1X69A

Solution structures of the sh3 domain of human src substrate cortactin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
GSSGSSGTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cortactin isoform a
publication title Solution structures of the SH3 domain of human Src substrate cortactin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x69A00
1K76A 2LQWA 1NEGA 4Z89A 5IHKA 4JJBA 1UHFA 2RN8A 4F14A 2LJ3A 1K9AA 4OMMA 1MUZA 4Z88A 4HVWA 4LNPA 2A36A 1ZSGA 1ZX6A 2HSPA 3VS4A 1K0SA 1ARKA 2EGAA 3M0SA 2KRSA 4ORZA 4OMOA 2VKNA 3NMZC 1OOTA 2D1XA 1M3CA 1X69A 1TG0A 3EGUA 4J9FA 2HDAA 2LZ6B 1YWPA 3U23A 1QKWA 2O31A 2VVKA 1AWXA 2MIOA 1AVZC 1GCQC 2A37A 2O9VA 2YUNA 2KYMA 2FPDA 2EKHA 2LMJA 1VYTA 2YUQA 2DL7A 1WDXA 1YN8A 2KE9A 1X43A 3KFVA 1JO8A 1H3HA 2JTEA 1PNJA 2P4RA 4EIKA 2K9GA 3ZL7C 2QDLA 5FWCA 4J9GA 4OMPA 2DVJA 1JU5C 1ZUYA 2W10A 3LH5A 5ECAA 3UA7A 2JM8A 1HSQA 5IHIA 2ED0A 2FEIA 1BU1A 1WA7A 4F16A 1PHTA 1SHGA 2DBKA 1CKAA 1E6GA 1UHCA 1WI7A 2AZVA 4AFQC 4CC7A 2YT6A 4LE9A 3REAB 2JMAA 1OPLA 1JXMA 1BK2A 1IO6A 2K6DA 2JM9A 2ROLA 2O88A 4E6RA 1W6XA 1K1ZA 2OI3A 4D8DA 2JMCA 1M3BA 1M27C 4AFSC 2BZYA 4FSSA 1JQQA 2DNUA 1SPKA 4A63B 2HCKA 2FPEA 1T3LA 1WXUA 1OEBA 1M30A 1V1CA 1AWJA 2EVRA 2RNAA 2CUBA 2D0NA 1AEYA 2HBWA 4LN2A 1T3SA 4HCKA 4OMLA 1NYFA 4JJCA 1AOJA 3QWXX 2KBTA 4IIMA 3VS5A 2KT8A 2CT4A 2RQUA 5FWBA 2A28A 2J6KA 2C0IA 2K3BA 2EYWA 2JS0A 2OAWA 1GBQA 2RQWA 2PZ1A 2ESWA 1MV0B 1ZLMA 1RUWA 1HJDA 1KIKA 1A0NB 1GBRA 2F2VA 2JS2A 1UE9A 4K11A 4J9HA 2I0NA 2A08A 3I5SA 1J3TA 2VWFA 3VS6A 4LUEA 4JZ4A 1ABQA 2GBQA 2KROA 4RUGA 2NWMA 4RTYA 1YP5A 2FRWA 3TSZA 2O2OA 3VS0A 2LJ1A 1KSWA 2KRNA 1SEMA 1UG1A 2GQIA 2DLPA 4D8KA 3UF4A 1SSHA 4JPBW 2FO0A 2DL5A 4RTUA 3UATA 4OMQA 2AKKA 4J9IA 2BTTA 2F2WA 2DA9A 1AZGB 4X1VA 1B07A 4RTZA 1VA7A 3H0IA 2CDTA 1ZUUA 2DRKA 1UJ0A 2SRCA 2RQVA 2ED1A 4CC3A 4Z8AA 1WXTA 3IQLA 4RTWA 2PNIA 2LCSA 1FYNA 2C0OA 3H41A 3GBQA 3EG0A 3NGPA 2KXDA 2B86A 4RTTA 4J9CA 1I0CA 2SEMA 2AK5A 1GCQA 2L3QA 3H0FA 1WFWA 1N5ZA 1KJWA 1H92A 5IHNA 2X3WD 2KRMA 1U3OA 2M0YA 1RLPC 3M0UA 4F17A 3TSWA 1AWWA 1X6GA 2D8HA 4M4ZA 1PKTA 2RF0A 2F2XA 1K4US 3JV3A 2HEQA 1OPKA 2G6FX 4QT7A 4J9BA 2DYBA 2EBPA 2L2PA 1X2QA 5IXBA 4JZ3A 1UECA 2E5KA 2DF6A 4R0KA 1X27A 2JT4A 1TUDA 2J7IA 2AZSA 4RTXA 1YWOA 1VYUA 1ZBJA 2KGTA 1UTIA 4J9EA 4LUDA 3R6NA 2FG0A 2J05A 2J06A 2FRYA 4GLMA 2ENMA 1GCPA 2CREA 1PWTA 3M0RA 1AD5A 1SHFA 2DE0X 1WLPB 5GJWB 3SEMA 3VRYA 1NG2A 2KR3A 1NEBA 4J9DA 1UUEA 1BBZA 3M0TA 2X3XD 1G2BA 1NLOC 3EG2A 2DRMA 3ULRB 1GL5A 2XMFA 1CKBA 5L23A 1H8KA 1PRLC 2JW4A 4OMNA 2KXCA 1EFNA 2CSQA 3I35A 3VS7A 1WYXA 1VYVA 4Y92A 3VS1A 1U06A 1HD3A 5IXFA 2EGCA 1UJYA 2O9SA 1ABOA 3TVTA 1E6HA 2BZ8A 1T0JA 1WXBA 2CT3A 4HVUA 4AFUC 2RQTA 2AKLA 2MOXA 1W1FA 1UFFA 1YNZA 1GFDA 2RQRA 1QCFA 5I11A 5EC7A 1W70A 1X6BA 2BZXA 2EPDA 2L3SA 3CQTA 2GTJA 3THKA 1I07A 2ROTA 2RMOA 4CC4B 2ECZA 2DILA 2LP5A 3REBB 2DBMA 2H8HA 1WIEA 1JXOA 2YUOA 3VS3A 1G83A 1QLYA 1PKSA 2EYZA 1M3AA 2KYBA 3H0HA 2EW3A 1X2KA 2PTKA 4WCIA 3O5ZA 2DL3A 3NPFA 4KRTA 4ESRA 2J6FA 2KNBB 2GNCA 4AG2C 2V1RA 2K79A 2LX7A 3C0CA 1NYGA 4HXJA 1KFZA 1GFCA 2CH4A 1RLQC 2LJ0A 5IH2A 1Z9ZA 1I1JA 3EG3A 2KT1A 2GTOA 2D8JA 2YSQA 1B3QA 1SRMA 5I22A 1QKXA 2CH4W 3SHWA 2CUDA 3EHQA 1GRIA 4HVVA 4JJDA 2DX1A 2IIMA 5FW9A 2YDLA 2JXBA 2LQNA 1PRMC 2YUPA 2DJQA 1AWOA 3A98A 2J6OA 3NHNA 2EYYA 2C0TA 1NM7A 1QWEA 1AZEA 2DL8A 3EG1A 2L0AA 1Y57A 2KEAA 4IIOA 4RTVA 3M0PA 1FMKA 4DEYA 1U5SA 1XOVA 1S1NA 3PVLA 2CSIA 3I5RA 3PVQA 1BB9A 1ZUKA 2GGRA 2ABLA 4DEXA 1CSKA 1TUCA 3UA6A 1Z9QA 2L3PA 4CC2A 3EHRA 2V1QA 4AFZC 1OV3A 3I9QA 2EYXA 4AG1C 1YCSB 2DL4A 1K0XA 3PE0A 4ZNXA 2DMOA 3VS2A 3M0QA 3RBBB 2FPFA 1LCKA 1MV3A 1SRLA 3FJ5A 1M8MA 1UDLA 2DM1A 1T0HA 2MCNA 1Y0MA 2W0ZA 2RPNA 1QWFA 2M51A 2OJ2A 2NUZA 1WX6A 4GBQA 1JEGA 2K2MA 1UGVA 5GJVB 3VRZA 2K7AA 2EQIA 5HCKA 3RNJA 1NLPC 1RI9A 2EGEA 2LNHB 3QWYA 1E7OA
chains in the Genus database with same CATH superfamily
3M9QA 1K76A 2LQWA 1NEGA 4Z89A 5A0DA 5IT9E 5HK0A 1M2VA 5KYYB 4M7AA 1ZSGA 1MMAA 3JSCA 3M0SA 5GAOm 4X34A 3OS2A 4FM4B 1WGSA 2ATCB 2YRDA 3HRSA 4ORZA 2VKNA 3NMZC 3E2UA 1KC8U 4XTZA 3BY7A 1M1KU 4J9FA 2F5TX 3U23A 1QKWA 2O31A 2YLBA 1GCQC 2A37A 2HQHA 2QQSA 2YUNA 2MAMA 4ZGEB 4A4HA 1VYTA 2KE9A 3M57A 4PJOB 1WQ7A 4D6WA 4EIKA 3ZL7C 1D1AA 2QDLA 4KGZB 4OMPA 4NL2A 3LH5A 3UA7A 1OZ2A 3CMEA 2ED0A 1BU1A 1QVPA 3EAEA 1WA7A 1PHTA 1VUBA 4C92F 3HTRA 1CKAA 1E6GA 1UHCA 3VKIA 3FB9A 1VQ7T 3CCUT 3GF5A 4QQ6A 1JXMA 1D0ZA 1IO6A 3EH2A 2MPXC 1K8AC 2O88A 2OI3A 4D8DA 2RO0A 3M4GA 2JMCA 5KYNA 2HAXA 2CP5A 3KXTA 1JQQA 2DZ9A 3MO8A 5GANe 1BCOA 4KUIA 1IGQA 2ZAEA 1VIEA 1X01A 2FPEA 3G4ST 3C95A 4C8QC 1QW1A 2EVRA 5A0LA 1QP2A 3FEOA 5D6YA 1WQWA 3CCST 3JCMb 4C92A 1T3SA 1QVGA 2GFUA 4JJCA 4M7DD 1AOJA 1M1GA 1PCXA 2DXCA 4IIMA 3VS5A 3CC2A 2QGFB 2RI3A 2VV5A 2K3BA 2JS0A 3CCRA 3CCET 3M5AA 2PZ1A 4N4IA 2ESWA 3EGDA 2MYSA 2JVVA 1MV0B 4IUUA 5CKDA 3CCUQ 1GBRA 1UE9A 2L89A 4MDWA 4J9HA 3MP1A 4LUEA 4A53A 1D3BA 2KROA 3GNFB 5FRMA 1KG1A 5GAN2 3VS0A 1EZZB 1KSWA 1UG1A 1KQ1A 3UF4A 2JN0A 3L2ZA 1VQPQ 4J83A 3URGA 2BTTA 3MCAB 2COWA 2F2WA 3G4SQ 2LDMA 3FIFA 4M75E 3H0IA 2QYZA 1DJ7B 2ED1A 3JB9D 2EWNA 4RTWA 3H41A 3GBQA 4NOYA 5C0MA 2OTJA 2R5AA 4HCBA 2B86A 3N5BB 1GCQA 2L3QA 3H0FA 1SSFA 3VUZA 3ASKA 1U3OA 1JJ2A 3E9GA 4M77D 3TSWA 1AWWA 2D8HA 5KYUB 4C0DC 3DB3A 3X20B 2RF0A 2R58A 2F2XA 3A8GB 3JV3A 2G6FX 4J9BA 2M16A 1B34A 3QZ9B 1ZBXA 1RI0A 2X51A 1RAFB 4M75B 2E5KA 2DF6A 1BI2A 1X27A 1TUGB 2GF7A 3UT1A 1JJ2P 2J7IA 3TEEA 1VQPA 5LJ3g 3CMAT 2WSFE 4RTXA 5LJ5f 4ZTFA 1K9MR 3V8KA 2KGTA 2FYKA 4J9EA 4JLIA 3CD6A 3F70A 1FMWA 2C06A 3M0RA 2CREA 4LD6A 4NL3A 4M7AD 1AD5A 4KUDK 2DE0X 2JJ9A 1Q81C 4FW2A 2E3HA 3CCLT 3OB9A 1NEBA 1VIFA 2EYQA 3OA6A 1UUEA 1BBZA 1G2BA 5HY6A 2QA4T 3LWHA 1GL5A 1D0XA 3JB9I 5L23A 1YITQ 3OW2A 1IZ6A 1YIJA 1PRLC 2JW4A 2XU8A 4C8QA 1NJIC 4F7UA 1D09B 1SKUB 3PMTA 2JZ2A 2HL5C 1Y7XA 1HD3A 3OSVA 2RHZA 4DBQA 1MNEA 2BZ8A 2CT3A 1VQ9T 1UGPB 2RK1A 1WHMA 3A5ZB 4L5GA 2DO3A 1VQ6Q 2E5QA 2LRQA 2MOXA 1W1FA 3CPFA 2KK4A 5LL6S 1GFDA 1QCFA 3L1AA 2XICA 1OX9A 3OW2P 4O5VA 1Q82U 5EC7A 2QG9B 2E4HA 3HFOA 2M0OA 4DQ2A 3THKA 3CQTA 1V29B 4RMOA 1I07A 2V8KA 1X75C 2LP5A 1WHJA 2DBMA 2H8HA 1WIEA 