1X75C

Ccdb:gyra14 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
99
Chain Sequence
MQFKVYTYKSRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit A
publication title Molecular Basis of Gyrase Poisoning by the Addiction Toxin CcdB
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase/signaling protein
total genus 27
structure length 99
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1x75C00
2C06A 3JRZA 5CKBA 1UB4A 4ELYC 5CCAA 5DLOA 2MF2A 1VUBA 3TCJA 5CK9A 4MZPA 3NFCA 3VUBA 4MZTA 1X75C 5HK0A 5CR2A 4OF1A 5CO7A 5CKEA 1NE8A 4MDXA 1M1FA 3HPWA 4ME7A 5HK3A 2VUBA 3G7ZA 3JSCA 5CQYA 5CQXA 5CKDA 4ELZC 4HKEA 4VUBA 5CKHA 5HKCA 5CKFA 4MZMA 2KMTA
chains in the Genus database with same CATH superfamily
1NPPA 3QXEB 3MHXA 1OYXA 4J9EA 4PJOC 5GANd 2L3QA 2WSFE 3V8LA 1YJNA 3EG9A 2PU9B 1EIFA 3I56A 1LPLA 3L42A 4F7UE 3GPLA 4OGCA 2JN0A 2M51A 2QAZA 2XI9A 2KGTA 2JW4A 2FL7A 5L23A 2QQ9A 4IUPA 2GQVA 3JB9I 8AT1B 4FCYA 1PD1A 4M75A 4N4GA 4F17A 3QIIA 2EW3A 3JCMJ 4PJOE 3QJ6A 2QQSA 1M1KC 2LQ8A 1QW1A 1VYUA 4L5GA 4IUVA 2CP7A 4JZ3A 2KROA 1PM3A 3OW2A 4M78B 5FRNA 1X6OA 2MOXA 2HSPA 2EIFA 1GBQA 3ZEHA 2YWWA 2A37A 3MPUB 1VQ4T 2OTJQ 5LJ5h 1OULA 4N0AA 3CXCP 1O9SA 3BY7A 2K9GA 1VQPT 2RQRA 2E70A 3MEAA 1WQ7A 3H8ZA 4GBQA 3S6WA 3OYDA 3MO8A 4FT2A 2BTTA 4A53A 1M90C 2OTJA 5A0DA 2OAWA 2GTOA 3CXCA 4LDWA 4AFZC 3QWXX 3VUZA 3KXTA 1RAEB 2LCSA 1D1BA 2VYTA 3JB9G 3I55Q 4PNOA 2ATCB 4AFQC 2DMOA 3PTAA 1YJ9T 1YITT 4FL6A 2A36A 3I55A 1MGQA 2L3SA 4OMNA 5A2QE 1VQ5T 2L3RA 1UGVA 2KK4A 2JXBA 1KHCA 2RHZA 2M02A 4Y28E 4OMPA 3OS1A 3I5SA 4B9WA 1Y96B 1D3BB 2D9TA 4CC3A 5GAOp 3RIRA 3NHNA 3DB3A 1I8FA 2H3JA 4JJNK 2L0AA 2KR3A 2F2VA 4CI0C 3BW1A 1BI2A 2VGMA 3FB9A 2KDSA 2XKOC 4M7AB 2PVDB 2K2MA 2BZXA 4EMKA 3X28B 3OB9A 4BDYA 1Q81U 2CP6A 4DEYA 2E6NA 2JVVA 2DFUA 3LYIA 3PIPA 4OB0B 2HKQB 3VUBA 4E7ZA 2JTMA 2DEUA 2EPDA 2D8HA 3CEYA 1NJIR 2HQEA 1JEGA 3RNJA 3G71T 4M4ZA 3PVQA 3QSUA 2FPEA 2DE0X 4ATOA 5CKHA 1NBEB 3X25B 2X4WA 1M8VA 4QQ6A 3TVTA 1KK7A 2E1HA 4C0ZA 3OYEA 1QQJA 4OMLA 1ZUYA 2EYQA 1X43A 2OX7A 4A54A 1VYVA 3HKSA 4BI8B 