1X69A

Solution structures of the sh3 domain of human src substrate cortactin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
GSSGSSGTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the SH3 domain of human Src substrate cortactin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords cortactin isoform a
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x69A00
2A28A 1UJYA 4RTWA 3NMZC 2HSPA 1JO8A 1WIEA 2DRMA 3I35A 1TUDA 2G6FX 1SHGA 2KBTA 1AVZC 3H0FA 2OJ2A 1LCKA 3A98A 5GJWB 1K0SA 1K4US 2AZSA 1YWOA 1X27A 2KRNA 4OMLA 3M0SA 1QKWA 1QLYA 3VS3A 4JJBA 4HCKA 1ABOA 2RMOA 1U5SA 1X6BA 3VS1A 1M27C 2FO0A 2J7IA 2K79A 4RTXA 1VYVA 2KEAA 2LZ6B 4D8KA 1H92A 1PKSA 1AWJA 2FRWA 1GCQA 4CC4B 3C0CA 3H0HA 1OPKA 5L23A 2D8HA 3EG3A 2EGAA 2EGCA 2HEQA 3H0IA 3PVQA 3I9QA 4IIMA 3VS6A 1AZEA 2J06A 4IIOA 2FPDA 1T0HA 1SRMA 1M3CA 1Z9QA 1YN8A 3EGUA 1ZX6A 1JEGA 1W1FA 3TSWA 2KNBB 5IHIA 3EG1A 1E6HA 1UGVA 1YP5A 2ENMA 4Y92A 1WDXA 2L0AA 1H3HA 2A37A 1K0XA 1UECA 2BZXA 1BK2A 2HDAA 2J6FA 3VS0A 4E6RA 1U06A 1RUWA 2EQIA 2A08A 4OMNA 4ORZA 2RN8A 3NGPA 2DL5A 4CC3A 1RLQC 4RTYA 2DF6A 1PHTA 1UHCA 1ZLMA 4J9HA 1WXTA 3M0PA 3EHQA 2RQTA 4J9DA 2FPEA 2ED1A 4LUDA 2K3BA 1UG1A 1SRLA 2KXDA 2V1QA 4J9IA 1AZGB 3I5RA 2PZ1A 2JW4A 2F2XA 4LNPA 2LX7A 2LJ1A 4JZ3A 2VVKA 2JMAA 2DVJA 5IXBA 2ECZA 2J6OA 1WFWA 1U3OA 3EG2A 5HCKA 2DNUA 4F16A 2LP5A 2M0YA 1SHFA 3M0RA 4A63B 4ESRA 1N5ZA 2GBQA 2JS2A 2KYMA 4RTTA 1OPLA 1X6GA 1AWWA 4R0KA 2YUPA 4GBQA 3GBQA 2L3PA 2PNIA 1NEGA 3QWXX 1GL5A 2IIMA 1GBRA 1JXOA 3SEMA 2D0NA 2NWMA 2FG0A 2CREA 2K9GA 4FSSA 4JJDA 2CUDA 1KSWA 2KXCA 1VA7A 4JJCA 4J9CA 2MIOA 2L3QA 3TVTA 2ROTA 2JT4A 2AK5A 1X43A 2ABLA 2KT1A 1B3QA 1K9AA 1YNZA 3ZL7C 1HD3A 2YUOA 2DMOA 1GCQC 1NYGA 2YUQA 2XMFA 3ULRB 4HVUA 1VYUA 1WXUA 2RPNA 1NLOC 4D8DA 3M0TA 4ZNXA 1SPKA 4F14A 4Z88A 3NPFA 3KFVA 1ABQA 1GBQA 2JXBA 1E6GA 2H8HA 3IQLA 2DYBA 1W6XA 1OEBA 4KRTA 1GRIA 5FWCA 1WA7A 2AZVA 2MOXA 1M3BA 2L2PA 5I11A 1BU1A 1UHFA 2X3WD 1B07A 1OV3A 2K7AA 4LE9A 2A36A 2W0ZA 2DBKA 1TG0A 2DLPA 2EW3A 1WXBA 1T0JA 2RQRA 2D1XA 1ZBJA 1JQQA 4QT7A 1K76A 3EG0A 2O88A 1QWFA 1HSQA 1FYNA 3LH5A 4OMOA 4M4ZA 2O9SA 1G83A 4WCIA 1RI9A 1GFCA 2CT4A 1SEMA 1KFZA 1NM7A 1AEYA 2LCSA 2RQUA 2RQWA 2E5KA 3M0QA 2EGEA 2KT8A 1CKAA 2EBPA 1TUCA 1UUEA 4LN2A 2GTJA 1UDLA 3O5ZA 1T3SA 2K2MA 5ECAA 2YUNA 1UFFA 4Z89A 1QKXA 3M0UA 2FPFA 2DX1A 1ZSGA 1NG2A 2EKHA 2KYBA 1A0NB 1WYXA 5FW9A 2P4RA 1WX6A 2JTEA 3QWYA 2CSIA 2V1RA 4F17A 4LUEA 2HBWA 1AWOA 1GFDA 2K6DA 4OMPA 2B86A 1BB9A 4DEXA 3FJ5A 1AWXA 2EYYA 3EHRA 3VRYA 1ZUYA 1T3LA 3REBB 4GLMA 1PRLC 1E7OA 2BZYA 2AKKA 4RTUA 4RTVA 2RQVA 2CDTA 2ESWA 4AG1C 2NUZA 1EFNA 2MCNA 4CC7A 2JM9A 1SSHA 2JMCA 1NLPC 2O9VA 2YT6A 2GTOA 2GNCA 2DA9A 1NEBA 4AFSC 1IO6A 4AFQC 1MV3A 4J9GA 4AG2C 2KROA 3I5SA 2VKNA 1ZUUA 2YSQA 2EYWA 1KJWA 3NHNA 4OMMA 2LQNA 4X1VA 1GCPA 2DL4A 4HVVA 1BBZA 1X2QA 3VS4A 3REAB 2GGRA 3RBBB 2KGTA 2BZ8A 1X2KA 2LNHB 1I1JA 2C0IA 1NYFA 1JXMA 2CSQA 2W10A 5IHKA 2CH4A 2C0TA 5FWBA 2LMJA 1G2BA 3R6NA 1AD5A 2O2OA 4J9EA 2DBMA 2VWFA 2KRSA 2AKLA 2OAWA 1J3TA 5GJVB 1Z9ZA 3UF4A 3VRZA 2YDLA 2JS0A 2CT3A 2EPDA 2J6KA 4OMQA 2LJ3A 4AFZC 2F2WA 1M3AA 2DJQA 3RNJA 2RNAA 1PKTA 3UA7A 2L3SA 2DILA 3VS2A 1XOVA 1YWPA 3H41A 1HJDA 1FMKA 2DRKA 2SRCA 1M8MA 4HVWA 2KRMA 4CC2A 3CQTA 1Y57A 4EIKA 5IH2A 3PVLA 2RF0A 3TSZA 4JZ4A 1V1CA 2FRYA 4DEYA 2KE9A 1UE9A 3JV3A 2PTKA 1WI7A 4RUGA 5IHNA 1UJ0A 1MV0B 5IXFA 3PE0A 1PNJA 1X69A 2ROLA 2CH4W 5I22A 2J05A 1WLPB 4AFUC 2DL8A 1OOTA 3VS7A 1M30A 3SHWA 1YCSB 2DM1A 1PRMC 2DE0X 1MUZA 1JU5C 2FEIA 2HCKA 4HXJA 1CKBA 2DL3A 2SEMA 1S1NA 2EVRA 3U23A 2F2VA 1Y0MA 3THKA 2I0NA 4K11A 2M51A 2BTTA 2D8JA 3UA6A 1AOJA 2C0OA 1I07A 2EYXA 1VYTA 2LJ0A 2DL7A 1I0CA 1K1ZA 2OI3A 1KIKA 2O31A 1RLPC 3UATA 1CSKA 1H8KA 1UTIA 2GQIA 2X3XD 2CUBA 1W70A 4RTZA 1ARKA 1ZUKA 2LQWA 1QCFA 1PWTA 5EC7A 1QWEA 3VS5A 2QDLA 2KR3A 4J9BA 2EYZA 4J9FA 2JM8A 2ED0A 4Z8AA 4JPBW
chains in the Genus database with same CATH superfamily
1N8RR 3EG9A 2A28A 2BE7D 3A8HB 3CBPA 2FVUA 3EH2A 1DJ7B 1WIEA 3RIRA 3I35A 1SHGA 2E10A 1K73C 3CMAA 2E70A 5FU6B 4NOYA 1BI3A 1AVZC 3LWHA 2MWPA 1LCKA 4PJOD 1Q7YU 2CZ0B 1K4US 2AZSA 3M0SA 4BI8B 3VS3A 1YCYA 2PVDB 4HCKA 5LJ5f 1U5SA 1M27C 2FO0A 2JVVA 3GOXA 1QMCA 4DOWA 1M90U 3JCMf 2KEAA 4D8KA 4GY5A 1PKSA 4CC4B 2JTMA 3CPWA 5LJ3f 5L23A 3EG3A 2HQEA 5GANd 1ZQ1A 1S72Q 5KE3A 1VQ5Q 2HL5C 4FL6A 1VQNQ 2FPDA 1YITT 4FYXB 3QXEB 2EJFA 5CIUA 4PJOA 3EGUA 1ZX6A 1JEGA 4FYVB 3WXMB 1JBMA 1QVPA 3QZ5B 5IHIA 1O75A 5GAOr 1UGVA 1VQOT 3V7CA 3JB9D 2A37A 2E12A 2LRQA 2J6FA 4E6RA 1OYXA 2EQIA 1KC8C 2ZPHB 2A08A 1RLQC 3G4ST 2A0FB 1TS9A 2FYKA 2LX9A 1PHTA 1UHCA 1ZLMA 2EJ9A 3M0PA 4J9DA 5LL6S 1OU9A 4WF2A 3QSUA 2ED1A 1VQOQ 3M5AA 4C5HA 3EFOA 1TH7A 2RI3A 2JW4A 4LNPA 2LX7A 5LJ3h 2DAQA 1D1CA 5IXBA 3OYEA 4MDWA 3V8LA 2ECZA 2QTXA 4MMKA 2D6FA 2CP2A 2CP0A 4KGZB 3A1PA 2DNUA 3D7SB 4C5GA 2M0YA 3M0RA 2KSSA 3JCMP 4JUVA 1YJNQ 4Y28E 2VGMA 3MKDA 1U1TA 4FM4B 1VQ4A 1EIFA 3RERA 1AWWA 5GAOn 3ZEHA 1YI2A 1VQPQ 3J80E 2QEXQ 1NEGA 3BY7A 1JXOA 3SEMA 3V8KA 2NWMA 3QZ9B 3QO3A 2CUDA 5KYWA 1KSWA 2YRVA 4M7DF 4C92A 3L2ZA 2C06A 2MIOA 2VXFA 2AK5A 2ABLA 1I5OB 3PMIA 1QQJA 2KT1A 3L2VA 5KYXB 2BKDN 2YUOA 4LDWA 2EQMA 1GCQC 4N0AA 3CBMA 4BE2A 4D8DA 4II1A 1KHIA 4Z88A 1UB4A 2JXBA 1S72A 4A4KA 2DIQA 1YJ9A 4J7IA 1PM3A 2FHDA 5LJ5d 2XIDA 4C92D 1WQ7A 1IB8A 1M3BA 1YFNA 2HD0A 3VUZA 3EAEA 4JJNK 4F04B 3CBOA 2RQRA 2D1XA 1ZBJA 3WVDB 4QT7A 3OYIA 3CEYA 1RAGB 2QQSA 1QWFA 1M1KC 2QA4Q 4B9XA 3OYMA 3QJ6A 4OMOA 5HKCA 4Q5WA 4C5IA 7AT1B 3A8GB 5CKFA 1AEYA 2DTIA 5GAN8 2E5KA 1PG5B 1MMNA 5GANh 1RAFB 3HKSA 3OS0A 1TUCA 2P0KA 2YLCA 5CVIA 1K73R 4M78F 1IGUA 2DO3A 3O5ZA 4M7AE 1YBYA 4C92G 1JB0E 3GF5A 2QI2A 5D6WA 2DX1A 3LW5E 2QA4T 4RG2A 2QQBA 4WTOB 3OYGA 3FC3A 1WX6A 4JRIA 1IRXA 1ACMB 4F7UG 4A54A 1RL2A 2ZZDA 3HTRA 4QW2A 3C95A 3OS2A 1I5LA 3CCQQ 1GFDA 2K6DA 4PJNA 1EZZB 1IHVA 2B86A 1RABB 1NPPA 2RB6A 1M1KR 2OTJT 1K8AC 2RJFA 2MMPA 1VQMQ 1YIJA 1YJWQ 3Q1JA 2XDPA 2NUPB 1LVKA 1Q7YR 2ESWA 2MCNA 3JCMe 1YJ9T 1SSHA 1G5VA 2KQWA 4QVCA 3LGFA 4XQ3A 1KQSP 2GNCA 3A5ZB 3CCSA 2MAMA 1NEBA 3S6WA 3NTIA 2EYWA 1KJWA 4OMMA 2GCXA 2RJEA 1SF9A 4X1VA 5CO7A 5GANf 1EX4A 3EGXA 3LH0A 4NS5A 1NPRA 3CCUA 3FDRA 