3U1SL 4ZNEE 5BXFA 3WJLA 4QYOA 4JFXA 5F7FA 4R96B 3AU1B 3PWPB 5IVXA 3QJFB 4UUJA 4FFWC 1OT1A 4FQJL 3C2SA 4MWFB 3G5XA 4P46D 1BQLL 3MLVL 1AGCB 3ALXA 2CPCA 4MDIA 4XVJL 4DN4L 4FQHB 4Z7VA 3BP4A 3VXNB 5C8JB 5GRUH 5K9OB 1UYWL 3VXRE 3HMWL 5IVNA 4YR6A 2I27N 4P9HL 1N6VA 1FGNL 3PG2A 2AABH 3QPXH 4HXBL 2EDJA 2IAMC 3TV3H 1EEQA 5E8DH 5ESVB 2LU4A 4HBCL 4J7RA 4OCSH 3VD3A 4U1MB 4NJAH 1AKJB 3R8QA 2O5XL 4YHPA 4PLJC 2MFNA 4IOIB 4PJGE 5CJXC 1MF2H 1Y6KR 3TGXA 1N4XL 2ZOKB 4FABH 1HKFA 1R3HB 1AGDA 2R15A 4PRAA 1W0VA 4RSVA 3M45A 4EN3A 3ARFD 2W65A 3E6HB 5CMAA 3A6OA 3B9KB 4PGEA 5TDOB 5DO2D 5HHOD 1YNTB 4PJ8B 1WLHA 1P4LB 3LS5L 2CLZA 3PABA 4HDIA 1JF1B 3O6KL 5TE7H 1S9YB 1SBSH 5L88H 5DFTA 1AJ7H 4HS6A 1QYGL 1DEEA 2P5EE 1I75A 4X9FA 1PD6A 4KKAC 4XH2B 1XGRB 1IZKA 3ARDA 4XP9H 3BAEH 3LS4H 1S3KH 2G2RB 4JFEB 4XMPL 3MRBB 4Z95H 3QEGH 1TZHA 3PNWA 2CO6B 2X4QB 5IVXF 1UACL 5DMGC 2WBJB 2DDQH 3GI8L 4PTUB 1ACYH 3HCVA 4U6XB 3VFGH 4K94H 2YPVL 4UZGA 4Z7VF 4O2EA 5FO7A 1BVLB 1TDQA 3BP6B 2ICWJ 5L6YH 3A6BL 5ANMA 5D1QD 3T0EC 5E08L 4C54A 4N0RA 2EDBA 5FYLE 1NLBH 3C87A 5TF1L 4LCCC 4BQ6A 2CDGA 2X4PB 3HE7B 1J1XL 1TJGH 3RX7A 1RHFA 1EXUB 4AIZB 5C0BB 4N1EA 1N59A 3CSYB 4KAQH 4LEOA 1NBZB 5ACMA 2B2XL 4RDQG 2VQ1A 5DWUL 5EPMB 1DBML 2GY5A 3U0WH 2EDXA 1MY5A 3BXNB 5TF0A 3WDHA 1CD1A 3O9WB 4EIZC 5I76B 1TENA 5D70L 4YGVA 2CRZA 2M1KA 3TH3T 3LKOA 4O5LL 3RY6C 4ELME 3QG6A 1U3YA 1P84J 2XA8L 3UJJH 3RVXD 4ZTOH 1Y18B 1MRCH 3QNYA 3JTSA 5GS0C 2QQKL 1UWXH 3BHBA 3F7VB 2D7PA 4NQCB 4EUPH 2X4NA 5IFJB 3P11H 1K4DA 2ADFL 3FO1A 3FAWA 4PJHE 1NGWB 3BKMH 4NKDA 1OAXH 3RWJA 5EUOE 3FO2B 4OFPA 4WVRA 2B7DT 4FQIH 1HINL 1FFPB 4M3KB 5FUZH 3NGBB 1FZJB 3B5HA 4YFEA 3BPLB 1G7LA 4NM8L 1TCMA 5HDLA 1RHHA 4YQXL 4RRPG 4F37F 3B2UD 4FMFA 2FL5A 3GSNA 