2DYBA 2DTIA 5IXFA 1M9SA 1M30A 4J9IA 1KC8U 2EFIA 2D0QB 3VJPA 2FZGB 3MEWA 2ZPHB 3EH1A 1RAHB 3OYMA 5GAN2 5GMKj 2DM1A 2H8HA 1H3HA 2DJQA 1WXBA 3BE3A 3CPFA 4F7UG 1MHNA 2M0OA 4VUBA 2O2OA 1UECA 3O8VA 4C0GA 1QVFP 1KJWA 3GNGA 1F1BB 4PJOG 1IHVA 1NEGA 3PE0A 1BYMA 3SWNC 3EGDB 4NOYA 1QP2A 3N5BB 1QVFA 5IN1A 2XK0A 3G7ZA 3M58A 5EG2A 4KULA 3ZFJA 2EYXA 2LX9A 5D7UA 4HVWA 4A4GA 2NUPB 2DLPA 1PRMC 2CT3A 1D0ZA 4XTWA 3HTRA 4X9DA 2PUOB 3OBYA 5GJWB 3CCUT 4DBFA 4D8KA 3SB2A 1JJ2S 1RI9A 2A0FB 2CDTA 2VKNA 1W2BS 4BD3A 3P8HA 4AT1B 3OYHA 2EGAA 2J05A 4PFOA 1ZBJA 1KHIA 2FPFA 4AG1C 1RL2A 4ZGJB 4FW2A 5I11A 1VIFA 2JMCA 5LJ5g 4F04B 4RCCA 2KBTA 3CMAQ 3WVDB 4XU2A 4QQGA 4M77C 2RA2A 1NJIC 3EG9B 4LD9K 1CSKA 3C94A 2YUPA 3CQTA 5GMKe 1W4SA 2ROLA 1BBZA 1BCOA 4PJNA 2QA4Q 4RTUA 4M75B 1HYOA 2AHJB 2JOYA 3BDLA 5GAMh 4M7DA 3OYBA 4PJMA 4C92C 3QO3A 2QA4A 2FG0A 3JB9J 2W10A 2DK3A 1IGUA 1Y7XA 3OW2S 1IB8A 4LN2A 3VYGA 1K73U 1QWFA 3JCMW 4B6MA 2DL8A 4PK4A 2RQTA 3RERA 3EHRA 4BE0A 2E6ZA 2XD0A 3CCLQ 2QQAA 3RUXA 1FWZA 1UFFA 2RI2A 1VQ9Q 2QQRA 2LT1A 1QVGP 3ULRB 2YHTA 2D8JA 4CRIA 4FW1A 2J6KA 3CCLA 3CXCS 1U3OA 1U8RA 5GAN8 1VQNT 2FRWA 3UT1A 5LJ3j 1VQ9A 3G4ST 4M78F 1FYNA 3VS0A 2QG9B 2EGEA 1QVGA 1D0YA 2KAFA 4C8QA 1EZZB 1X69A 1H92A 3FIFA 2DD4A 4B9XA 3QDFA 4M7DD 3JCMb 3QZ5B 1M3CA 2PVOB 1VQLQ 2KE9A 1N6AA 3OYNA 1Q82U 2K3BA 2JJ9A 1UHFA 2DF6A 1VQLA 4JRIA 3CCSA 4FYWB 2CGHA 1A0NB 1R0CB 3HRUA 3JCMV 1NYFA 1R0BG 1VQMQ 2A3LA 1Y07A 1YJNT 1KQSP 1WFWA 1MNEA 1U1SA 5GMKl 3C0CA 3CC7Q 1WGSA 1VQMA 2DTHA 4RTWA 1KQSA 2EVRA 4EMKB 2RHIA 5CKBA 3OYCA 1LCKA 1T0HA 4E6RA 3CC7A 2HDAA 4C8QD 4M77B 1XJWB 5GANh 3R6OA 4F7UA 3J81E 2EQIA 4BACA 2DJZA 2M9UA 3OSSC 2YLBA 4J9DA 1X2QA 2DNUA 5LJ3e 2Z0WA 4PJOA 3KFVA 1UUEA 5KCHA 2CH4W 2KYMA 4J5YA 2O01E 2IVWA 1K9MU 2IIMA 2MK5A 3A8GB 4RTXA 4PJJA 1MMGA 4FIBA 4J6YA 1VQ6Q 1BIAA 2NLUA 2DERA 1M2VA 3EFOA 1D09B 3CPWP 2OTLQ 1I07A 1ZSGA 3M55A 3SHWA 3VU3C 1BI1A 4A4EA 1YI2Q 4DBRA 3I55T 2PUKB 1ZA1B 3HPWA 3F70A 4DOWA 2MIOA 2JS2A 4E2FB 3P8DA 2O9VA 1ARKA 4EDUA 4OB2B 2OTLA 4M7AD 1YI2A 2GCXA 4NL3A 4A4HA 1QCNA 4A63B 3H0FA 5GMKi 2KNBB 