2LVMA 4DBQA 4J8OA 1I1JA 2C0IA 1NYFA 3EFOB 5AT1B 1V29B 2CSQA 2W10A 5IHKA 2K57A 3HL8A 1G3TA 1MMGA 4XU1A 3NFCA 4M75D 2AKLA 2DTHA 1M90R 4C8QF 2KI7A 5GJVB 3P8HA 3TCJA 2KY9A 1YI2T 1IHWA 4EMKA 2LCCA 1D3BB 4M7DE 2XICA 4OMQA 1FXXA 3QIIA 5CQYA 2FZGB 3PGGA 4LDUA 1N6AA 2BUDA 2RNAA 4FW2A 2XU8A 2CZ6B 3H41A 1HJDA 2P0QA 1FMKA 2SRCA 4DBHA 2OTJQ 4X34A 1TTHB 2P84A 4IUUA 5LJ5j 1M8VA 1PD1A 3CQTA 4FT4A 3CCQA 2MWOA 1V1CA 2KVQG 2LC4A 2CKKA 2R5AA 1GXIE 3M54A 1VQPA 1YI2Q 2LQKA 5CQXA 2A3LA 3VJPA 1QVFA 1QCOA 1MV0B 2QG9B 3EGDB 1G3YA 3JCMc 3ME9A 1FMWA 2K2VA 3L2RA 4AFUC 4MZTA 1OOTA 2NUTA 3HRUA 3G4SQ 2DM1A 3FB9A 2DE0X 3VKIA 2WACA 1WHJA 1WJSA 1B7TA 3U23A 3KXTA 2F2VA 1Y0MA 2I0NA 4K11A 4M7AC 1N27A 2CP5A 3BE3A 4ZTJA 1AOJA 2C0OA 4NL2A 2LJ0A 1K1ZA 3GIBA 1TOVA 4C8QC 2F5KA 3QPHA 4EPCA 2RHYA 4GLKA 2IG0A 2EQUA 5GAMd 1CSKA 1WHMA 3L2WA 2GQIA 1W70A 2OTLT 3CCMT 1QCFA 1D1BA 1QWEA 2QDLA 2LCLA 2KR3A 1N9RA 1WJQA 2VXEA 2EYZA 4IUVA 4NL3A 4LD6A 2DJZA 4Z8AA 4JPBW 1VUBA 3EGDA 2RJCA 3NMZC 1N8RU 2IVWA 2RHUA 5HK0A 2G6FX 1MNDA 4M75E 1VQ6T 5GAN7 1OZ3A 5AYFA 1BI1A 3H0FA 4M7AA 2OJ2A 4M77C 3CMAT 5GJWB 4IURA 1YWOA 2KRNA 3PFSA 2CZ7B 4JJBA 4C8QA 1WHGA 4XTUA 1KG1A 2K3XA 3INZA 3VS1A 3G7ZA 4M7DC 2LZ6B 1H92A 3M55A 4OB2B 3OA6A 3VYGA 3H0HA 2D8HA 2HKQB 2OAUA 1K8AR 5A0GA 5L8RE 1VQ8A 2P4TA 2RK1A 3VS6A 1P92A 3CCRT 4M78E 3OYCA 1T0HA 4BDZA 4FCYA 1K73U 2E41A 1W1FA 2KMTA 2KNBB 3JCMh 4JRPA 4M77A 4IUTA 2OX7A 3CC2Q 4C8QD 2JUFA 3E9FA 2ENMA 1WDXA 2L0AA 1HYOA 1K0XA 1OZ2A 2BZXA 2HDAA 2QTVA 1UGQB 2RN8A 3NGPA 4CC3A 4M7DA 1PCXA 3LYIA 2OTLA 2MYSA 2XI9A 1BIBA 1WXTA 4XK8E 4OB0B 3QJYA 3M57A 5GAOl 1R0BG 3PMTA 2NUTB 3UDCA 1JJ2A 4ZGEB 4KBMB 1M2VA 1SRLA 2KXDA 2JTFA 1AZGB 3LGLA 1ZSZB 3RESA 5GAOm 1VQ9Q 5D7UA 2LJ1A 2VVKA 1QVFP 1WPYA 3L2UA 3PT9A 1WFWA 3QUIA 1U3OA 4QVZA 2GBQA 2KYMA 4RTTA 1G8XA 1OPLA 4R0KA 3JAME 5HK3A 3G71A 4E7SA 5KE2A 2DXUA 3QWXX 3CMEA 1GBRA 3CXCS 2BIVA 2CREA 3HP9A 3A8MB 3VUBA 3OYKA 1V76A 3TREA 1YJ9Q 8AT1B 2KXCA 1VA7A 1VQ7Q 4J9CA 4ZGDB 2L3QA 2AT1B 3OS1A 4RG8A 3L2QA 4XTYA 3ZL7C 1UGPB 4BE0A 4LD9K 1YJNA 3G1JA 2YUQA 5J3BA 2WSCE 3ULRB 3HFNA 2RPNA 1NLOC 4ZNXA 4XU2A 2RHXA 4JS5A 4M7DG 1VOMA 4HCBA 1E6GA 2H8HA 3OY9A 3CCET 1OEBA 4ME7A 5GAMg 3OQ5A 4KRTA 1GRIA 5FU7B 1H3ZA 1AHJB 4C92E 1AT1B 2EKOA 1ZA1B 2LT4A 2MOXA 3JB9G 4JRKA 4ZTFA 3GPLA 5GANj 5KYUB 5KYNA 2VGNA 1B07A 2NYSA 4LE9A 4P5NA 2DLPA 3SDZA 1WXBA 4XU0A 4O5VA 1KD1U 1JQQA 1Y96B 2O88A 3I56A 4PFPA 1RI0A 3DLMA 3BDUA 4E7IA 3LH5A 2Y90A 1Y96A 1BKBA 4QQ6A 1KQ2A 4PL6A 1G83A 2BE9B 2CT4A 4VUBA 2E3HA 3CCSQ 2RQWA 2X4YA 5GANg 4D6WA 2EBPA 2XG8D 5HY6A 4LN2A 4PFOA 3JCMg 4JRQA 3QG1A 4A4HA 3SWNA 4QQGA 1RAAB 1VQOA 1M2VB 1FMVA 5ECAA 1UFFA 1ZSGA 2DD4A 3OS5A 1NG2A 1A0NB 1WYXA 3E19A 1RAIB 3QWYA 2CSIA 1Y07A 4F17A 4LUEA 2DVEA 3P8BB 1C0MA 1BB9A 1ZHIA 3FJ5A 1AWXA 3VRYA 1ZUYA 4M77F 3CMET 4EMHA 3GNFB 2DXTA 4JDSA 3REBB 1PRLC 2BZYA 1JRIA 2CDTA 4AG1C 1ZA2B 5DLOA 2NUZA 2CP6A 8ATCB 1D09B 3MEUA 3CCEA 2EFIA 1YITA 4LDYA 4QKUA 2M02A 4C8QE 1O9SA 1ZBXA 2K4YA 2QYZA 4XTWA 2R57A 2VASA 4AFSC 4AFQC 4J9GA 4AT1B 1XNIA 2GF7A 2LT1A 3X20B 4PFZA 3E1SA 4C8QG 1GCPA 3I55Q 1TWBA 2L89A 1BBZA 1TUGB 3VS4A 4DOVA 5GMKe 1TU0B 4E47A 2BZ8A 3E9GA 2DPPB 6AT1B 4XAXB 4M7AF 2LNHB 4J83A 2CH4A 3OYHA 4A4GA 4IUPA 1G2BA 3R6NA 1AD5A 1MMAA 2DBMA 2QK0A 1Q81R 3JCMV 3JCMb 2M0OA 5FROA 1J3TA 5LJ3e 3G71T 1QVGS 1VQPT 2YDLA 3JB9F 2CP3A 2CT3A 1M3AA 3CCMQ 3RNJA 3UA7A 1PC0A 1PKTA 2QQRA 2DILA 2RK2A 4BD3A 2HAXA 1YWPA 1R77A 5J26A 2EAYA 2K5IA 1M8MA 3OYAA 5A0LA 2COYA 1M1FA 5CKDA 1NJIR 5GMKh 4R56A 4EIKA 2RO0A 3C4SA 3PVLA 2FRYA 4HT9A 2HL3A 2PVGB 3OYBA 4MZPA 3G71Q 4A53A 3URGA 2E6ZA 3CCLA 1WI7A 1VQ6Q 1QCNA 1PSEA 3QHSA 4KULA 2PQWA 2ROLA 1BCMA 2GFAA 3CMAQ 3RUXA 2QAZA 3OMCA 1MUZA 2HCKA 3M4GA 4C0GA 4DBRA 2DYIA 4HXJA 3VV0A 4M75F 2DETA 3OSSC 3V8JA 2KDSA 5FRNA 2BTTA 2EQKA 1YJNT 3UA6A 1OULA 2MF2A 5KYUA 3L1AA 3QDFA 2L8DA 4OP0A 4PJOB 1Q82U 3CCRQ 3CC4A 1VQLA 3CC2T 1UTIA 4M7AB 4E7LA 4RTZA 2WSFE 2LQWA 3M58A 4ZGJB 2JOYA 5EC7A 3VS5A 3OYYA 3CPWP 1I4K1 3HFOA 1FX7A 3CCJA 4JLGA 4JS4A 3NTKA 1U1SA 4PJJA 4X9DA 1F1BB 3T9NA 1JJ2P 2HSPA 1TUDA 4E7KA 3G4SA 3KUFA 3H9NA 1Y7XA 1K0SA 1X27A 4C92C 3BDLA 3HHTB 3OSVA 1QP3A 2RMOA 4N4IA 4HCZA 4O6JA 4Z02A 5DLQE 1BI0A 2K79A 3EGXB 1W2BP 4RTXA 3OYJA 4PJOE 5GAMj 1QVGA 1GCQA 3C0CA 5GAN3 4N4HA 3VU3C 2AHJB 2EGCA 4V2SA 2HEQA 3PVQA 3I9QA 4IIMA 1Q81U 2J06A 4M7DB 1NE8A 4IIOA 1SRMA 1C1AA 2E6NA 4B9WA 4HA8A 1OX9A 4PJOF 2NUPA 3JB9H 2VC8A 3JCMW 2XKOC 3EG1A 3M53A 3JCMX 4BI3A 3GNGA 1TXQA 4Y92A 2EJGA 1H3HA 1VIEA 1UECA 1BK2A 3SWNB 3VS0A 3MO8A 4E2FB 5FRMA 5GANe 4LXCA 4RTYA 2DF6A 4LDVA 1TSFA 3FIFA 2ZPFB 3EHQA 1M1GA 3CCVQ 4LUDA 3UT1A 4MDXA 3L42A 2K3BA 1UG1A 4M78G 4E7HA 3DKMA 2V1QA 5D6YA 1FWZA 4C92F 4J9IA 1Q7YC 3I5RA 1KQSA 1XQHA 3CC4T 2LDMA 2DVJA 1Q95G 2RM4A 3C94A 3CCEQ 5GMKl 4F16A 2LP5A 1SHFA 1JJ2S 4ESRA 1D3BA 1VQNA 1OQKA 1X6GA 1YIJQ 1RACB 1VQMA 2YUPA 4C0DB 2H3EB 3CD6A 4BUGA 5GAN2 2PNIA 2IIMA 2L5QA 3HRSA 3J81E 2D0NA 3I56T 2DEUA 2K9GA 1UGSB 4EMKB 3OW2S 1C6VX 4JJDA 3V7SA 3RMSA 5A0DA 2FL7A 1K9MR 4JJCA 2RD1A 3CXCP 2KK4A 3TVTA 1B3QA 1K9AA 2DZCA 1VQNT 1HD3A 2DMOA 3A8LB 2QQ9A 1NYGA 3CC7T 4HVUA 3M0TA 1HXDA 3RKYA 2H3JA 3NPFA 3KFVA 1GBQA 3IQLA 3I55T 3F70A 1D0YA 5GAN4 3EFSA 2DEQA 1OU8A 2ZPGB 3X28B 2AZVA 1WJRA 2L2PA 1B34B 3TEEA 5I11A 2YLBA 5DY9A 1BU1A 4JLIA 3CC7Q 1UHFA 2X3WD 3FEOA 1OV3A 3HRTA 1SSFA 4EMKC 2W0ZA 2DBKA 3FJPA 5KYWB 3CC7A 2EW3A 1T0JA 4A4EA 4OGCA 4PK4A 1LPLA 3R6OA 2HQXA 1K76A 1HSQA 1FYNA 1IREB 2EIFA 4ZN3A 5FU7C 1VQLT 3CC2A 1VQ4Q 1RI9A 1GFCA 2QASA 3CCST 1SEMA 1NM7A 4C92B 2F5TX 2Z0WA 2LCSA 1BI2A 3M0QA 5LJ5g 2EGEA 2KT8A 2E1HA 4E7ZA 1VQ6A 5GAOp 1UDLA 3O8VA 2X4JA 3LWIA 1T3SA 2CGHA 4FSXA 2YUNA 5KCOA 1QKXA 3M0UA 2FPFA 4EDUA 3CPFA 1K9MU 5CK9A 4QQDA 1VQ8Q 4KUIA 2HBWA 1AWOA 3QYHB 2WSEE 1VIFA 1BYMA 4DEXA 3P8DA 2EYYA 3EHRA 2QDYB 2Y4XA 4FU6A 4CRIA 1T3LA 5GMKm 1NZ9A 2AKKA 4RTUA 1N9SA 3MP1A 3JCMQ 2RQVA 4F7UA 1EFNA 4C0DC 2XHCA 2JM9A 2JMCA 2HBPA 1NLPC 2O9VA 3OW2A 2ZPIB 1ZSZC 4PLLA 1S72T 2DA9A 3BFMA 2KROA 3I5SA 2VKNA 1ZUUA 1Q81C 3RDVA 3JB9J 3UPUA 2V8KA 3NHNA 2HMAA 2DL4A 2LTOA 4HVVA 3WVEB 5CKBA 5A2QE 3M4YA 1X2QA 3OYFA 3REAB 2GGRA 2EWNA 2COWA 2DK3A 3CD6Q 1YHQA 