2VUBA 2VXEA 2EYZA 3MEVA 1W2BS 3H0HA 2EW3A 4LDYA 3CCLQ 2VB6A 4KRTA 3LGFA 3OS1A 2V1RA 2LX7A 1LNXA 2DERA 1KFZA 3BE3A 1B34B 2LJ0A 1Z9ZA 4OMFB 3OYAA 2YSQA 1YITA 1B3QA 3S6WA 3GP8A 4HT8A 1YJWT 3P8HA 1GRIA 2DJZA 4HVVA 1LJOA 2RD1A 4JJDA 3RIRA 1VQ9Q 3QSUA 5FW9A 2JXBA 2LQNA 4PJOC 4OB2B 2DPPB 4C92D 5GAN5 3M55A 1VQ6A 2MI6A 1UEBA 2EYYA 3MP6A 1AZEA 2DL8A 3JCMd 4HCCA 1Y57A 3CXCS 4XU3A 4QQDA 3CBMA 4XTXA 3CCVQ 1YI2Q 3PGGA 2Z0WA 4FT4A 3EG9A 3MPUB 4C8QB 4LDXA 3JAME 2OTLA 4QW2A 1WPYA 2CSIA 4M78E 3UA6A 5LJ3e 2MMPA 4HCZA 2M02A 4BE1A 1OV3A 3OSSC 3OYMA 2IVWA 2YRVA 2VXFA 1VQNQ 4CI0C 3QYGB 5GMKj 5DLOA 1M8MA 1UDLA 1IHVA 1VQ8T 2W0ZA 2RPNA 1WHHA 3VJPA 2LT1A 4A54A 2D6FA 1K73U 2XIDA 2XDPA 3L42A 2LT4A 2ZGWA 1B7TA 1TTHB 2EQIA 5DY9A 3RNJA 2RM4A 2NYSA 4M78B 2P0PA 2GFAA 4JJBA 1UHFA 4ZGDB 2ZPHB 4F14A 1K9AA 1WHLA 3CCVA 1YI2A 2A36A 2EGAA 5D7UA 1K8AR 4KGVB 2V26A 1I4K1 1X69A 2DVEA 3EGUA 2LZ6B 2R5MA 1AWXA 2MIOA 2PUOB 4PJOF 3J7AF 2O9VA 5KYYA 1JB0E 1NPRA 1VQ8Q 2EKHA 5EG2A 5GAMh 2KQWA 2YUQA 3P8DA 2DL7A 2LTOA 3INZA 3CC7Q 1YN8A 3KFVA 4FCYA 2DAQA 1N27A 1JO8A 2LX9A 1XTDA 1H3HA 4ANJA 1G3TA 1Q81U 1R77A 1HXDA 2K9GA 2NLUA 5FWCA 3QBYA 2DVJA 1RAAB 4M77F 4PL6A 5ECAA 2DD5A 2JM8A 5IHIA 2P0KA 3LX7A 2RI5A 4JRKA 4C8QD 1SHGA 3CC4T 1VQOQ 1NJIU 4PJMA 1WI7A 2AZVA 2RJFA 1MGQA 4AFQC 3CPWS 4V2SA 3REAB 4Q5WA 1OPLA 4PJOA 2RHXA 5J39A 4XU0A 4FIBA 4XTUA 1MNDA 3DLMA 1G3SA 3M53A 1S72Q 4PFOA 4AFSC 4M75C 5CKEA 1WNLA 1SPKA 2CP3A 4OB1B 3LW5E 4JRQA 1YJ9T 4OGCA 1V1CA 1AWJA 4AMCA 2RB6A 4JUVA 2K3XA 2CKKA 2D0NA 2R57A 3QIIA 3CC7A 4ZGJB 2PU9B 2EQMA 3C94A 2V8IA 4J7IA 2LQKA 2O01E 1XJWB 3QWXX 4BI8B 1M9SA 2KBTA 2KT8A 2CT4A 5J3BA 3FC3A 2RQUA 5FWBA 2A28A 2J6KA 1QQJA 3RDVA 3SWNB 5FLXE 1ZQ1A 2QASA 1ZLMA 1VQOA 1KIKA 3A1PA 2F2VA 1W4SA 2JS2A 4BY6B 2CP6A 4K11A 4J5YA 4PLLA 1JRIA 2JUFA 2A08A 3Q1JA 3VS6A 1W2BA 2X4YA 4JZ4A 5GANd 4RUGA 4RTYA 3CC2T 2HKQB 1NBEB 3TSZA 2O2OA 4YTLA 3CCRT 4LD9K 2VGMA 2DL5A 2AKKA 2ZCFB 2RJDA 3A8HB 2NUPB 1YCYA 2DIQA 4RTZA 5GAOr 3HSBA 1VA7A 3CCJQ 1ZUUA 3I55T 3UDCA 3A8OB 2AHJB 4FYXB 2SRCA 2RQVA 1YBYA 3IQLA 2PNIA 4Y91A 3G7ZA 2E6NA 3QUIA 5GMKm 1LVKA 2EAYA 2SEMA 2AK5A 5HKCA 1Q82C 1G3WA 3H6ZA 4E7JA 2VASA 1NJIR 1TS9A 1WFWA 1N5ZA 5AT1B 3R6OA 5IHNA 2KRMA 4N0AC 3CXCA 4M75F 1WHKA 2CZ0B 2OTJT 1K4US 5D6WA 4BDZA 3DKMA 2DYBA 1VQLT 4P5NA 4HT9A 2LNVA 2L2PA 2CZ1B 3AT1B 4M7DG 1UECA 2JT4A 5KE3A 4E7ZA 1MHNA 4PKCC 3EGXB 4PNOA 5KYUA 3RESA 1VYUA 4JJNK 4LUDA 3R6NA 2IG0A 3AHUA 3OYLA 2J05A 2J06A 4GLMA 3QKJA 2RJCA 1U1TA 5LJ5g 1SHFA 1WLPB 1HK9A 3RR6A 1WJRA 3SEMA 4C5EA 3JCMJ 1N8RU 4KGXB 1H3ZA 4M75A 1ZHIA 1XQHA 1OX8A 3EG2A 1NLOC 3S3NA 3JCMQ 2DRMA 1AT1B 1QCNA 3ULRB 1RAHB 1VQ5T 1CKBA 2QQAA 4OB3B 4PFZA 3CD6T 4DBHA 1R0BG 1XNIA 3QHSA 3M56A 4OMNA 2KXCA 2F69A 2CSQA 1PD1A 4XTWA 1WYXA 3VUBA 4Y92A 4RCCA 5GAN8 5IXFA 1VQ7Q 1VQLQ 5CO7A 1QVGP 3KUFA 1WXBA 3EFOA 4HVUA 2CZ6B 5C6SA 3JB9G 1KC8R 3LGLA 1YJNT 1M1KR 2K5IA 5FU7B 5A2QE 2M1HA 2BZXA 4M78C 2RMOA 4PLIA 2LVMA 1D0YA 2RA2A 2HD0A 2DILA 5I21A 3TQ7P 3VS3A 1BKBA 3OS0A 1HYOA 4BI3A 1PKSA 2E3IA 4M77G 2H3JA 2VGNA 3FLGA 4PJOD 3CCSQ 1X2KA 1K73C 4FL6A 1IGUA 2DL3A 2HNIA 1IXDA 3G6ET 5CIUA 3EFSA 4JS5A 4AG2C 4HXJA 2HZYA 1GFCA 5IH2A 4GLKA 3ME9A 3EG3A 2GTOA 2X4XA 4DA4A 5KYXB 4JRIA 4BUGA 3CCEQ 3OYNA 1QKXA 1TSFA 1RACB 2GQVA 3OBWA 3CPWA 3PTAA 2IIMA 1VQ7A 3CCUA 3RKYA 4RG2A 4MDXA 4M7AG 1WJQA 3LWIA 3A98A 2J6OA 1YJNQ 4WF2A 3E1SA 3NHNA 3M58A 1QWEA 4BI4A 4C8QF 4F7UF 3MEWA 4PJNA 3TU4K 1Q86C 3BDLA 5GANj 3M54A 4N0AA 3HRTA 3ER0A 4IIOA 1OYXA 4RTVA 5GAOl 1UGQB 3HP9A 1FMKA 3RMSA 3A8LB 4C5IA 3G4SA 2P84A 1U5SA 2XKOC 1XOVA 2RK2A 3PVLA 2DFUA 2EJGA 1ZUKA 2GGRA 1TUCA 4Z02A 2DIGA 4CC2A 3EHRA 4AFZC 3EFOB 2EYXA 1VQ4T 3GOXA 2YLCA 1PM3A 1K0XA 1Q7YU 2ZPEB 5LJ5e 3VS2A 2FPFA 4DBRA 1MV3A 1SRLA 3CCEA 2CYZB 2OTLT 2L8DA 2DM1A 1RADB 2DYIA 5GMKl 4JS4A 5AYFA 1TXQA 4GBQA 4M78F 4II1A 1KD1U 4QQGA 5GAMg 3M4YA 5GJVB 3VRZA 2ZPIB 1RI9A 2EGEA 2LNHB 3SWNC 3H8ZA 3QWYA 3OYKA 5KH6A 5LJ5h 2WSEE 4KBMB 2ZZDA 3OYBA 3CMAQ 4HA8A 2B8AA 4KULA 5LJ3d 4FYVB 2K2VA 2LJ3A 4BY6C 2DTIA 4Z88A 2I2LA 4HVWA 1K0SA 1ZX6A 3VS4A 1ARKA 3MEAA 3PNWC 3JRZA 3P8BB 4PK4A 3SFMA 4B9WA 4C92G 1OOTA 1VQ4Q 2HDAA 2QA4Q 2XD0A 5GMKh 2DK3A 4M78A 3WVEB 4E7KA 1IHWA 4A4FA 2K57A 3FJPA 3FDRA 2L3RA 2EKOA 1C6VX 3RMQA 3BW1A 2KI7A 3D7SB 1WDXA 1X43A 5J26A 1UGSB 2EJ9A 2JTEA 4EMKC 1M5Q1 1PNJA 2P4RA 2NUTB 4M75D 3SD4A 1RAIB 2K5FA 1JU5C 2W10A 1VQMT 3T9NA 4QVDA 1HSQA 2FEIA 1I5OB 2KVQG 4J6YA 4PJJA 3CMAA 2YT6A 2XI9A 4FYWB 3CCQT 3HHTB 2DETA 4IURA 2QEXT 4B6MA 1BYMA 5I2SA 5LJ3f 1LOJA 3CCLA 1N9SA 1OU9A 3L2RA 1BIBA 4LDVA 4FSSA 2DNUA 3I56T 1IRXA 2X4JA 2XDDA 2QA4A 3RKXA 4A63B 5FROA 4BACA 2A7YA 3BDUA 1T3LA 1PSEA 1ACMB 4ZN3A 4JLGA 3NFCA 1YJWQ 2HKNA 3HRUA 3HKSA 1O75A 2D0QB 1AEYA 4HCKA 4OMLA 3G71T 1VQ9A 1M90C 4IKFA 3OS5A 2E70A 3GNGA 2CP0A 4DBFA 1Q82R 4QKUA 1GXIE 2V8JA 2C0IA 3CCMT 5A0GA 4Y28E 4LDWA 1MMGA 5GAN3 3LYIA 5GAN7 2DXBA 2RQWA 4FT2A 1HJDA 1U8RA 2CGHA 1VQKT 5M9OA 3RKWA 1FMVA 5GAMe 1J3TA 2VWFA 3JCMf 2K4YA 2GBQA 2NWMA 1N8RC 2FRWA 1YHQA 3TREA 3SDZA 2LJ1A 2KRNA 3TCJA 5FU7C 2GQIA 2FZCB 2DLPA 2HL3A 3SWNA 4D8KA 3C12A 1YHQT 4L59A 1SSHA 2EIFA 4DOWA 3I56Q 4RTUA 2FVUA 2DKGA 3JB9J 1Q86U 4J9IA 1KK7A 3OYJA 2H3EB 3H9NA 4MZTA 4OF1A 4X1VA 5CQYA 1VQNA 3PIOA 1B07A 1G8XA 2QI2A 2CDTA 3QJ6A 4X9DA 1OQKA 1YJWA 4UC4A 4OVAA 4CC3A 4Z8AA 2Y4YA 3FRNA 3EH1A 1D1CA 1M2OA 1FYNA 3WVDB 3G71Q 2KSSA 3NGPA 3E19A 2KAFA 4ELZC 3CEYA 4RTTA 1I0CA 3CCMQ 1ZA2B 2NUPA 3ZFJA 3OBYA 2BE7D 2X3WD 2M0YA 1RLPC 4F17A 1X6GA 1PKTA 1KHIA 2HEQA 1OPKA 4EMKA 2CS7A 2D9TA 1KHCA 5GAOq 2MK5A 1OULA 1X2QA 5LJ3j 5CKFA 3CMET 4BD3A 4PJLA 1N6AA 4R0KA 2Y90A 1OZ3A 1TUDA 3JB9H 3QG1A 5FRNA 3DB4A 2RH2A 1YWOA 1UTIA 4M7DE 2AIRB 2FHDA 3M59A 2ENMA 1QVFS 1GCPA 3S3MA 4C0ZA 2FZGB 1C1AA 3J81E 1K73R 1VQ8A 5GJWB 1NZ9A 3MJXA 4E7IA 3EFRA 3RUXA 3M0TA 2X3XD 2EFIA 5DLQE 4AT1B 1WJSA 4A4GA 3J80E 3EGXA 2VYTA 4IUTA 4M78D 1EIFA 1EFNA 1QMCA 3VS7A 1RAEB 3CC4Q 4KT0E 1VYVA 3VS1A 1U06A 1X6OA 4EMGA 2A3LA 2O9SA 1QP3A 1ABOA 1E6HA 5GAN6 5I2MA 1T0JA 3OYGA 2QXFA 3QXEB 5HK3A 2COZA 2Y4XA 4RG8A 2QDYB 5KYWB 4M7DB 1Q86R 1QCOA 1S72A 2ZPBB 4GY5A 5GAOn 1Q7YC 1TH7A 1W70A 1X6BA 2CZ7B 2L3SA 1PSFA 3OMGA 