1X75A

Ccdb:gyra14 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
127
Chain Sequence
b'TRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLVAAMLEDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit A
publication title Molecular Basis of Gyrase Poisoning by the Addiction Toxin CcdB
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase/signaling protein
total genus 37
structure length 127
sequence length 132
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2004-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.268.10 Mainly Alpha Orthogonal Bundle Topoisomerase; domain 3 Topoisomerase, domain 3 1x75A00
4J3NA 1AB4A 4Z53A 3L4JA 4DDQA 3FOFA 4ELZA 3NUHA 4FM9A 3QX3A 3LPXA 4TMAA 4ELYA 1X75A 4CKKA 1ZVUA 4CKLA 1BJTA 3L4KA 3FOEA 4G0VA 2RGRA 2XCQA 2XCOA 2Y3PA 1BGWA 4Z3OA 4Z4QA 4G0WA 2XCRB 4G0UA
chains in the Genus database with same CATH superfamily
4J3NA 1AB4A 4Z53A 3L4JA 4DDQA 3FOFA 4ELZA 3NUHA 4FM9A 3QX3A 3LPXA 4TMAA 4ELYA 1X75A 4CKKA 1ZVUA 4CKLA 1BJTA 2QPTA 3L4KA 3FOEA 4G0VA 2RGRA 2XCQA 2XCOA 2Y3PA 1BGWA 4CIDA 4Z3OA 4Z4QA 4G0WA 2XCRB 4G0UA
chains in the Genus database with same CATH topology
4J3NA 1AB4A 4Z53A 3L4JA 4DDQA 3FOFA 4ELZA 3NUHA 4FM9A 3QX3A 3LPXA 4TMAA 4ELYA 1X75A 4CKKA 1ZVUA 4CKLA 1BJTA 3L4KA 3FOEA 4G0VA 2RGRA 2XCQA 2XCOA 2Y3PA 1BGWA 4Z3OA 4Z4QA 4G0WA 2XCRB 4G0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J3N A;  1AB4 A;  4Z53 A;  3L4J A;  4DDQ A;  3FOF A;  4ELZ A;  3NUH A;  4FM9 A;  3QX3 A;  3LPX A;  4TMA A;  4ELY A;  1X75 A;  4CKK A;  1ZVU A;  4CKL A;  1BJT A;  3L4K A;  3FOE A;  4G0V A;  2RGR A;  2XCQ A;  2XCO A;  2Y3P A;  1BGW A;  4Z3O A;  4Z4Q A;  4G0W A;  2XCR B;  4G0U A; 
#chains in the Genus database with same CATH topology
 4J3N A;  1AB4 A;  4Z53 A;  3L4J A;  4DDQ A;  3FOF A;  4ELZ A;  3NUH A;  4FM9 A;  3QX3 A;  3LPX A;  4TMA A;  4ELY A;  1X75 A;  4CKK A;  1ZVU A;  4CKL A;  1BJT A;  2QPT A;  3L4K A;  3FOE A;  4G0V A;  2RGR A;  2XCQ A;  2XCO A;  2Y3P A;  1BGW A;  4CID A;  4Z3O A;  4Z4Q A;  4G0W A;  2XCR B;  4G0U A; 
#chains in the Genus database with same CATH homology
 4J3N A;  1AB4 A;  4Z53 A;  3L4J A;  4DDQ A;  3FOF A;  4ELZ A;  3NUH A;  4FM9 A;  3QX3 A;  3LPX A;  4TMA A;  4ELY A;  1X75 A;  4CKK A;  1ZVU A;  4CKL A;  1BJT A;  3L4K A;  3FOE A;  4G0V A;  2RGR A;  2XCQ A;  2XCO A;  2Y3P A;  1BGW A;  4Z3O A;  4Z4Q A;  4G0W A;  2XCR B;  4G0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...