2EQJA 1X2KA 2OTLQ 1JXMA 1M9SA 2E65A 3CCMA 4LDXA 2O2OA 1UEBA 2KRSA 2QEXA 2OAWA 3VRZA 1Z9ZA 1ZSZA 2JS0A 4J7FA 3SFMA 2LJ3A 4YTLA 3H8ZA 5KH6A 2X35A 5CR2A 2DJQA 4M7AG 1XTDA 2F1LA 2L3SA 3ZBDA 1N8RC 3VS2A 1YJWA 4FW1A 2DRKA 3M9QA 1SG5A 1K8AU 4QVDA 2E5QA 5KYYB 5EG2A 1VQ7A 1Q82C 4N4GA 2QEXT 2MK5A 4E7JA 3TSZA 5KYYA 3OBYA 5C0MA 4OMFB 4KUDK 1G3SA 1KHCA 1UE9A 3CCUT 3JV3A 2PTKA 4M78B 3GLXA 3MHXA 2DFUA 2GQVA 5IHNA 2V8IA 1VQ9T 1NBEB 4IKFA 5IXFA 1BCOA 1MGQA 1X69A 2CH4W 1D1AA 3JCMd 2G3RA 3ER0A 1M30A 1YCSB 4M77E 4F7UF 2FEIA 1IZ6A 2XDDA 4RCBA 2DL3A 2SEMA 1S1NA 5DM7R 3PTAA 3M56A 2E3IA 3V7RA 2M1HA 3QBYA 1WHKA 2D8JA 1Y71A 3KBGA 1I07A 3EG9B 4PJMA 3CCUQ 2VV5A 2OI3A 2FZCB 2A7YA 4F7UB 1KIKA 3CMEQ 4BDYA 3UATA 4C5EA 3CC4Q 3SD4A 3HPWA 3ASKA 2V8JA 2CUBA 1ARKA 1ZUKA 4M75G 1PWTA 3NTHA 3CCQT 4J9BA 5CKHA 4BE1A 4J9FA 1W2BS 2IPOB 1VQ7T 5LJ5h 1UJYA 4N0AC 1WHHA 4RTWA 1W4SA 5M9OA 1JO8A 4M77B 3DLLA 2ZPBB 1YJWT 3CPWS 4J6WA 2DRMA 5I21A 3AT1B 2KBTA 2RH2A 3OYDA 4R55A 3A98A 1Q86R 4KT0E 3OMGA 4OMLA 4UC4A 2D9TA 3RKXA 1QKWA 1QLYA 3CCVT 3JCMJ 1VQLQ 1ABOA 1VQ4T 1X6BA 4RKUE 2J7IA 4C8QB 2O4XA 5D6XA 1WGSA 4PJOG 1VYVA 3FRNA 3LX7A 4BY6C 1VQKT 1B34A 2CZ1B 1AWJA 2FRWA 3QDRB 4ANJA 3MCAB 1H641 1OPKA 2EGAA 2LQ8A 1KD1R 1R8OB 3CCRA 3H0IA 2QGGA 1MMDA 3PNWC 4L59A 1AZEA 5J39A 2JJ9A 1M3CA 2YXYA 3QKJA 1Z9QA 1YN8A 2VUBA 2AIRB 4BACA 3TSWA 1YIJT 2QGFB 1E6HA 4M75A 2RA2A 4OVAA 4DA4A 1VQ9A 4PJLA 1YP5A 4J5YA 2MI6A 2ZCFB 3RMQA 2Y4YA 3CCLQ 5IT9E 2DKGA 1U06A 2CS7A 3N5BB 1RUWA 3J7AF 2F69A 4OMNA 4ORZA 2DL5A 4M78C 4FIBA 2DIGA 4J9HA 3PIOA 5IAYA 2DD5A 2RQTA 4KGXB 2FPEA 3CCVA 3MJXA 2D0QB 4BY6B 2XD0A 4FT2A 3GP8A 2R5MA 2L3RA 5CCAA 2KAFA 5FLXE 3A8OB 2PZ1A 2FB7A 3SWNC 2F2XA 3QYGB 4JZ3A 3CCLT 2JMAA 4M75C 2JN0A 4L6V5 2J6OA 3FLGA 3EG2A 5HCKA 2NLUA 4A63B 2PU9B 4M75B 1D0ZA 4L5GA 1N5ZA 3MP8A 1IXDA 2JS2A 3RR6A 4M77G 4M78A 2RJDA 4PKCC 1WQWA 4ELZC 2X4WA 1KD1C 5KYXA 2ATCB 3GBQA 4GBQA 1M1KU 2L3PA 1GL5A 5GMKi 2X51A 2YRDA 3SB2A 3I56Q 2FG0A 1HK9A 3X24B 4FSSA 5LJ3j 2QXFA 2QQAA 3I55A 3HSBA 4PJOC 4C0FA 2VB6A 1X01A 1NJIC 3BW1A 3MEWA 4A4FA 2ROTA 2JT4A 2E64A 1X43A 1K9MC 1YNZA 2YRCA 4MZMA 3TQ7P 2ZAEA 1VQ5T 1KC8R 4MMLA 4M78D 2XMFA 1OI1A 2DZ9A 1VYUA 1WXUA 2MPXC 1RAHB 4F14A 1SPKA 2M16A 3DB4A 2EYQA 2QA4A 1ABQA 1YITQ 3MP6A 4F7UE 2DYBA 1W6XA 5LJ5e 4XTZA 1Q86C 4XTXA 4C0ZA 5CAIA 4M7AD 2VYTA 5FWCA 1WA7A 4ZN1A 5C6SA 1RAEB 3OB9A 5CKEA 2DERA 5GAN6 4HKEA 4KH1B 1WNLA 2K7AA 2A36A 1TG0A 4B6MA 2PUKB 3MEVA 4IUQA 3EG0A 4TVRA 4Y91A 3X26B 1U8RA 1YHQT 1OX8A 4X9CA 4M4ZA 2O9SA 4WCIA 5GAN5 1KFZA 3S3NA 2DXBA 2K5LA 2RQUA 1CKAA 3M59A 1UUEA 3OBWA 2GTJA 1MHNA 2M9UA 4M77D 9ATCB 2R58A 1VQ5A 3UWNA 2K2MA 2P0PA 4Z89A 5LJ3g 2CP7A 2I2LA 2JNGA 4J6YA 4OGEA 2EKHA 2KYBA 4AMCA 2B8AA 3OYNA 1VQ8T 5FW9A 2P4RA 3PIPA 2JTEA 2COZA 2V1RA 4OB3B 3DB3A 4M7DD 5GAMf 3MEAA 1LNXA 2V26A 4OMPA 2OTJA 3ZFJA 1X75C 1IGQA 1BIAA 4GLMA 1E7OA 3E2UA 5GAMe 4RTVA 1Q86U 1KC8U 3CXCA 4CC7A 2O01E 4XU3A 2ZPEB 2HKNA 2LNVA 2X4XA 2FZKB 2YT6A 2GTOA 4KH0B 1PSFA 4OF1A 1IO6A 3MPUB 1SKUB 1MV3A 4AG2C 2YSQA 2CYZB 1RADB 4ELYC 2RI2A 2HQHA 2LQNA 1NJIU 2X9HA 1XJWB 3C12A 5I2SA 2YHTA 1YHQQ 2RHIA 1MNEA 2O4XB 3LLRA 2PUOB 3CD6T 3RBBB 2KGTA 1KQ1A 4EMGA 3X25B 4OB1B 2DTOA 2C0TA 1UGRB 5FWBA 2LMJA 1M90C 3META 4CI0C 1G3WA 4J6XA 1I81A 4J9EA 1WHLA 2VWFA 5GAMh 2DXCA 3UF4A 4XTVA 5GAOq 2K5FA 1QP2A 1WZOA 4PNOA 2RI5A 5I2MA 2EPDA 2J6KA 4HT8A 4AFZC 2F2WA 4BB7A 2HNIA 2E4HA 1I8FA 3OW2P 3VYHB 1QVFS 3EFRA 1XOVA 3G6EA 2ZGWA 3OYLA 4BI4A 4PLIA 2RHZA 1VQKQ 4HVWA 3H6ZA 1M5Q1 2KRMA 4RCCA 2YWWA 1PD0A 2PVOB 4CC2A 1Y57A 5IH2A 2RF0A 4JZ4A 5LJ3d 4DEYA 3S3OA 2KE9A 3TU4K 4DQ2A 1VQKA 4HCCA 5KCHA 4FYYB 4DBFA 4RUGA 4RMOA 5FU6C 1UJ0A 5IN1A 3PE0A 1PNJA 1KK7A 5I22A 2J05A 3G6EQ 1WLPB 2DL8A 2HZYA 3VS7A 3SHWA 1PRMC 3EH1A 3AHUA 1M2OA 1JU5C 1Q82R 1CKBA 2EVRA 4KGVB 1VQMT 1W2BA 3THKA 4ATOA 2HSEB 2M51A 1KQSS 3CCJQ 2XK0A 1QW1A 2GFUA 3JB9I 2EYXA 1VYTA 2DL7A 4FYWB 1LOJA 1I0CA 1R0CB 3S3MA 3JRZA 2O31A 1RLPC 1H8KA 1M4ZA 2JZ2A 2XDBA 3G6ET 2X3XD 2K3YA 1QVGP 1D0XA 3RKWA 2JM8A 3JSCA 2ED0A 3CCJT 1X6OA 1LJOA 5GMKj
chains in the Genus database with same CATH topology
2A28A 1UJYA 4RTWA 3NMZC 2HSPA 1JO8A 1WIEA 2DRMA 3I35A 1TUDA 2G6FX 1SHGA 2KBTA 1AVZC 3H0FA 2OJ2A 1LCKA 3A98A 5GJWB 1K0SA 1K4US 2AZSA 1YWOA 1X27A 2KRNA 4OMLA 3M0SA 1QKWA 1QLYA 3VS3A 4JJBA 4HCKA 1ABOA 2RMOA 1U5SA 1X6BA 3VS1A 1M27C 2FO0A 2J7IA 2K79A 4RTXA 1VYVA 2KEAA 2LZ6B 4D8KA 1H92A 1PKSA 1AWJA 2FRWA 1GCQA 4CC4B 3C0CA 3H0HA 1OPKA 5L23A 2D8HA 3EG3A 2EGAA 2EGCA 2HEQA 3H0IA 3PVQA 3I9QA 4IIMA 3VS6A 1AZEA 2J06A 4IIOA 2FPDA 1T0HA 1SRMA 1M3CA 1Z9QA 1YN8A 3EGUA 1ZX6A 1JEGA 1W1FA 3TSWA 2KNBB 5IHIA 3EG1A 1E6HA 1UGVA 1YP5A 2ENMA 4Y92A 1WDXA 2L0AA 1H3HA 2A37A 1K0XA 1UECA 2BZXA 1BK2A 2HDAA 2J6FA 3VS0A 4E6RA 1U06A 1RUWA 2EQIA 2A08A 4OMNA 4ORZA 2RN8A 3NGPA 2DL5A 4CC3A 1RLQC 4RTYA 2DF6A 1PHTA 1UHCA 1ZLMA 4J9HA 1WXTA 3M0PA 3EHQA 2RQTA 4J9DA 2FPEA 2ED1A 4LUDA 2K3BA 1UG1A 1SRLA 2KXDA 2V1QA 4J9IA 1AZGB 3I5RA 2PZ1A 2JW4A 2F2XA 4LNPA 2LX7A 2LJ1A 4JZ3A 2VVKA 2JMAA 2DVJA 5IXBA 2ECZA 2J6OA 1WFWA 1U3OA 3EG2A 5HCKA 2DNUA 4F16A 2LP5A 2M0YA 1SHFA 3M0RA 4A63B 4ESRA 1N5ZA 2GBQA 2JS2A 2KYMA 4RTTA 1OPLA 1X6GA 1AWWA 4R0KA 2YUPA 4GBQA 3GBQA 2L3PA 2PNIA 1NEGA 3QWXX 1GL5A 2IIMA 1GBRA 1JXOA 3SEMA 2D0NA 2NWMA 2FG0A 2CREA 2K9GA 4FSSA 4JJDA 2CUDA 1KSWA 2KXCA 1VA7A 4JJCA 4J9CA 2MIOA 2L3QA 3TVTA 2ROTA 2JT4A 2AK5A 1X43A 2ABLA 2KT1A 1B3QA 1K9AA 1YNZA 3ZL7C 1HD3A 2YUOA 2DMOA 1GCQC 1NYGA 2YUQA 2XMFA 3ULRB 4HVUA 1VYUA 1WXUA 2RPNA 1NLOC 4D8DA 3M0TA 4ZNXA 1SPKA 4F14A 4Z88A 3NPFA 3KFVA 1ABQA 1GBQA 2JXBA 1E6GA 2H8HA 3IQLA 2DYBA 1W6XA 1OEBA 4KRTA 1GRIA 5FWCA 1WA7A 2AZVA 2MOXA 1M3BA 2L2PA 5I11A 1BU1A 1UHFA 2X3WD 1B07A 1OV3A 2K7AA 4LE9A 2A36A 2W0ZA 2DBKA 1TG0A 2DLPA 2EW3A 1WXBA 1T0JA 2RQRA 2D1XA 1ZBJA 1JQQA 4QT7A 1K76A 3EG0A 2O88A 1QWFA 1HSQA 1FYNA 3LH5A 4OMOA 4M4ZA 2O9SA 1G83A 4WCIA 1RI9A 1GFCA 2CT4A 1SEMA 1KFZA 1NM7A 1AEYA 2LCSA 2RQUA 2RQWA 2E5KA 3M0QA 2EGEA 2KT8A 1CKAA 2EBPA 1TUCA 1UUEA 4LN2A 2GTJA 1UDLA 3O5ZA 1T3SA 2K2MA 5ECAA 2YUNA 1UFFA 4Z89A 1QKXA 3M0UA 2FPFA 2DX1A 1ZSGA 1NG2A 2EKHA 2KYBA 1A0NB 1WYXA 5FW9A 2P4RA 1WX6A 2JTEA 3QWYA 