1TOVA 1YJ9Q 4HKEA 3REBB 2MWPA 4B9XA 1W2BP 1G3YA 2PVGB 2EJFA 4WCIA 5FU6B 1IB8A 1Q81R 5CR2A 3OYYA 1KD1C 4ESRA 2KNBB 4KH0B 3C0CA 4ATOA 4EMKB 1NYGA 4M77E 2CH4A 4O6JA 2HQXA 2KT1A 2F5KA 1SRMA 3OYEA 4NS5A 2YXYA 1KQ2A 3SHWA 3JCMW 2CUDA 3EHQA 3S3OA 1MMDA 4MZPA 3JCMX 3CC4A 4TVRA 4A4KA 2DX1A 3OY9A 1PRMC 2LCLA 4IUVA 3CC2Q 2E10A 3LLRA 2DJQA 2QK0A 3PMIA 1M90U 1U1SA 3CCRQ 3HFNA 4LXCA 4MMLA 5D6XA 5KYXA 3MKDA 2DXUA 4F04B 4M7AE 2L0AA 2CP7A 2RHIA 5GANf 3CXCP 1UGRB 3M0PA 4C5GA 2YHTA 1YJ9A 4M77B 3I55Q 1S1NA 4BE0A 3I5RA 3PVQA 3CCJA 1BB9A 1O9SA 3WXMB 3UPUA 4DEXA 9ATCB 1ZSZB 2DXTA 2G3RA 4E7HA 4J7FA 3ZBDA 5CVIA 2V1QA 4N4HA 2PVOB 4LDUA 2JTMA 4AG1C 1BI3A 1VQPT 1YCSB 4FU6A 3PE0A 5IAYA 4ZNXA 2O4XA 5IN1A 3M0QA 3V8JA 3GPLA 1K9MU 2QGGA 2MCNA 5CCAA 1M2VB 2QTXA 2OTJQ 5CK9A 2OJ2A 1WX6A 4M7AB 4PJOG 1FX7A 3V7RA 1JEGA 2K2MA 3CBOA 5GANh 2HSEB 2EQUA 1YIJT 5HCKA 2ZPGB 2XG8D 4OGEA 1E7OA 2XHCA 2FZKB 3OYCA 5IHKA 3X28B 2QAZA 2RN8A 2QQRA 4OMMA 1MUZA 4LNPA 2HSPA 2PQWA 2DTOA 3I55A 2KRSA 5GAOp 4OMOA 4KH1B 3JCMc 5LJ5d 2DEUA 2D1XA 2BUDA 1M3CA 3X26B 1TG0A 4J6WA 2JTFA 1YWPA 1VQ5Q 2VVKA 4XTVA 1VOMA 1AVZC 3CD6Q 2AT1B 4E7SA 2F1LA 4C0FA 4C92E 2KYMA 4XQ3A 2BE9B 2E6ZA 2E64A 2FPDA 3QPHA 2LMJA 5CQXA 4DOVA 3META 5KCOA 4MZMA 3OYDA 3X25B 1M90R 1VQLA 2L5QA 3QJYA 3JCMP 4QVZA 2MWOA 4J9GA 3RERA 1BI0A 1YIJQ 3VYGA 2GCXA 1YITT 1ZUYA 1AHJB 4F16A 1Y07A 3QZ5B 1KQSS 4WTOB 2DBKA 4CC7A 1NPPA 3CPWP 1PD0A 4LE9A 2O4XB 2JMAA 4L6V5 1BK2A 2JNGA 2QQBA 1QVFA 4FYYB 2NUTA 1VQ6T 1N8RR 2K6DA 2JM9A 2ROLA 3KBGA 4BB7A 4E6RA 1W6XA 1K1ZA 1G5VA 4C92B 3CCSA 5DM7R 3G6EQ 2BIVA 1M3BA 1M27C 2BZYA 3L2WA 2X35A 4QVCA 1VQ5A 4VUBA 4ZTJA 2HCKA 4R56A 1YFNA 4RCBA 1WXUA 3MEUA 1OEBA 1M30A 4OP0A 1QVFP 3L2VA 2YRCA 1I5LA 3EGDB 1Y71A 2RNAA 1M1FA 2CUBA 2HBWA 4XK8E 4LN2A 3QDFA 1NYFA 2XDBA 4ME7A 4JRPA 1D3BB 3OYFA 4IUQA 4R55A 4A4EA 1YJNA 4ZN1A 1ZA1B 1PG5B 1IREB 2EYWA 4E47A 2OAWA 1I8FA 8ATCB 1I81A 3PFSA 5GMKe 1GBQA 6AT1B 3OYIA 1RUWA 1MMNA 1A0NB 1RABB 2HMAA 7AT1B 2QTVA 2BKDN 2I0NA 2YWWA 3I5SA 1ABQA 1YP5A 3O8VA 4PFPA 3UWNA 3QO3A 1RL2A 2LCCA 1SG5A 4M7DC 1SEMA 3JCMg 3G6EA 4M75G 1SF9A 2P4TA 4JPBW 2FO0A 3NTKA 3UATA 4OMQA 2FL7A 3GLXA 4JDSA 2DA9A 1AZGB 4EDUA 3CCVT 4ELYC 4BE2A 1YI2T 1BIAA 1BCMA 2OTLQ 1OI1A 4OB0B 2DRKA 1UJ0A 3E9FA 5CKHA 5FU6C 2RI2A 2E41A 2KMTA 2IPOB 1WXTA 1K8AU 1F1BB 1M8VA 2LCSA 2C0OA 3HPWA 2A0FB 3EG0A 4C8QE 2CP2A 2DD4A 3VYHB 8AT1B 3BFMA 4F7UE 2KXDA 2XK0A 4J9CA 1TWBA 1VQNT 3V7CA 2COYA 2HQEA 5GAMd 1KJWA 1H92A 1Y96A 1R0CB 3M0UA 1Q95G 2X9HA 2E12A 4M4ZA 4EMHA 3OQ5A 3G1JA 4QT7A 1NE8A 2WSCE 1KC8C 2EBPA 1JBMA 2E65A 2EQKA 4JZ3A 5IXBA 1M1KC 2EQJA 4XAXB 2OX7A 4C5HA 1Q7YR 2DZCA 1VQ4A 2RHYA 2VC8A 2AZSA 5LJ5j 4EPCA 2ZPFB 1ZBJA 2FG0A 1BI1A 2LC4A 4F7UB 4M77C 2FRYA 1PWTA 3VU3C 5CAIA 3VRYA 1NG2A 1ZSZC 2KR3A 3HL8A 1KD1R 4J9DA 5GMKi 4MMKA 1WHGA 4CRIA 2XMFA 5CKBA 1VQMQ 1H8KA 3V8LA 2E1HA 3GIBA 3I35A 3OMCA 4M7DF 2EGCA 1UJYA 2FB7A 3CC7T 3TVTA 3CCQQ 1QVGS 5GAMf 4J8OA 4M7AC 1M4ZA 5LJ3h 4AFUC 2KDSA 2QEXQ 2RQTA 2AKLA 1UFFA 3MHXA 1YNZA 1WZOA 3PIPA 4BDYA 2RQRA 4XU2A 5I11A 3OYHA 3V7SA 2PUKB 2M9UA 2EPDA 1VQOT 2GTJA 2JOYA 2ROTA 1OU8A 4CC4B 3PT9A 1P92A 2ECZA 1K9MC 2K3YA 2YUOA 1JXOA 3X24B 5L8RE 1G83A 1QLYA 1M3AA 4C8QG 3JCMe 1Y96B 2KYBA 4F7UG 1RAGB 2HBPA 2PTKA 5KYWA 3O5ZA 4RKUE 4M7DA 3NPFA 1S72T 2J6FA 2GNCA 4X9CA 2K79A 3LH0A 1RLQC 3QYHB 1I1JA 2X4WA 2RHUA 2D8JA 3QDRB 1VQMA 3JB9F 5KCHA 5I22A 1D1BA 2CH4W 1R8OB 1KQSA 4IUPA 1LPLA 3JCMh 4C0DB 1VQKQ 1UB4A 3SB2A 2YDLA 2DEQA 4XU1A 3EG9B 3CCQA 1H641 2YUPA 3C4SA 3L2UA 1AWOA 2QEXA 1TU0B 2C0TA 3VV0A 1NM7A 1FXXA 2OAUA 4N4GA 1YHQQ 4XTYA 2PVDB 3EG1A 4FSXA 1KQSP 3DLLA 3I56A 2RJEA 1JJ2S 3A8MB 2KEAA 2P0QA 4M78G 4DEYA 5KE2A 3ZEHA 3L2QA 1FWZA 5GANg 2LQ8A 2ABLA 3NTHA 1CSKA 4C92C 1Z9QA 2L3PA 1C0MA 4FW1A 2MF2A 1PC0A 3G71A 3I9QA 2DL4A 4C0GA 2DMOA 4M7AF 1EX4A 4J6XA 3CBPA 3MP8A 3CCMA 3RBBB 1LCKA 4M77A 3FJ5A 3CCJT 2WACA 1T0HA 2K5LA 2KY9A 1N9RA 1Y0MA 2QQ9A 1QWFA 1V76A 1ZSZA 1VQKA 5GAMj 2M51A 2NUZA 3JCMV 5GAN4 2DTHA 1UGVA 4E2FB 3CMEQ 2K7AA 3OW2S 4E7LA 1NLPC 3NTIA 4PJOE
chains in the Genus database with same CATH topology
1K76A 2LQWA 1NEGA 4Z89A 5IHKA 4JJBA 1UHFA 2RN8A 4F14A 2LJ3A 1K9AA 4OMMA 1MUZA 4Z88A 4HVWA 4LNPA 2A36A 1ZSGA 1ZX6A 2HSPA 3VS4A 1K0SA 1ARKA 2EGAA 3M0SA 2KRSA 4ORZA 4OMOA 2VKNA 3NMZC 1OOTA 2D1XA 1M3CA 1X69A 1TG0A 3EGUA 4J9FA 2HDAA 2LZ6B 1YWPA 3U23A 1QKWA 2O31A 2VVKA 1AWXA 2MIOA 1AVZC 1GCQC 2A37A 2O9VA 2YUNA 2KYMA 2FPDA 2EKHA 2LMJA 1VYTA 2YUQA 2DL7A 1WDXA 1YN8A 2KE9A 1X43A 3KFVA 1JO8A 1H3HA 2JTEA 1PNJA 2P4RA 4EIKA 2K9GA 3ZL7C 2QDLA 5FWCA 4J9GA 4OMPA 2DVJA 1JU5C 1ZUYA 2W10A 3LH5A 5ECAA 3UA7A 2JM8A 1HSQA 5IHIA 2ED0A 2FEIA 1BU1A 1WA7A 4F16A 1PHTA 1SHGA 2DBKA 1CKAA 1E6GA 1UHCA 1WI7A 2AZVA 4AFQC 4CC7A 2YT6A 4LE9A 3REAB 2JMAA 1OPLA 1JXMA 1BK2A 1IO6A 2K6DA 2JM9A 2ROLA 2O88A 4E6RA 1W6XA 1K1ZA 2OI3A 4D8DA 2JMCA 1M3BA 1M27C 4AFSC 2BZYA 4FSSA 1JQQA 2DNUA 1SPKA 4A63B 2HCKA 2FPEA 1T3LA 1WXUA 1OEBA 1M30A 1V1CA 1AWJA 2EVRA 2RNAA 2CUBA 2D0NA 1AEYA 2HBWA 4LN2A 1T3SA 4HCKA 4OMLA 1NYFA 4JJCA 1AOJA 3QWXX 2KBTA 4IIMA 3VS5A 2KT8A 2CT4A 2RQUA 5FWBA 2A28A 2J6KA 2C0IA 2K3BA 2EYWA 2JS0A 2OAWA 1GBQA 2RQWA 2PZ1A 2ESWA 1MV0B 1ZLMA 1RUWA 1HJDA 1KIKA 1A0NB 1GBRA 2F2VA 2JS2A 1UE9A 4K11A 4J9HA 2I0NA 2A08A 3I5SA 1J3TA 2VWFA 3VS6A 4LUEA 4JZ4A 1ABQA 2GBQA 2KROA 4RUGA 2NWMA 4RTYA 1YP5A 2FRWA 3TSZA 2O2OA 3VS0A 2LJ1A 1KSWA 2KRNA 1SEMA 1UG1A 2GQIA 2DLPA 4D8KA 3UF4A 1SSHA 4JPBW 2FO0A 2DL5A 4RTUA 3UATA 4OMQA 2AKKA 4J9IA 2BTTA 2F2WA 2DA9A 1AZGB 4X1VA 1B07A 4RTZA 1VA7A 3H0IA 2CDTA 1ZUUA 2DRKA 1UJ0A 2SRCA 2RQVA 2ED1A 4CC3A 4Z8AA 1WXTA 3IQLA 4RTWA 2PNIA 2LCSA 1FYNA 2C0OA 3H41A 3GBQA 3EG0A 3NGPA 2KXDA 2B86A 4RTTA 4J9CA 1I0CA 2SEMA 2AK5A 1GCQA 2L3QA 3H0FA 1WFWA 1N5ZA 1KJWA 1H92A 5IHNA 2X3WD 2KRMA 1U3OA 2M0YA 1RLPC 3M0UA 4F17A 3TSWA 1AWWA 1X6GA 2D8HA 4M4ZA 1PKTA 2RF0A 2F2XA 1K4US 3JV3A 2HEQA 1OPKA 2G6FX 4QT7A 4J9BA 2DYBA 2EBPA 2L2PA 1X2QA 5IXBA 4JZ3A 1UECA 2E5KA 2DF6A 4R0KA 1X27A 2JT4A 1TUDA 2J7IA 2AZSA 4RTXA 1YWOA 1VYUA 1ZBJA 2KGTA 1UTIA 4J9EA 4LUDA 3R6NA 2FG0A 2J05A 2J06A 2FRYA 4GLMA 2ENMA 1GCPA 2CREA 1PWTA 3M0RA 1AD5A 1SHFA 2DE0X 1WLPB 5GJWB 