1X67A

Solution structure of the cofilin homology domain of hip-55 (drebrin-like protein)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
146
structure length
146
Chain Sequence
GSSGSSGMAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structures of actin depolymerizing factor homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Drebrin-like protein
total genus 21
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1x67A01
2XFAA 1SVYA 1SVQA 5KYNA 1M2VB 1T3XA 1Q8XA 1SVRA 4PKGG 4CBXG 2KVKA 5KYUB 1AHQA 1NLVG 1P8ZG 5HVKD 2VILA 1VKKA 1WNJA 1M2VA 1M2OA 1P8XA 2LLFA 1TMWA 2FH3A 5DD2A 1F7SA 3A5OS 5KYWA 2HD7A 3FG6A 3EH2A 1D0NA 5A1MA 1VFQA 2FF6G 1JHWA 2FH2A 2W0IA 5L6WC 3FFKA 1UDMA 4KEFA 1KCQA 1EQYS 1YVNG 2I2QA 3A5MS 4JD2H 1NMDG 4Z94G 2XF1A 3EH1A 3EGDA 5FAFA 3TU5B 1YAGG 5IVUA 5KYUA 2NUTB 2LXXA 3CI5G 1TVJA 1NM1G 1V6FA 2MV2A 2NUPB 3EG9A 2QTVA 2L72A 2FH1A 4PKHB 1WM4A 5KYYA 1Q8GA 1C0FS 4KEDA 2NUPA 1COFA 3CIPG 1T3YA 1CNUA 3A5NS 3CJCG 2LJ8A 4CBWG 1NPHA 2NUTA 3EG9B 4CBUG 4BEX1 1PD0A 2D8BA 1H1VG 5KYYB 1X67A 1HQZ1 1C0GS 1T44G 1PD1A 2FF3A 3EFOA 3Q2BA 3FG7A 2FH4A 3CJBG 2VIKA 3EGXB 3FFNA 3EGDB 1MDUA 1AK6A 2MOTA 3EGXA 5KYXB 4PKIG 1CFYA 1AK7A 3A5LS 2MP4A 3L50A 2FGHA 3DAWB 1PCXA 1T2LA 5HVKB 5FAEA 4LIZA 3EFOB 1RGIG 4S10C 5KYWB 4KEEA 2VACA 1D4XG 1ESVS 5KYXA 1J72A 1M4JA 1DEJS 1WFSA 1QPVA
chains in the Genus database with same CATH superfamily
2XFAA 1SVYA 1SVQA 5KYNA 1M2VB 1T3XA 1Q8XA 1SVRA 4PKGG 4CBXG 2KVKA 5KYUB 1AHQA 3DA7A 1NLVG 1P8ZG 5HVKD 2VILA 1VKKA 1WNJA 1M2VA 1M2OA 1P8XA 2LLFA 1TMWA 2FH3A 5DD2A 1F7SA 3A5OS 5KYWA 2HD7A 3FG6A 3EH2A 1D0NA 5A1MA 1VFQA 2FF6G 1JHWA 2FH2A 2W0IA 5L6WC 3FFKA 1UDMA 4KEFA 1KCQA 1EQYS 1YVNG 2I2QA 3A5MS 4JD2H 1NMDG 4Z94G 2XF1A 3EH1A 3EGDA 5FAFA 3TU5B 1YAGG 5IVUA 5KYUA 2NUTB 2LXXA 3CI5G 1TVJA 1NM1G 1V6FA 2MV2A 2NUPB 3EG9A 2QTVA 2L72A 2FH1A 4PKHB 1WM4A 5KYYA 1Q8GA 1C0FS 4KEDA 2NUPA 1COFA 3CIPG 1T3YA 1CNUA 3A5NS 3CJCG 2LJ8A 4CBWG 1NPHA 2NUTA 3EG9B 4CBUG 4BEX1 1PD0A 2D8BA 1H1VG 5KYYB 1X67A 1HQZ1 1C0GS 1T44G 1PD1A 2FF3A 3EFOA 3Q2BA 3FG7A 2FH4A 3CJBG 2VIKA 3EGXB 3FFNA 3EGDB 1MDUA 1AK6A 2MOTA 3EGXA 5KYXB 4PKIG 1CFYA 1AK7A 3A5LS 2MP4A 3L50A 2FGHA 3DAWB 1PCXA 1T2LA 5HVKB 5FAEA 4LIZA 3EFOB 1RGIG 4S10C 5KYWB 4KEEA 2VACA 1D4XG 1ESVS 5KYXA 1J72A 1M4JA 1DEJS 1WFSA 1QPVA
chains in the Genus database with same CATH topology