2CSIA 2V1RA 4F17A 4LUEA 2HBWA 1AWOA 1GFDA 2K6DA 4OMPA 2B86A 1BB9A 4DEXA 3FJ5A 1AWXA 2EYYA 3EHRA 3VRYA 1ZUYA 1T3LA 3REBB 4GLMA 1PRLC 1E7OA 2BZYA 2AKKA 4RTUA 4RTVA 2RQVA 2CDTA 2ESWA 4AG1C 2NUZA 1EFNA 2MCNA 4CC7A 2JM9A 1SSHA 2JMCA 1NLPC 2O9VA 2YT6A 2GTOA 2GNCA 2DA9A 1NEBA 4AFSC 1IO6A 4AFQC 1MV3A 4J9GA 4AG2C 2KROA 3I5SA 2VKNA 1ZUUA 2YSQA 2EYWA 1KJWA 3NHNA 4OMMA 2LQNA 4X1VA 1GCPA 2DL4A 4HVVA 1BBZA 1X2QA 3VS4A 3REAB 2GGRA 3RBBB 2KGTA 2BZ8A 1X2KA 2LNHB 1I1JA 2C0IA 1NYFA 1JXMA 2CSQA 2W10A 5IHKA 2CH4A 2C0TA 5FWBA 2LMJA 1G2BA 3R6NA 1AD5A 2O2OA 4J9EA 2DBMA 2VWFA 2KRSA 2AKLA 2OAWA 1J3TA 5GJVB 1Z9ZA 3UF4A 3VRZA 2YDLA 2JS0A 2CT3A 2EPDA 2J6KA 4OMQA 2LJ3A 4AFZC 2F2WA 1M3AA 2DJQA 3RNJA 2RNAA 1PKTA 3UA7A 2L3SA 2DILA 3VS2A 1XOVA 1YWPA 3H41A 1HJDA 1FMKA 2DRKA 2SRCA 1M8MA 4HVWA 2KRMA 4CC2A 3CQTA 1Y57A 4EIKA 5IH2A 3PVLA 2RF0A 3TSZA 4JZ4A 1V1CA 2FRYA 4DEYA 2KE9A 1UE9A 3JV3A 2PTKA 1WI7A 4RUGA 5IHNA 1UJ0A 1MV0B 5IXFA 3PE0A 1PNJA 1X69A 2ROLA 2CH4W 5I22A 2J05A 1WLPB 4AFUC 2DL8A 1OOTA 3VS7A 1M30A 3SHWA 1YCSB 2DM1A 1PRMC 2DE0X 1MUZA 1JU5C 2FEIA 2HCKA 4HXJA 1CKBA 2DL3A 2SEMA 1S1NA 2EVRA 3U23A 2F2VA 1Y0MA 3THKA 2I0NA 4K11A 2M51A 2BTTA 2D8JA 3UA6A 1AOJA 2C0OA 1I07A 2EYXA 1VYTA 2LJ0A 2DL7A 1I0CA 1K1ZA 2OI3A 1KIKA 2O31A 1RLPC 3UATA 1CSKA 1H8KA 1UTIA 2GQIA 2X3XD 2CUBA 1W70A 4RTZA 1ARKA 1ZUKA 2LQWA 1QCFA 1PWTA 5EC7A 1QWEA 3VS5A 2QDLA 2KR3A 4J9BA 2EYZA 4J9FA 2JM8A 2ED0A 4Z8AA 4JPBW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A28 A;  1UJY A;  4RTW A;  3NMZ C;  2HSP A;  1JO8 A;  1WIE A;  2DRM A;  3I35 A;  1TUD A;  2G6F X;  1SHG A;  2KBT A;  1AVZ C;  3H0F A;  2OJ2 A;  1LCK A;  3A98 A;  5GJW B;  1K0S A;  1K4U S;  2AZS A;  1YWO A;  1X27 A;  2KRN A;  4OML A;  3M0S A;  1QKW A;  1QLY A;  3VS3 A;  4JJB A;  4HCK A;  1ABO A;  2RMO A;  1U5S A;  1X6B A;  3VS1 A;  1M27 C;  2FO0 A;  2J7I A;  2K79 A;  4RTX A;  1VYV A;  2KEA A;  2LZ6 B;  4D8K A;  1H92 A;  1PKS A;  1AWJ A;  2FRW A;  1GCQ A;  4CC4 B;  3C0C A;  3H0H A;  1OPK A;  5L23 A;  2D8H A;  3EG3 A;  2EGA A;  2EGC A;  2HEQ A;  3H0I A;  3PVQ A;  3I9Q A;  4IIM A;  3VS6 A;  1AZE A;  2J06 A;  4IIO A;  2FPD A;  1T0H A;  1SRM A;  1M3C A;  1Z9Q A;  1YN8 A;  3EGU A;  1ZX6 A;  1JEG A;  1W1F A;  3TSW A;  2KNB B;  5IHI A;  3EG1 A;  1E6H A;  1UGV A;  1YP5 A;  2ENM A;  4Y92 A;  1WDX A;  2L0A A;  1H3H A;  2A37 A;  1K0X A;  1UEC A;  2BZX A;  1BK2 A;  2HDA A;  2J6F A;  3VS0 A;  4E6R A;  1U06 A;  1RUW A;  2EQI A;  2A08 A;  4OMN A;  4ORZ A;  2RN8 A;  3NGP A;  2DL5 A;  4CC3 A;  1RLQ C;  4RTY A;  2DF6 A;  1PHT A;  1UHC A;  1ZLM A;  4J9H A;  1WXT A;  3M0P A;  3EHQ A;  2RQT A;  4J9D A;  2FPE A;  2ED1 A;  4LUD A;  2K3B A;  1UG1 A;  1SRL A;  2KXD A;  2V1Q A;  4J9I A;  1AZG B;  3I5R A;  2PZ1 A;  2JW4 A;  2F2X A;  4LNP A;  2LX7 A;  2LJ1 A;  4JZ3 A;  2VVK A;  2JMA A;  2DVJ A;  5IXB A;  2ECZ A;  2J6O A;  1WFW A;  1U3O A;  3EG2 A;  5HCK A;  2DNU A;  4F16 A;  2LP5 A;  2M0Y A;  1SHF A;  3M0R A;  4A63 B;  4ESR A;  1N5Z A;  2GBQ A;  2JS2 A;  2KYM A;  4RTT A;  1OPL A;  1X6G A;  1AWW A;  4R0K A;  2YUP A;  4GBQ A;  3GBQ A;  2L3P A;  2PNI A;  1NEG A;  3QWX X;  1GL5 A;  2IIM A;  1GBR A;  1JXO A;  3SEM A;  2D0N A;  2NWM A;  2FG0 A;  2CRE A;  2K9G A;  4FSS A;  4JJD A;  2CUD A;  1KSW A;  2KXC A;  1VA7 A;  4JJC A;  4J9C A;  2MIO A;  2L3Q A;  3TVT A;  2ROT A;  2JT4 A;  2AK5 A;  1X43 A;  2ABL A;  2KT1 A;  1B3Q A;  1K9A A;  1YNZ A;  3ZL7 C;  1HD3 A;  2YUO A;  2DMO A;  1GCQ C;  1NYG A;  2YUQ A;  2XMF A;  3ULR B;  4HVU A;  1VYU A;  1WXU A;  2RPN A;  1NLO C;  4D8D A;  3M0T A;  4ZNX A;  1SPK A;  4F14 A;  4Z88 A;  3NPF A;  3KFV A;  1ABQ A;  1GBQ A;  2JXB A;  1E6G A;  2H8H A;  3IQL A;  2DYB A;  1W6X A;  1OEB A;  4KRT A;  1GRI A;  5FWC A;  1WA7 A;  2AZV A;  2MOX A;  1M3B A;  2L2P A;  5I11 A;  1BU1 A;  1UHF A;  2X3W D;  1B07 A;  1OV3 A;  2K7A A;  4LE9 A;  2A36 A;  2W0Z A;  2DBK A;  1TG0 A;  2DLP A;  2EW3 A;  1WXB A;  1T0J A;  2RQR A;  2D1X A;  1ZBJ A;  1JQQ A;  4QT7 A;  1K76 A;  3EG0 A;  2O88 A;  1QWF A;  1HSQ A;  1FYN A;  3LH5 A;  4OMO A;  4M4Z A;  2O9S A;  1G83 A;  4WCI A;  1RI9 A;  1GFC A;  2CT4 A;  1SEM A;  1KFZ A;  1NM7 A;  1AEY A;  2LCS A;  2RQU A;  2RQW A;  2E5K A;  3M0Q A;  2EGE A;  2KT8 A;  1CKA A;  2EBP A;  1TUC A;  1UUE A;  4LN2 A;  2GTJ A;  1UDL A;  3O5Z A;  1T3S A;  2K2M A;  5ECA A;  2YUN A;  1UFF A;  4Z89 A;  1QKX A;  3M0U A;  2FPF A;  2DX1 A;  1ZSG A;  1NG2 A;  2EKH A;  2KYB A;  1A0N B;  1WYX A;  5FW9 A;  2P4R A;  1WX6 A;  2JTE A;  3QWY A;  2CSI A;  2V1R A;  4F17 A;  4LUE A;  2HBW A;  1AWO A;  1GFD A;  2K6D A;  4OMP A;  2B86 A;  1BB9 A;  4DEX A;  3FJ5 A;  1AWX A;  2EYY A;  3EHR A;  3VRY A;  1ZUY A;  1T3L A;  3REB B;  4GLM A;  1PRL C;  1E7O A;  2BZY A;  2AKK A;  4RTU A;  4RTV A;  2RQV A;  2CDT A;  2ESW A;  4AG1 C;  2NUZ A;  1EFN A;  2MCN A;  4CC7 A;  2JM9 A;  1SSH A;  2JMC A;  1NLP C;  2O9V A;  2YT6 A;  2GTO A;  2GNC A;  2DA9 A;  1NEB A;  4AFS C;  1IO6 A;  4AFQ C;  1MV3 A;  4J9G A;  4AG2 C;  2KRO A;  3I5S A;  2VKN A;  1ZUU A;  2YSQ A;  2EYW A;  1KJW A;  3NHN A;  4OMM A;  2LQN A;  4X1V A;  1GCP A;  2DL4 A;  4HVV A;  1BBZ A;  1X2Q A;  3VS4 A;  3REA B;  2GGR A;  3RBB B;  2KGT A;  2BZ8 A;  1X2K A;  2LNH B;  1I1J A;  2C0I A;  1NYF A;  1JXM A;  2CSQ A;  2W10 A;  5IHK A;  2CH4 A;  2C0T A;  5FWB A;  2LMJ A;  1G2B A;  3R6N A;  1AD5 A;  2O2O A;  4J9E A;  2DBM A;  2VWF A;  2KRS A;  2AKL A;  2OAW A;  1J3T A;  5GJV B;  1Z9Z A;  3UF4 A;  3VRZ A;  2YDL A;  2JS0 A;  2CT3 A;  2EPD A;  2J6K A;  4OMQ A;  2LJ3 A;  4AFZ C;  2F2W A;  1M3A A;  2DJQ A;  3RNJ A;  2RNA A;  1PKT A;  3UA7 A;  2L3S A;  2DIL A;  3VS2 A;  1XOV A;  1YWP A;  3H41 A;  1HJD A;  1FMK A;  2DRK A;  2SRC A;  1M8M A;  4HVW A;  2KRM A;  4CC2 A;  3CQT A;  1Y57 A;  4EIK A;  5IH2 A;  3PVL A;  2RF0 A;  3TSZ A;  4JZ4 A;  1V1C A;  2FRY A;  4DEY A;  2KE9 A;  1UE9 A;  3JV3 A;  2PTK A;  1WI7 A;  4RUG A;  5IHN A;  1UJ0 A;  1MV0 B;  5IXF A;  3PE0 A;  1PNJ A;  1X69 A;  2ROL A;  2CH4 W;  5I22 A;  2J05 A;  1WLP B;  4AFU C;  2DL8 A;  1OOT A;  3VS7 A;  1M30 A;  3SHW A;  1YCS B;  2DM1 A;  1PRM C;  2DE0 X;  1MUZ A;  1JU5 C;  2FEI A;  2HCK A;  4HXJ A;  1CKB A;  2DL3 A;  2SEM A;  1S1N A;  2EVR A;  3U23 A;  2F2V A;  1Y0M A;  3THK A;  2I0N A;  4K11 A;  2M51 A;  2BTT A;  2D8J A;  3UA6 A;  1AOJ A;  2C0O A;  1I07 A;  2EYX A;  1VYT A;  2LJ0 A;  2DL7 A;  1I0C A;  1K1Z A;  2OI3 A;  1KIK A;  2O31 A;  1RLP C;  3UAT A;  1CSK A;  1H8K A;  1UTI A;  2GQI A;  2X3X D;  2CUB A;  1W70 A;  4RTZ A;  1ARK A;  1ZUK A;  2LQW A;  1QCF A;  1PWT A;  5EC7 A;  1QWE A;  3VS5 A;  2QDL A;  2KR3 A;  4J9B A;  2EYZ A;  4J9F A;  2JM8 A;  2ED0 A;  4Z8A A;  4JPB W; 