3SEMA 3VRYA 1NG2A 2KR3A 1NEBA 4J9DA 1UUEA 1BBZA 3M0TA 2X3XD 1G2BA 1NLOC 3EG2A 2DRMA 3ULRB 1GL5A 2XMFA 1CKBA 5L23A 1H8KA 1PRLC 2JW4A 4OMNA 2KXCA 1EFNA 2CSQA 3I35A 3VS7A 1WYXA 1VYVA 4Y92A 3VS1A 1U06A 1HD3A 5IXFA 2EGCA 1UJYA 2O9SA 1ABOA 3TVTA 1E6HA 2BZ8A 1T0JA 1WXBA 2CT3A 4HVUA 4AFUC 2RQTA 2AKLA 2MOXA 1W1FA 1UFFA 1YNZA 1GFDA 2RQRA 1QCFA 5I11A 5EC7A 1W70A 1X6BA 2BZXA 2EPDA 2L3SA 3CQTA 2GTJA 3THKA 1I07A 2ROTA 2RMOA 4CC4B 2ECZA 2DILA 2LP5A 3REBB 2DBMA 2H8HA 1WIEA 1JXOA 2YUOA 3VS3A 1G83A 1QLYA 1PKSA 2EYZA 1M3AA 2KYBA 3H0HA 2EW3A 1X2KA 2PTKA 4WCIA 3O5ZA 2DL3A 3NPFA 4KRTA 4ESRA 2J6FA 2KNBB 2GNCA 4AG2C 2V1RA 2K79A 2LX7A 3C0CA 1NYGA 4HXJA 1KFZA 1GFCA 2CH4A 1RLQC 2LJ0A 5IH2A 1Z9ZA 1I1JA 3EG3A 2KT1A 2GTOA 2D8JA 2YSQA 1B3QA 1SRMA 5I22A 1QKXA 2CH4W 3SHWA 2CUDA 3EHQA 1GRIA 4HVVA 4JJDA 2DX1A 2IIMA 5FW9A 2YDLA 2JXBA 2LQNA 1PRMC 2YUPA 2DJQA 1AWOA 3A98A 2J6OA 3NHNA 2EYYA 2C0TA 1NM7A 1QWEA 1AZEA 2DL8A 3EG1A 2L0AA 1Y57A 2KEAA 4IIOA 4RTVA 3M0PA 1FMKA 4DEYA 1U5SA 1XOVA 1S1NA 3PVLA 2CSIA 3I5RA 3PVQA 1BB9A 1ZUKA 2GGRA 2ABLA 4DEXA 1CSKA 1TUCA 3UA6A 1Z9QA 2L3PA 4CC2A 3EHRA 2V1QA 4AFZC 1OV3A 3I9QA 2EYXA 4AG1C 1YCSB 2DL4A 1K0XA 3PE0A 4ZNXA 2DMOA 3VS2A 3M0QA 3RBBB 2FPFA 1LCKA 1MV3A 1SRLA 3FJ5A 1M8MA 1UDLA 2DM1A 1T0HA 2MCNA 1Y0MA 2W0ZA 2RPNA 1QWFA 2M51A 2OJ2A 2NUZA 1WX6A 4GBQA 1JEGA 2K2MA 1UGVA 5GJVB 3VRZA 2K7AA 2EQIA 5HCKA 3RNJA 1NLPC 1RI9A 2EGEA 2LNHB 3QWYA 1E7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K76 A;  2LQW A;  1NEG A;  4Z89 A;  5IHK A;  4JJB A;  1UHF A;  2RN8 A;  4F14 A;  2LJ3 A;  1K9A A;  4OMM A;  1MUZ A;  4Z88 A;  4HVW A;  4LNP A;  2A36 A;  1ZSG A;  1ZX6 A;  2HSP A;  3VS4 A;  1K0S A;  1ARK A;  2EGA A;  3M0S A;  2KRS A;  4ORZ A;  4OMO A;  2VKN A;  3NMZ C;  1OOT A;  2D1X A;  1M3C A;  1X69 A;  1TG0 A;  3EGU A;  4J9F A;  2HDA A;  2LZ6 B;  1YWP A;  3U23 A;  1QKW A;  2O31 A;  2VVK A;  1AWX A;  2MIO A;  1AVZ C;  1GCQ C;  2A37 A;  2O9V A;  2YUN A;  2KYM A;  2FPD A;  2EKH A;  2LMJ A;  1VYT A;  2YUQ A;  2DL7 A;  1WDX A;  1YN8 A;  2KE9 A;  1X43 A;  3KFV A;  1JO8 A;  1H3H A;  2JTE A;  1PNJ A;  2P4R A;  4EIK A;  2K9G A;  3ZL7 C;  2QDL A;  5FWC A;  4J9G A;  4OMP A;  2DVJ A;  1JU5 C;  1ZUY A;  2W10 A;  3LH5 A;  5ECA A;  3UA7 A;  2JM8 A;  1HSQ A;  5IHI A;  2ED0 A;  2FEI A;  1BU1 A;  1WA7 A;  4F16 A;  1PHT A;  1SHG A;  2DBK A;  1CKA A;  1E6G A;  1UHC A;  1WI7 A;  2AZV A;  4AFQ C;  4CC7 A;  2YT6 A;  4LE9 A;  3REA B;  2JMA A;  1OPL A;  1JXM A;  1BK2 A;  1IO6 A;  2K6D A;  2JM9 A;  2ROL A;  2O88 A;  4E6R A;  1W6X A;  1K1Z A;  2OI3 A;  4D8D A;  2JMC A;  1M3B A;  1M27 C;  4AFS C;  2BZY A;  4FSS A;  1JQQ A;  2DNU A;  1SPK A;  4A63 B;  2HCK A;  2FPE A;  1T3L A;  1WXU A;  1OEB A;  1M30 A;  1V1C A;  1AWJ A;  2EVR A;  2RNA A;  2CUB A;  2D0N A;  1AEY A;  2HBW A;  4LN2 A;  1T3S A;  4HCK A;  4OML A;  1NYF A;  4JJC A;  1AOJ A;  3QWX X;  2KBT A;  4IIM A;  3VS5 A;  2KT8 A;  2CT4 A;  2RQU A;  5FWB A;  2A28 A;  2J6K A;  2C0I A;  2K3B A;  2EYW A;  2JS0 A;  2OAW A;  1GBQ A;  2RQW A;  2PZ1 A;  2ESW A;  1MV0 B;  1ZLM A;  1RUW A;  1HJD A;  1KIK A;  1A0N B;  1GBR A;  2F2V A;  2JS2 A;  1UE9 A;  4K11 A;  4J9H A;  2I0N A;  2A08 A;  3I5S A;  1J3T A;  2VWF A;  3VS6 A;  4LUE A;  4JZ4 A;  1ABQ A;  2GBQ A;  2KRO A;  4RUG A;  2NWM A;  4RTY A;  1YP5 A;  2FRW A;  3TSZ A;  2O2O A;  3VS0 A;  2LJ1 A;  1KSW A;  2KRN A;  1SEM A;  1UG1 A;  2GQI A;  2DLP A;  4D8K A;  3UF4 A;  1SSH A;  4JPB W;  2FO0 A;  2DL5 A;  4RTU A;  3UAT A;  4OMQ A;  2AKK A;  4J9I A;  2BTT A;  2F2W A;  2DA9 A;  1AZG B;  4X1V A;  1B07 A;  4RTZ A;  1VA7 A;  3H0I A;  2CDT A;  1ZUU A;  2DRK A;  1UJ0 A;  2SRC A;  2RQV A;  2ED1 A;  4CC3 A;  4Z8A A;  1WXT A;  3IQL A;  4RTW A;  2PNI A;  2LCS A;  1FYN A;  2C0O A;  3H41 A;  3GBQ A;  3EG0 A;  3NGP A;  2KXD A;  2B86 A;  4RTT A;  4J9C A;  1I0C A;  2SEM A;  2AK5 A;  1GCQ A;  2L3Q A;  3H0F A;  1WFW A;  1N5Z A;  1KJW A;  1H92 A;  5IHN A;  2X3W D;  2KRM A;  1U3O A;  2M0Y A;  1RLP C;  3M0U A;  4F17 A;  3TSW A;  1AWW A;  1X6G A;  2D8H A;  4M4Z A;  1PKT A;  2RF0 A;  2F2X A;  1K4U S;  3JV3 A;  2HEQ A;  1OPK A;  2G6F X;  4QT7 A;  4J9B A;  2DYB A;  2EBP A;  2L2P A;  1X2Q A;  5IXB A;  4JZ3 A;  1UEC A;  2E5K A;  2DF6 A;  4R0K A;  1X27 A;  2JT4 A;  1TUD A;  2J7I A;  2AZS A;  4RTX A;  1YWO A;  1VYU A;  1ZBJ A;  2KGT A;  1UTI A;  4J9E A;  4LUD A;  3R6N A;  2FG0 A;  2J05 A;  2J06 A;  2FRY A;  4GLM A;  2ENM A;  1GCP A;  2CRE A;  1PWT A;  3M0R A;  1AD5 A;  1SHF A;  2DE0 X;  1WLP B;  5GJW B;  3SEM A;  3VRY A;  1NG2 A;  2KR3 A;  1NEB A;  4J9D A;  1UUE A;  1BBZ A;  3M0T A;  2X3X D;  1G2B A;  1NLO C;  3EG2 A;  2DRM A;  3ULR B;  1GL5 A;  2XMF A;  1CKB A;  5L23 A;  1H8K A;  1PRL C;  2JW4 A;  4OMN A;  2KXC A;  1EFN A;  2CSQ A;  3I35 A;  3VS7 A;  1WYX A;  1VYV A;  4Y92 A;  3VS1 A;  1U06 A;  1HD3 A;  5IXF A;  2EGC A;  1UJY A;  2O9S A;  1ABO A;  3TVT A;  1E6H A;  2BZ8 A;  1T0J A;  1WXB A;  2CT3 A;  4HVU A;  4AFU C;  2RQT A;  2AKL A;  2MOX A;  1W1F A;  1UFF A;  1YNZ A;  1GFD A;  2RQR A;  1QCF A;  5I11 A;  5EC7 A;  1W70 A;  1X6B A;  2BZX A;  2EPD A;  2L3S A;  3CQT A;  2GTJ A;  3THK A;  1I07 A;  2ROT A;  2RMO A;  4CC4 B;  2ECZ A;  2DIL A;  2LP5 A;  3REB B;  2DBM A;  2H8H A;  1WIE A;  1JXO A;  2YUO A;  3VS3 A;  1G83 A;  1QLY A;  1PKS A;  2EYZ A;  1M3A A;  2KYB A;  3H0H A;  2EW3 A;  1X2K A;  2PTK A;  4WCI A;  3O5Z A;  2DL3 A;  3NPF A;  4KRT A;  4ESR A;  2J6F A;  2KNB B;  2GNC A;  4AG2 C;  2V1R A;  2K79 A;  2LX7 A;  3C0C A;  1NYG A;  4HXJ A;  1KFZ A;  1GFC A;  2CH4 A;  1RLQ C;  2LJ0 A;  5IH2 A;  1Z9Z A;  1I1J A;  3EG3 A;  2KT1 A;  2GTO A;  2D8J A;  2YSQ A;  1B3Q A;  1SRM A;  5I22 A;  1QKX A;  2CH4 W;  3SHW A;  2CUD A;  3EHQ A;  1GRI A;  4HVV A;  4JJD A;  2DX1 A;  2IIM A;  5FW9 A;  2YDL A;  2JXB A;  2LQN A;  1PRM C;  2YUP A;  2DJQ A;  1AWO A;  3A98 A;  2J6O A;  3NHN A;  2EYY A;  2C0T A;  1NM7 A;  1QWE A;  1AZE A;  2DL8 A;  3EG1 A;  2L0A A;  1Y57 A;  2KEA A;  4IIO A;  4RTV A;  3M0P A;  1FMK A;  4DEY A;  1U5S A;  1XOV A;  1S1N A;  3PVL A;  2CSI A;  3I5R A;  3PVQ A;  1BB9 A;  1ZUK A;  2GGR A;  2ABL A;  4DEX A;  1CSK A;  1TUC A;  3UA6 A;  1Z9Q A;  2L3P A;  4CC2 A;  3EHR A;  2V1Q A;  4AFZ C;  1OV3 A;  3I9Q A;  2EYX A;  4AG1 C;  1YCS B;  2DL4 A;  1K0X A;  3PE0 A;  4ZNX A;  2DMO A;  3VS2 A;  3M0Q A;  3RBB B;  2FPF A;  1LCK A;  1MV3 A;  1SRL A;  3FJ5 A;  1M8M A;  1UDL A;  2DM1 A;  1T0H A;  2MCN A;  1Y0M A;  2W0Z A;  2RPN A;  1QWF A;  2M51 A;  2OJ2 A;  2NUZ A;  1WX6 A;  4GBQ A;  1JEG A;  2K2M A;  1UGV A;  5GJV B;  3VRZ A;  2K7A A;  2EQI A;  5HCK A;  3RNJ A;  1NLP C;  1RI9 A;  2EGE A;  2LNH B;  3QWY A;  1E7O A; 
