1X69A

Solution structures of the sh3 domain of human src substrate cortactin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
b'GSSGSSGTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cortactin isoform a
publication title Solution structures of the SH3 domain of human Src substrate cortactin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x69A00
4F17A 1FYNA 1UGVA 1BK2A 1OV3A 2EGEA 2DJQA 1K0XA 2KT1A 3M0UA 4LUEA 1ZUYA 2FEIA 4OMOA 2NUZA 2C0IA 4JZ3A 2EVRA 2RN8A 3PE0A 4JJDA 1UHCA 2EYYA 4IIMA 2JM9A 5FWCA 2YUNA 1GBQA 2AKLA 1B07A 4GLMA 2F2WA 3VS3A 2DILA 5ECAA 1W6XA 3VS4A 2CSQA 1AZGB 1BB9A 2DBKA 4OMNA 2DMOA 2IIMA 3SEMA 3I5RA 1YCSB 1AZEA 2JXBA 4F16A 2KROA 4J9CA 1WLPB 2FG0A 2GNCA 4CC2A 1CKAA 4Y92A 4CC3A 4R0KA 3VRZA 4ESRA 2JTEA 2YUOA 2G6FX 2L0AA 1G83A 1K0SA 1OPKA 5GJWB 2DRMA 4JJBA 2A36A 3M0TA 2BTTA 1EFNA 4J9DA 3IQLA 1HSQA 1QLYA 2DM1A 2KRSA 1GFDA 2YT6A 4HCKA 1E6GA 2D8JA 1Z9QA 2K9GA 4J9EA 2HDAA 2XMFA 2JMAA 2O31A 2KXDA 1YWOA 2JS2A 2ESWA 3NPFA 3M0PA 2RQRA 4D8KA 3EHQA 2OI3A 1U06A 2AZVA 5FW9A 2ENMA 2MCNA 4AG1C 5FWBA 2DL7A 2F2VA 2RQUA 3A98A 4K11A 2B86A 2FO0A 2DNUA 1WXUA 3TSWA 1NEGA 2FRWA 2JM8A 2AK5A 1UFFA 3TVTA 1PWTA 3ULRB 1KSWA 1X2KA 1M30A 1HD3A 2HSPA 2OJ2A 2V1QA 2EKHA 1UJYA 3U23A 2J6KA 4E6RA 2VWFA 2DA9A 1VYVA 1VYUA 5IHKA 2EPDA 4AFSC 2J7IA 2V1RA 1MV3A 2K6DA 2ABLA 2YUQA 1SEMA 3UA6A 4Z8AA 1AEYA 2EBPA 2F2XA 3EG3A 1AWOA 2O9SA 2GQIA 2SRCA 2GTOA 4OMMA 2JMCA 3UF4A 1CKBA 2LJ1A 1K9AA 4JPBW 2YSQA 1T3LA 3VS6A 2DYBA 2PZ1A 2LP5A 1VYTA 1YN8A 4HVWA 1PRMC 1RLPC 2EYWA 1YWPA 1K76A 1JXOA 1NG2A 3PVQA 1KIKA 1ABOA 3NGPA 1TG0A 1M3BA 1OPLA 2DVJA 2X3WD 1PKTA 1A0NB 5I11A 2KE9A 3VS0A 1H3HA 1LCKA 3LH5A 2A08A 1GCPA 2P4RA 1W70A 2L3SA 2J6FA 2PNIA 1AWJA 1AOJA 3VS2A 4RTTA 1PRLC 5IXBA 1SRMA 5IH2A 4CC7A 1WYXA 1T0JA 1AVZC 3TSZA 2EGAA 1JXMA 1QKXA 1WI7A 1NYFA 1E6HA 1GCQC 2K7AA 1JQQA 2CSIA 2ED1A 1I07A 1GRIA 1QKWA 1RLQC 2GBQA 1RUWA 1NLPC 2ED0A 2NWMA 1AD5A 1WXTA 2RQVA 1WFWA 3I35A 3PVLA 2VVKA 2LJ3A 1T3SA 1PHTA 4J9FA 3ZL7C 1PNJA 1AWXA 1BU1A 4GBQA 2J05A 2LZ6B 2QDLA 3THKA 1SPKA 4KRTA 1UJ0A 1CSKA 1GFCA 3NHNA 2D1XA 4LN2A 3QWXX 1Y0MA 1YP5A 3M0SA 2RQTA 3VS5A 2KYBA 3UA7A 1AWWA 2I0NA 1UECA 2EQIA 2KT8A 1ZUKA 1K4US 2FPFA 1RI9A 1TUDA 2D0NA 1MV0B 2H8HA 2GGRA 2LX7A 2C0TA 2RPNA 3M0RA 3EG1A 4AFZC 2KRNA 1E7OA 1K1ZA 1M8MA 2CREA 2DF6A 4F14A 2EGCA 2MOXA 4LE9A 1PKSA 1I0CA 1MUZA 2PTKA 3EHRA 2BZ8A 3H0FA 4JJCA 2CT4A 4HXJA 4QT7A 4RTWA 2C0OA 5IXFA 2LNHB 3O5ZA 1X43A 1GBRA 2CH4A 3EG2A 2K2MA 1B3QA 2AZSA 1IO6A 2X3XD 3H0IA 5HCKA 5I22A 1U3OA 1BBZA 4J9IA 1ZSGA 2W0ZA 2MIOA 4J9HA 2HCKA 4JZ4A 2DL4A 2DL8A 1N5ZA 3CQTA 1X2QA 2EYXA 1HJDA 1ABQA 1UHFA 1G2BA 2YUPA 1QWEA 3SHWA 1SHGA 2LMJA 4OMLA 2KNBB 4RTZA 1ZX6A 1M3AA 1ZUUA 4AG2C 1OEBA 2DX1A 2KXCA 4RUGA 1GL5A 1NEBA 3JV3A 3I9QA 2ROTA 3REBB 4DEYA 1J3TA 1XOVA 4DEXA 2CT3A 1GCQA 2K3BA 2FPEA 2L3QA 3QWYA 1X27A 3EG0A 2FPDA 2BZXA 1NLOC 2YDLA 4J9GA 1Z9ZA 2RF0A 1KFZA 1I1JA 4EIKA 3REAB 4FSSA 2K79A 5IHNA 3M0QA 1V1CA 2A28A 1VA7A 3FJ5A 4HVUA 2DLPA 1NM7A 2DBMA 3I5SA 5EC7A 2KYMA 1W1FA 1SSHA 1X6GA 2HEQA 2CDTA 2ECZA 4Z89A 1YNZA 2A37A 2D8HA 2CH4W 3H41A 3H0HA 2JT4A 5L23A 5GJVB 2FRYA 1JEGA 4OMQA 2DE0X 4LUDA 4WCIA 1SHFA 2M51A 2DL5A 2DL3A 2DRKA 1UTIA 3R6NA 1ZLMA 4D8DA 2E5KA 2CUBA 1NYGA 1OOTA 1WX6A 1SRLA 4Z88A 1WDXA 2KEAA 2LQNA 1WXBA 2KGTA 4RTYA 2SEMA 3VS7A 2KBTA 2RMOA 1ARKA 2J06A 3RNJA 4A63B 2JW4A 4CC4B 1S1NA 4AFQC 1U5SA 1FMKA 1WIEA 4HVVA 2BZYA 1JU5C 1KJWA 2EYZA 3VS1A 2JS0A 1JO8A 1M27C 2OAWA 2VKNA 2O88A 1X6BA 4J9BA 2LQWA 3EGUA 3KFVA 2M0YA 1Y57A 4X1VA 4IIOA 2LCSA 1H8KA 3NMZC 2L2PA 4ORZA 1X69A 1QCFA 2ROLA 4OMPA 5IHIA 1WA7A 2CUDA 3VRYA 2LJ0A 4LNPA 2J6OA 3C0CA 1UG1A 2O2OA 2W10A 1UUEA 2EW3A 4RTUA 4M4ZA 1TUCA 2KRMA 3RBBB 2KR3A 1ZBJA 4AFUC 4RTVA 2AKKA 2HBWA 1QWFA 2O9VA 1UE9A 2L3PA 4ZNXA 2GTJA 3UATA 1H92A 2RQWA 4RTXA 1T0HA 1UDLA 2RNAA 1M3CA 3GBQA
chains in the Genus database with same CATH superfamily
4F17A 4M7AB 2EGEA 2DJQA 4FYYB 2PUKB 2NUZA 2LRQA 2C0IA 2XIDA 2EVRA 2EQKA 2K2VA 3PE0A 1D0YA 1PD1A 3EGDB 1D1CA 5FWCA 3URGA 4A54A 5D6YA 2QI2A 4J7IA 1KG1A 1GXIE 3OYKA 3DB4A 2F2WA 2CS7A 4AMCA 3VS3A 4EMKA 3KBGA 4C92D 2DK3A 1BB9A 2EQMA 2K5IA 2DMOA 3CCQT 4EMGA 1KK7A 3JAME 3JCMQ 3GNGA 4QQDA 5GAOl 3HFOA 3CMAA 2D6FA 2JTEA 4HKEA 1VQNT 3CCJQ 2YRVA 2G6FX 2HMAA 3CBOA 2OTJA 1OPKA 4C5HA 3GF5A 3OBYA 4JJBA 4KGZB 1N9RA 2COYA 4J9DA 3IQLA 3QIIA 2JVVA 1ZBXA 2DM1A 5GANf 2YT6A 2ZPBB 4RG8A 1U1TA 3CCVA 2QTVA 1Z9QA 2LVMA 5CIUA 5CQXA 3P8DA 2HDAA 4M7DE 2M16A 1P92A 5KYUA 1XNIA 3EHQA 4F7UE 5GAN5 3CD6T 1RAGB 3CC4Q 2F2VA 4K11A 2B86A 2EAYA 4BDZA 4QW2A 3TVTA 1YJ9T 4BY6B 2CP3A 1M30A 1HD3A 5AT1B 2V1QA 3CCMT 2DXBA 4XTYA 1YI2T 3U23A 2CYZB 2J6KA 5HY6A 2VWFA 5HK3A 3TREA 4FM4B 3J81E 2A3LA 3V7CA 4AFSC 2LC4A 2V1RA 4R55A 2YUQA 4RCBA 5D6XA 4BDYA 2F2XA 2KAFA 2YXYA 3CCQA 1VQ8T 4MDWA 1VQOQ 2GTOA 2MPXC 4OMMA 1BCOA 1N8RC 3JB9H 2LJ1A 2YSQA 3CC2Q 1R0CB 3VS6A 4C8QD 3OS0A 2DO3A 3VU3C 2D0QB 1VQNA 3JRZA 1Q82R 4HVWA 5GANh 3S6WA 3PMTA 3RESA 1Y07A 2VXFA 2QGFB 1NG2A 3PVQA 1KD1R 2RA2A 2WSFE 3NGPA 2E3IA 4M77G 2CP5A 1OPLA 2X3WD 6AT1B 4OGEA 1Q86C 3JCMh 2OAUA 4HA8A 1YJNQ 2E4HA 5FRNA 1TXQA 1GCPA 2RD1A 2P4RA 1RAIB 3CMET 1AWJA 4PJNA 1XQHA 5IXBA 3HHTB 2CP7A 1VQ4T 1NE8A 4CC7A 1WYXA 2QQBA 1AVZC 3HRUA 1WI7A 1NYFA 3PFSA 3QJYA 1GCQC 2K7AA 1JQQA 3ME9A 2E5QA 1NJIR 2ED1A 3MEUA 3CCMA 1GRIA 4XTVA 3QG1A 1YI2A 1RLQC 1BI2A 3RUXA 4RG2A 2NWMA 4M7DB 1C1AA 4XTWA 1MNDA 1PHTA 4J9FA 3EH2A 2MAMA 3FB9A 3I56Q 3L2WA 4GBQA 2V8JA 2MWOA 2DXCA 2H3EB 3CPFA 1VQLA 4FT2A 1GFCA 1VQ8A 3NTKA 4ME7A 4OVAA 1Y0MA 5IN1A 4BI3A 5A0GA 1W2BP 3L2ZA 4DQ2A 2FZKB 2M9UA 1UECA 5J39A 1ZUKA 2FZGB 4PFOA 1IXDA 3CCEQ 2LQ8A 5LJ5e 4DBQA 2M02A 1AT1B 1KQSA 2DYIA 2DD5A 4PJOE 3JCMV 1MHNA 2KRNA 4D6WA 4BD3A 1K1ZA 2KQWA 1I0CA 1VQKQ 2BZ8A 2HKNA 4JJCA 2CT4A 2E12A 4Z02A 5GANd 2LQKA 2F5KA 3RDVA 1C6VX 2O4XB 2X9HA 4FW1A 1GBRA 2HSEB 2HQXA 2JTMA 3EG2A 1K73U 4NL3A 3H0IA 4PJJA 5HCKA 1U3OA 5LJ5j 4ATOA 3KUFA 4DOVA 3JCMd 2W0ZA 3PTAA 2DEUA 4J9HA 2RJCA 1D0XA 1VQ6T 2DL4A 1QVGA 1N5ZA 1X2QA 1HJDA 4IUTA 4KULA 2RB6A 1G8XA 4KBMB 3SHWA 1Q7YU 3EFRA 3CEYA 1I8FA 4MMLA 4RTZA 2KNBB 4QVCA 1ZUUA 1YJWT 5C0MA 1OEBA 2DX1A 