2XFAA 1SVYA 1SVQA 5KYNA 1M2VB 1T3XA 1Q8XA 1SVRA 4PKGG 4CBXG 2KVKA 5KYUB 1AHQA 3DA7A 1NLVG 1P8ZG 5HVKD 2VILA 1VKKA 1WNJA 1M2VA 1M2OA 1P8XA 2LLFA 1TMWA 2FH3A 5DD2A 1F7SA 3A5OS 5KYWA 2HD7A 3FG6A 3EH2A 1D0NA 5A1MA 1VFQA 2FF6G 1JHWA 2FH2A 2W0IA 5L6WC 3FFKA 1UDMA 4KEFA 1KCQA 1EQYS 1YVNG 2I2QA 3A5MS 4JD2H 1NMDG 4Z94G 2XF1A 3EH1A 3EGDA 5FAFA 3TU5B 1YAGG 5IVUA 5KYUA 2NUTB 2LXXA 3CI5G 1TVJA 1NM1G 1V6FA 2MV2A 2NUPB 3EG9A 2QTVA 2L72A 2FH1A 4PKHB 1WM4A 5KYYA 1Q8GA 1C0FS 4KEDA 2NUPA 1COFA 3CIPG 1T3YA 1CNUA 3A5NS 3CJCG 2LJ8A 4CBWG 1NPHA 2NUTA 3EG9B 4CBUG 4BEX1 1PD0A 2D8BA 1H1VG 5KYYB 1X67A 1HQZ1 1C0GS 1T44G 1PD1A 2FF3A 3EFOA 3Q2BA 3FG7A 2FH4A 3CJBG 2VIKA 3EGXB 3FFNA 3EGDB 1MDUA 1AK6A 2MOTA 3EGXA 5KYXB 4PKIG 1CFYA 1AK7A 3A5LS 2MP4A 3L50A 2FGHA 3DAWB 1PCXA 1T2LA 5HVKB 5FAEA 4LIZA 3EFOB 1RGIG 4S10C 5KYWB 4KEEA 2VACA 1D4XG 1ESVS 5KYXA 1J72A 1M4JA 1DEJS 1WFSA 1QPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XFA A;  1SVY A;  1SVQ A;  5KYN A;  1M2V B;  1T3X A;  1Q8X A;  1SVR A;  4PKG G;  4CBX G;  2KVK A;  5KYU B;  1AHQ A;  1NLV G;  1P8Z G;  5HVK D;  2VIL A;  1VKK A;  1WNJ A;  1M2V A;  1M2O A;  1P8X A;  2LLF A;  1TMW A;  2FH3 A;  5DD2 A;  1F7S A;  3A5O S;  5KYW A;  2HD7 A;  3FG6 A;  3EH2 A;  1D0N A;  5A1M A;  1VFQ A;  2FF6 G;  1JHW A;  2FH2 A;  2W0I A;  5L6W C;  3FFK A;  1UDM A;  4KEF A;  1KCQ A;  1EQY S;  1YVN G;  2I2Q A;  3A5M S;  4JD2 H;  1NMD G;  4Z94 G;  2XF1 A;  3EH1 A;  3EGD A;  5FAF A;  3TU5 B;  1YAG G;  5IVU A;  5KYU A;  2NUT B;  2LXX A;  3CI5 G;  1TVJ A;  1NM1 G;  1V6F A;  2MV2 A;  2NUP B;  3EG9 A;  2QTV A;  2L72 A;  2FH1 A;  4PKH B;  1WM4 A;  5KYY A;  1Q8G A;  1C0F S;  4KED A;  2NUP A;  1COF A;  3CIP G;  1T3Y A;  1CNU A;  3A5N S;  3CJC G;  2LJ8 A;  4CBW G;  1NPH A;  2NUT A;  3EG9 B;  4CBU G;  4BEX 1;  1PD0 A;  2D8B A;  1H1V G;  5KYY B;  1X67 A;  1HQZ 1;  1C0G S;  1T44 G;  1PD1 A;  2FF3 A;  3EFO A;  3Q2B A;  3FG7 A;  2FH4 A;  3CJB G;  2VIK A;  3EGX B;  3FFN A;  3EGD B;  1MDU A;  1AK6 A;  2MOT A;  3EGX A;  5KYX B;  4PKI G;  1CFY A;  1AK7 A;  3A5L S;  2MP4 A;  3L50 A;  2FGH A;  3DAW B;  1PCX A;  1T2L A;  5HVK B;  5FAE A;  4LIZ A;  3EFO B;  1RGI G;  4S10 C;  5KYW B;  4KEE A;  2VAC A;  1D4X G;  1ESV S;  5KYX A;  1J72 A;  1M4J A;  1DEJ S;  1WFS A;  1QPV A; 
#chains in the Genus database with same CATH topology