#chains in the Genus database with same CATH topology
 3M9Q A;  1K76 A;  2LQW A;  1NEG A;  4Z89 A;  5A0D A;  5IT9 E;  5HK0 A;  1M2V A;  5KYY B;  4M7A A;  1ZSG A;  1MMA A;  3JSC A;  3M0S A;  5GAO m;  4X34 A;  3OS2 A;  4FM4 B;  1WGS A;  2ATC B;  2YRD A;  3HRS A;  4ORZ A;  2VKN A;  3NMZ C;  3E2U A;  1KC8 U;  4XTZ A;  3BY7 A;  1M1K U;  4J9F A;  2F5T X;  3U23 A;  1QKW A;  2O31 A;  2YLB A;  1GCQ C;  2A37 A;  2HQH A;  2QQS A;  2YUN A;  2MAM A;  4ZGE B;  4A4H A;  1VYT A;  2KE9 A;  3M57 A;  4PJO B;  1WQ7 A;  4D6W A;  4EIK A;  3ZL7 C;  1D1A A;  2QDL A;  4KGZ B;  4OMP A;  4NL2 A;  3LH5 A;  3UA7 A;  1OZ2 A;  3CME A;  2ED0 A;  1BU1 A;  1QVP A;  3EAE A;  1WA7 A;  1PHT A;  1VUB A;  4C92 F;  3HTR A;  1CKA A;  1E6G A;  1UHC A;  3VKI A;  3FB9 A;  1VQ7 T;  3CCU T;  3GF5 A;  4QQ6 A;  1JXM A;  1D0Z A;  1IO6 A;  3EH2 A;  2MPX C;  1K8A C;  2O88 A;  2OI3 A;  4D8D A;  2RO0 A;  3M4G A;  2JMC A;  5KYN A;  2HAX A;  2CP5 A;  3KXT A;  1JQQ A;  2DZ9 A;  3MO8 A;  5GAN e;  1BCO A;  4KUI A;  1IGQ A;  2ZAE A;  1VIE A;  1X01 A;  2FPE A;  3G4S T;  3C95 A;  4C8Q C;  1QW1 A;  2EVR A;  5A0L A;  1QP2 A;  3FEO A;  5D6Y A;  1WQW A;  3CCS T;  3JCM b;  4C92 A;  1T3S A;  1QVG A;  2GFU A;  4JJC A;  4M7D D;  1AOJ A;  1M1G A;  1PCX A;  2DXC A;  4IIM A;  3VS5 A;  3CC2 A;  2QGF B;  2RI3 A;  2VV5 A;  2K3B A;  2JS0 A;  3CCR A;  3CCE T;  3M5A A;  2PZ1 A;  4N4I A;  2ESW A;  3EGD A;  2MYS A;  2JVV A;  1MV0 B;  4IUU A;  5CKD A;  3CCU Q;  1GBR A;  1UE9 A;  2L89 A;  4MDW A;  4J9H A;  3MP1 A;  4LUE A;  4A53 A;  1D3B A;  2KRO A;  3GNF B;  5FRM A;  1KG1 A;  5GAN 2;  3VS0 A;  1EZZ B;  1KSW A;  1UG1 A;  1KQ1 A;  3UF4 A;  2JN0 A;  3L2Z A;  1VQP Q;  4J83 A;  3URG A;  2BTT A;  3MCA B;  2COW A;  2F2W A;  3G4S Q;  2LDM A;  3FIF A;  4M75 E;  3H0I A;  2QYZ A;  1DJ7 B;  2ED1 A;  3JB9 D;  2EWN A;  4RTW A;  3H41 A;  3GBQ A;  4NOY A;  5C0M A;  2OTJ A;  2R5A A;  4HCB A;  2B86 A;  3N5B B;  1GCQ A;  2L3Q A;  3H0F A;  1SSF A;  3VUZ A;  3ASK A;  1U3O A;  1JJ2 A;  3E9G A;  4M77 D;  3TSW A;  1AWW A;  2D8H A;  5KYU B;  4C0D C;  3DB3 A;  3X20 B;  2RF0 A;  2R58 A;  2F2X A;  3A8G B;  3JV3 A;  2G6F X;  4J9B A;  2M16 A;  1B34 A;  3QZ9 B;  1ZBX A;  1RI0 A;  2X51 A;  1RAF B;  4M75 B;  2E5K A;  2DF6 A;  1BI2 A;  1X27 A;  1TUG B;  2GF7 A;  3UT1 A;  1JJ2 P;  2J7I A;  3TEE A;  1VQP A;  5LJ3 g;  3CMA T;  2WSF E;  4RTX A;  5LJ5 f;  4ZTF A;  1K9M R;  3V8K A;  2KGT A;  2FYK A;  4J9E A;  4JLI A;  3CD6 A;  3F70 A;  1FMW A;  2C06 A;  3M0R A;  2CRE A;  4LD6 A;  4NL3 A;  4M7A D;  1AD5 A;  4KUD K;  2DE0 X;  2JJ9 A;  1Q81 C;  4FW2 A;  2E3H A;  3CCL T;  3OB9 A;  1NEB A;  1VIF A;  2EYQ A;  3OA6 A;  1UUE A;  1BBZ A;  1G2B A;  5HY6 A;  2QA4 T;  3LWH A;  1GL5 A;  1D0X A;  3JB9 I;  5L23 A;  1YIT Q;  3OW2 A;  1IZ6 A;  1YIJ A;  1PRL C;  2JW4 A;  2XU8 A;  4C8Q A;  1NJI C;  4F7U A;  1D09 B;  1SKU B;  3PMT A;  2JZ2 A;  2HL5 C;  1Y7X A;  1HD3 A;  3OSV A;  2RHZ A;  4DBQ A;  1MNE A;  2BZ8 A;  2CT3 A;  1VQ9 T;  1UGP B;  2RK1 A;  1WHM A;  3A5Z B;  4L5G A;  2DO3 A;  1VQ6 Q;  2E5Q A;  2LRQ A;  2MOX A;  1W1F A;  3CPF A;  2KK4 A;  5LL6 S;  1GFD A;  1QCF A;  3L1A A;  2XIC A;  1OX9 A;  3OW2 P;  4O5V A;  1Q82 U;  5EC7 A;  2QG9 B;  2E4H A;  3HFO A;  2M0O A;  4DQ2 A;  3THK A;  3CQT A;  1V29 B;  4RMO A;  1I07 A;  2V8K A;  1X75 C;  2LP5 A;  1WHJ A;  2DBM A;  2H8H A;  1WIE A;  2VUB A;  2VXE A;  2EYZ A;  3MEV A;  1W2B S;  3H0H A;  2EW3 A;  4LDY A;  3CCL Q;  2VB6 A;  4KRT A;  3LGF A;  3OS1 A;  2V1R A;  2LX7 A;  1LNX A;  2DER A;  1KFZ A;  3BE3 A;  1B34 B;  2LJ0 A;  1Z9Z A;  4OMF B;  3OYA A;  2YSQ A;  1YIT A;  1B3Q A;  3S6W A;  3GP8 A;  4HT8 A;  1YJW T;  3P8H A;  1GRI A;  2DJZ A;  4HVV A;  1LJO A;  2RD1 A;  4JJD A;  3RIR A;  1VQ9 Q;  3QSU A;  5FW9 A;  2JXB A;  2LQN A;  4PJO C;  4OB2 B;  2DPP B;  4C92 D;  5GAN 5;  3M55 A;  1VQ6 A;  2MI6 A;  1UEB A;  2EYY A;  3MP6 A;  1AZE A;  2DL8 A;  3JCM d;  4HCC A;  1Y57 A;  3CXC S;  4XU3 A;  4QQD A;  3CBM A;  4XTX A;  3CCV Q;  1YI2 Q;  3PGG A;  2Z0W A;  4FT4 A;  3EG9 A;  3MPU B;  4C8Q B;  4LDX A;  3JAM E;  2OTL A;  4QW2 A;  1WPY A;  2CSI A;  4M78 E;  3UA6 A;  5LJ3 e;  2MMP A;  4HCZ A;  2M02 A;  4BE1 A;  1OV3 A;  3OSS C;  3OYM A;  2IVW A;  2YRV A;  2VXF A;  1VQN Q;  4CI0 C;  3QYG B;  5GMK j;  5DLO A;  1M8M A;  1UDL A;  1IHV A;  1VQ8 T;  2W0Z A;  2RPN A;  1WHH A;  3VJP A;  2LT1 A;  4A54 A;  2D6F A;  1K73 U;  2XID A;  2XDP A;  3L42 A;  2LT4 A;  2ZGW A;  1B7T A;  1TTH B;  2EQI A;  5DY9 A;  3RNJ A;  2RM4 A;  2NYS A;  4M78 B;  2P0P A;  2GFA A;  4JJB A;  1UHF A;  4ZGD B;  2ZPH B;  4F14 A;  1K9A A;  1WHL A;  3CCV A;  1YI2 A;  2A36 A;  2EGA A;  5D7U A;  1K8A R;  4KGV B;  2V26 A;  1I4K 1;  1X69 A;  2DVE A;  3EGU A;  2LZ6 B;  2R5M A;  1AWX A;  2MIO A;  2PUO B;  4PJO F;  3J7A F;  2O9V A;  5KYY A;  1JB0 E;  1NPR A;  1VQ8 Q;  2EKH A;  5EG2 A;  5GAM h;  2KQW A;  2YUQ A;  3P8D A;  2DL7 A;  2LTO A;  3INZ A;  3CC7 Q;  1YN8 A;  3KFV A;  4FCY A;  2DAQ A;  1N27 A;  1JO8 A;  2LX9 A;  1XTD A;  1H3H A;  4ANJ A;  1G3T A;  1Q81 U;  1R77 A;  1HXD A;  2K9G A;  2NLU A;  5FWC A;  3QBY A;  2DVJ A;  1RAA B;  4M77 F;  4PL6 A;  5ECA A;  2DD5 A;  2JM8 A;  5IHI A;  2P0K A;  3LX7 A;  2RI5 A;  4JRK A;  4C8Q D;  1SHG A;  3CC4 T;  1VQO Q;  1NJI U;  4PJM A;  1WI7 A;  2AZV A;  2RJF A;  1MGQ A;  4AFQ C;  3CPW S;  4V2S A;  3REA B;  4Q5W A;  1OPL A;  4PJO A;  2RHX A;  5J39 A;  4XU0 A;  4FIB A;  4XTU A;  1MND A;  3DLM A;  1G3S A;  3M53 A;  1S72 Q;  4PFO A;  4AFS C;  4M75 C;  5CKE A;  1WNL A;  1SPK A;  2CP3 