3G6EA 5FU7B 1D3BA 2LTOA 4M75G 3REBB 2A7YA 1XOVA 5M9OA 3M56A 1GCQA 2FPEA 2L3QA 2RO0A 1X27A 3M9QA 1HXDA 3QHSA 4J9GA 2QEXQ 5DY9A 2HQHA 1Z9ZA 3CXCP 4N0AA 3REAB 4FSSA 2RJEA 3SWNC 2A28A 3PIOA 3CBPA 1K9MU 1RAHB 3RMSA 2XG8D 2EQJA 2CZ0B 3X25B 1W1FA 1SSHA 3FIFA 4C8QC 4XTXA 4Z89A 1Y71A 3C12A 2CH4W 5L8RE 3VKIA 2K3XA 2RH2A 4C0DB 4O6JA 4WCIA 3TEEA 2DRKA 2E5KA 3OW2P 1OOTA 2VASA 4LDYA 3G71Q 5CK9A 3TU4K 1ZSZB 5GAOq 1QMCA 2F1LA 2LCCA 2OTLT 3VS7A 2DTOA 2KBTA 3UT1A 1ARKA 2JW4A 1VQ6A 4AFQC 2JOYA 4PJMA 3EGXA 4HVVA 2BZYA 4XAXB 3OS2A 3CPWP 1RABB 3VJPA 1UGQB 2C06A 2X4WA 1X6BA 2DTIA 2E3HA 3G4ST 1JJ2A 3EGUA 2M0YA 1MGQA 3NMZC 2L2PA 2MYSA 2I2LA 3CD6Q 4OMPA 4M7AC 1WA7A 2QYZA 5GAMg 2J6OA 1UG1A 5EG2A 5GAN2 3LW5E 1WHMA 3CCJA 4FT4A 3FLGA 1YJ9Q 4RTUA 2OX7A 4M4ZA 2KRMA 5GMKi 3VUZA 3OS5A 1YHQQ 2KR3A 5CKEA 3MEWA 4EPCA 2AKKA 3SB2A 2F69A 1M2OA 5LJ3g 1Y96A 3C94A 5GAOr 1H92A 3OYGA 1YJNT 4ZGEB 5GAN6 1M3CA 4MZPA 3GBQA 3PGGA 1UGVA 1OV3A 2QA4T 1PM3A 4PLLA 2KT1A 3OW2A 2Y90A 2WACA 2FEIA 4OMOA 1VQ8Q 4M78E 4JZ3A 1U8RA 1PSFA 3CC4A 3SWNA 1QCNA 4E7KA 2R57A 3UWNA 3OS1A 2EYYA 5KYWB 2JM9A 4ZGJB 2RJDA 4M77E 4GLMA 3T9NA 1Q82U 5ECAA 2CSQA 3CPWA 3EG9B 4OMNA 5DLOA 4JS5A 3QYGB 1K73C 3I56T 1KD1U 3MJXA 3I5RA 1M9SA 1WLPB 2MK5A 2XU8A 5KYXA 1B34B 1WHHA 4EMKC 4R0KA 3CMEQ 4FL6A 4PFPA 4FU6A 1VQ4Q 4ZTJA 1Q7YC 2L0AA 3E9FA 4IUQA 3RERA 2RHYA 2ZAEA 4A4EA 3QUIA 4BY6C 2X51A 1HSQA 2CKKA 2DZCA 3QDFA 1WHJA 1NJIU 1PSEA 2YWWA 2JS2A 2ESWA 1NPPA 3NPFA 1YJNA 2MMPA 5GAMf 2VYTA 1D1AA 4M7AA 4PK4A 5GANg 4AG1C 2DL7A 1K9MC 3TSWA 5IT9E 2ZCFB 1NEGA 1WJQA 2FRWA 5GMKl 3EGDA 3ULRB 2OJ2A 2ZPEB 2X4XA 5LJ3f 4E6RA 3JCMg 3LGFA 2KY9A 3QSUA 1VYVA 2EQUA 4YTLA 4Y28E 3I56A 1MV3A 2YLCA 2JJ9A 2YRCA 1O9SA 2COZA 1AWOA 1YBYA 1PD0A 1OZ2A 4E7JA 1CKBA 2R5AA 3SDZA 2DEQA 2L3RA 1IGQA 4P5NA 3A8HB 3D7SB 4C92G 2NUTB 4M77B 1RADB 2QEXT 1IHWA 3QXEB 1VYTA 1YN8A 2IPOB 3INZA 2QXFA 1PRMC 2B8AA 3M5AA 4JLGA 1RLPC 3S3MA 2JN0A 3KXTA 1K9MR 3CCEA 1PG5B 3V7RA 4KT0E 3QYHB 3LX7A 1VQ6Q 2P4TA 1M3BA 5KCOA 5GAMh 4N4GA 3OYLA 4M75E 3VS0A 4M7DC 1FX7A 1VQKA 4A4GA 1YJWQ 1W70A 1QVFP 1AOJA 3VS2A 1LVKA 4C8QF 4DBRA 1SRMA 5LJ3h 3DKMA 1I4K1 1KQ1A 2EGAA 3A5ZB 1QKXA 2A0FB 3JCMX 3G71T 1E6HA 2IG0A 3HPWA 2GQVA 3META 3MP8A 3JCMc 2GBQA 1VQMQ 1RUWA 1VIFA 3OYJA 2ED0A 4MZTA 2RQVA 3I35A 4O5VA 4XTZA 2LJ3A 1T3SA 4FYVB 4GLKA 4N4HA 4ZN3A 2LZ6B 2QDLA 3THKA 1SPKA 4KRTA 2HL5C 3LYIA 1CSKA 2K5FA 4XQ3A 1N6AA 2EKOA 2QG9B 5KYYB 3JCMf 1Q82C 3VS5A 2HL3A 1MMAA 2Z0WA 3G7ZA 2QEXA 3CBMA 1OU9A 1KD1C 2ATCB 4ZTFA 2FPFA 1RI9A 1LNXA 1KQSS 1WHKA 1MV0B 5CR2A 4M7AF 4FYWB 2OTLQ 2LX7A 2VXEA 3RMQA 4AFZC 1YHQT 1QCOA 2M0OA 1BKBA 1M8MA 4B9WA 2QQSA 4C8QG 4DBHA 1QVFA 2JTFA 2LNHB 4PJLA 1X43A 4JDSA 1VQ7T 3G4SQ 4FSXA 2KDSA 3RKWA 5FU7C 2K2MA 1R0BG 2AZSA 1NJIC 2G3RA 3OY9A 1KHCA 5I22A 3G71A 5GAMd 2DAQA 3X20B 1ZSGA 4Q5WA 2MIOA 4ZGDB 4QKUA 1QVGS 3GP8A 4JZ4A 1N27A 4M7DA 4M75B 2O01E 4BE0A 4LDWA 3MO8A 2YUPA 1Q81R 1BYMA 2YHTA 3BDUA 4OMLA 2E6ZA 5LJ3d 4F7UA 2R58A 2NYSA 1TOVA 3LWIA 1VQPQ 1S72T 1GL5A 5FU6B 1ZA2B 2ROTA 1SKUB 2YLBA 1FMWA 1Y7XA 2DIQA 4UC4A 2K3BA 2WSCE 2QA4Q 3EG0A 1D0ZA 2FPDA 1W4SA 2Y4YA 2XHCA 3CD6A 3BW1A 3AT1B 1IRXA 1KFZA 1I1JA 4EIKA 2DIGA 5KH6A 2K79A 5IHNA 3M0QA 5GAN4 4J7FA 1V1CA 1YJ9A 3C95A 1ZSZC 1IGUA 3RR6A 4PJOC 1NM7A 1D09B 1YHQA 2V8KA 2KYMA 1M2VB 4N0AC 3BDLA 4M7AD 3H41A 3H0HA 2MF2A 5L23A 3P8HA 3OBWA 4E7ZA 1JEGA 2DE0X 4LUDA 1SHFA 2DL5A 2O4XA 3R6NA 4JJNK 4X34A 4D8DA 2X35A 2CUBA 4LDUA 1KHIA 4Z88A 8AT1B 2CP0A 4LD6A 2KEAA 1WXBA 5CCAA 3RIRA 2AT1B 3O8VA 4LXCA 4RTYA 4KH0B 3MCAB 3OA6A 2J06A 3RNJA 4KGXB 4A63B 4F04B 2RHIA 3M55A 2CZ7B 3OYAA 1U5SA 3QDRB 3OYFA 1WIEA 9ATCB 2VV5A 3VS1A 1JO8A 3E9GA 2NUPB 1JJ2S 1M27C 1VQ9T 2VKNA 4QVZA 2O88A 3L2QA 4IUVA 3KFVA 2V26A 4IIOA 1YIJQ 5DLQE 1YITQ 1JRIA 4IUPA 1QCFA 3CMEA 5IHIA 3VRYA 5CVIA 3L2UA 2O2OA 1VQ4A 4FYXB 3S3NA 1ZBJA 4RTVA 5CAIA 3MP6A 2E6NA 2HBWA 4FW2A 3ZFJA 2GTJA 4RTXA 1UDLA 2RNAA 2QQ9A 3OW2S 1WGSA 1WHLA 1FYNA 1ZHIA 4C92E 1K0XA 2DXTA 2P0KA 1X01A 1ZUYA 4LUEA 4WF2A 1IB8A 1N9SA 1VQ5T 4M7DF 2RN8A 4AT1B 3OYBA 3L1AA 4JJDA 1ZSZA 1UHCA 3I55T 4F7UF 1W2BA 4IIMA 4E47A 5A0DA 4PJOA 5GAOn 1VQMT 1OQKA 2K4YA 3Q1JA 4L6V5 3CPWS 3FEOA 4QQGA 1W6XA 2HKQB 4B9XA 3VV0A 2DBKA 4RKUE 4X9DA 4ELZC 1X6OA 4JRPA 1YCSB 3OYCA 5KCHA 3HTRA 2JXBA 1X75C 2KROA 2VUBA 4J9CA 3GPLA 2FG0A 2GNCA 5GAN3 4CC2A 2PQWA 1CKAA 2XDBA 4J5YA 4Y92A 4CC3A 3DLLA 3VRZA 4XU0A 4NL2A 2ZGWA 1UEBA 2HZYA 3MKDA 4J6XA 3OSVA 3HRTA 1G83A 2E10A 2ZPHB 5GJWB 1PC0A 1QP3A 3M0TA 2BTTA 3JCMb 1EFNA 1QLYA 4MDXA 3A1PA 2KRSA 2GFAA 1GFDA 1E6GA 2QGGA 2D8JA 1D3BB 3L2VA 5GMKe 2O31A 2KXDA 2HAXA 1YWOA 4KGVB 1YJWA 1QP2A 2RI2A 1U06A 4F7UG 3OB9A 2DTHA 3HP9A 2V8IA 1BI0A 3BE3A 2MCNA 2ENMA 2QQAA 3CCUT 4M78C 2RQUA 2FO0A 2DNUA 3VYGA 4XU2A 2JM8A 1PCXA 1UFFA 2K57A 1PWTA 4C0GA 5KYWA 1KSWA 2HQEA 2EKHA 1UJYA 4JRIA 4M7DD 3CXCA 2CZ1B 3NTHA 4QVDA 3C4SA 4M77C 3QJ6A 5I21A 5GAMe 1RACB 1VQMA 2DA9A 2DD4A 5GMKj 2KSSA 3EG9A 1VYUA 4OGCA 1BIBA 2EPDA 4C92B 2K6DA 1BI3A 2PVGB 1AEYA 3MEAA 1VQPT 1KQ2A 3A8LB 2EBPA 2GQIA 1B34A 1M90R 5LJ3e 3UF4A 3H8ZA 4A4KA 4JPBW 2XI9A 1OI1A 4XU1A 1VQ7Q 1T3LA 3TQ7P 4OB0B 2ZPIB 1UGRB 3PT9A 2QDYB 1K76A 1JXOA 1FMVA 3HFNA 1NBEB 3EGXB 3JCMJ 2OTLA 1TG0A 2PUOB 5LL6S 3RKYA 4JS4A 2DVJA 4FCYA 1WJSA 1PKTA 1A0NB 3X26B 5C6SA 2KE9A 1H3HA 5HK0A 2QQRA 3M57A 5LJ3j 3H6ZA 5I2SA 2PVOB 1BIAA 2L3SA 2J6FA 1WJRA 4PJOF 1Q81U 4DBFA 1S72Q 3LH0A 2DETA 3JB9F 4RTTA 2DXUA 5IH2A 3G4SA 1T0JA 3G1JA 1JXMA 3QPHA 2BUDA 4XK8E 4A53A 1I07A 1OZ3A 1TUGB 4JRKA 3CC7Q 5FRMA 1QKWA 3ASKA 3EH1A 3M4YA 1AD5A 1Y96B 1WFWA 1YFNA 1TSFA 3PVLA 3ZL7C 1OX9A 1MMDA 1AWXA 1PNJA 2RI3A 4HCZA 4CI0C 2J05A 3AHUA 5I2MA 3ZBDA 4M78A 1M8VA 1UJ0A 1WQ7A 4BE2A 2EIFA 1VQPA 3NHNA 2BKDN 2CP2A 2D1XA 4RCCA 5CKHA 4EMHA 2VB6A 3SWNB 3JB9I 1YIJT 1YITT 1YP5A 5FLXE 2RQTA 2KYBA 2QA4A 4L5GA 2NUTA 4M77A 1HK9A 4CRIA 3UA7A 2I0NA 4MMKA 2EQIA 1TH7A 4C8QB 5GANe 3CCST 1TUDA 4IUUA 2IVWA 2H8HA 3GOXA 3HSBA 2C0TA 2RPNA 3M0RA 1E7OA 2E41A 1UGPB 2DF6A 3BY7A 4F14A 2MOXA 1EZZB 1PKSA 4M75C 3MP1A 3JCMe 1QVFS 3M4GA 4A4HA 2PTKA 3EHRA 2BIVA 4RTWA 4OP0A 3QZ9B 2C0OA 1VQ9Q 4DA4A 4V2SA 5LJ5d 1KC8R 3QZ5B 2AIRB 3R6OA 4BB7A 3QBYA 1K8AR 5DM7R 