#chains in the Genus database with same CATH topology
 1N8R R;  3EG9 A;  2A28 A;  2BE7 D;  3A8H B;  3CBP A;  2FVU A;  3EH2 A;  1DJ7 B;  1WIE A;  3RIR A;  3I35 A;  1SHG A;  2E10 A;  1K73 C;  3CMA A;  2E70 A;  5FU6 B;  4NOY A;  1BI3 A;  1AVZ C;  3LWH A;  2MWP A;  1LCK A;  4PJO D;  1Q7Y U;  2CZ0 B;  1K4U S;  2AZS A;  3M0S A;  4BI8 B;  3VS3 A;  1YCY A;  2PVD B;  4HCK A;  5LJ5 f;  1U5S A;  1M27 C;  2FO0 A;  2JVV A;  3GOX A;  1QMC A;  4DOW A;  1M90 U;  3JCM f;  2KEA A;  4D8K A;  4GY5 A;  1PKS A;  4CC4 B;  2JTM A;  3CPW A;  5LJ3 f;  5L23 A;  3EG3 A;  2HQE A;  5GAN d;  1ZQ1 A;  1S72 Q;  5KE3 A;  1VQ5 Q;  2HL5 C;  4FL6 A;  1VQN Q;  2FPD A;  1YIT T;  4FYX B;  3QXE B;  2EJF A;  5CIU A;  4PJO A;  3EGU A;  1ZX6 A;  1JEG A;  4FYV B;  3WXM B;  1JBM A;  1QVP A;  3QZ5 B;  5IHI A;  1O75 A;  5GAO r;  1UGV A;  1VQO T;  3V7C A;  3JB9 D;  2A37 A;  2E12 A;  2LRQ A;  2J6F A;  4E6R A;  1OYX A;  2EQI A;  1KC8 C;  2ZPH B;  2A08 A;  1RLQ C;  3G4S T;  2A0F B;  1TS9 A;  2FYK A;  2LX9 A;  1PHT A;  1UHC A;  1ZLM A;  2EJ9 A;  3M0P A;  4J9D A;  5LL6 S;  1OU9 A;  4WF2 A;  3QSU A;  2ED1 A;  1VQO Q;  3M5A A;  4C5H A;  3EFO A;  1TH7 A;  2RI3 A;  2JW4 A;  4LNP A;  2LX7 A;  5LJ3 h;  2DAQ A;  1D1C A;  5IXB A;  3OYE A;  4MDW A;  3V8L A;  2ECZ A;  2QTX A;  4MMK A;  2D6F A;  2CP2 A;  2CP0 A;  4KGZ B;  3A1P A;  2DNU A;  3D7S B;  4C5G A;  2M0Y A;  3M0R A;  2KSS A;  3JCM P;  4JUV A;  1YJN Q;  4Y28 E;  2VGM A;  3MKD A;  1U1T A;  4FM4 B;  1VQ4 A;  1EIF A;  3RER A;  1AWW A;  5GAO n;  3ZEH A;  1YI2 A;  1VQP Q;  3J80 E;  2QEX Q;  1NEG A;  3BY7 A;  1JXO A;  3SEM A;  3V8K A;  2NWM A;  3QZ9 B;  3QO3 A;  2CUD A;  5KYW A;  1KSW A;  2YRV A;  4M7D F;  4C92 A;  3L2Z A;  2C06 A;  2MIO A;  2VXF A;  2AK5 A;  2ABL A;  1I5O B;  3PMI A;  1QQJ A;  2KT1 A;  3L2V A;  5KYX B;  2BKD N;  2YUO A;  4LDW A;  2EQM A;  1GCQ C;  4N0A A;  3CBM A;  4BE2 A;  4D8D A;  4II1 A;  1KHI A;  4Z88 A;  1UB4 A;  2JXB A;  1S72 A;  4A4K A;  2DIQ A;  1YJ9 A;  4J7I A;  1PM3 A;  2FHD A;  5LJ5 d;  2XID A;  4C92 D;  1WQ7 A;  1IB8 A;  1M3B A;  1YFN A;  2HD0 A;  3VUZ A;  3EAE A;  4JJN K;  4F04 B;  3CBO A;  2RQR A;  2D1X A;  1ZBJ A;  3WVD B;  4QT7 A;  3OYI A;  3CEY A;  1RAG B;  2QQS A;  1QWF A;  1M1K C;  2QA4 Q;  4B9X A;  3OYM A;  3QJ6 A;  4OMO A;  5HKC A;  4Q5W A;  4C5I A;  7AT1 B;  3A8G B;  5CKF A;  1AEY A;  2DTI A;  5GAN 8;  2E5K A;  1PG5 B;  1MMN A;  5GAN h;  1RAF B;  3HKS A;  3OS0 A;  1TUC A;  2P0K A;  2YLC A;  5CVI A;  1K73 R;  4M78 F;  1IGU A;  2DO3 A;  3O5Z A;  4M7A E;  1YBY A;  4C92 G;  1JB0 E;  3GF5 A;  2QI2 A;  5D6W A;  2DX1 A;  3LW5 E;  2QA4 T;  4RG2 A;  2QQB A;  4WTO B;  3OYG A;  3FC3 A;  1WX6 A;  4JRI A;  1IRX A;  1ACM B;  4F7U G;  4A54 A;  1RL2 A;  2ZZD A;  3HTR A;  4QW2 A;  3C95 A;  3OS2 A;  1I5L A;  3CCQ Q;  1GFD A;  2K6D A;  4PJN A;  1EZZ B;  1IHV A;  2B86 A;  1RAB B;  1NPP A;  2RB6 A;  1M1K R;  2OTJ T;  1K8A C;  2RJF A;  2MMP A;  1VQM Q;  1YIJ A;  1YJW Q;  3Q1J A;  2XDP A;  2NUP B;  1LVK A;  1Q7Y R;  2ESW A;  2MCN A;  3JCM e;  1YJ9 T;  1SSH A;  1G5V A;  2KQW A;  4QVC A;  3LGF A;  4XQ3 A;  1KQS P;  2GNC A;  3A5Z B;  3CCS A;  2MAM A;  1NEB A;  3S6W A;  3NTI A;  2EYW A;  1KJW A;  4OMM A;  2GCX A;  2RJE A;  1SF9 A;  4X1V A;  5CO7 A;  5GAN f;  1EX4 A;  3EGX A;  3LH0 A;  4NS5 A;  1NPR A;  3CCU A;  3FDR A;  2LVM A;  4DBQ A;  4J8O A;  1I1J A;  2C0I A;  1NYF A;  3EFO B;  5AT1 B;  1V29 B;  2CSQ A;  2W10 A;  5IHK A;  2K57 A;  3HL8 A;  1G3T A;  1MMG A;  4XU1 A;  3NFC A;  4M75 D;  2AKL A;  2DTH A;  1M90 R;  4C8Q F;  2KI7 A;  5GJV B;  3P8H A;  3TCJ A;  2KY9 A;  1YI2 T;  1IHW A;  4EMK A;  2LCC A;  1D3B B;  4M7D E;  2XIC A;  4OMQ A;  1FXX A;  3QII A;  5CQY A;  2FZG B;  3PGG A;  4LDU A;  1N6A A;  2BUD A;  2RNA A;  4FW2 A;  2XU8 A;  2CZ6 B;  3H41 A;  1HJD A;  2P0Q A;  1FMK A;  2SRC A;  4DBH A;  2OTJ Q;  4X34 A;  1TTH B;  2P84 A;  4IUU A;  5LJ5 j;  1M8V A;  1PD1 A;  3CQT A;  4FT4 A;  3CCQ A;  2MWO A;  1V1C A;  2KVQ G;  2LC4 A;  2CKK A;  2R5A A;  1GXI E;  3M54 A;  1VQP A;  1YI2 Q;  2LQK A;  5CQX A;  2A3L A;  3VJP A;  1QVF A;  1QCO A;  1MV0 B;  2QG9 B;  3EGD B;  1G3Y A;  3JCM c;  3ME9 A;  1FMW A;  2K2V A;  3L2R A;  4AFU C;  4MZT A;  1OOT A;  2NUT A;  3HRU A;  3G4S Q;  2DM1 A;  3FB9 A;  2DE0 X;  3VKI A;  2WAC A;  1WHJ A;  1WJS A;  1B7T A;  3U23 A;  3KXT A;  2F2V A;  1Y0M A;  2I0N A;  4K11 A;  4M7A C;  1N27 A;  2CP5 A;  3BE3 A;  4ZTJ A;  1AOJ A;  2C0O A;  4NL2 A;  2LJ0 A;  1K1Z A;  3GIB A;  1TOV A;  4C8Q C;  2F5K A;  3QPH A;  4EPC A;  2RHY A;  4GLK A;  2IG0 A;  2EQU A;  5GAM d;  1CSK A;  1WHM A;  3L2W A;  2GQI A;  1W70 A;  2OTL T;  3CCM T;  1QCF A;  1D1B A;  1QWE A;  2QDL A;  2LCL A;  2KR3 A;  1N9R A;  1WJQ A;  2VXE A;  2EYZ A;  4IUV A;  4NL3 A;  4LD6 A;  2DJZ A;  4Z8A A;  4JPB W;  1VUB A;  3EGD A;  2RJC A;  3NMZ C;  1N8R U;  2IVW A;  2RHU A;  5HK0 A;  2G6F X;  1MND A;  4M75 E;  1VQ6 T;  5GAN 7;  1OZ3 A;  5AYF A;  1BI1 A;  3H0F A;  4M7A A;  2OJ2 A;  4M77 C;  3CMA T;  5GJW B;  4IUR A;  1YWO A;  2KRN A;  3PFS A;  2CZ7 B;  4JJB A;  4C8Q A;  1WHG A;  4XTU A;  1KG1 A;  2K3X A;  3INZ A;  3VS1 A;  3G7Z A;  4M7D C;  2LZ6 B;  1H92 A;  3M55 A;  4OB2 B;  3OA6 A;  3VYG A;  3H0H A;  2D8H A;  2HKQ B;  2OAU A;  1K8A R;  5A0G A;  5L8R E;  1VQ8 A;  2P4T A;  2RK1 A;  3VS6 A;  1P92 A;  3CCR T;  4M78 E;  3OYC A;  1T0H A;  4BDZ A;  4FCY A;  1K73 U;  2E41 A;  1W1F A;  2KMT A;  2KNB B;  3JCM h;  4JRP A;  4M77 A;  4IUT A;  2OX7 A;  3CC2 Q;  4C8Q D;  2JUF A;  3E9F A;  2ENM A;  1WDX A;  