 2XFA A;  1SVY A;  1SVQ A;  5KYN A;  1M2V B;  1T3X A;  1Q8X A;  1SVR A;  4PKG G;  4CBX G;  2KVK A;  5KYU B;  1AHQ A;  3DA7 A;  1NLV G;  1P8Z G;  5HVK D;  2VIL A;  1VKK A;  1WNJ A;  1M2V A;  1M2O A;  1P8X A;  2LLF A;  1TMW A;  2FH3 A;  5DD2 A;  1F7S A;  3A5O S;  5KYW A;  2HD7 A;  3FG6 A;  3EH2 A;  1D0N A;  5A1M A;  1VFQ A;  2FF6 G;  1JHW A;  2FH2 A;  2W0I A;  5L6W C;  3FFK A;  1UDM A;  4KEF A;  1KCQ A;  1EQY S;  1YVN G;  2I2Q A;  3A5M S;  4JD2 H;  1NMD G;  4Z94 G;  2XF1 A;  3EH1 A;  3EGD A;  5FAF A;  3TU5 B;  1YAG G;  5IVU A;  5KYU A;  2NUT B;  2LXX A;  3CI5 G;  1TVJ A;  1NM1 G;  1V6F A;  2MV2 A;  2NUP B;  3EG9 A;  2QTV A;  2L72 A;  2FH1 A;  4PKH B;  1WM4 A;  5KYY A;  1Q8G A;  1C0F S;  4KED A;  2NUP A;  1COF A;  3CIP G;  1T3Y A;  1CNU A;  3A5N S;  3CJC G;  2LJ8 A;  4CBW G;  1NPH A;  2NUT A;  3EG9 B;  4CBU G;  4BEX 1;  1PD0 A;  2D8B A;  1H1V G;  5KYY B;  1X67 A;  1HQZ 1;  1C0G S;  1T44 G;  1PD1 A;  2FF3 A;  3EFO A;  3Q2B A;  3FG7 A;  2FH4 A;  3CJB G;  2VIK A;  3EGX B;  3FFN A;  3EGD B;  1MDU A;  1AK6 A;  2MOT A;  3EGX A;  5KYX B;  4PKI G;  1CFY A;  1AK7 A;  3A5L S;  2MP4 A;  3L50 A;  2FGH A;  3DAW B;  1PCX A;  1T2L A;  5HVK B;  5FAE A;  4LIZ A;  3EFO B;  1RGI G;  4S10 C;  5KYW B;  4KEE A;  2VAC A;  1D4X G;  1ESV S;  5KYX A;  1J72 A;  1M4J A;  1DEJ S;  1WFS A;  1QPV A; 
#chains in the Genus database with same CATH homology
 2XFA A;  1SVY A;  1SVQ A;  5KYN A;  1M2V B;  1T3X A;  1Q8X A;  1SVR A;  4PKG G;  4CBX G;  2KVK A;  5KYU B;  1AHQ A;  3DA7 A;  1NLV G;  1P8Z G;  5HVK D;  2VIL A;  1VKK A;  1WNJ A;  1M2V A;  1M2O A;  1P8X A;  2LLF A;  1TMW A;  2FH3 A;  5DD2 A;  1F7S A;  3A5O S;  5KYW A;  2HD7 A;  3FG6 A;  3EH2 A;  1D0N A;  5A1M A;  1VFQ A;  2FF6 G;  1JHW A;  2FH2 A;  2W0I A;  5L6W C;  3FFK A;  1UDM A;  4KEF A;  1KCQ A;  1EQY S;  1YVN G;  2I2Q A;  3A5M S;  4JD2 H;  1NMD G;  4Z94 G;  2XF1 A;  3EH1 A;  3EGD A;  5FAF A;  3TU5 B;  1YAG G;  5IVU A;  5KYU A;  2NUT B;  2LXX A;  3CI5 G;  1TVJ A;  1NM1 G;  1V6F A;  2MV2 A;  2NUP B;  3EG9 A;  2QTV A;  2L72 A;  2FH1 A;  4PKH B;  1WM4 A;  5KYY A;  1Q8G A;  1C0F S;  4KED A;  2NUP A;  1COF A;  3CIP G;  1T3Y A;  1CNU A;  3A5N S;  3CJC G;  2LJ8 A;  4CBW G;  1NPH A;  2NUT A;  3EG9 B;  4CBU G;  4BEX 1;  1PD0 A;  2D8B A;  1H1V G;  5KYY B;  1X67 A;  1HQZ 1;  1C0G S;  1T44 G;  1PD1 A;  2FF3 A;  3EFO A;  3Q2B A;  3FG7 A;  2FH4 A;  3CJB G;  2VIK A;  3EGX B;  3FFN A;  3EGD B;  1MDU A;  1AK6 A;  2MOT A;  3EGX A;  5KYX B;  4PKI G;  1CFY A;  1AK7 A;  3A5L S;  2MP4 A;  3L50 A;  2FGH A;  3DAW B;  1PCX A;  1T2L A;  5HVK B;  5FAE A;  4LIZ A;  3EFO B;  1RGI G;  4S10 C;  5KYW B;  4KEE A;  2VAC A;  1D4X G;  1ESV S;  5KYX A;  1J72 A;  1M4J A;  1DEJ S;  1WFS A;  1QPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...