2OTJT 5CKDA 2CH4A 4OF1A 4PJOD 5GANj 5D6WA 2CGHA 3OMGA 3JB9D 1BBZA 4J9IA 2HCKA 3EFOB 3CCVT 2KVQG 4J6WA 3SD4A 2CZ6B 1OX8A 4A4FA 2DL8A 3CQTA 2XICA 1UHFA 2QTXA 3J7AF 1QWEA 2MI6A 3FC3A 4TVRA 2QASA 4XTUA 1SHGA 1ZX6A 4KUIA 1BCMA 3HKSA 5GAOm 4RUGA 1OYXA 1FXXA 4HT8A 3I9QA 4OMFB 4HCCA 1G3TA 4BUGA 4GY5A 4PFZA 4DEYA 4DEXA 2CT3A 2EJGA 5AYFA 4OB1B 5KYYA 1YIJA 1ZQ1A 1YITA 1M1FA 1NLOC 4PNOA 1VQ5Q 4B6MA 1B7TA 4FIBA 2JZ2A 3I55Q 3CCSA 3L2RA 5J3BA 2COWA 2K5LA 2GF7A 1RI0A 2GFUA 5A0LA 3V8KA 2ECZA 2A37A 2D8HA 2FRYA 4J8OA 1I5OB 1R77A 2LCLA 2M51A 2K3YA 1UTIA 1ZLMA 1I5LA 3LGLA 1NYGA 3A8MB 4JLIA 2LQNA 1M1GA 1V76A 1HYOA 4M78F 2RMOA 2EFIA 1Q81C 1G3SA 4M75A 1S1NA 3M59A 4EMKB 2JUFA 3MEVA 3M58A 1KJWA 4M77F 4WTOB 1FWZA 2OAWA 4J9BA 2P0QA 1M1KU 2LQWA 4X1VA 2LCSA 2VGMA 3E2UA 4BE1A 2ROLA 3GNFB 1H641 5KE3A 2LJ0A 2PU9B 2XDDA 3CCUQ 3F70A 4LNPA 4ZN1A 3OQ5A 1QVPA 1UUEA 2HNIA 5J26A 2EW3A 1JB0E 4PKCC 5CKFA 3OYNA 5KE2A 3RBBB 4AFUC 4JUVA 1QWFA 2RI5A 1VQLT 1M2VA 2E1HA 3E19A 1UE9A 4E7LA 3UATA 2JNGA 2RQWA 4C0ZA 2VGNA 3CCLQ 1T0HA 5KYUB 4VUBA 1BK2A 4J83A 3M0UA 3ER0A 3VYHB 4M78G 1IHVA 3OYYA 1W2BS 4C0DC 4JRQA 1M90U 2KK4A 4M7AG 2YUNA 2EJ9A 1KQSP 1GBQA 1RAAB 2RJFA 3CC7T 2AKLA 1B07A 2DILA 3VS4A 4KUDK 3JCMW 1AZGB 3QO3A 2IIMA 4M78D 3SEMA 1TWBA 1AZEA 2NUPA 4OB3B 3OYMA 1WNLA 2L89A 4F16A 3GLXA 3MPUB 3HRSA 1ACMB 1EIFA 4BI4A 5IAYA 3OYEA 4M77D 3L42A 4ESRA 5GAN7 2ZZDA 1M4ZA 2YUOA 2P0PA 5GAOp 1N8RR 3JSCA 1VQ7A 2X4YA 1K0SA 2BE9B 1O75A 3EAEA 3X24B 1BI1A 2DRMA 1QVGP 2RK1A 2A36A 4KH1B 3MHXA 2DPPB 3WVEB 5A2QE 3FRNA 2RM4A 4HCKA 4F7UB 3G6ET 3CCRQ 2K9GA 4J9EA 2XKOC 2XMFA 2D9TA 2JMAA 1UB4A 2RHZA 1Q86R 1TS9A 3M0PA 4IURA 2RQRA 4D8KA 3QKJA 2EJFA 2OI3A 4C92C 2AZVA 2MWPA 3PIPA 1S72A 2YRDA 5FW9A 5LJ5g 4M75F 5FWBA 3OMCA 3A98A 1WXUA 2XDPA 3NFCA 2CP6A 2AK5A 3CXCS 1X2KA 2FL7A 2HSPA 1IZ6A 1I81A 3CC7A 3CCSQ 1SF9A 2LNVA 3HL8A 2QAZA 1NZ9A 5IHKA 2RHUA 2J7IA 2E65A 2DFUA 2ABLA 3UA6A 1SEMA 4C5IA 7AT1B 4Z8AA 3DB3A 1YCYA 1TU0B 3EG3A 2O9SA 4L59A 2FHDA 2SRCA 3CMAQ 3ZEHA 2JMCA 2DERA 1K9AA 2X4JA 3V8JA 2DYBA 2H3JA 2PZ1A 2LP5A 2OTJQ 1MMNA 3RKXA 1KC8U 4E7IA 1K8AU 2EYWA 1YWPA 1M1KC 1KIKA 2F5TX 4C0FA 1ABOA 3CCVQ 3UPUA 3OYHA 4PL6A 2ZPGB 5I11A 1LCKA 3LH5A 2A08A 5CO7A 1JJ2P 3M54A 2LT1A 3JCMP 4NS5A 3OYDA 2PNIA 1WZOA 4MZMA 2DJZA 4C5GA 1VQ9A 3J80E 1PRLC 3CCJT 3A8GB 5D7UA 3TSZA 1SSFA 4E7SA 2CSIA 1MNEA 3SFMA 4M75D 1QW1A 2WSEE 4X9CA 1NLPC 1G5VA 1WXTA 1JBMA 2VVKA 4LD9K 3VUBA 1BU1A 1WPYA 4C92A 1VOMA 5LJ5f 1M1KR 3P8BB 4E2FB 1M90C 3CCQQ 1F1BB 4LDVA 4M7DG 3CC4T 4RMOA 3JB9J 4Y91A 2PVDB 3UDCA 4LN2A 1D1BA 3QWXX 3M0SA 1VQNQ 1DJ7B 3GIBA 4XU3A 4PJOB 1AWWA 1LJOA 1VQ5A 2KT8A 4J6YA 1K4US 2LX9A 2DKGA 4DOWA 1TTHB 2E70A 2D0NA 1SG5A 2GGRA 3I55A 2HBPA 2RHXA 3EG1A 4NOYA 2LT4A 2R5MA 3FDRA 1UGSB 4C8QE 1VIEA 2CREA 3M53A 2EGCA 8ATCB 4LE9A 1MUZA 1G3YA 3H0FA 2DZ9A 5GAN8 3CCLT 1VQOT 2RK2A 4HXJA 4QT7A 1RAFB 5IXFA 3O5ZA 3CC2T 1Q95G 2FZCB 1B3QA 2NLUA 3V7SA 1IO6A 1NPRA 2X3XD 4QQ6A 2L5QA 3CCMQ 1YI2Q 5CQYA 2E64A 4HCBA 2BE7D 5LJ5h 2KMTA 2EYXA 5GAMj 1ABQA 1G2BA 1RAEB 3PMIA 2LMJA 3PNWC 4EDUA 1M3AA 2EYQA 4AG2C 4II1A 1VQLQ 3BFMA 2KXCA 1NEBA 2EWNA 5FROA 3JV3A 3N5BB 1J3TA 2QK0A 3A8OB 3S3OA 3QWYA 4BI8B 1OU8A 2BZXA 2GCXA 2M1HA 4C5EA 4M7AE 2YDLA 3V8LA 4LDXA 1C0MA 3CCUA 4E7HA 4C8QA 2RF0A 1QQJA 3LWHA 1AHJB 1VA7A 3FJ5A 4HVUA 2DLPA 2ZPFB 1XJWB 2DBMA 3I5SA 2Y4XA 4OB2B 5EC7A 1M5Q1 3CCRT 1X6GA 2HEQA 4HT9A 2CDTA 1YNZA 2AHJB 2JT4A 4ANJA 5CKBA 5GJVB 1KC8C 1R8OB 1U1SA 3CCLA 1VQOA 4PLIA 2LDMA 2VC8A 4OMQA 1K8AC 5GMKm 3WXMB 2DL3A 1OULA 3CC2A 4R56A 3X28B 2KI7A 1EX4A 1WX6A 1SRLA 1WDXA 3DLMA 3CCET 4C92F 2KGTA 2SEMA 3EFOA 1N8RU 2FB7A 1H3ZA 2XD0A 1WHGA 3WVDB 4N4IA 4CC4B 2FYKA 1FMKA 4BACA 3E1SA 1VQKT 1JU5C 2EYZA 3TCJA 2FVUA 3G6EQ 2JS0A 2DVEA 4PJOG 4ELYC 1K73R 1LPLA 3JB9G 1IREB 5KYXB 1LOJA 1Y57A 3EFSA 3CMAT 1RL2A 1H8KA 2L8DA 4ORZA 1X69A 2P84A 1Q86U 2CUDA 3NTIA 3C0CA 5FU6C 5KYNA 2W10A 3H9NA 3LLRA 1WQWA 1Q7YR 1TUCA 1G3WA 3OSSC 1XTDA 4IKFA 2XK0A 5HKCA 3OYIA 2O9VA 3FJPA 1VUBA 3CCRA 4M78B 1V29B 5GMKh 1ZA1B 2L3PA 4ZNXA 1MMGA 2HD0A
chains in the Genus database with same CATH topology
4F17A 1FYNA 1UGVA 1BK2A 1OV3A 2EGEA 2DJQA 1K0XA 2KT1A 3M0UA 4LUEA 1ZUYA 2FEIA 4OMOA 2NUZA 2C0IA 4JZ3A 2EVRA 2RN8A 3PE0A 4JJDA 1UHCA 2EYYA 4IIMA 2JM9A 5FWCA 2YUNA 1GBQA 2AKLA 1B07A 4GLMA 2F2WA 3VS3A 2DILA 5ECAA 1W6XA 3VS4A 2CSQA 1AZGB 1BB9A 2DBKA 4OMNA 2DMOA 2IIMA 3SEMA 3I5RA 1YCSB 1AZEA 2JXBA 4F16A 2KROA 4J9CA 1WLPB 2FG0A 2GNCA 4CC2A 1CKAA 4Y92A 4CC3A 4R0KA 3VRZA 4ESRA 2JTEA 2YUOA 2G6FX 2L0AA 1G83A 1K0SA 1OPKA 5GJWB 2DRMA 4JJBA 2A36A 3M0TA 2BTTA 1EFNA 4J9DA 3IQLA 1HSQA 1QLYA 2DM1A 2KRSA 1GFDA 2YT6A 4HCKA 1E6GA 2D8JA 1Z9QA 2K9GA 4J9EA 2HDAA 2XMFA 2JMAA 2O31A 2KXDA 1YWOA 2JS2A 2ESWA 3NPFA 3M0PA 2RQRA 4D8KA 3EHQA 2OI3A 1U06A 2AZVA 5FW9A 2ENMA 2MCNA 4AG1C 5FWBA 2DL7A 2F2VA 2RQUA 3A98A 4K11A 2B86A 2FO0A 2DNUA 1WXUA 3TSWA 1NEGA 2FRWA 2JM8A 2AK5A 1UFFA 3TVTA 1PWTA 3ULRB 1KSWA 1X2KA 1M30A 1HD3A 2HSPA 2OJ2A 2V1QA 2EKHA 1UJYA 3U23A 2J6KA 4E6RA 2VWFA 2DA9A 1VYVA 1VYUA 5IHKA 2EPDA 4AFSC 2J7IA 2V1RA 1MV3A 2K6DA 2ABLA 2YUQA 1SEMA 3UA6A 4Z8AA 1AEYA 2EBPA 2F2XA 3EG3A 1AWOA 2O9SA 2GQIA 2SRCA 2GTOA 4OMMA 2JMCA 3UF4A 1CKBA 2LJ1A 1K9AA 4JPBW 2YSQA 1T3LA 3VS6A 2DYBA 2PZ1A 2LP5A 1VYTA 1YN8A 4HVWA 1PRMC 1RLPC 2EYWA 1YWPA 1K76A 1JXOA 1NG2A 3PVQA 1KIKA 1ABOA 3NGPA 1TG0A 1M3BA 1OPLA 2DVJA 2X3WD 1PKTA 1A0NB 5I11A 2KE9A 3VS0A 1H3HA 1LCKA 3LH5A 2A08A 1GCPA 2P4RA 1W70A 2L3SA 2J6FA 2PNIA 1AWJA 1AOJA 3VS2A 4RTTA 1PRLC 5IXBA 1SRMA 5IH2A 4CC7A 1WYXA 1T0JA 1AVZC 3TSZA 2EGAA 1JXMA 1QKXA 1WI7A 1NYFA 1E6HA 1GCQC 2K7AA 1JQQA 2CSIA 2ED1A 1I07A 1GRIA 1QKWA 1RLQC 2GBQA 1RUWA 1NLPC 2ED0A 2NWMA 1AD5A 1WXTA 2RQVA 1WFWA 3I35A 3PVLA 2VVKA 2LJ3A 1T3SA 1PHTA 4J9FA 3ZL7C 1PNJA 1AWXA 1BU1A 4GBQA 2J05A 2LZ6B 2QDLA 3THKA 1SPKA 4KRTA 1UJ0A 1CSKA 1GFCA 3NHNA 2D1XA 4LN2A 3QWXX 1Y0MA 1YP5A 3M0SA 2RQTA 3VS5A 2KYBA 3UA7A 1AWWA 2I0NA 1UECA 2EQIA 2KT8A 1ZUKA 1K4US 2FPFA 1RI9A 1TUDA 2D0NA 1MV0B 2H8HA 2GGRA 2LX7A 2C0TA 2RPNA 3M0RA 3EG1A 4AFZC 2KRNA 1E7OA 1K1ZA 1M8MA 2CREA 2DF6A 4F14A 2EGCA 2MOXA 4LE9A 1PKSA 1I0CA 1MUZA 2PTKA 3EHRA 2BZ8A 3H0FA 4JJCA 