2L0A A;  1HYO A;  1K0X A;  1OZ2 A;  2BZX A;  2HDA A;  2QTV A;  1UGQ B;  2RN8 A;  3NGP A;  4CC3 A;  4M7D A;  1PCX A;  3LYI A;  2OTL A;  2MYS A;  2XI9 A;  1BIB A;  1WXT A;  4XK8 E;  4OB0 B;  3QJY A;  3M57 A;  5GAO l;  1R0B G;  3PMT A;  2NUT B;  3UDC A;  1JJ2 A;  4ZGE B;  4KBM B;  1M2V A;  1SRL A;  2KXD A;  2JTF A;  1AZG B;  3LGL A;  1ZSZ B;  3RES A;  5GAO m;  1VQ9 Q;  5D7U A;  2LJ1 A;  2VVK A;  1QVF P;  1WPY A;  3L2U A;  3PT9 A;  1WFW A;  3QUI A;  1U3O A;  4QVZ A;  2GBQ A;  2KYM A;  4RTT A;  1G8X A;  1OPL A;  4R0K A;  3JAM E;  5HK3 A;  3G71 A;  4E7S A;  5KE2 A;  2DXU A;  3QWX X;  3CME A;  1GBR A;  3CXC S;  2BIV A;  2CRE A;  3HP9 A;  3A8M B;  3VUB A;  3OYK A;  1V76 A;  3TRE A;  1YJ9 Q;  8AT1 B;  2KXC A;  1VA7 A;  1VQ7 Q;  4J9C A;  4ZGD B;  2L3Q A;  2AT1 B;  3OS1 A;  4RG8 A;  3L2Q A;  4XTY A;  3ZL7 C;  1UGP B;  4BE0 A;  4LD9 K;  1YJN A;  3G1J A;  2YUQ A;  5J3B A;  2WSC E;  3ULR B;  3HFN A;  2RPN A;  1NLO C;  4ZNX A;  4XU2 A;  2RHX A;  4JS5 A;  4M7D G;  1VOM A;  4HCB A;  1E6G A;  2H8H A;  3OY9 A;  3CCE T;  1OEB A;  4ME7 A;  5GAM g;  3OQ5 A;  4KRT A;  1GRI A;  5FU7 B;  1H3Z A;  1AHJ B;  4C92 E;  1AT1 B;  2EKO A;  1ZA1 B;  2LT4 A;  2MOX A;  3JB9 G;  4JRK A;  4ZTF A;  3GPL A;  5GAN j;  5KYU B;  5KYN A;  2VGN A;  1B07 A;  2NYS A;  4LE9 A;  4P5N A;  2DLP A;  3SDZ A;  1WXB A;  4XU0 A;  4O5V A;  1KD1 U;  1JQQ A;  1Y96 B;  2O88 A;  3I56 A;  4PFP A;  1RI0 A;  3DLM A;  3BDU A;  4E7I A;  3LH5 A;  2Y90 A;  1Y96 A;  1BKB A;  4QQ6 A;  1KQ2 A;  4PL6 A;  1G83 A;  2BE9 B;  2CT4 A;  4VUB A;  2E3H A;  3CCS Q;  2RQW A;  2X4Y A;  5GAN g;  4D6W A;  2EBP A;  2XG8 D;  5HY6 A;  4LN2 A;  4PFO A;  3JCM g;  4JRQ A;  3QG1 A;  4A4H A;  3SWN A;  4QQG A;  1RAA B;  1VQO A;  1M2V B;  1FMV A;  5ECA A;  1UFF A;  1ZSG A;  2DD4 A;  3OS5 A;  1NG2 A;  1A0N B;  1WYX A;  3E19 A;  1RAI B;  3QWY A;  2CSI A;  1Y07 A;  4F17 A;  4LUE A;  2DVE A;  3P8B B;  1C0M A;  1BB9 A;  1ZHI A;  3FJ5 A;  1AWX A;  3VRY A;  1ZUY A;  4M77 F;  3CME T;  4EMH A;  3GNF B;  2DXT A;  4JDS A;  3REB B;  1PRL C;  2BZY A;  1JRI A;  2CDT A;  4AG1 C;  1ZA2 B;  5DLO A;  2NUZ A;  2CP6 A;  8ATC B;  1D09 B;  3MEU A;  3CCE A;  2EFI A;  1YIT A;  4LDY A;  4QKU A;  2M02 A;  4C8Q E;  1O9S A;  1ZBX A;  2K4Y A;  2QYZ A;  4XTW A;  2R57 A;  2VAS A;  4AFS C;  4AFQ C;  4J9G A;  4AT1 B;  1XNI A;  2GF7 A;  2LT1 A;  3X20 B;  4PFZ A;  3E1S A;  4C8Q G;  1GCP A;  3I55 Q;  1TWB A;  2L89 A;  1BBZ A;  1TUG B;  3VS4 A;  4DOV A;  5GMK e;  1TU0 B;  4E47 A;  2BZ8 A;  3E9G A;  2DPP B;  6AT1 B;  4XAX B;  4M7A F;  2LNH B;  4J83 A;  2CH4 A;  3OYH A;  4A4G A;  4IUP A;  1G2B A;  3R6N A;  1AD5 A;  1MMA A;  2DBM A;  2QK0 A;  1Q81 R;  3JCM V;  3JCM b;  2M0O A;  5FRO A;  1J3T A;  5LJ3 e;  3G71 T;  1QVG S;  1VQP T;  2YDL A;  3JB9 F;  2CP3 A;  2CT3 A;  1M3A A;  3CCM Q;  3RNJ A;  3UA7 A;  1PC0 A;  1PKT A;  2QQR A;  2DIL A;  2RK2 A;  4BD3 A;  2HAX A;  1YWP A;  1R77 A;  5J26 A;  2EAY A;  2K5I A;  1M8M A;  3OYA A;  5A0L A;  2COY A;  1M1F A;  5CKD A;  1NJI R;  5GMK h;  4R56 A;  4EIK A;  2RO0 A;  3C4S A;  3PVL A;  2FRY A;  4HT9 A;  2HL3 A;  2PVG B;  3OYB A;  4MZP A;  3G71 Q;  4A53 A;  3URG A;  2E6Z A;  3CCL A;  1WI7 A;  1VQ6 Q;  1QCN A;  1PSE A;  3QHS A;  4KUL A;  2PQW A;  2ROL A;  1BCM A;  2GFA A;  3CMA Q;  3RUX A;  2QAZ A;  3OMC A;  1MUZ A;  2HCK A;  3M4G A;  4C0G A;  4DBR A;  2DYI A;  4HXJ A;  3VV0 A;  4M75 F;  2DET A;  3OSS C;  3V8J A;  2KDS A;  5FRN A;  2BTT A;  2EQK A;  1YJN T;  3UA6 A;  1OUL A;  2MF2 A;  5KYU A;  3L1A A;  3QDF A;  2L8D A;  4OP0 A;  4PJO B;  1Q82 U;  3CCR Q;  3CC4 A;  1VQL A;  3CC2 T;  1UTI A;  4M7A B;  4E7L A;  4RTZ A;  2WSF E;  2LQW A;  3M58 A;  4ZGJ B;  2JOY A;  5EC7 A;  3VS5 A;  3OYY A;  3CPW P;  1I4K 1;  3HFO A;  1FX7 A;  3CCJ A;  4JLG A;  4JS4 A;  3NTK A;  1U1S A;  4PJJ A;  4X9D A;  1F1B B;  3T9N A;  1JJ2 P;  2HSP A;  1TUD A;  4E7K A;  3G4S A;  3KUF A;  3H9N A;  1Y7X A;  1K0S A;  1X27 A;  4C92 C;  3BDL A;  3HHT B;  3OSV A;  1QP3 A;  2RMO A;  4N4I A;  4HCZ A;  4O6J A;  4Z02 A;  5DLQ E;  1BI0 A;  2K79 A;  3EGX B;  1W2B P;  4RTX A;  3OYJ A;  4PJO E;  5GAM j;  1QVG A;  1GCQ A;  3C0C A;  5GAN 3;  4N4H A;  3VU3 C;  2AHJ B;  2EGC A;  4V2S A;  2HEQ A;  3PVQ A;  3I9Q A;  4IIM A;  1Q81 U;  2J06 A;  4M7D B;  1NE8 A;  4IIO A;  1SRM A;  1C1A A;  2E6N A;  4B9W A;  4HA8 A;  1OX9 A;  4PJO F;  2NUP A;  3JB9 H;  2VC8 A;  3JCM W;  2XKO C;  3EG1 A;  3M53 A;  3JCM X;  4BI3 A;  3GNG A;  1TXQ A;  4Y92 A;  2EJG A;  1H3H A;  1VIE A;  1UEC A;  1BK2 A;  3SWN B;  3VS0 A;  3MO8 A;  4E2F B;  5FRM A;  5GAN e;  4LXC A;  4RTY A;  2DF6 A;  4LDV A;  1TSF A;  3FIF A;  2ZPF B;  3EHQ A;  1M1G A;  3CCV Q;  4LUD A;  3UT1 A;  4MDX A;  3L42 A;  2K3B A;  1UG1 A;  4M78 G;  4E7H A;  3DKM A;  2V1Q A;  5D6Y A;  1FWZ A;  4C92 F;  4J9I A;  1Q7Y C;  3I5R A;  1KQS A;  1XQH A;  3CC4 T;  2LDM A;  2DVJ A;  1Q95 G;  2RM4 A;  3C94 A;  3CCE Q;  5GMK l;  4F16 A;  2LP5 A;  1SHF A;  1JJ2 S;  4ESR A;  1D3B A;  1VQN A;  1OQK A;  1X6G A;  1YIJ Q;  1RAC B;  1VQM A;  2YUP A;  4C0D B;  2H3E B;  3CD6 A;  4BUG A;  5GAN 2;  2PNI A;  2IIM A;  2L5Q A;  3HRS A;  3J81 E;  2D0N A;  3I56 T;  2DEU A;  2K9G A;  1UGS B;  4EMK B;  3OW2 S;  1C6V X;  4JJD A;  3V7S A;  3RMS A;  5A0D A;  2FL7 A;  1K9M R;  4JJC A;  2RD1 A;  3CXC P;  2KK4 A;  3TVT A;  1B3Q A;  1K9A A;  2DZC A;  1VQN T;  1HD3 A;  2DMO A;  3A8L B;  2QQ9 A;  1NYG A;  3CC7 T;  4HVU A;  3M0T A;  1HXD A;  3RKY A;  2H3J A;  3NPF A;  3KFV A;  1GBQ A;  3IQL A;  3I55 T;  3F70 A;  1D0Y A;  5GAN 4;  3EFS A;  2DEQ A;  1OU8 A;  2ZPG B;  3X28 B;  2AZV A;  1WJR A;  2L2P A;  1B34 B;  3TEE A;  5I11 A;  2YLB A;  5DY9 A;  1BU1 A;  4JLI A;  3CC7 Q;  1UHF A;  2X3W D;  3FEO A;  1OV3 A;  3HRT A;  1SSF A;  4EMK C;  2W0Z A;  2DBK A;  3FJP A;  5KYW B;  3CC7 A;  2EW3 A;  1T0J A;  4A4E A;  4OGC A;  4PK4 A;  1LPL A;  3R6O A;  2HQX A;  1K76 A;  1HSQ A;  1FYN A;  1IRE B;  2EIF A;  4ZN3 A;  5FU7 C;  1VQL T;  3CC2 A;  1VQ4 Q;  1RI9 A;  1GFC A;  2QAS A;  3CCS T;  1SEM A;  1NM7 A;  4C92 B;  2F5T X;  2Z0W A;  2LCS A;  1BI2 A;  3M0Q A;  5LJ5 