1OP3K 2WW8A 4NNXA 5EBMB 4LPTA 4YC2B 2VLKE 1PJ9A 1NGYB 3QWOB 4JGMA 4NQEA 4W4OC 3THMH 4BZ1H 2BHYA 1OGTA 3KPSD 3IDIB 4HZLB 2PTVA 3MUHL 5F7WC 3LVEA 3GSXB 2AEWA 5J11C 4FXKA 4KZEH 4XNMA 4XWOD 1T21A 3QDJB 4YE4L 5EOCL 1J1OH 3I6KA 1T04A 5IQ7H 3QUXB 3D85D 3O11A 4HK3N 1A9EB 4PGJA 4P3CH 4EEEA 1T0MA 1RD6A 3VXPA 3RFZC 1NFDB 1N26A 1D5MA 1KIQA 4NQXA 3BIKA 3VFVA 1WWWX 4FTVD 2VZ1A 1I1AD 1CLOH 1JPGA 1VFAB 4YK4C 3H9SE 1JHLL 3OAZH 4OLZH 15C8H 1I1FA 2P7TA 1FSKC 4APQB 1GOFA 1C12A 1KG0B 4GG8B 1A1NB 4IDJL 5TGBB 1LEKA 5HVGB 1IEAA 4NO5B 3KYNB 3O4LD 1NCBL 5T3ZH 2J7LA 1IQDB 4IOFC 2GSIB 2XN9A 4X6CE 2BERA 1I7UB 3VXMA 2Z92A 4G8GD 4H1LB 1L4IA 3V8CA 5D7SH 1A22B 2FHFA 3GMQB 5F6IC 4XI5D 3NPSB 3LKRB 2JB6B 3WS6C 2HJFA 1UM6L 4KRPD 5TPWL 2IWGA 4MJIA 4PREA 3BWAB 5GGTH 1CICB 1JRHL 3FT3A 3VMOA 3IXAB 1NPUA 1T89A 1XEDA 1QNZH 4RFNC 5HTSA 3B9VA 4HV8B 4HWEL 4ZTPL 4NKOA 4XHQA 1VFUA 1T7YA 2YZ1A 3OKNA 3CH1B 5GRYA 3RNQA 1JPSL 1UB5B 1A5FL 3RI5F 4BSWA 5TH2A 4NQTA 1TETL 3HI6H 1BFSA 5F3HA 2EDDA 3ZDYE 3AS3A 2D31B 3IJYA 1O7SA 2W9EL 4ZFOL 4LQFH 4DUVA 3O8XC 1BBDH 1TZGL 4GAGH 4TRPL 3Q2CA 4X9IA 3I9GL 1MHCB 3F7PC 3VWJD 1EV2E 3C60A 2Y1VA 3ZO0A 5MENA 3SOBH 2R2HA 3MBED 5ETUB 1IBGL 4QY8B 3SE3A 1AXTL 4PJ8C 3A6CL 1M05A 4MAUH 4FQLL 3K2MC 2C3WA 4G5ZH 4I2XA 4JZOA 3QUYB 1YY8B 3MRIB 3UBXA 2YA2A 4NZTH 5AYQA 4JDTH 4LLWB 3F7RA 5C1MB 1ZHLA 3GBNL 1A0QL 2V6HA 1MCBA 2XZAH 1J05A 1B6UA 3LCYA 1MFCH 5C0AE 3DV4A 5DEGA 4U0RB 4XCFH 5CD5D 2R0LH 1RZ7L 1RU9H 3FT4A 4M00A 3RL1A 3PL6D 3F8UB 1JYXA 1I1YA 5E2WL 2QR0B 2PW1B 5JQ6L 4S0SD 3QO1B 3C5SA 4YNYA 1JYVA 1UZ8B 4JM2B 4RMTA 3QRGH 4XBGB 3L6FA 2WWMC 1Q72L 4LSUH 1RIUL 5E00B 1HSBA 3QG7H 3MRHA 5ERWA 1YEKH 4MAYA 2HRPL 1JGUH 2VERN 4OF5A 1XF5A 3DMMA 4LOUC 1OM3H 1B0RB 43CAB 1RUKL <