A;  4OB1 B;  3LW5 E;  4JRQ A;  1YJ9 T;  4OGC A;  1V1C A;  1AWJ A;  4AMC A;  2RB6 A;  4JUV A;  2K3X A;  2CKK A;  2D0N A;  2R57 A;  3QII A;  3CC7 A;  4ZGJ B;  2PU9 B;  2EQM A;  3C94 A;  2V8I A;  4J7I A;  2LQK A;  2O01 E;  1XJW B;  3QWX X;  4BI8 B;  1M9S A;  2KBT A;  2KT8 A;  2CT4 A;  5J3B A;  3FC3 A;  2RQU A;  5FWB A;  2A28 A;  2J6K A;  1QQJ A;  3RDV A;  3SWN B;  5FLX E;  1ZQ1 A;  2QAS A;  1ZLM A;  1VQO A;  1KIK A;  3A1P A;  2F2V A;  1W4S A;  2JS2 A;  4BY6 B;  2CP6 A;  4K11 A;  4J5Y A;  4PLL A;  1JRI A;  2JUF A;  2A08 A;  3Q1J A;  3VS6 A;  1W2B A;  2X4Y A;  4JZ4 A;  5GAN d;  4RUG A;  4RTY A;  3CC2 T;  2HKQ B;  1NBE B;  3TSZ A;  2O2O A;  4YTL A;  3CCR T;  4LD9 K;  2VGM A;  2DL5 A;  2AKK A;  2ZCF B;  2RJD A;  3A8H B;  2NUP B;  1YCY A;  2DIQ A;  4RTZ A;  5GAO r;  3HSB A;  1VA7 A;  3CCJ Q;  1ZUU A;  3I55 T;  3UDC A;  3A8O B;  2AHJ B;  4FYX B;  2SRC A;  2RQV A;  1YBY A;  3IQL A;  2PNI A;  4Y91 A;  3G7Z A;  2E6N A;  3QUI A;  5GMK m;  1LVK A;  2EAY A;  2SEM A;  2AK5 A;  5HKC A;  1Q82 C;  1G3W A;  3H6Z A;  4E7J A;  2VAS A;  1NJI R;  1TS9 A;  1WFW A;  1N5Z A;  5AT1 B;  3R6O A;  5IHN A;  2KRM A;  4N0A C;  3CXC A;  4M75 F;  1WHK A;  2CZ0 B;  2OTJ T;  1K4U S;  5D6W A;  4BDZ A;  3DKM A;  2DYB A;  1VQL T;  4P5N A;  4HT9 A;  2LNV A;  2L2P A;  2CZ1 B;  3AT1 B;  4M7D G;  1UEC A;  2JT4 A;  5KE3 A;  4E7Z A;  1MHN A;  4PKC C;  3EGX B;  4PNO A;  5KYU A;  3RES A;  1VYU A;  4JJN K;  4LUD A;  3R6N A;  2IG0 A;  3AHU A;  3OYL A;  2J05 A;  2J06 A;  4GLM A;  3QKJ A;  2RJC A;  1U1T A;  5LJ5 g;  1SHF A;  1WLP B;  1HK9 A;  3RR6 A;  1WJR A;  3SEM A;  4C5E A;  3JCM J;  1N8R U;  4KGX B;  1H3Z A;  4M75 A;  1ZHI A;  1XQH A;  1OX8 A;  3EG2 A;  1NLO C;  3S3N A;  3JCM Q;  2DRM A;  1AT1 B;  1QCN A;  3ULR B;  1RAH B;  1VQ5 T;  1CKB A;  2QQA A;  4OB3 B;  4PFZ A;  3CD6 T;  4DBH A;  1R0B G;  1XNI A;  3QHS A;  3M56 A;  4OMN A;  2KXC A;  2F69 A;  2CSQ A;  1PD1 A;  4XTW A;  1WYX A;  3VUB A;  4Y92 A;  4RCC A;  5GAN 8;  5IXF A;  1VQ7 Q;  1VQL Q;  5CO7 A;  1QVG P;  3KUF A;  1WXB A;  3EFO A;  4HVU A;  2CZ6 B;  5C6S A;  3JB9 G;  1KC8 R;  3LGL A;  1YJN T;  1M1K R;  2K5I A;  5FU7 B;  5A2Q E;  2M1H A;  2BZX A;  4M78 C;  2RMO A;  4PLI A;  2LVM A;  1D0Y A;  2RA2 A;  2HD0 A;  2DIL A;  5I21 A;  3TQ7 P;  3VS3 A;  1BKB A;  3OS0 A;  1HYO A;  4BI3 A;  1PKS A;  2E3I A;  4M77 G;  2H3J A;  2VGN A;  3FLG A;  4PJO D;  3CCS Q;  1X2K A;  1K73 C;  4FL6 A;  1IGU A;  2DL3 A;  2HNI A;  1IXD A;  3G6E T;  5CIU A;  3EFS A;  4JS5 A;  4AG2 C;  4HXJ A;  2HZY A;  1GFC A;  5IH2 A;  4GLK A;  3ME9 A;  3EG3 A;  2GTO A;  2X4X A;  4DA4 A;  5KYX B;  4JRI A;  4BUG A;  3CCE Q;  3OYN A;  1QKX A;  1TSF A;  1RAC B;  2GQV A;  3OBW A;  3CPW A;  3PTA A;  2IIM A;  1VQ7 A;  3CCU A;  3RKY A;  4RG2 A;  4MDX A;  4M7A G;  1WJQ A;  3LWI A;  3A98 A;  2J6O A;  1YJN Q;  4WF2 A;  3E1S A;  3NHN A;  3M58 A;  1QWE A;  4BI4 A;  4C8Q F;  4F7U F;  3MEW A;  4PJN A;  3TU4 K;  1Q86 C;  3BDL A;  5GAN j;  3M54 A;  4N0A A;  3HRT A;  3ER0 A;  4IIO A;  1OYX A;  4RTV A;  5GAO l;  1UGQ B;  3HP9 A;  1FMK A;  3RMS A;  3A8L B;  4C5I A;  3G4S A;  2P84 A;  1U5S A;  2XKO C;  1XOV A;  2RK2 A;  3PVL A;  2DFU A;  2EJG A;  1ZUK A;  2GGR A;  1TUC A;  4Z02 A;  2DIG A;  4CC2 A;  3EHR A;  4AFZ C;  3EFO B;  2EYX A;  1VQ4 T;  3GOX A;  2YLC A;  1PM3 A;  1K0X A;  1Q7Y U;  2ZPE B;  5LJ5 e;  3VS2 A;  2FPF A;  4DBR A;  1MV3 A;  1SRL A;  3CCE A;  2CYZ B;  2OTL T;  2L8D A;  2DM1 A;  1RAD B;  2DYI A;  5GMK l;  4JS4 A;  5AYF A;  1TXQ A;  4GBQ A;  4M78 F;  4II1 A;  1KD1 U;  4QQG A;  5GAM g;  3M4Y A;  5GJV B;  3VRZ A;  2ZPI B;  1RI9 A;  2EGE A;  2LNH B;  3SWN C;  3H8Z A;  3QWY A;  3OYK A;  5KH6 A;  5LJ5 h;  2WSE E;  4KBM B;  2ZZD A;  3OYB A;  3CMA Q;  4HA8 A;  2B8A A;  4KUL A;  5LJ3 d;  4FYV B;  2K2V A;  2LJ3 A;  4BY6 C;  2DTI A;  4Z88 A;  2I2L A;  4HVW A;  1K0S A;  1ZX6 A;  3VS4 A;  1ARK A;  3MEA A;  3PNW C;  3JRZ A;  3P8B B;  4PK4 A;  3SFM A;  4B9W A;  4C92 G;  1OOT A;  1VQ4 Q;  2HDA A;  2QA4 Q;  2XD0 A;  5GMK h;  2DK3 A;  4M78 A;  3WVE B;  4E7K A;  1IHW A;  4A4F A;  2K57 A;  3FJP A;  3FDR A;  2L3R A;  2EKO A;  1C6V X;  3RMQ A;  3BW1 A;  2KI7 A;  3D7S B;  1WDX A;  1X43 A;  5J26 A;  1UGS B;  2EJ9 A;  2JTE A;  4EMK C;  1M5Q 1;  1PNJ A;  2P4R A;  2NUT B;  4M75 D;  3SD4 A;  1RAI B;  2K5F A;  1JU5 C;  2W10 A;  1VQM T;  3T9N A;  4QVD A;  1HSQ A;  2FEI A;  1I5O B;  2KVQ G;  4J6Y A;  4PJJ A;  3CMA A;  2YT6 A;  2XI9 A;  4FYW B;  3CCQ T;  3HHT B;  2DET A;  4IUR A;  2QEX T;  4B6M A;  1BYM A;  5I2S A;  5LJ3 f;  1LOJ A;  3CCL A;  1N9S A;  1OU9 A;  3L2R A;  1BIB A;  4LDV A;  4FSS A;  2DNU A;  3I56 T;  1IRX A;  2X4J A;  2XDD A;  2QA4 A;  3RKX A;  4A63 B;  5FRO A;  4BAC A;  2A7Y A;  3BDU A;  1T3L A;  1PSE A;  1ACM B;  4ZN3 A;  4JLG A;  3NFC A;  1YJW Q;  2HKN A;  3HRU A;  3HKS A;  1O75 A;  2D0Q B;  1AEY A;  4HCK A;  4OML A;  3G71 T;  1VQ9 A;  1M90 C;  4IKF A;  3OS5 A;  2E70 A;  3GNG A;  2CP0 A;  4DBF A;  1Q82 R;  4QKU A;  1GXI E;  2V8J A;  2C0I A;  3CCM T;  5A0G A;  4Y28 E;  4LDW A;  1MMG A;  5GAN 3;  3LYI A;  5GAN 7;  2DXB A;  2RQW A;  4FT2 A;  1HJD A;  1U8R A;  2CGH A;  1VQK T;  5M9O A;  3RKW A;  1FMV A;  5GAM e;  1J3T A;  2VWF A;  3JCM f;  2K4Y A;  2GBQ A;  2NWM A;  1N8R C;  2FRW A;  1YHQ A;  3TRE A;  3SDZ A;  2LJ1 A;  2KRN A;  3TCJ A;  5FU7 C;  2GQI A;  2FZC B;  2DLP A;  2HL3 A;  3SWN A;  4D8K A;  3C12 A;  1YHQ T;  4L59 A;  1SSH A;  2EIF A;  4DOW A;  3I56 Q;  4RTU A;  2FVU A;  2DKG A;  3JB9 J;  1Q86 U;  4J9I A;  1KK7 A;  3OYJ A;  2H3E B;  3H9N A;  4MZT A;  4OF1 A;  4X1V A;  5CQY A;  1VQN A;  3PIO A;  1B07 A;  1G8X A;  2QI2 A;  2CDT A;  3QJ6 A;  4X9D A;  1OQK A;  1YJW A;  4UC4 A;  4OVA A;  4CC3 A;  4Z8A A;  2Y4Y A;  3FRN A;  3EH1 A;  1D1C A;  1M2O A;  1FYN A;  3WVD B;  3G71 Q;  2KSS A;  3NGP A;  3E19 A;  2KAF A;  4ELZ C;  3CEY A;  4RTT A;  1I0C A;  3CCM Q;  1ZA2 B;  2NUP A;  3ZFJ A;  3OBY A;  2BE7 D;  2X3W D;  2M0Y A;  1RLP C;  4F17 A;  1X6G A;  1PKT A;  1KHI A;  2HEQ A;  1OPK A;  4EMK A;  2CS7 A;  2D9T A;  1KHC A;  5GAO q;  2MK5 A;  1OUL A;  1X2Q