g;  2EGE A;  2KT8 A;  2E1H A;  4E7Z A;  1VQ6 A;  5GAO p;  1UDL A;  3O8V A;  2X4J A;  3LWI A;  1T3S A;  2CGH A;  4FSX A;  2YUN A;  5KCO A;  1QKX A;  3M0U A;  2FPF A;  4EDU A;  3CPF A;  1K9M U;  5CK9 A;  4QQD A;  1VQ8 Q;  4KUI A;  2HBW A;  1AWO A;  3QYH B;  2WSE E;  1VIF A;  1BYM A;  4DEX A;  3P8D A;  2EYY A;  3EHR A;  2QDY B;  2Y4X A;  4FU6 A;  4CRI A;  1T3L A;  5GMK m;  1NZ9 A;  2AKK A;  4RTU A;  1N9S A;  3MP1 A;  3JCM Q;  2RQV A;  4F7U A;  1EFN A;  4C0D C;  2XHC A;  2JM9 A;  2JMC A;  2HBP A;  1NLP C;  2O9V A;  3OW2 A;  2ZPI B;  1ZSZ C;  4PLL A;  1S72 T;  2DA9 A;  3BFM A;  2KRO A;  3I5S A;  2VKN A;  1ZUU A;  1Q81 C;  3RDV A;  3JB9 J;  3UPU A;  2V8K A;  3NHN A;  2HMA A;  2DL4 A;  2LTO A;  4HVV A;  3WVE B;  5CKB A;  5A2Q E;  3M4Y A;  1X2Q A;  3OYF A;  3REA B;  2GGR A;  2EWN A;  2COW A;  2DK3 A;  3CD6 Q;  1YHQ A;  2EQJ A;  1X2K A;  2OTL Q;  1JXM A;  1M9S A;  2E65 A;  3CCM A;  4LDX A;  2O2O A;  1UEB A;  2KRS A;  2QEX A;  2OAW A;  3VRZ A;  1Z9Z A;  1ZSZ A;  2JS0 A;  4J7F A;  3SFM A;  2LJ3 A;  4YTL A;  3H8Z A;  5KH6 A;  2X35 A;  5CR2 A;  2DJQ A;  4M7A G;  1XTD A;  2F1L A;  2L3S A;  3ZBD A;  1N8R C;  3VS2 A;  1YJW A;  4FW1 A;  2DRK A;  3M9Q A;  1SG5 A;  1K8A U;  4QVD A;  2E5Q A;  5KYY B;  5EG2 A;  1VQ7 A;  1Q82 C;  4N4G A;  2QEX T;  2MK5 A;  4E7J A;  3TSZ A;  5KYY A;  3OBY A;  5C0M A;  4OMF B;  4KUD K;  1G3S A;  1KHC A;  1UE9 A;  3CCU T;  3JV3 A;  2PTK A;  4M78 B;  3GLX A;  3MHX A;  2DFU A;  2GQV A;  5IHN A;  2V8I A;  1VQ9 T;  1NBE B;  4IKF A;  5IXF A;  1BCO A;  1MGQ A;  1X69 A;  2CH4 W;  1D1A A;  3JCM d;  2G3R A;  3ER0 A;  1M30 A;  1YCS B;  4M77 E;  4F7U F;  2FEI A;  1IZ6 A;  2XDD A;  4RCB A;  2DL3 A;  2SEM A;  1S1N A;  5DM7 R;  3PTA A;  3M56 A;  2E3I A;  3V7R A;  2M1H A;  3QBY A;  1WHK A;  2D8J A;  1Y71 A;  3KBG A;  1I07 A;  3EG9 B;  4PJM A;  3CCU Q;  2VV5 A;  2OI3 A;  2FZC B;  2A7Y A;  4F7U B;  1KIK A;  3CME Q;  4BDY A;  3UAT A;  4C5E A;  3CC4 Q;  3SD4 A;  3HPW A;  3ASK A;  2V8J A;  2CUB A;  1ARK A;  1ZUK A;  4M75 G;  1PWT A;  3NTH A;  3CCQ T;  4J9B A;  5CKH A;  4BE1 A;  4J9F A;  1W2B S;  2IPO B;  1VQ7 T;  5LJ5 h;  1UJY A;  4N0A C;  1WHH A;  4RTW A;  1W4S A;  5M9O A;  1JO8 A;  4M77 B;  3DLL A;  2ZPB B;  1YJW T;  3CPW S;  4J6W A;  2DRM A;  5I21 A;  3AT1 B;  2KBT A;  2RH2 A;  3OYD A;  4R55 A;  3A98 A;  1Q86 R;  4KT0 E;  3OMG A;  4OML A;  4UC4 A;  2D9T A;  3RKX A;  1QKW A;  1QLY A;  3CCV T;  3JCM J;  1VQL Q;  1ABO A;  1VQ4 T;  1X6B A;  4RKU E;  2J7I A;  4C8Q B;  2O4X A;  5D6X A;  1WGS A;  4PJO G;  1VYV A;  3FRN A;  3LX7 A;  4BY6 C;  1VQK T;  1B34 A;  2CZ1 B;  1AWJ A;  2FRW A;  3QDR B;  4ANJ A;  3MCA B;  1H64 1;  1OPK A;  2EGA A;  2LQ8 A;  1KD1 R;  1R8O B;  3CCR A;  3H0I A;  2QGG A;  1MMD A;  3PNW C;  4L59 A;  1AZE A;  5J39 A;  2JJ9 A;  1M3C A;  2YXY A;  3QKJ A;  1Z9Q A;  1YN8 A;  2VUB A;  2AIR B;  4BAC A;  3TSW A;  1YIJ T;  2QGF B;  1E6H A;  4M75 A;  2RA2 A;  4OVA A;  4DA4 A;  1VQ9 A;  4PJL A;  1YP5 A;  4J5Y A;  2MI6 A;  2ZCF B;  3RMQ A;  2Y4Y A;  3CCL Q;  5IT9 E;  2DKG A;  1U06 A;  2CS7 A;  3N5B B;  1RUW A;  3J7A F;  2F69 A;  4OMN A;  4ORZ A;  2DL5 A;  4M78 C;  4FIB A;  2DIG A;  4J9H A;  3PIO A;  5IAY A;  2DD5 A;  2RQT A;  4KGX B;  2FPE A;  3CCV A;  3MJX A;  2D0Q B;  4BY6 B;  2XD0 A;  4FT2 A;  3GP8 A;  2R5M A;  2L3R A;  5CCA A;  2KAF A;  5FLX E;  3A8O B;  2PZ1 A;  2FB7 A;  3SWN C;  2F2X A;  3QYG B;  4JZ3 A;  3CCL T;  2JMA A;  4M75 C;  2JN0 A;  4L6V 5;  2J6O A;  3FLG A;  3EG2 A;  5HCK A;  2NLU A;  4A63 B;  2PU9 B;  4M75 B;  1D0Z A;  4L5G A;  1N5Z A;  3MP8 A;  1IXD A;  2JS2 A;  3RR6 A;  4M77 G;  4M78 A;  2RJD A;  4PKC C;  1WQW A;  4ELZ C;  2X4W A;  1KD1 C;  5KYX A;  2ATC B;  3GBQ A;  4GBQ A;  1M1K U;  2L3P A;  1GL5 A;  5GMK i;  2X51 A;  2YRD A;  3SB2 A;  3I56 Q;  2FG0 A;  1HK9 A;  3X24 B;  4FSS A;  5LJ3 j;  2QXF A;  2QQA A;  3I55 A;  3HSB A;  4PJO C;  4C0F A;  2VB6 A;  1X01 A;  1NJI C;  3BW1 A;  3MEW A;  4A4F A;  2ROT A;  2JT4 A;  2E64 A;  1X43 A;  1K9M C;  1YNZ A;  2YRC A;  4MZM A;  3TQ7 P;  2ZAE A;  1VQ5 T;  1KC8 R;  4MML A;  4M78 D;  2XMF A;  1OI1 A;  2DZ9 A;  1VYU A;  1WXU A;  2MPX C;  1RAH B;  4F14 A;  1SPK A;  2M16 A;  3DB4 A;  2EYQ A;  2QA4 A;  1ABQ A;  1YIT Q;  3MP6 A;  4F7U E;  2DYB A;  1W6X A;  5LJ5 e;  4XTZ A;  1Q86 C;  4XTX A;  4C0Z A;  5CAI A;  4M7A D;  2VYT A;  5FWC A;  1WA7 A;  4ZN1 A;  5C6S A;  1RAE B;  3OB9 A;  5CKE A;  2DER A;  5GAN 6;  4HKE A;  4KH1 B;  1WNL A;  2K7A A;  2A36 A;  1TG0 A;  4B6M A;  2PUK B;  3MEV A;  4IUQ A;  3EG0 A;  4TVR A;  4Y91 A;  3X26 B;  1U8R A;  1YHQ T;  1OX8 A;  4X9C A;  4M4Z A;  2O9S A;  4WCI A;  5GAN 5;  1KFZ A;  3S3N A;  2DXB A;  2K5L A;  2RQU A;  1CKA A;  3M59 A;  1UUE A;  3OBW A;  2GTJ A;  1MHN A;  2M9U A;  4M77 D;  9ATC B;  2R58 A;  1VQ5 A;  3UWN A;  2K2M A;  2P0P A;  4Z89 A;  5LJ3 g;  2CP7 A;  2I2L A;  2JNG A;  4J6Y A;  4OGE A;  2EKH A;  2KYB A;  4AMC A;  2B8A A;  3OYN A;  1VQ8 T;  5FW9 A;  2P4R A;  3PIP A;  2JTE A;  2COZ A;  2V1R A;  4OB3 B;  3DB3 A;  4M7D D;  5GAM f;  3MEA A;  1LNX A;  2V26 A;  4OMP A;  2OTJ A;  3ZFJ A;  1X75 C;  1IGQ A;  1BIA A;  4GLM A;  1E7O A;  3E2U A;  5GAM e;  4RTV A;  1Q86 U;  1KC8 U;  3CXC A;  4CC7 A;  2O01 E;  4XU3 A;  2ZPE B;  2HKN A;  2LNV A;  2X4X A;  2FZK B;  2YT6 A;  2GTO A;  4KH0 B;  1PSF A;  4OF1 A;  1IO6 A;  3MPU B;  1SKU B;  1MV3 A;  4AG2 C;  2YSQ A;  2CYZ B;  1RAD B;  4ELY C;  2RI2 A;  2HQH A;  2LQN A;  1NJI U;  2X9H A;  1XJW B;  3C12 A;  5I2S A;  2YHT A;  1YHQ Q;  2RHI A;  1MNE A;  2O4X B;  3LLR A;  2PUO B;  3CD6 T;  3RBB B;  2KGT A;  1KQ1 A;  4EMG A;  3X25 B;  4OB1 B;  2DTO A;  2C0T A;  1UGR B;  5FWB A;  2LMJ A;  1M90 C;  3MET A;  4CI0 C;  1G3W A;  4J6X A;  1I81 A;  4J9E A;  1WHL A;  2VWF A;  5GAM h;  2DXC A;  3UF4 A;  4XTV A;  5GAO q;  2K5F A;  1QP2 A;  1WZO A;  4PNO A;  2RI5 A;  5I2M A;  2EPD A;  2J6K A;  4HT8 A;  4AFZ C;  2F2W A;  4BB7 A;  2HNI A;  2E4H A;  1I8F A;  3OW2 P;  3VYH B;  1QVF S;  3EFR A;  1XOV A;  3G6E A;  2ZGW A;  3OYL A;  4BI4 A;  4PLI A;  2RHZ A;  1VQK Q;  4HVW A;  3H6Z A;  1M5Q 1;  2KRM A;  4RCC A;  2YWW A;  1PD0 A;  2PVO B;  4CC2 A;  1Y57 A;  5IH2 A;  2RF0 A;  4JZ4 A;  5LJ3 d;  4DEY A;  3S3O A;  2KE9 A;  3TU4 K;  4DQ2 A;  1VQK A;  4HCC A;  5KCH A;  4FYY B;  4DBF A;  4RUG A;  4RMO A;  5FU6 C;  1UJ0 A;  5IN1 A;  3PE0 A;  1PNJ A;  1KK7 A;  5I22 A;  2J05 A;  3G6E Q;  1WLP B;  2DL8 A;  2HZY A;  3VS7 A;  3SHW A;  1PRM C;  3EH1 A;  3AHU A;  1M2O A;  1JU5 C;  1Q82 R;  1CKB A;  2EVR A;  4KGV B;  1VQM T;  1W2B A;  3THK A;  4ATO A;  2HSE B;  2M51 A;  1KQS S;  3CCJ Q;  2XK0 A;  1QW1 A;  2GFU A;  3JB9 I;  2EYX A;  1VYT A;  2DL7 A;  4FYW B;  1LOJ A;  1I0C A;  1R0C B;  3S3M A;  3JRZ A;  2O31 A;  1RLP C;  1H8K A;  1M4Z A;  2JZ2 A;  2XDB A;  3G6E T;  2X3X D;  2K3Y A;  1QVG P;  1D0X A;  3RKW A;  2JM8 A;  3JSC A;  2ED0 A;  3CCJ T;  1X6O A;  1LJO A;  5GMK j; 