2CT4A 4HXJA 4QT7A 4RTWA 2C0OA 5IXFA 2LNHB 3O5ZA 1X43A 1GBRA 2CH4A 3EG2A 2K2MA 1B3QA 2AZSA 1IO6A 2X3XD 3H0IA 5HCKA 5I22A 1U3OA 1BBZA 4J9IA 1ZSGA 2W0ZA 2MIOA 4J9HA 2HCKA 4JZ4A 2DL4A 2DL8A 1N5ZA 3CQTA 1X2QA 2EYXA 1HJDA 1ABQA 1UHFA 1G2BA 2YUPA 1QWEA 3SHWA 1SHGA 2LMJA 4OMLA 2KNBB 4RTZA 1ZX6A 1M3AA 1ZUUA 4AG2C 1OEBA 2DX1A 2KXCA 4RUGA 1GL5A 1NEBA 3JV3A 3I9QA 2ROTA 3REBB 4DEYA 1J3TA 1XOVA 4DEXA 2CT3A 1GCQA 2K3BA 2FPEA 2L3QA 3QWYA 1X27A 3EG0A 2FPDA 2BZXA 1NLOC 2YDLA 4J9GA 1Z9ZA 2RF0A 1KFZA 1I1JA 4EIKA 3REAB 4FSSA 2K79A 5IHNA 3M0QA 1V1CA 2A28A 1VA7A 3FJ5A 4HVUA 2DLPA 1NM7A 2DBMA 3I5SA 5EC7A 2KYMA 1W1FA 1SSHA 1X6GA 2HEQA 2CDTA 2ECZA 4Z89A 1YNZA 2A37A 2D8HA 2CH4W 3H41A 3H0HA 2JT4A 5L23A 5GJVB 2FRYA 1JEGA 4OMQA 2DE0X 4LUDA 4WCIA 1SHFA 2M51A 2DL5A 2DL3A 2DRKA 1UTIA 3R6NA 1ZLMA 4D8DA 2E5KA 2CUBA 1NYGA 1OOTA 1WX6A 1SRLA 4Z88A 1WDXA 2KEAA 2LQNA 1WXBA 2KGTA 4RTYA 2SEMA 3VS7A 2KBTA 2RMOA 1ARKA 2J06A 3RNJA 4A63B 2JW4A 4CC4B 1S1NA 4AFQC 1U5SA 1FMKA 1WIEA 4HVVA 2BZYA 1JU5C 1KJWA 2EYZA 3VS1A 2JS0A 1JO8A 1M27C 2OAWA 2VKNA 2O88A 1X6BA 4J9BA 2LQWA 3EGUA 3KFVA 2M0YA 1Y57A 4X1VA 4IIOA 2LCSA 1H8KA 3NMZC 2L2PA 4ORZA 1X69A 1QCFA 2ROLA 4OMPA 5IHIA 1WA7A 2CUDA 3VRYA 2LJ0A 4LNPA 2J6OA 3C0CA 1UG1A 2O2OA 2W10A 1UUEA 2EW3A 4RTUA 4M4ZA 1TUCA 2KRMA 3RBBB 2KR3A 1ZBJA 4AFUC 4RTVA 2AKKA 2HBWA 1QWFA 2O9VA 1UE9A 2L3PA 4ZNXA 2GTJA 3UATA 1H92A 2RQWA 4RTXA 1T0HA 1UDLA 2RNAA 1M3CA 3GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F17 A;  1FYN A;  1UGV A;  1BK2 A;  1OV3 A;  2EGE A;  2DJQ A;  1K0X A;  2KT1 A;  3M0U A;  4LUE A;  1ZUY A;  2FEI A;  4OMO A;  2NUZ A;  2C0I A;  4JZ3 A;  2EVR A;  2RN8 A;  3PE0 A;  4JJD A;  1UHC A;  2EYY A;  4IIM A;  2JM9 A;  5FWC A;  2YUN A;  1GBQ A;  2AKL A;  1B07 A;  4GLM A;  2F2W A;  3VS3 A;  2DIL A;  5ECA A;  1W6X A;  3VS4 A;  2CSQ A;  1AZG B;  1BB9 A;  2DBK A;  4OMN A;  2DMO A;  2IIM A;  3SEM A;  3I5R A;  1YCS B;  1AZE A;  2JXB A;  4F16 A;  2KRO A;  4J9C A;  1WLP B;  2FG0 A;  2GNC A;  4CC2 A;  1CKA A;  4Y92 A;  4CC3 A;  4R0K A;  3VRZ A;  4ESR A;  2JTE A;  2YUO A;  2G6F X;  2L0A A;  1G83 A;  1K0S A;  1OPK A;  5GJW B;  2DRM A;  4JJB A;  2A36 A;  3M0T A;  2BTT A;  1EFN A;  4J9D A;  3IQL A;  1HSQ A;  1QLY A;  2DM1 A;  2KRS A;  1GFD A;  2YT6 A;  4HCK A;  1E6G A;  2D8J A;  1Z9Q A;  2K9G A;  4J9E A;  2HDA A;  2XMF A;  2JMA A;  2O31 A;  2KXD A;  1YWO A;  2JS2 A;  2ESW A;  3NPF A;  3M0P A;  2RQR A;  4D8K A;  3EHQ A;  2OI3 A;  1U06 A;  2AZV A;  5FW9 A;  2ENM A;  2MCN A;  4AG1 C;  5FWB A;  2DL7 A;  2F2V A;  2RQU A;  3A98 A;  4K11 A;  2B86 A;  2FO0 A;  2DNU A;  1WXU A;  3TSW A;  1NEG A;  2FRW A;  2JM8 A;  2AK5 A;  1UFF A;  3TVT A;  1PWT A;  3ULR B;  1KSW A;  1X2K A;  1M30 A;  1HD3 A;  2HSP A;  2OJ2 A;  2V1Q A;  2EKH A;  1UJY A;  3U23 A;  2J6K A;  4E6R A;  2VWF A;  2DA9 A;  1VYV A;  1VYU A;  5IHK A;  2EPD A;  4AFS C;  2J7I A;  2V1R A;  1MV3 A;  2K6D A;  2ABL A;  2YUQ A;  1SEM A;  3UA6 A;  4Z8A A;  1AEY A;  2EBP A;  2F2X A;  3EG3 A;  1AWO A;  2O9S A;  2GQI A;  2SRC A;  2GTO A;  4OMM A;  2JMC A;  3UF4 A;  1CKB A;  2LJ1 A;  1K9A A;  4JPB W;  2YSQ A;  1T3L A;  3VS6 A;  2DYB A;  2PZ1 A;  2LP5 A;  1VYT A;  1YN8 A;  4HVW A;  1PRM C;  1RLP C;  2EYW A;  1YWP A;  1K76 A;  1JXO A;  1NG2 A;  3PVQ A;  1KIK A;  1ABO A;  3NGP A;  1TG0 A;  1M3B A;  1OPL A;  2DVJ A;  2X3W D;  1PKT A;  1A0N B;  5I11 A;  2KE9 A;  3VS0 A;  1H3H A;  1LCK A;  3LH5 A;  2A08 A;  1GCP A;  2P4R A;  1W70 A;  2L3S A;  2J6F A;  2PNI A;  1AWJ A;  1AOJ A;  3VS2 A;  4RTT A;  1PRL C;  5IXB A;  1SRM A;  5IH2 A;  4CC7 A;  1WYX A;  1T0J A;  1AVZ C;  3TSZ A;  2EGA A;  1JXM A;  1QKX A;  1WI7 A;  1NYF A;  1E6H A;  1GCQ C;  2K7A A;  1JQQ A;  2CSI A;  2ED1 A;  1I07 A;  1GRI A;  1QKW A;  1RLQ C;  2GBQ A;  1RUW A;  1NLP C;  2ED0 A;  2NWM A;  1AD5 A;  1WXT A;  2RQV A;  1WFW A;  3I35 A;  3PVL A;  2VVK A;  2LJ3 A;  1T3S A;  1PHT A;  4J9F A;  3ZL7 C;  1PNJ A;  1AWX A;  1BU1 A;  4GBQ A;  2J05 A;  2LZ6 B;  2QDL A;  3THK A;  1SPK A;  4KRT A;  1UJ0 A;  1CSK A;  1GFC A;  3NHN A;  2D1X A;  4LN2 A;  3QWX X;  1Y0M A;  1YP5 A;  3M0S A;  2RQT A;  3VS5 A;  2KYB A;  3UA7 A;  1AWW A;  2I0N A;  1UEC A;  2EQI A;  2KT8 A;  1ZUK A;  1K4U S;  2FPF A;  1RI9 A;  1TUD A;  2D0N A;  1MV0 B;  2H8H A;  2GGR A;  2LX7 A;  2C0T A;  2RPN A;  3M0R A;  3EG1 A;  4AFZ C;  2KRN A;  1E7O A;  1K1Z A;  1M8M A;  2CRE A;  2DF6 A;  4F14 A;  2EGC A;  2MOX A;  4LE9 A;  1PKS A;  1I0C A;  1MUZ A;  2PTK A;  3EHR A;  2BZ8 A;  3H0F A;  4JJC A;  2CT4 A;  4HXJ A;  4QT7 A;  4RTW A;  2C0O A;  5IXF A;  2LNH B;  3O5Z A;  1X43 A;  1GBR A;  2CH4 A;  3EG2 A;  2K2M A;  1B3Q A;  2AZS A;  1IO6 A;  2X3X D;  3H0I A;  5HCK A;  5I22 A;  1U3O A;  1BBZ A;  4J9I A;  1ZSG A;  2W0Z A;  2MIO A;  4J9H A;  2HCK A;  4JZ4 A;  2DL4 A;  2DL8 A;  1N5Z A;  3CQT A;  1X2Q A;  2EYX A;  1HJD A;  1ABQ A;  1UHF A;  1G2B A;  2YUP A;  1QWE A;  3SHW A;  1SHG A;  2LMJ A;  4OML A;  2KNB B;  4RTZ A;  1ZX6 A;  1M3A A;  1ZUU A;  4AG2 C;  1OEB A;  2DX1 A;  2KXC A;  4RUG A;  1GL5 A;  1NEB A;  3JV3 A;  3I9Q A;  2ROT A;  3REB B;  4DEY A;  1J3T A;  1XOV A;  4DEX A;  2CT3 A;  1GCQ A;  2K3B A;  2FPE A;  2L3Q A;  3QWY A;  1X27 A;  3EG0 A;  2FPD A;  2BZX A;  1NLO C;  2YDL A;  4J9G A;  1Z9Z A;  2RF0 A;  1KFZ A;  1I1J A;  4EIK A;  3REA B;  4FSS A;  2K79 A;  5IHN A;  3M0Q A;  1V1C A;  2A28 A;  1VA7 A;  3FJ5 A;  4HVU A;  2DLP A;  1NM7 A;  2DBM A;  3I5S A;  5EC7 A;  2KYM A;  1W1F A;  1SSH A;  1X6G A;  2HEQ A;  2CDT A;  2ECZ A;  4Z89 A;  1YNZ A;  2A37 A;  2D8H A;  2CH4 W;  3H41 A;  3H0H A;  2JT4 A;  5L23 A;  5GJV B;  2FRY A;  1JEG A;  4OMQ A;  2DE0 X;  4LUD A;  4WCI A;  1SHF A;  2M51 A;  2DL5 A;  2DL3 A;  2DRK A;  1UTI A;  3R6N A;  1ZLM A;  4D8D A;  2E5K A;  2CUB A;  1NYG A;  1OOT A;  1WX6 A;  1SRL A;  4Z88 A;  1WDX A;  2KEA A;  2LQN A;  1WXB A;  2KGT A;  4RTY A;  2SEM A;  3VS7 A;  2KBT A;  2RMO A;  1ARK A;  2J06 A;  3RNJ A;  4A63 B;  2JW4 A;  4CC4 B;  1S1N A;  4AFQ C;  1U5S A;  1FMK A;  1WIE A;  4HVV A;  2BZY A;  1JU5 C;  1KJW A;  2EYZ A;  3VS1 A;  2JS0 A;  1JO8 A;  1M27 C;  2OAW A;  2VKN A;  2O88 A;  1X6B A;  4J9B A;  2LQW A;  3EGU A;  3KFV A;  2M0Y A;  1Y57 A;  4X1V A;  4IIO A;  2LCS A;  1H8K A;  3NMZ C;  2L2P A;  4ORZ A;  1X69 A;  1QCF A;  2ROL A;  4OMP A;  5IHI A;  1WA7 A;  2CUD A;  3VRY A;  2LJ0 A;  4LNP A;  2J6O A;  3C0C A;  1UG1 A;  2O2O A;  2W10 A;  1UUE A;  2EW3 A;  4RTU A;  4M4Z A;  1TUC A;  2KRM A;  3RBB B;  2KR3 A;  1ZBJ A;  4AFU C;  4RTV A;  2AKK A;  2HBW A;  1QWF A;  2O9V A;  1UE9 A;  2L3P A;  4ZNX A;  2GTJ A;  3UAT A;  1H92 A;  2RQW A;  4RTX A;  1T0H A;  1UDL A;  2RNA A;  1M3C A;  3GBQ A; 