A;  5LJ3 j;  5CKF A;  3CME T;  4BD3 A;  4PJL A;  1N6A A;  4R0K A;  2Y90 A;  1OZ3 A;  1TUD A;  3JB9 H;  3QG1 A;  5FRN A;  3DB4 A;  2RH2 A;  1YWO A;  1UTI A;  4M7D E;  2AIR B;  2FHD A;  3M59 A;  2ENM A;  1QVF S;  1GCP A;  3S3M A;  4C0Z A;  2FZG B;  1C1A A;  3J81 E;  1K73 R;  1VQ8 A;  5GJW B;  1NZ9 A;  3MJX A;  4E7I A;  3EFR A;  3RUX A;  3M0T A;  2X3X D;  2EFI A;  5DLQ E;  4AT1 B;  1WJS A;  4A4G A;  3J80 E;  3EGX A;  2VYT A;  4IUT A;  4M78 D;  1EIF A;  1EFN A;  1QMC A;  3VS7 A;  1RAE B;  3CC4 Q;  4KT0 E;  1VYV A;  3VS1 A;  1U06 A;  1X6O A;  4EMG A;  2A3L A;  2O9S A;  1QP3 A;  1ABO A;  1E6H A;  5GAN 6;  5I2M A;  1T0J A;  3OYG A;  2QXF A;  3QXE B;  5HK3 A;  2COZ A;  2Y4X A;  4RG8 A;  2QDY B;  5KYW B;  4M7D B;  1Q86 R;  1QCO A;  1S72 A;  2ZPB B;  4GY5 A;  5GAO n;  1Q7Y C;  1TH7 A;  1W70 A;  1X6B A;  2CZ7 B;  2L3S A;  1PSF A;  3OMG A;  1TOV A;  1YJ9 Q;  4HKE A;  3REB B;  2MWP A;  4B9X A;  1W2B P;  1G3Y A;  2PVG B;  2EJF A;  4WCI A;  5FU6 B;  1IB8 A;  1Q81 R;  5CR2 A;  3OYY A;  1KD1 C;  4ESR A;  2KNB B;  4KH0 B;  3C0C A;  4ATO A;  4EMK B;  1NYG A;  4M77 E;  2CH4 A;  4O6J A;  2HQX A;  2KT1 A;  2F5K A;  1SRM A;  3OYE A;  4NS5 A;  2YXY A;  1KQ2 A;  3SHW A;  3JCM W;  2CUD A;  3EHQ A;  3S3O A;  1MMD A;  4MZP A;  3JCM X;  3CC4 A;  4TVR A;  4A4K A;  2DX1 A;  3OY9 A;  1PRM C;  2LCL A;  4IUV A;  3CC2 Q;  2E10 A;  3LLR A;  2DJQ A;  2QK0 A;  3PMI A;  1M90 U;  1U1S A;  3CCR Q;  3HFN A;  4LXC A;  4MML A;  5D6X A;  5KYX A;  3MKD A;  2DXU A;  4F04 B;  4M7A E;  2L0A A;  2CP7 A;  2RHI A;  5GAN f;  3CXC P;  1UGR B;  3M0P A;  4C5G A;  2YHT A;  1YJ9 A;  4M77 B;  3I55 Q;  1S1N A;  4BE0 A;  3I5R A;  3PVQ A;  3CCJ A;  1BB9 A;  1O9S A;  3WXM B;  3UPU A;  4DEX A;  9ATC B;  1ZSZ B;  2DXT A;  2G3R A;  4E7H A;  4J7F A;  3ZBD A;  5CVI A;  2V1Q A;  4N4H A;  2PVO B;  4LDU A;  2JTM A;  4AG1 C;  1BI3 A;  1VQP T;  1YCS B;  4FU6 A;  3PE0 A;  5IAY A;  4ZNX A;  2O4X A;  5IN1 A;  3M0Q A;  3V8J A;  3GPL A;  1K9M U;  2QGG A;  2MCN A;  5CCA A;  1M2V B;  2QTX A;  2OTJ Q;  5CK9 A;  2OJ2 A;  1WX6 A;  4M7A B;  4PJO G;  1FX7 A;  3V7R A;  1JEG A;  2K2M A;  3CBO A;  5GAN h;  2HSE B;  2EQU A;  1YIJ T;  5HCK A;  2ZPG B;  2XG8 D;  4OGE A;  1E7O A;  2XHC A;  2FZK B;  3OYC A;  5IHK A;  3X28 B;  2QAZ A;  2RN8 A;  2QQR A;  4OMM A;  1MUZ A;  4LNP A;  2HSP A;  2PQW A;  2DTO A;  3I55 A;  2KRS A;  5GAO p;  4OMO A;  4KH1 B;  3JCM c;  5LJ5 d;  2DEU A;  2D1X A;  2BUD A;  1M3C A;  3X26 B;  1TG0 A;  4J6W A;  2JTF A;  1YWP A;  1VQ5 Q;  2VVK A;  4XTV A;  1VOM A;  1AVZ C;  3CD6 Q;  2AT1 B;  4E7S A;  2F1L A;  4C0F A;  4C92 E;  2KYM A;  4XQ3 A;  2BE9 B;  2E6Z A;  2E64 A;  2FPD A;  3QPH A;  2LMJ A;  5CQX A;  4DOV A;  3MET A;  5KCO A;  4MZM A;  3OYD A;  3X25 B;  1M90 R;  1VQL A;  2L5Q A;  3QJY A;  3JCM P;  4QVZ A;  2MWO A;  4J9G A;  3RER A;  1BI0 A;  1YIJ Q;  3VYG A;  2GCX A;  1YIT T;  1ZUY A;  1AHJ B;  4F16 A;  1Y07 A;  3QZ5 B;  1KQS S;  4WTO B;  2DBK A;  4CC7 A;  1NPP A;  3CPW P;  1PD0 A;  4LE9 A;  2O4X B;  2JMA A;  4L6V 5;  1BK2 A;  2JNG A;  2QQB A;  1QVF A;  4FYY B;  2NUT A;  1VQ6 T;  1N8R R;  2K6D A;  2JM9 A;  2ROL A;  3KBG A;  4BB7 A;  4E6R A;  1W6X A;  1K1Z A;  1G5V A;  4C92 B;  3CCS A;  5DM7 R;  3G6E Q;  2BIV A;  1M3B A;  1M27 C;  2BZY A;  3L2W A;  2X35 A;  4QVC A;  1VQ5 A;  4VUB A;  4ZTJ A;  2HCK A;  4R56 A;  1YFN A;  4RCB A;  1WXU A;  3MEU A;  1OEB A;  1M30 A;  4OP0 A;  1QVF P;  3L2V A;  2YRC A;  1I5L A;  3EGD B;  1Y71 A;  2RNA A;  1M1F A;  2CUB A;  2HBW A;  4XK8 E;  4LN2 A;  3QDF A;  1NYF A;  2XDB A;  4ME7 A;  4JRP A;  1D3B B;  3OYF A;  4IUQ A;  4R55 A;  4A4E A;  1YJN A;  4ZN1 A;  1ZA1 B;  1PG5 B;  1IRE B;  2EYW A;  4E47 A;  2OAW A;  1I8F A;  8ATC B;  1I81 A;  3PFS A;  5GMK e;  1GBQ A;  6AT1 B;  3OYI A;  1RUW A;  1MMN A;  1A0N B;  1RAB B;  2HMA A;  7AT1 B;  2QTV A;  2BKD N;  2I0N A;  2YWW A;  3I5S A;  1ABQ A;  1YP5 A;  3O8V A;  4PFP A;  3UWN A;  3QO3 A;  1RL2 A;  2LCC A;  1SG5 A;  4M7D C;  1SEM A;  3JCM g;  3G6E A;  4M75 G;  1SF9 A;  2P4T A;  4JPB W;  2FO0 A;  3NTK A;  3UAT A;  4OMQ A;  2FL7 A;  3GLX A;  4JDS A;  2DA9 A;  1AZG B;  4EDU A;  3CCV T;  4ELY C;  4BE2 A;  1YI2 T;  1BIA A;  1BCM A;  2OTL Q;  1OI1 A;  4OB0 B;  2DRK A;  1UJ0 A;  3E9F A;  5CKH A;  5FU6 C;  2RI2 A;  2E41 A;  2KMT A;  2IPO B;  1WXT A;  1K8A U;  1F1B B;  1M8V A;  2LCS A;  2C0O A;  3HPW A;  2A0F B;  3EG0 A;  4C8Q E;  2CP2 A;  2DD4 A;  3VYH B;  8AT1 B;  3BFM A;  4F7U E;  2KXD A;  2XK0 A;  4J9C A;  1TWB A;  1VQN T;  3V7C A;  2COY A;  2HQE A;  5GAM d;  1KJW A;  1H92 A;  1Y96 A;  1R0C B;  3M0U A;  1Q95 G;  2X9H A;  2E12 A;  4M4Z A;  4EMH A;  3OQ5 A;  3G1J A;  4QT7 A;  1NE8 A;  2WSC E;  1KC8 C;  2EBP A;  1JBM A;  2E65 A;  2EQK A;  4JZ3 A;  5IXB A;  1M1K C;  2EQJ A;  4XAX B;  2OX7 A;  4C5H A;  1Q7Y R;  2DZC A;  1VQ4 A;  2RHY A;  2VC8 A;  2AZS A;  5LJ5 j;  4EPC A;  2ZPF B;  1ZBJ A;  2FG0 A;  1BI1 A;  2LC4 A;  4F7U B;  4M77 C;  2FRY A;  1PWT A;  3VU3 C;  5CAI A;  3VRY A;  1NG2 A;  1ZSZ C;  2KR3 A;  3HL8 A;  1KD1 R;  4J9D A;  5GMK i;  4MMK A;  1WHG A;  4CRI A;  2XMF A;  5CKB A;  1VQM Q;  1H8K A;  3V8L A;  2E1H A;  3GIB A;  3I35 A;  3OMC A;  4M7D F;  2EGC A;  1UJY A;  2FB7 A;  3CC7 T;  3TVT A;  3CCQ Q;  1QVG S;  5GAM f;  4J8O A;  4M7A C;  1M4Z A;  5LJ3 h;  4AFU C;  2KDS A;  2QEX Q;  2RQT A;  2AKL A;  1UFF A;  3MHX A;  1YNZ A;  1WZO A;  3PIP A;  4BDY A;  2RQR A;  4XU2 A;  5I11 A;  3OYH A;  3V7S A;  2PUK B;  2M9U A;  2EPD A;  1VQO T;  2GTJ A;  2JOY A;  2ROT A;  1OU8 A;  4CC4 B;  3PT9 A;  1P92 A;  2ECZ A;  1K9M C;  2K3Y A;  2YUO A;  1JXO A;  3X24 B;  5L8R E;  1G83 A;  1QLY A;  1M3A A;  4C8Q G;  3JCM e;  1Y96 B;  2KYB A;  4F7U G;  1RAG B;  2HBP A;  2PTK A;  5KYW A;  3O5Z A;  4RKU E;  4M7D A;  3NPF A;  1S72 T;  2J6F A;  2GNC A;  4X9C A;  2K79 A;  3LH0 A;  1RLQ C;  3QYH B;  1I1J A;  2X4W A;  2RHU A;  2D8J A;  3QDR B;  1VQM A;  3JB9 F;  5KCH A;  5I22 A;  1D1B A;  2CH4 W;  1R8O B;  1KQS A;  4IUP A;  1LPL A;  3JCM h;  4C0D B;  1VQK Q;  1UB4 A;  3SB2 A;  2YDL A;  2DEQ A;  4XU1 A;  3EG9 B;  3CCQ A;  1H64 1;  2YUP A;  3C4S A;  3L2U A;  1AWO A;  2QEX A;  1TU0 B;  2C0T A;  3VV0 A;  1NM7 A;  1FXX A;  2OAU A;  4N4G A;  1YHQ Q;  4XTY A;  2PVD B;  3EG1 A;  4FSX A;  1KQS P;  3DLL A;  3I56 A;  2RJE A;  1JJ2 S;  3A8M B;  2KEA A;  2P0Q A;  4M78 G;  4DEY A;  5KE2 A;  3ZEH A;  3L2Q A;  1FWZ A;  5GAN g;  2LQ8 A;  2ABL A;  3NTH A;  1CSK A;  4C92 C;  1Z9Q A;  2L3P A;  1C0M A;  4FW1 A;  2MF2 A;  1PC0 A;  3G71 A;  3I9Q A;  2DL4 A;  4C0G A;  2DMO A;  4M7A F;  1EX4 A;  4J6X A;  3CBP A;  3MP8 A;  3CCM A;  3RBB B;  1LCK A;  4M77 A;  3FJ5 A;  3CCJ T;  2WAC A;  1T0H A;  2K5L A;  2KY9 A;  1N9R A;  1Y0M A;  2QQ9 A;  1QWF A;  1V76 A;  1ZSZ A;  1VQK A;  5GAM j;  2M51 A;  2NUZ A;  3JCM V;  5GAN 4;  2DTH A;  1UGV A;  4E2F B;  3CME Q;  2K7A A;  3OW2 S;  4E7L A;  1NLP C;  3NTI A;  4PJO E; 