#chains in the Genus database with same CATH homology
 2A28 A;  1UJY A;  4RTW A;  3NMZ C;  2HSP A;  1JO8 A;  1WIE A;  2DRM A;  3I35 A;  1TUD A;  2G6F X;  1SHG A;  2KBT A;  1AVZ C;  3H0F A;  2OJ2 A;  1LCK A;  3A98 A;  5GJW B;  1K0S A;  1K4U S;  2AZS A;  1YWO A;  1X27 A;  2KRN A;  4OML A;  3M0S A;  1QKW A;  1QLY A;  3VS3 A;  4JJB A;  4HCK A;  1ABO A;  2RMO A;  1U5S A;  1X6B A;  3VS1 A;  1M27 C;  2FO0 A;  2J7I A;  2K79 A;  4RTX A;  1VYV A;  2KEA A;  2LZ6 B;  4D8K A;  1H92 A;  1PKS A;  1AWJ A;  2FRW A;  1GCQ A;  4CC4 B;  3C0C A;  3H0H A;  1OPK A;  5L23 A;  2D8H A;  3EG3 A;  2EGA A;  2EGC A;  2HEQ A;  3H0I A;  3PVQ A;  3I9Q A;  4IIM A;  3VS6 A;  1AZE A;  2J06 A;  4IIO A;  2FPD A;  1T0H A;  1SRM A;  1M3C A;  1Z9Q A;  1YN8 A;  3EGU A;  1ZX6 A;  1JEG A;  1W1F A;  3TSW A;  2KNB B;  5IHI A;  3EG1 A;  1E6H A;  1UGV A;  1YP5 A;  2ENM A;  4Y92 A;  1WDX A;  2L0A A;  1H3H A;  2A37 A;  1K0X A;  1UEC A;  2BZX A;  1BK2 A;  2HDA A;  2J6F A;  3VS0 A;  4E6R A;  1U06 A;  1RUW A;  2EQI A;  2A08 A;  4OMN A;  4ORZ A;  2RN8 A;  3NGP A;  2DL5 A;  4CC3 A;  1RLQ C;  4RTY A;  2DF6 A;  1PHT A;  1UHC A;  1ZLM A;  4J9H A;  1WXT A;  3M0P A;  3EHQ A;  2RQT A;  4J9D A;  2FPE A;  2ED1 A;  4LUD A;  2K3B A;  1UG1 A;  1SRL A;  2KXD A;  2V1Q A;  4J9I A;  1AZG B;  3I5R A;  2PZ1 A;  2JW4 A;  2F2X A;  4LNP A;  2LX7 A;  2LJ1 A;  4JZ3 A;  2VVK A;  2JMA A;  2DVJ A;  5IXB A;  2ECZ A;  2J6O A;  1WFW A;  1U3O A;  3EG2 A;  5HCK A;  2DNU A;  4F16 A;  2LP5 A;  2M0Y A;  1SHF A;  3M0R A;  4A63 B;  4ESR A;  1N5Z A;  2GBQ A;  2JS2 A;  2KYM A;  4RTT A;  1OPL A;  1X6G A;  1AWW A;  4R0K A;  2YUP A;  4GBQ A;  3GBQ A;  2L3P A;  2PNI A;  1NEG A;  3QWX X;  1GL5 A;  2IIM A;  1GBR A;  1JXO A;  3SEM A;  2D0N A;  2NWM A;  2FG0 A;  2CRE A;  2K9G A;  4FSS A;  4JJD A;  2CUD A;  1KSW A;  2KXC A;  1VA7 A;  4JJC A;  4J9C A;  2MIO A;  2L3Q A;  3TVT A;  2ROT A;  2JT4 A;  2AK5 A;  1X43 A;  2ABL A;  2KT1 A;  1B3Q A;  1K9A A;  1YNZ A;  3ZL7 C;  1HD3 A;  2YUO A;  2DMO A;  1GCQ C;  1NYG A;  2YUQ A;  2XMF A;  3ULR B;  4HVU A;  1VYU A;  1WXU A;  2RPN A;  1NLO C;  4D8D A;  3M0T A;  4ZNX A;  1SPK A;  4F14 A;  4Z88 A;  3NPF A;  3KFV A;  1ABQ A;  1GBQ A;  2JXB A;  1E6G A;  2H8H A;  3IQL A;  2DYB A;  1W6X A;  1OEB A;  4KRT A;  1GRI A;  5FWC A;  1WA7 A;  2AZV A;  2MOX A;  1M3B A;  2L2P A;  5I11 A;  1BU1 A;  1UHF A;  2X3W D;  1B07 A;  1OV3 A;  2K7A A;  4LE9 A;  2A36 A;  2W0Z A;  2DBK A;  1TG0 A;  2DLP A;  2EW3 A;  1WXB A;  1T0J A;  2RQR A;  2D1X A;  1ZBJ A;  1JQQ A;  4QT7 A;  1K76 A;  3EG0 A;  2O88 A;  1QWF A;  1HSQ A;  1FYN A;  3LH5 A;  4OMO A;  4M4Z A;  2O9S A;  1G83 A;  4WCI A;  1RI9 A;  1GFC A;  2CT4 A;  1SEM A;  1KFZ A;  1NM7 A;  1AEY A;  2LCS A;  2RQU A;  2RQW A;  2E5K A;  3M0Q A;  2EGE A;  2KT8 A;  1CKA A;  2EBP A;  1TUC A;  1UUE A;  4LN2 A;  2GTJ A;  1UDL A;  3O5Z A;  1T3S A;  2K2M A;  5ECA A;  2YUN A;  1UFF A;  4Z89 A;  1QKX A;  3M0U A;  2FPF A;  2DX1 A;  1ZSG A;  1NG2 A;  2EKH A;  2KYB A;  1A0N B;  1WYX A;  5FW9 A;  2P4R A;  1WX6 A;  2JTE A;  3QWY A;  2CSI A;  2V1R A;  4F17 A;  4LUE A;  2HBW A;  1AWO A;  1GFD A;  2K6D A;  4OMP A;  2B86 A;  1BB9 A;  4DEX A;  3FJ5 A;  1AWX A;  2EYY A;  3EHR A;  3VRY A;  1ZUY A;  1T3L A;  3REB B;  4GLM A;  1PRL C;  1E7O A;  2BZY A;  2AKK A;  4RTU A;  4RTV A;  2RQV A;  2CDT A;  2ESW A;  4AG1 C;  2NUZ A;  1EFN A;  2MCN A;  4CC7 A;  2JM9 A;  1SSH A;  2JMC A;  1NLP C;  2O9V A;  2YT6 A;  2GTO A;  2GNC A;  2DA9 A;  1NEB A;  4AFS C;  1IO6 A;  4AFQ C;  1MV3 A;  4J9G A;  4AG2 C;  2KRO A;  3I5S A;  2VKN A;  1ZUU A;  2YSQ A;  2EYW A;  1KJW A;  3NHN A;  4OMM A;  2LQN A;  4X1V A;  1GCP A;  2DL4 A;  4HVV A;  1BBZ A;  1X2Q A;  3VS4 A;  3REA B;  2GGR A;  3RBB B;  2KGT A;  2BZ8 A;  1X2K A;  2LNH B;  1I1J A;  2C0I A;  1NYF A;  1JXM A;  2CSQ A;  2W10 A;  5IHK A;  2CH4 A;  2C0T A;  5FWB A;  2LMJ A;  1G2B A;  3R6N A;  1AD5 A;  2O2O A;  4J9E A;  2DBM A;  2VWF A;  2KRS A;  2AKL A;  2OAW A;  1J3T A;  5GJV B;  1Z9Z A;  3UF4 A;  3VRZ A;  2YDL A;  2JS0 A;  2CT3 A;  2EPD A;  2J6K A;  4OMQ A;  2LJ3 A;  4AFZ C;  2F2W A;  1M3A A;  2DJQ A;  3RNJ A;  2RNA A;  1PKT A;  3UA7 A;  2L3S A;  2DIL A;  3VS2 A;  1XOV A;  1YWP A;  3H41 A;  1HJD A;  1FMK A;  2DRK A;  2SRC A;  1M8M A;  4HVW A;  2KRM A;  4CC2 A;  3CQT A;  1Y57 A;  4EIK A;  5IH2 A;  3PVL A;  2RF0 A;  3TSZ A;  4JZ4 A;  1V1C A;  2FRY A;  4DEY A;  2KE9 A;  1UE9 A;  3JV3 A;  2PTK A;  1WI7 A;  4RUG A;  5IHN A;  1UJ0 A;  1MV0 B;  5IXF A;  3PE0 A;  1PNJ A;  1X69 A;  2ROL A;  2CH4 W;  5I22 A;  2J05 A;  1WLP B;  4AFU C;  2DL8 A;  1OOT A;  3VS7 A;  1M30 A;  3SHW A;  1YCS B;  2DM1 A;  1PRM C;  2DE0 X;  1MUZ A;  1JU5 C;  2FEI A;  2HCK A;  4HXJ A;  1CKB A;  2DL3 A;  2SEM A;  1S1N A;  2EVR A;  3U23 A;  2F2V A;  1Y0M A;  3THK A;  2I0N A;  4K11 A;  2M51 A;  2BTT A;  2D8J A;  3UA6 A;  1AOJ A;  2C0O A;  1I07 A;  2EYX A;  1VYT A;  2LJ0 A;  2DL7 A;  1I0C A;  1K1Z A;  2OI3 A;  1KIK A;  2O31 A;  1RLP C;  3UAT A;  1CSK A;  1H8K A;  1UTI A;  2GQI A;  2X3X D;  2CUB A;  1W70 A;  4RTZ A;  1ARK A;  1ZUK A;  2LQW A;  1QCF A;  1PWT A;  5EC7 A;  1QWE A;  3VS5 A;  2QDL A;  2KR3 A;  4J9B A;  2EYZ A;  4J9F A;  2JM8 A;  2ED0 A;  4Z8A A;  4JPB W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...