#chains in the Genus database with same CATH topology
 4F17 A;  4M7A B;  2EGE A;  2DJQ A;  4FYY B;  2PUK B;  2NUZ A;  2LRQ A;  2C0I A;  2XID A;  2EVR A;  2EQK A;  2K2V A;  3PE0 A;  1D0Y A;  1PD1 A;  3EGD B;  1D1C A;  5FWC A;  3URG A;  4A54 A;  5D6Y A;  2QI2 A;  4J7I A;  1KG1 A;  1GXI E;  3OYK A;  3DB4 A;  2F2W A;  2CS7 A;  4AMC A;  3VS3 A;  4EMK A;  3KBG A;  4C92 D;  2DK3 A;  1BB9 A;  2EQM A;  2K5I A;  2DMO A;  3CCQ T;  4EMG A;  1KK7 A;  3JAM E;  3JCM Q;  3GNG A;  4QQD A;  5GAO l;  3HFO A;  3CMA A;  2D6F A;  2JTE A;  4HKE A;  1VQN T;  3CCJ Q;  2YRV A;  2G6F X;  2HMA A;  3CBO A;  2OTJ A;  1OPK A;  4C5H A;  3GF5 A;  3OBY A;  4JJB A;  4KGZ B;  1N9R A;  2COY A;  4J9D A;  3IQL A;  3QII A;  2JVV A;  1ZBX A;  2DM1 A;  5GAN f;  2YT6 A;  2ZPB B;  4RG8 A;  1U1T A;  3CCV A;  2QTV A;  1Z9Q A;  2LVM A;  5CIU A;  5CQX A;  3P8D A;  2HDA A;  4M7D E;  2M16 A;  1P92 A;  5KYU A;  1XNI A;  3EHQ A;  4F7U E;  5GAN 5;  3CD6 T;  1RAG B;  3CC4 Q;  2F2V A;  4K11 A;  2B86 A;  2EAY A;  4BDZ A;  4QW2 A;  3TVT A;  1YJ9 T;  4BY6 B;  2CP3 A;  1M30 A;  1HD3 A;  5AT1 B;  2V1Q A;  3CCM T;  2DXB A;  4XTY A;  1YI2 T;  3U23 A;  2CYZ B;  2J6K A;  5HY6 A;  2VWF A;  5HK3 A;  3TRE A;  4FM4 B;  3J81 E;  2A3L A;  3V7C A;  4AFS C;  2LC4 A;  2V1R A;  4R55 A;  2YUQ A;  4RCB A;  5D6X A;  4BDY A;  2F2X A;  2KAF A;  2YXY A;  3CCQ A;  1VQ8 T;  4MDW A;  1VQO Q;  2GTO A;  2MPX C;  4OMM A;  1BCO A;  1N8R C;  3JB9 H;  2LJ1 A;  2YSQ A;  3CC2 Q;  1R0C B;  3VS6 A;  4C8Q D;  3OS0 A;  2DO3 A;  3VU3 C;  2D0Q B;  1VQN A;  3JRZ A;  1Q82 R;  4HVW A;  5GAN h;  3S6W A;  3PMT A;  3RES A;  1Y07 A;  2VXF A;  2QGF B;  1NG2 A;  3PVQ A;  1KD1 R;  2RA2 A;  2WSF E;  3NGP A;  2E3I A;  4M77 G;  2CP5 A;  1OPL A;  2X3W D;  6AT1 B;  4OGE A;  1Q86 C;  3JCM h;  2OAU A;  4HA8 A;  1YJN Q;  2E4H A;  5FRN A;  1TXQ A;  1GCP A;  2RD1 A;  2P4R A;  1RAI B;  3CME T;  1AWJ A;  4PJN A;  1XQH A;  5IXB A;  3HHT B;  2CP7 A;  1VQ4 T;  1NE8 A;  4CC7 A;  1WYX A;  2QQB A;  1AVZ C;  3HRU A;  1WI7 A;  1NYF A;  3PFS A;  3QJY A;  1GCQ C;  2K7A A;  1JQQ A;  3ME9 A;  2E5Q A;  1NJI R;  2ED1 A;  3MEU A;  3CCM A;  1GRI A;  4XTV A;  3QG1 A;  1YI2 A;  1RLQ C;  1BI2 A;  3RUX A;  4RG2 A;  2NWM A;  4M7D B;  1C1A A;  4XTW A;  1MND A;  1PHT A;  4J9F A;  3EH2 A;  2MAM A;  3FB9 A;  3I56 Q;  3L2W A;  4GBQ A;  2V8J A;  2MWO A;  2DXC A;  2H3E B;  3CPF A;  1VQL A;  4FT2 A;  1GFC A;  1VQ8 A;  3NTK A;  4ME7 A;  4OVA A;  1Y0M A;  5IN1 A;  4BI3 A;  5A0G A;  1W2B P;  3L2Z A;  4DQ2 A;  2FZK B;  2M9U A;  1UEC A;  5J39 A;  1ZUK A;  2FZG B;  4PFO A;  1IXD A;  3CCE Q;  2LQ8 A;  5LJ5 e;  4DBQ A;  2M02 A;  1AT1 B;  1KQS A;  2DYI A;  2DD5 A;  4PJO E;  3JCM V;  1MHN A;  2KRN A;  4D6W A;  4BD3 A;  1K1Z A;  2KQW A;  1I0C A;  1VQK Q;  2BZ8 A;  2HKN A;  4JJC A;  2CT4 A;  2E12 A;  4Z02 A;  5GAN d;  2LQK A;  2F5K A;  3RDV A;  1C6V X;  2O4X B;  2X9H A;  4FW1 A;  1GBR A;  2HSE B;  2HQX A;  2JTM A;  3EG2 A;  1K73 U;  4NL3 A;  3H0I A;  4PJJ A;  5HCK A;  1U3O A;  5LJ5 j;  4ATO A;  3KUF A;  4DOV A;  3JCM d;  2W0Z A;  3PTA A;  2DEU A;  4J9H A;  2RJC A;  1D0X A;  1VQ6 T;  2DL4 A;  1QVG A;  1N5Z A;  1X2Q A;  1HJD A;  4IUT A;  4KUL A;  2RB6 A;  1G8X A;  4KBM B;  3SHW A;  1Q7Y U;  3EFR A;  3CEY A;  1I8F A;  4MML A;  4RTZ A;  2KNB B;  4QVC A;  1ZUU A;  1YJW T;  5C0M A;  1OEB A;  2DX1 A;  3G6E A;  5FU7 B;  1D3B A;  2LTO A;  4M75 G;  3REB B;  2A7Y A;  1XOV A;  5M9O A;  3M56 A;  1GCQ A;  2FPE A;  2L3Q A;  2RO0 A;  1X27 A;  3M9Q A;  1HXD A;  3QHS A;  4J9G A;  2QEX Q;  5DY9 A;  2HQH A;  1Z9Z A;  3CXC P;  4N0A A;  3REA B;  4FSS A;  2RJE A;  3SWN C;  2A28 A;  3PIO A;  3CBP A;  1K9M U;  1RAH B;  3RMS A;  2XG8 D;  2EQJ A;  2CZ0 B;  3X25 B;  1W1F A;  1SSH A;  3FIF A;  4C8Q C;  4XTX A;  4Z89 A;  1Y71 A;  3C12 A;  2CH4 W;  5L8R E;  3VKI A;  2K3X A;  2RH2 A;  4C0D B;  4O6J A;  4WCI A;  3TEE A;  2DRK A;  2E5K A;  3OW2 P;  1OOT A;  2VAS A;  4LDY A;  3G71 Q;  5CK9 A;  3TU4 K;  1ZSZ B;  5GAO q;  1QMC A;  2F1L A;  2LCC A;  2OTL T;  3VS7 A;  2DTO A;  2KBT A;  3UT1 A;  1ARK A;  2JW4 A;  1VQ6 A;  4AFQ C;  2JOY A;  4PJM A;  3EGX A;  4HVV A;  2BZY A;  4XAX B;  3OS2 A;  3CPW P;  1RAB B;  3VJP A;  1UGQ B;  2C06 A;  2X4W A;  1X6B A;  2DTI A;  2E3H A;  3G4S T;  1JJ2 A;  3EGU A;  2M0Y A;  1MGQ A;  3NMZ C;  2L2P A;  2MYS A;  2I2L A;  3CD6 Q;  4OMP A;  4M7A C;  1WA7 A;  2QYZ A;  5GAM g;  2J6O A;  1UG1 A;  5EG2 A;  5GAN 2;  3LW5 E;  1WHM A;  3CCJ A;  4FT4 A;  3FLG A;  1YJ9 Q;  4RTU A;  2OX7 A;  4M4Z A;  2KRM A;  5GMK i;  3VUZ A;  3OS5 A;  1YHQ Q;  2KR3 A;  5CKE A;  3MEW A;  4EPC A;  2AKK A;  3SB2 A;  2F69 A;  1M2O A;  5LJ3 g;  1Y96 A;  3C94 A;  5GAO r;  1H92 A;  3OYG A;  1YJN T;  4ZGE B;  5GAN 6;  1M3C A;  4MZP A;  3GBQ A;  3PGG A;  1UGV A;  1OV3 A;  2QA4 T;  1PM3 A;  4PLL A;  2KT1 A;  3OW2 A;  2Y90 A;  2WAC A;  2FEI A;  4OMO A;  1VQ8 Q;  4M78 E;  4JZ3 A;  1U8R A;  1PSF A;  3CC4 A;  3SWN A;  1QCN A;  4E7K A;  2R57 A;  3UWN A;  3OS1 A;  2EYY A;  5KYW B;  2JM9 A;  4ZGJ B;  2RJD A;  4M77 E;  4GLM A;  3T9N A;  1Q82 U;  5ECA A;  2CSQ A;  3CPW A;  3EG9 B;  4OMN A;  5DLO A;  4JS5 A;  3QYG B;  1K73 C;  3I56 T;  1KD1 U;  3MJX A;  3I5R A;  1M9S A;  1WLP B;  2MK5 A;  2XU8 A;  5KYX A;  1B34 B;  1WHH A;  4EMK C;  4R0K A;  3CME Q;  4FL6 A;  4PFP A;  4FU6 A;  1VQ4 Q;  4ZTJ A;  1Q7Y C;  2L0A A;  3E9F A;  4IUQ A;  3RER A;  2RHY A;  2ZAE A;  4A4E A;  3QUI A;  4BY6 C;  2X51 A;  1HSQ A;  2CKK A;  2DZC A;  3QDF A;  1WHJ A;  1NJI U;  1PSE A;  2YWW A;  2JS2 A;  2ESW