#chains in the Genus database with same CATH homology
 1K76 A;  2LQW A;  1NEG A;  4Z89 A;  5IHK A;  4JJB A;  1UHF A;  2RN8 A;  4F14 A;  2LJ3 A;  1K9A A;  4OMM A;  1MUZ A;  4Z88 A;  4HVW A;  4LNP A;  2A36 A;  1ZSG A;  1ZX6 A;  2HSP A;  3VS4 A;  1K0S A;  1ARK A;  2EGA A;  3M0S A;  2KRS A;  4ORZ A;  4OMO A;  2VKN A;  3NMZ C;  1OOT A;  2D1X A;  1M3C A;  1X69 A;  1TG0 A;  3EGU A;  4J9F A;  2HDA A;  2LZ6 B;  1YWP A;  3U23 A;  1QKW A;  2O31 A;  2VVK A;  1AWX A;  2MIO A;  1AVZ C;  1GCQ C;  2A37 A;  2O9V A;  2YUN A;  2KYM A;  2FPD A;  2EKH A;  2LMJ A;  1VYT A;  2YUQ A;  2DL7 A;  1WDX A;  1YN8 A;  2KE9 A;  1X43 A;  3KFV A;  1JO8 A;  1H3H A;  2JTE A;  1PNJ A;  2P4R A;  4EIK A;  2K9G A;  3ZL7 C;  2QDL A;  5FWC A;  4J9G A;  4OMP A;  2DVJ A;  1JU5 C;  1ZUY A;  2W10 A;  3LH5 A;  5ECA A;  3UA7 A;  2JM8 A;  1HSQ A;  5IHI A;  2ED0 A;  2FEI A;  1BU1 A;  1WA7 A;  4F16 A;  1PHT A;  1SHG A;  2DBK A;  1CKA A;  1E6G A;  1UHC A;  1WI7 A;  2AZV A;  4AFQ C;  4CC7 A;  2YT6 A;  4LE9 A;  3REA B;  2JMA A;  1OPL A;  1JXM A;  1BK2 A;  1IO6 A;  2K6D A;  2JM9 A;  2ROL A;  2O88 A;  4E6R A;  1W6X A;  1K1Z A;  2OI3 A;  4D8D A;  2JMC A;  1M3B A;  1M27 C;  4AFS C;  2BZY A;  4FSS A;  1JQQ A;  2DNU A;  1SPK A;  4A63 B;  2HCK A;  2FPE A;  1T3L A;  1WXU A;  1OEB A;  1M30 A;  1V1C A;  1AWJ A;  2EVR A;  2RNA A;  2CUB A;  2D0N A;  1AEY A;  2HBW A;  4LN2 A;  1T3S A;  4HCK A;  4OML A;  1NYF A;  4JJC A;  1AOJ A;  3QWX X;  2KBT A;  4IIM A;  3VS5 A;  2KT8 A;  2CT4 A;  2RQU A;  5FWB A;  2A28 A;  2J6K A;  2C0I A;  2K3B A;  2EYW A;  2JS0 A;  2OAW A;  1GBQ A;  2RQW A;  2PZ1 A;  2ESW A;  1MV0 B;  1ZLM A;  1RUW A;  1HJD A;  1KIK A;  1A0N B;  1GBR A;  2F2V A;  2JS2 A;  1UE9 A;  4K11 A;  4J9H A;  2I0N A;  2A08 A;  3I5S A;  1J3T A;  2VWF A;  3VS6 A;  4LUE A;  4JZ4 A;  1ABQ A;  2GBQ A;  2KRO A;  4RUG A;  2NWM A;  4RTY A;  1YP5 A;  2FRW A;  3TSZ A;  2O2O A;  3VS0 A;  2LJ1 A;  1KSW A;  2KRN A;  1SEM A;  1UG1 A;  2GQI A;  2DLP A;  4D8K A;  3UF4 A;  1SSH A;  4JPB W;  2FO0 A;  2DL5 A;  4RTU A;  3UAT A;  4OMQ A;  2AKK A;  4J9I A;  2BTT A;  2F2W A;  2DA9 A;  1AZG B;  4X1V A;  1B07 A;  4RTZ A;  1VA7 A;  3H0I A;  2CDT A;  1ZUU A;  2DRK A;  1UJ0 A;  2SRC A;  2RQV A;  2ED1 A;  4CC3 A;  4Z8A A;  1WXT A;  3IQL A;  4RTW A;  2PNI A;  2LCS A;  1FYN A;  2C0O A;  3H41 A;  3GBQ A;  3EG0 A;  3NGP A;  2KXD A;  2B86 A;  4RTT A;  4J9C A;  1I0C A;  2SEM A;  2AK5 A;  1GCQ A;  2L3Q A;  3H0F A;  1WFW A;  1N5Z A;  1KJW A;  1H92 A;  5IHN A;  2X3W D;  2KRM A;  1U3O A;  2M0Y A;  1RLP C;  3M0U A;  4F17 A;  3TSW A;  1AWW A;  1X6G A;  2D8H A;  4M4Z A;  1PKT A;  2RF0 A;  2F2X A;  1K4U S;  3JV3 A;  2HEQ A;  1OPK A;  2G6F X;  4QT7 A;  4J9B A;  2DYB A;  2EBP A;  2L2P A;  1X2Q A;  5IXB A;  4JZ3 A;  1UEC A;  2E5K A;  2DF6 A;  4R0K A;  1X27 A;  2JT4 A;  1TUD A;  2J7I A;  2AZS A;  4RTX A;  1YWO A;  1VYU A;  1ZBJ A;  2KGT A;  1UTI A;  4J9E A;  4LUD A;  3R6N A;  2FG0 A;  2J05 A;  2J06 A;  2FRY A;  4GLM A;  2ENM A;  1GCP A;  2CRE A;  1PWT A;  3M0R A;  1AD5 A;  1SHF A;  2DE0 X;  1WLP B;  5GJW B;  3SEM A;  3VRY A;  1NG2 A;  2KR3 A;  1NEB A;  4J9D A;  1UUE A;  1BBZ A;  3M0T A;  2X3X D;  1G2B A;  1NLO C;  3EG2 A;  2DRM A;  3ULR B;  1GL5 A;  2XMF A;  1CKB A;  5L23 A;  1H8K A;  1PRL C;  2JW4 A;  4OMN A;  2KXC A;  1EFN A;  2CSQ A;  3I35 A;  3VS7 A;  1WYX A;  1VYV A;  4Y92 A;  3VS1 A;  1U06 A;  1HD3 A;  5IXF A;  2EGC A;  1UJY A;  2O9S A;  1ABO A;  3TVT A;  1E6H A;  2BZ8 A;  1T0J A;  1WXB A;  2CT3 A;  4HVU A;  4AFU C;  2RQT A;  2AKL A;  2MOX A;  1W1F A;  1UFF A;  1YNZ A;  1GFD A;  2RQR A;  1QCF A;  5I11 A;  5EC7 A;  1W70 A;  1X6B A;  2BZX A;  2EPD A;  2L3S A;  3CQT A;  2GTJ A;  3THK A;  1I07 A;  2ROT A;  2RMO A;  4CC4 B;  2ECZ A;  2DIL A;  2LP5 A;  3REB B;  2DBM A;  2H8H A;  1WIE A;  1JXO A;  2YUO A;  3VS3 A;  1G83 A;  1QLY A;  1PKS A;  2EYZ A;  1M3A A;  2KYB A;  3H0H A;  2EW3 A;  1X2K A;  2PTK A;  4WCI A;  3O5Z A;  2DL3 A;  3NPF A;  4KRT A;  4ESR A;  2J6F A;  2KNB B;  2GNC A;  4AG2 C;  2V1R A;  2K79 A;  2LX7 A;  3C0C A;  1NYG A;  4HXJ A;  1KFZ A;  1GFC A;  2CH4 A;  1RLQ C;  2LJ0 A;  5IH2 A;  1Z9Z A;  1I1J A;  3EG3 A;  2KT1 A;  2GTO A;  2D8J A;  2YSQ A;  1B3Q A;  1SRM A;  5I22 A;  1QKX A;  2CH4 W;  3SHW A;  2CUD A;  3EHQ A;  1GRI A;  4HVV A;  4JJD A;  2DX1 A;  2IIM A;  5FW9 A;  2YDL A;  2JXB A;  2LQN A;  1PRM C;  2YUP A;  2DJQ A;  1AWO A;  3A98 A;  2J6O A;  3NHN A;  2EYY A;  2C0T A;  1NM7 A;  1QWE A;  1AZE A;  2DL8 A;  3EG1 A;  2L0A A;  1Y57 A;  2KEA A;  4IIO A;  4RTV A;  3M0P A;  1FMK A;  4DEY A;  1U5S A;  1XOV A;  1S1N A;  3PVL A;  2CSI A;  3I5R A;  3PVQ A;  1BB9 A;  1ZUK A;  2GGR A;  2ABL A;  4DEX A;  1CSK A;  1TUC A;  3UA6 A;  1Z9Q A;  2L3P A;  4CC2 A;  3EHR A;  2V1Q A;  4AFZ C;  1OV3 A;  3I9Q A;  2EYX A;  4AG1 C;  1YCS B;  2DL4 A;  1K0X A;  3PE0 A;  4ZNX A;  2DMO A;  3VS2 A;  3M0Q A;  3RBB B;  2FPF A;  1LCK A;  1MV3 A;  1SRL A;  3FJ5 A;  1M8M A;  1UDL A;  2DM1 A;  1T0H A;  2MCN A;  1Y0M A;  2W0Z A;  2RPN A;  1QWF A;  2M51 A;  2OJ2 A;  2NUZ A;  1WX6 A;  4GBQ A;  1JEG A;  2K2M A;  1UGV A;  5GJV B;  3VRZ A;  2K7A A;  2EQI A;  5HCK A;  3RNJ A;  1NLP C;  1RI9 A;  2EGE A;  2LNH B;  3QWY A;  1E7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...