A;  1NPP A;  3NPF A;  1YJN A;  2MMP A;  5GAM f;  2VYT A;  1D1A A;  4M7A A;  4PK4 A;  5GAN g;  4AG1 C;  2DL7 A;  1K9M C;  3TSW A;  5IT9 E;  2ZCF B;  1NEG A;  1WJQ A;  2FRW A;  5GMK l;  3EGD A;  3ULR B;  2OJ2 A;  2ZPE B;  2X4X A;  5LJ3 f;  4E6R A;  3JCM g;  3LGF A;  2KY9 A;  3QSU A;  1VYV A;  2EQU A;  4YTL A;  4Y28 E;  3I56 A;  1MV3 A;  2YLC A;  2JJ9 A;  2YRC A;  1O9S A;  2COZ A;  1AWO A;  1YBY A;  1PD0 A;  1OZ2 A;  4E7J A;  1CKB A;  2R5A A;  3SDZ A;  2DEQ A;  2L3R A;  1IGQ A;  4P5N A;  3A8H B;  3D7S B;  4C92 G;  2NUT B;  4M77 B;  1RAD B;  2QEX T;  1IHW A;  3QXE B;  1VYT A;  1YN8 A;  2IPO B;  3INZ A;  2QXF A;  1PRM C;  2B8A A;  3M5A A;  4JLG A;  1RLP C;  3S3M A;  2JN0 A;  3KXT A;  1K9M R;  3CCE A;  1PG5 B;  3V7R A;  4KT0 E;  3QYH B;  3LX7 A;  1VQ6 Q;  2P4T A;  1M3B A;  5KCO A;  5GAM h;  4N4G A;  3OYL A;  4M75 E;  3VS0 A;  4M7D C;  1FX7 A;  1VQK A;  4A4G A;  1YJW Q;  1W70 A;  1QVF P;  1AOJ A;  3VS2 A;  1LVK A;  4C8Q F;  4DBR A;  1SRM A;  5LJ3 h;  3DKM A;  1I4K 1;  1KQ1 A;  2EGA A;  3A5Z B;  1QKX A;  2A0F B;  3JCM X;  3G71 T;  1E6H A;  2IG0 A;  3HPW A;  2GQV A;  3MET A;  3MP8 A;  3JCM c;  2GBQ A;  1VQM Q;  1RUW A;  1VIF A;  3OYJ A;  2ED0 A;  4MZT A;  2RQV A;  3I35 A;  4O5V A;  4XTZ A;  2LJ3 A;  1T3S A;  4FYV B;  4GLK A;  4N4H A;  4ZN3 A;  2LZ6 B;  2QDL A;  3THK A;  1SPK A;  4KRT A;  2HL5 C;  3LYI A;  1CSK A;  2K5F A;  4XQ3 A;  1N6A A;  2EKO A;  2QG9 B;  5KYY B;  3JCM f;  1Q82 C;  3VS5 A;  2HL3 A;  1MMA A;  2Z0W A;  3G7Z A;  2QEX A;  3CBM A;  1OU9 A;  1KD1 C;  2ATC B;  4ZTF A;  2FPF A;  1RI9 A;  1LNX A;  1KQS S;  1WHK A;  1MV0 B;  5CR2 A;  4M7A F;  4FYW B;  2OTL Q;  2LX7 A;  2VXE A;  3RMQ A;  4AFZ C;  1YHQ T;  1QCO A;  2M0O A;  1BKB A;  1M8M A;  4B9W A;  2QQS A;  4C8Q G;  4DBH A;  1QVF A;  2JTF A;  2LNH B;  4PJL A;  1X43 A;  4JDS A;  1VQ7 T;  3G4S Q;  4FSX A;  2KDS A;  3RKW A;  5FU7 C;  2K2M A;  1R0B G;  2AZS A;  1NJI C;  2G3R A;  3OY9 A;  1KHC A;  5I22 A;  3G71 A;  5GAM d;  2DAQ A;  3X20 B;  1ZSG A;  4Q5W A;  2MIO A;  4ZGD B;  4QKU A;  1QVG S;  3GP8 A;  4JZ4 A;  1N27 A;  4M7D A;  4M75 B;  2O01 E;  4BE0 A;  4LDW A;  3MO8 A;  2YUP A;  1Q81 R;  1BYM A;  2YHT A;  3BDU A;  4OML A;  2E6Z A;  5LJ3 d;  4F7U A;  2R58 A;  2NYS A;  1TOV A;  3LWI A;  1VQP Q;  1S72 T;  1GL5 A;  5FU6 B;  1ZA2 B;  2ROT A;  1SKU B;  2YLB A;  1FMW A;  1Y7X A;  2DIQ A;  4UC4 A;  2K3B A;  2WSC E;  2QA4 Q;  3EG0 A;  1D0Z A;  2FPD A;  1W4S A;  2Y4Y A;  2XHC A;  3CD6 A;  3BW1 A;  3AT1 B;  1IRX A;  1KFZ A;  1I1J A;  4EIK A;  2DIG A;  5KH6 A;  2K79 A;  5IHN A;  3M0Q A;  5GAN 4;  4J7F A;  1V1C A;  1YJ9 A;  3C95 A;  1ZSZ C;  1IGU A;  3RR6 A;  4PJO C;  1NM7 A;  1D09 B;  1YHQ A;  2V8K A;  2KYM A;  1M2V B;  4N0A C;  3BDL A;  4M7A D;  3H41 A;  3H0H A;  2MF2 A;  5L23 A;  3P8H A;  3OBW A;  4E7Z A;  1JEG A;  2DE0 X;  4LUD A;  1SHF A;  2DL5 A;  2O4X A;  3R6N A;  4JJN K;  4X34 A;  4D8D A;  2X35 A;  2CUB A;  4LDU A;  1KHI A;  4Z88 A;  8AT1 B;  2CP0 A;  4LD6 A;  2KEA A;  1WXB A;  5CCA A;  3RIR A;  2AT1 B;  3O8V A;  4LXC A;  4RTY A;  4KH0 B;  3MCA B;  3OA6 A;  2J06 A;  3RNJ A;  4KGX B;  4A63 B;  4F04 B;  2RHI A;  3M55 A;  2CZ7 B;  3OYA A;  1U5S A;  3QDR B;  3OYF A;  1WIE A;  9ATC B;  2VV5 A;  3VS1 A;  1JO8 A;  3E9G A;  2NUP B;  1JJ2 S;  1M27 C;  1VQ9 T;  2VKN A;  4QVZ A;  2O88 A;  3L2Q A;  4IUV A;  3KFV A;  2V26 A;  4IIO A;  1YIJ Q;  5DLQ E;  1YIT Q;  1JRI A;  4IUP A;  1QCF A;  3CME A;  5IHI A;  3VRY A;  5CVI A;  3L2U A;  2O2O A;  1VQ4 A;  4FYX B;  3S3N A;  1ZBJ A;  4RTV A;  5CAI A;  3MP6 A;  2E6N A;  2HBW A;  4FW2 A;  3ZFJ A;  2GTJ A;  4RTX A;  1UDL A;  2RNA A;  2QQ9 A;  3OW2 S;  1WGS A;  1WHL A;  1FYN A;  1ZHI A;  4C92 E;  1K0X A;  2DXT A;  2P0K A;  1X01 A;  1ZUY A;  4LUE A;  4WF2 A;  1IB8 A;  1N9S A;  1VQ5 T;  4M7D F;  2RN8 A;  4AT1 B;  3OYB A;  3L1A A;  4JJD A;  1ZSZ A;  1UHC A;  3I55 T;  4F7U F;  1W2B A;  4IIM A;  4E47 A;  5A0D A;  4PJO A;  5GAO n;  1VQM T;  1OQK A;  2K4Y A;  3Q1J A;  4L6V 5;  3CPW S;  3FEO A;  4QQG A;  1W6X A;  2HKQ B;  4B9X A;  3VV0 A;  2DBK A;  4RKU E;  4X9D A;  4ELZ C;  1X6O A;  4JRP A;  1YCS B;  3OYC A;  5KCH A;  3HTR A;  2JXB A;  1X75 C;  2KRO A;  2VUB A;  4J9C A;  3GPL A;  2FG0 A;  2GNC A;  5GAN 3;  4CC2 A;  2PQW A;  1CKA A;  2XDB A;  4J5Y A;  4Y92 A;  4CC3 A;  3DLL A;  3VRZ A;  4XU0 A;  4NL2 A;  2ZGW A;  1UEB A;  2HZY A;  3MKD A;  4J6X A;  3OSV A;  3HRT A;  1G83 A;  2E10 A;  2ZPH B;  5GJW B;  1PC0 A;  1QP3 A;  3M0T A;  2BTT A;  3JCM b;  1EFN A;  1QLY A;  4MDX A;  3A1P A;  2KRS A;  2GFA A;  1GFD A;  1E6G A;  2QGG A;  2D8J A;  1D3B B;  3L2V A;  5GMK e;  2O31 A;  2KXD A;  2HAX A;  1YWO A;  4KGV B;  1YJW A;  1QP2 A;  2RI2 A;  1U06 A;  4F7U G;  3OB9 A;  2DTH A;  3HP9 A;  2V8I A;  1BI0 A;  3BE3 A;  2MCN A;  2ENM A;  2QQA A;  3CCU T;  4M78 C;  2RQU A;  2FO0 A;  2DNU A;  3VYG A;  4XU2 A;  2JM8 A;  1PCX A;  1UFF A;  2K57 A;  1PWT A;  4C0G A;  5KYW A;  1KSW A;  2HQE A;  2EKH A;  1UJY A;  4JRI A;  4M7D D;  3CXC A;  2CZ1 B;  3NTH A;  4QVD A;  3C4S A;  4M77 C;  3QJ6 A;  5I21 A;  5GAM e;  1RAC B;  1VQM A;  2DA9 A;  2DD4 A;  5GMK j;  2KSS A;  3EG9 A;  1VYU A;  4OGC A;  1BIB A;  2EPD A;  4C92 B;  2K6D A;  1BI3 A;  2PVG B;  1AEY A;  3MEA A;  1VQP T;  1KQ2 A;  3A8L B;  2EBP A;  2GQI A;  1B34 A;  1M90 R;  5LJ3 e;  3UF4 A;  3H8Z A;  4A4K A;  4JPB W;  2XI9 A;  1OI1 A;  4XU1 A;  1VQ7 Q;  1T3L A;  3TQ7 P;  4OB0 B;  2ZPI B;  1UGR B;  3PT9 A;  2QDY B;  1K76 A;  1JXO A;  1FMV A;  3HFN A;  1NBE B;  3EGX B;  3JCM J;  2OTL A;  1TG0 A;  2PUO B;  5LL6 S;  3RKY A;  4JS4 A;  2DVJ A;  4FCY A;  1WJS A;  1PKT A;  1A0N B;  3X26 B;  5C6S A;  2KE9 A;  1H3H A;  5HK0 A;  2QQR A;  3M57 A;  5LJ3 j;  3H6Z A;  5I2S A;  2PVO B;  1BIA A;  2L3S A;  2J6F A;  1WJR A;  4PJO F;  1Q81 U;  4DBF A;  1S72 Q;  3LH0 A;  2DET A;  3JB9 F;  4RTT A;  2DXU A;  5IH2 A;  3G4S A;  1T0J A;  3G1J A;  1JXM A;  3QPH A;  2BUD A;  4XK8 E;  4A53 A;  1I07 A;  1OZ3 A;  1TUG B;  4JRK A;  3CC7 Q;  5FRM A;  1QKW A;  3ASK A;  3EH1 A;  3M4Y A;  1AD5 A;  1Y96 B;  1WFW A;  1YFN A;  1TSF A;  3PVL A;  3ZL7 C;  1OX9 A;  1MMD A;  1AWX A;  1PNJ A;  2RI3 A;  4HCZ A;  4CI0 C;  2J05 A;  3AHU A;  5I2M A;  3ZBD A;  4M78 A;  1M8V A;  1UJ0 A;  1WQ7 A;  4BE2 A;  2EIF A;  1VQP A;  3NHN A;  2BKD N;  2CP2 A;  2D1X A;  4RCC A;  5CKH A;  4EMH A;  2VB6 A;  3SWN B;  3JB9 I;  1YIJ T;  1YIT T;  1YP5 A;  5FLX E;  2RQT A;  2KYB A;  2QA4 A;  4L5G A;  2NUT A;  4M77 A;  1HK9 A;  4CRI A;  3UA7 A;  2I0N A;  4MMK A;  2EQI A;  1TH7 A;  4C8Q B;  5GAN e;  3CCS T;  1TUD A;  4IUU A;  2IVW A;  2H8H A;  3GOX A;  3HSB A;  2C0T A;  2RPN A;  3M0R A;  1E7O A;  2E41 A;  1UGP B;  2DF6 A;  3BY7 A;  4F14 A;  2MOX A;  1EZZ B;  1PKS A;  4M75 C;  3MP1 A;  3JCM e;  1QVF S;  3M4G A;  4A4H A;  2PTK A;  3EHR A;  2BIV A;  4RTW A;  4OP0 A;  3QZ9 B;  2C0O A;  1VQ9 Q;  4DA4 A;  4V2S A;  5LJ5 d;  1KC8 R;  3QZ5 B;  2AIR B;  3R6O A;  4BB7 A;  3QBY A;  1K8A R;  5DM7 R;  2OTJ T;  5CKD A;  2CH4 A;  4OF1 A;  4PJO D;  5GAN j;  5D6W A;  2CGH A;  3OMG A;  3JB9 D;  1BBZ A;  4J9I A;  2HCK A;  3EFO B;  3CCV T;  2KVQ G;  4J6W A;  3SD4 A;  2CZ6 B;  1OX8 A;  4A4F A;  2DL8 A;  3CQT A;  2XIC A;  1UHF A;  2QTX A;  3J7A F;  1QWE A;  2MI6 A;  3FC3 A;  4TVR A;  2QAS A;  4XTU A;  1SHG A;  1ZX6 A;  4KUI A;  1BCM A;  3HKS A;  5GAO m;  4RUG A;  1OYX A;  1FXX A;  4HT8 A;  3I9Q A;  4OMF B;  4HCC A;  1G3T A;  4BUG A;  4GY5 A;  4PFZ A;  4DEY A;  4DEX A;  2CT3 A;  2EJG A;  5AYF A;  4OB1 B;  5KYY A;  1YIJ A;  1ZQ1 A;  1YIT A;  1M1F A;  1NLO C;  4PNO A;  1VQ5 Q;  4B6M A;  1B7T A;  4FIB A;  2JZ2 A;  3I55 Q;  3CCS A;  3L2R A;  5J3B A;  2COW A;  2K5L A;  2GF7 A;  1RI0 A;  2GFU A;  5A0L A;  3V8K A;  2ECZ A;  2A37 A;  2D8H A;  2FRY A;  4J8O A;  1I5O B;  1R77 A;  2LCL A;  2M51 A;  2K3Y A;  1UTI A;  1ZLM A;  1I5L A;  3LGL A;  1NYG A;  3A8M B;  4JLI A;  2LQN A;  1M1G A;  1V76 A;  1HYO A;  4M78 F;  2RMO A;  2EFI A;  1Q81 C;  1G3S A;  4M75 A;  1S1N A;  3M59 A;  4EMK B;  2JUF A;  3MEV A;  3M58 A;  1KJW A;  4M77 F;  4WTO B;  1FWZ A;  2OAW A;  4J9B A;  2P0Q A;  1M1K U;  2LQW A;  4X1V A;  2LCS A;  2VGM A;  3E2U A;  4BE1 A;  2ROL A;  3GNF B;  1H64 1;  5KE3 A;  2LJ0 A;  2PU9 B;  2XDD A;  3CCU Q;  3F70 A;  4LNP A;  4ZN1 A;  3OQ5 A;  1QVP A;  1UUE A;  2HNI A;  5J26 A;  2EW3 A;  1JB0 E;  4PKC C;  5CKF A;  3OYN A;  5KE2 A;  3RBB B;  4AFU C;  4JUV A;  1QWF A;  2RI5 A;  1VQL T;  1M2V A;  2E1H A;  3E19 A;  1UE9 A;  4E7L A;  3UAT A;  2JNG A;  2RQW A;  4C0Z A;  2VGN A;  3CCL Q;  1T0H A;  5KYU B;  4VUB A;  1BK2 A;  4J83 A;  3M0U A;  3ER0 A;  3VYH B;  4M78 G;  1IHV A;  3OYY A;  1W2B S;  4C0D C;  4JRQ A;  1M90 U;  2KK4 A;  4M7A G;  2YUN A;  2EJ9 A;  1KQS P;  1GBQ A;  1RAA B;  2RJF A;  3CC7 T;  2AKL A;  1B07 A;  2DIL A;  3VS4 A;  4KUD K;  3JCM W;  1AZG B;  3QO3 A;  2IIM A;  4M78 D;  3SEM A;  1TWB A;  1AZE A;  2NUP A;  4OB3 B;  3OYM A;  1WNL A;  2L89 A;  4F16 A;  3GLX A;  3MPU B;  3HRS A;  1ACM B;  1EIF A;  4BI4 A;  5IAY A;  3OYE A;  4M77 D;  3L42 A;  4ESR A;  5GAN 7;  2ZZD A;  1M4Z A;  2YUO A;  2P0P A;  5GAO p;  1N8R R;  3JSC A;  1VQ7 A;  2X4Y A;  1K0S A;  2BE9 B;  1O75 A;  3EAE A;  3X24 B;  1BI1 A;  2DRM A;  1QVG P;  2RK1 A;  2A36 A;  4KH1 B;  3MHX A;  2DPP B;  3WVE B;  5A2Q E;  3FRN A;  2RM4 A;  4HCK A;  4F7U B;  3G6E T;  3CCR Q;  2K9G A;  4J9E A;  2XKO C;  2XMF A;  2D9T A;  2JMA A;  1UB4 A;  2RHZ A;  1Q86 R;  1TS9 A;  3M0P A;  4IUR A;  2RQR A;  4D8K A;  3QKJ A;  2EJF A;  2OI3 A;  4C92 C;  2AZV A;  2MWP A;  3PIP A;  1S72 A;  2YRD A;  5FW9 A;  5LJ5 g;  4M75 F;  5FWB A;  3OMC A;  3A98 A;  1WXU A;  2XDP A;  3NFC A;  2CP6 A;  2AK5 A;  3CXC S;  1X2K A;  2FL7 A;  2HSP A;  1IZ6 A;  1I81 A;  3CC7 A;  3CCS Q;  1SF9 A;  2LNV A;  3HL8 A;  2QAZ A;  1NZ9 A;  5IHK A;  2RHU A;  2J7I A;  2E65 A;  2DFU A;  2ABL A;  3UA6 A;  1SEM A;  4C5I A;  7AT1 B;  4Z8A A;  3DB3 A;  1YCY A;  1TU0 B;  3EG3 A;  2O9S A;  4L59 A;  2FHD A;  2SRC A;  3CMA Q;  3ZEH A;  2JMC A;  2DER A;  1K9A A;  2X4J A;  3V8J A;  2DYB A;  2H3J A;  2PZ1 A;  2LP5 A;  2OTJ Q;  1MMN A;  3RKX A;  1KC8 U;  4E7I A;  1K8A U;  2EYW A;  1YWP A;  1M1K C;  1KIK A;  2F5T X;  4C0F A;  1ABO A;  3CCV Q;  3UPU A;  3OYH A;  4PL6 A;  2ZPG B;  5I11 A;  1LCK A;  3LH5 A;  2A08 A;  5CO7 A;  1JJ2 P;  3M54 A;  2LT1 A;  3JCM P;  4NS5 A;  3OYD A;  2PNI A;  1WZO A;  4MZM A;  2DJZ A;  4C5G A;  1VQ9 A;  3J80 E;  1PRL C;  3CCJ T;  3A8G B;  5D7U A;  3TSZ A;  1SSF A;  4E7S A;  2CSI A;  1MNE A;  3SFM A;  4M75 D;  1QW1 A;  2WSE E;  4X9C A;  1NLP C;  1G5V A;  1WXT A;  1JBM A;  2VVK A;  4LD9 K;  3VUB A;  1BU1 A;  1WPY A;  4C92 A;  1VOM A;  5LJ5 f;  1M1K R;  3P8B B;  4E2F B;  1M90 C;  3CCQ Q;  1F1B B;  4LDV A;  4M7D G;  3CC4 T;  4RMO A;  3JB9 J;  4Y91 A;  2PVD B;  3UDC A;  4LN2 A;  1D1B A;  3QWX X;  3M0S A;  1VQN Q;  1DJ7 B;  3GIB A;  4XU3 A;  4PJO B;  1AWW A;  1LJO A;  1VQ5 A;  2KT8 A;  4J6Y A;  1K4U S;  2LX9 A;  2DKG A;  4DOW A;  1TTH B;  2E70 A;  2D0N A;  1SG5 A;  2GGR A;  3I55 A;  2HBP A;  2RHX A;  3EG1 A;  4NOY A;  2LT4 A;  2R5M A;  3FDR A;  1UGS B;  4C8Q E;  1VIE A;  2CRE A;  3M53 A;  2EGC A;  8ATC B;  4LE9 A;  1MUZ A;  1G3Y A;  3H0F A;  2DZ9 A;  5GAN 8;  3CCL T;  1VQO T;  2RK2 A;  4HXJ A;  4QT7 A;  1RAF B;  5IXF A;  3O5Z A;  3CC2 T;  1Q95 G;  2FZC B;  1B3Q A;  2NLU A;  3V7S A;  1IO6 A;  1NPR A;  2X3X D;  4QQ6 A;  2L5Q A;  3CCM Q;  1YI2 Q;  5CQY A;  2E64 A;  4HCB A;  2BE7 D;  5LJ5 h;  2KMT A;  2EYX A;  5GAM j;  1ABQ A;  1G2B A;  1RAE B;  3PMI A;  2LMJ A;  3PNW C;  4EDU A;  1M3A A;  2EYQ A;  4AG2 C;  4II1 A;  1VQL Q;  3BFM A;  2KXC A;  1NEB A;  2EWN A;  5FRO A;  3JV3 A;  3N5B B;  1J3T A;  2QK0 A;  3A8O B;  3S3O A;  3QWY A;  4BI8 B;  1OU8 A;  2BZX A;  2GCX A;  2M1H A;  4C5E A;  4M7A E;  2YDL A;  3V8L A;  4LDX A;  1C0M A;  3CCU A;  4E7H A;  4C8Q A;  2RF0 A;  1QQJ A;  3LWH A;  1AHJ B;  1VA7 A;  3FJ5 A;  4HVU A;  2DLP A;  2ZPF B;  1XJW B;  2DBM A;  3I5S A;  2Y4X A;  4OB2 B;  5EC7 A;  1M5Q 1;  3CCR T;  1X6G A;  2HEQ A;  4HT9 A;  2CDT A;  1YNZ A;  2AHJ B;  2JT4 A;  4ANJ A;  5CKB A;  5GJV B;  1KC8 C;  1R8O B;  1U1S A;  3CCL A;  1VQO A;  4PLI A;  2LDM A;  2VC8 A;  4OMQ A;  1K8A C;  5GMK m;  3WXM B;  2DL3 A;  1OUL A;  3CC2 A;  4R56 A;  3X28 B;  2KI7 A;  1EX4 A;  1WX6 A;  1SRL A;  1WDX A;  3DLM A;  3CCE T;  4C92 F;  2KGT A;  2SEM A;  3EFO A;  1N8R U;  2FB7 A;  1H3Z A;  2XD0 A;  1WHG A;  3WVD B;  4N4I A;  4CC4 B;  2FYK A;  1FMK A;  4BAC A;  3E1S A;  1VQK T;  1JU5 C;  2EYZ A;  3TCJ A;  2FVU A;  3G6E Q;  2JS0 A;  2DVE A;  4PJO G;  4ELY C;  1K73 R;  1LPL A;  3JB9 G;  1IRE B;  5KYX B;  1LOJ A;  1Y57 A;  3EFS A;  3CMA T;  1RL2 A;  1H8K A;  2L8D A;  4ORZ A;  1X69 A;  2P84 A;  1Q86 U;  2CUD A;  3NTI A;  3C0C A;  5FU6 C;  5KYN A;  2W10 A;  3H9N A;  3LLR A;  1WQW A;  1Q7Y R;  1TUC A;  1G3W A;  3OSS C;  1XTD A;  4IKF A;  2XK0 A;  5HKC A;  3OYI A;  2O9V A;  3FJP A;  1VUB A;  3CCR A;  4M78 B;  1V29 B;  5GMK h;  1ZA1 B;  2L3P A;  4ZNX A;  1MMG A;  2HD0 A; 
#chains in the Genus database with same CATH homology
 4F17 A;  1FYN A;  1UGV A;  1BK2 A;  1OV3 A;  2EGE A;  2DJQ A;  1K0X A;  2KT1 A;  3M0U A;  4LUE A;  1ZUY A;  2FEI A;  4OMO A;  2NUZ A;  2C0I A;  4JZ3 A;  2EVR A;  2RN8 A;  3PE0 A;  4JJD A;  1UHC A;  2EYY A;  4IIM A;  2JM9 A;  5FWC A;  2YUN A;  1GBQ A;  2AKL A;  1B07 A;  4GLM A;  2F2W A;  3VS3 A;  2DIL A;  5ECA A;  1W6X A;  3VS4 A;  2CSQ A;  1AZG B;  1BB9 A;  2DBK A;  4OMN A;  2DMO A;  2IIM A;  3SEM A;  3I5R A;  1YCS B;  1AZE A;  2JXB A;  4F16 A;  2KRO A;  4J9C A;  1WLP B;  2FG0 A;  2GNC A;  4CC2 A;  1CKA A;  4Y92 A;  4CC3 A;  4R0K A;  3VRZ A;  4ESR A;  2JTE A;  2YUO A;  2G6F X;  2L0A A;  1G83 A;  1K0S A;  1OPK A;  5GJW B;  2DRM A;  4JJB A;  2A36 A;  3M0T A;  2BTT A;  1EFN A;  4J9D A;  3IQL A;  1HSQ A;  1QLY A;  2DM1 A;  2KRS A;  1GFD A;  2YT6 A;  4HCK A;  1E6G A;  2D8J A;  1Z9Q A;  2K9G A;  4J9E A;  2HDA A;  2XMF A;  2JMA A;  2O31 A;  2KXD A;  1YWO A;  2JS2 A;  2ESW A;  3NPF A;  3M0P A;  2RQR A;  4D8K A;  3EHQ A;  2OI3 A;  1U06 A;  2AZV A;  5FW9 A;  2ENM A;  2MCN A;  4AG1 C;  5FWB A;  2DL7 A;  2F2V A;  2RQU A;  3A98 A;  4K11 A;  2B86 A;  2FO0 A;  2DNU A;  1WXU A;  3TSW A;  1NEG A;  2FRW A;  2JM8 A;  2AK5 A;  1UFF A;  3TVT A;  1PWT A;  3ULR B;  1KSW A;  1X2K A;  1M30 A;  1HD3 A;  2HSP A;  2OJ2 A;  2V1Q A;  2EKH A;  1UJY A;  3U23 A;  2J6K A;  4E6R A;  2VWF A;  2DA9 A;  1VYV A;  1VYU A;  5IHK A;  2EPD A;  4AFS C;  2J7I A;  2V1R A;  1MV3 A;  2K6D A;  2ABL A;  2YUQ A;  1SEM A;  3UA6 A;  4Z8A A;  1AEY A;  2EBP A;  2F2X A;  3EG3 A;  1AWO A;  2O9S A;  2GQI A;  2SRC A;  2GTO A;  4OMM A;  2JMC A;  3UF4 A;  1CKB A;  2LJ1 A;  1K9A A;  4JPB W;  2YSQ A;  1T3L A;  3VS6 A;  2DYB A;  2PZ1 A;  2LP5 A;  1VYT A;  1YN8 A;  4HVW A;  1PRM C;  1RLP C;  2EYW A;  1YWP A;  1K76 A;  1JXO A;  1NG2 A;  3PVQ A;  1KIK A;  1ABO A;  3NGP A;  1TG0 A;  1M3B A;  1OPL A;  2DVJ A;  2X3W D;  1PKT A;  1A0N B;  5I11 A;  2KE9 A;  3VS0 A;  1H3H A;  1LCK A;  3LH5 A;  2A08 A;  1GCP A;  2P4R A;  1W70 A;  2L3S A;  2J6F A;  2PNI A;  1AWJ A;  1AOJ A;  3VS2 A;  4RTT A;  1PRL C;  5IXB A;  1SRM A;  5IH2 A;  4CC7 A;  1WYX A;  1T0J A;  1AVZ C;  3TSZ A;  2EGA A;  1JXM A;  1QKX A;  1WI7 A;  1NYF A;  1E6H A;  1GCQ C;  2K7A A;  1JQQ A;  2CSI A;  2ED1 A;  1I07 A;  1GRI A;  1QKW A;  1RLQ C;  2GBQ A;  1RUW A;  1NLP C;  2ED0 A;  2NWM A;  1AD5 A;  1WXT A;  2RQV A;  1WFW A;  3I35 A;  3PVL A;  2VVK A;  2LJ3 A;  1T3S A;  1PHT A;  4J9F A;  3ZL7 C;  1PNJ A;  1AWX A;  1BU1 A;  4GBQ A;  2J05 A;  2LZ6 B;  2QDL A;  3THK A;  1SPK A;  4KRT A;  1UJ0 A;  1CSK A;  1GFC A;  3NHN A;  2D1X A;  4LN2 A;  3QWX X;  1Y0M A;  1YP5 A;  3M0S A;  2RQT A;  3VS5 A;  2KYB A;  3UA7 A;  1AWW A;  2I0N A;  1UEC A;  2EQI A;  2KT8 A;  1ZUK A;  1K4U S;  2FPF A;  1RI9 A;  1TUD A;  2D0N A;  1MV0 B;  2H8H A;  2GGR A;  2LX7 A;  2C0T A;  2RPN A;  3M0R A;  3EG1 A;  4AFZ C;  2KRN A;  1E7O A;  1K1Z A;  1M8M A;  2CRE A;  2DF6 A;  4F14 A;  2EGC A;  2MOX A;  4LE9 A;  1PKS A;  1I0C A;  1MUZ A;  2PTK A;  3EHR A;  2BZ8 A;  3H0F A;  4JJC A;  2CT4 A;  4HXJ A;  4QT7 A;  4RTW A;  2C0O A;  5IXF A;  2LNH B;  3O5Z A;  1X43 A;  1GBR A;  2CH4 A;  3EG2 A;  2K2M A;  1B3Q A;  2AZS A;  1IO6 A;  2X3X D;  3H0I A;  5HCK A;  5I22 A;  1U3O A;  1BBZ A;  4J9I A;  1ZSG A;  2W0Z A;  2MIO A;  4J9H A;  2HCK A;  4JZ4 A;  2DL4 A;  2DL8 A;  1N5Z A;  3CQT A;  1X2Q A;  2EYX A;  1HJD A;  1ABQ A;  1UHF A;  1G2B A;  2YUP A;  1QWE A;  3SHW A;  1SHG A;  2LMJ A;  4OML A;  2KNB B;  4RTZ A;  1ZX6 A;  1M3A A;  1ZUU A;  4AG2 C;  1OEB A;  2DX1 A;  2KXC A;  4RUG A;  1GL5 A;  1NEB A;  3JV3 A;  3I9Q A;  2ROT A;  3REB B;  4DEY A;  1J3T A;  1XOV A;  4DEX A;  2CT3 A;  1GCQ A;  2K3B A;  2FPE A;  2L3Q A;  3QWY A;  1X27 A;  3EG0 A;  2FPD A;  2BZX A;  1NLO C;  2YDL A;  4J9G A;  1Z9Z A;  2RF0 A;  1KFZ A;  1I1J A;  4EIK A;  3REA B;  4FSS A;  2K79 A;  5IHN A;  3M0Q A;  1V1C A;  2A28 A;  1VA7 A;  3FJ5 A;  4HVU A;  2DLP A;  1NM7 A;  2DBM A;  3I5S A;  5EC7 A;  2KYM A;  1W1F A;  1SSH A;  1X6G A;  2HEQ A;  2CDT A;  2ECZ A;  4Z89 A;  1YNZ A;  2A37 A;  2D8H A;  2CH4 W;  3H41 A;  3H0H A;  2JT4 A;  5L23 A;  5GJV B;  2FRY A;  1JEG A;  4OMQ A;  2DE0 X;  4LUD A;  4WCI A;  1SHF A;  2M51 A;  2DL5 A;  2DL3 A;  2DRK A;  1UTI A;  3R6N A;  1ZLM A;  4D8D A;  2E5K A;  2CUB A;  1NYG A;  1OOT A;  1WX6 A;  1SRL A;  4Z88 A;  1WDX A;  2KEA A;  2LQN A;  1WXB A;  2KGT A;  4RTY A;  2SEM A;  3VS7 A;  2KBT A;  2RMO A;  1ARK A;  2J06 A;  3RNJ A;  4A63 B;  2JW4 A;  4CC4 B;  1S1N A;  4AFQ C;  1U5S A;  1FMK A;  1WIE A;  4HVV A;  2BZY A;  1JU5 C;  1KJW A;  2EYZ A;  3VS1 A;  2JS0 A;  1JO8 A;  1M27 C;  2OAW A;  2VKN A;  2O88 A;  1X6B A;  4J9B A;  2LQW A;  3EGU A;  3KFV A;  2M0Y A;  1Y57 A;  4X1V A;  4IIO A;  2LCS A;  1H8K A;  3NMZ C;  2L2P A;  4ORZ A;  1X69 A;  1QCF A;  2ROL A;  4OMP A;  5IHI A;  1WA7 A;  2CUD A;  3VRY A;  2LJ0 A;  4LNP A;  2J6O A;  3C0C A;  1UG1 A;  2O2O A;  2W10 A;  1UUE A;  2EW3 A;  4RTU A;  4M4Z A;  1TUC A;  2KRM A;  3RBB B;  2KR3 A;  1ZBJ A;  4AFU C;  4RTV A;  2AKK A;  2HBW A;  1QWF A;  2O9V A;  1UE9 A;  2L3P A;  4ZNX A;  2GTJ A;  3UAT A;  1H92 A;  2RQW A;  4RTX A;  1T0H A;  1UDL A;  2RNA A;  1M3C A;  3GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...