4ZN3A 1HD3A 2DL5A 1XOVA 5GAN4 3J80E 4R0KA 3CC4Q 3VS2A 1WA7A 5LJ5f 1PWTA 2FZCB 5J3BA 1VQKQ 4EMHA 1K4US 5M9OA 3J7AF 3PGGA 3GBQA 1RUWA 1G3SA 2P0PA 3CC4A 1SPKA 3DLLA 1EFNA 5FRMA 2AKKA 4FYVB 2QQBA 1VQKA 1GRIA 3OYAA 1G3WA 3MEVA 4Z02A 1WLPB 4M78E 1SHFA 2MF2A 5GAMg 3QKJA 2BE9B 2W0ZA 2YRDA 1QWEA 4IUUA 1BI0A 3GIBA 2BUDA 3MP1A 5GAOr 3OYIA 1PKSA 1NPRA 2EAYA 1WXUA 3V7SA 2DKGA 2X51A 1B3QA 2ZPBB 3M59A 4MZPA 3MP6A 1D1CA 4BDZA 1S72Q 4V2SA 4JPBW 1IXDA 1YHQQ 5FU6B 1PRLC 5FWCA 5IHKA 2RHYA 1S72A 1AWXA 2GNCA 1PD0A 3FDRA 2I0NA 2VASA 1YHQA 3E9FA 1UJ0A 4IURA 1BI3A 3UATA 4M7DB 3A8MB 3FJPA 1V1CA 1WHLA 1G8XA 3S3MA 1UE9A 5GAOl 2L89A 1RLQC 2XG8D 3UA7A 2DBMA 2RJEA 2DXCA 4HVVA 2IPOB 1KQ2A 3PNWC 2JM9A 3WXMB 2P84A 5DM7R 5CIUA 2VC8A 2V1RA 2X35A 3I5RA 1UEBA 3GLXA 5GAOq 2B8AA 2CP0A 4CC7A 2F2WA 4LUEA 1ABQA 2JUFA 2RI3A 2QGGA 2QEXQ 1X2KA 1VQOQ 4C5GA 2EQKA 2MCNA 3BDUA 1OX9A 4KGXB 2VWFA 3OS5A 4PLLA 2QEXA 4KUDK 1WX6A 2P4TA 1QVGS 1VQOA 4FSXA 3VS3A 2RB6A 3META 4C8QB 2ZPIB 1ZX6A 4JRQA 1Q86R 5HK3A 3GF5A 5LJ3d 3BFMA 5ECAA 3EGXA 1PSFA 2NUTA 3M0RA 5GANg 2XHCA 4DA4A 2R5AA 4Y91A 1UG1A 4M75D 2FO0A 1X27A 2RM4A 2GTJA 4ZGEB 1AWWA 1N5ZA 1QCOA 2QTVA 4J8OA 4GY5A 4ZN1A 2J06A 3SWNA 2GQIA 4PLIA 1N9RA 4HCBA 3CCJQ 1MUZA 4RCBA 4GLMA 5GMKm 3JAME 2BZYA 4Q5WA 5CQYA 2DXBA 2AKLA 4X34A 4OB1B 2KI7A 3CMAT 2DO3A 3LH0A 2CREA 1QKWA 1NZ9A 3CCJA 2XDPA 1M1KU 1KQSS 3LX7A 2F69A 4OB3B 3OY9A 1SF9A 3DKMA 2KSSA 4C0DC 4LNPA 3JCMd 1RAAB 1ACMB 2XIDA 1AOJA 2HL5C 1SEMA 3VYHB 1XTDA 4Z88A 4EPCA 1GFCA 1KSWA 1BU1A 4F7UB 2R58A 2HCKA 4J9BA 3PFSA 5IH2A 1AEYA 2DL7A 1H641 4JJCA 2RJCA 2CH4A 5KE2A 1WHGA 3LW5E 1WJQA 2COWA 2LJ1A 4PJOB 1Q7YR 4M77A 2AK5A 4M78G 4EMGA 1M90U 2SEMA 4TVRA 3PMTA 2AZSA 2F5KA 4MDXA 1JB0E 3CCMQ 3NTKA 2GF7A 2RH2A 1OZ2A 4LDUA 2KEAA 3CCLT 3L2UA 1OPLA 3MCAB 2RQUA 1SG5A 3CCMA 3VKIA 1VQ9T 4C0FA 5FLXE 4C92A 1M2VB 3QBYA 3EFOB 1JXMA 4BY6C 5CR2A 1QCFA 3OMCA 2RHUA 2FEIA 5GAMf 4LUDA 2KRSA 4KRTA 3OA6A 1KD1R 2MI6A 1VA7A 4QVDA 1IO6A 4F16A 3QZ9B 1AVZC 5DLOA 2P0KA 9ATCB 3VS4A 2D1XA 3EFSA 1M27C 1PSEA 2EQJA 1Q86C 4M77D 4AFSC 1W1FA 1RLPC 2RMOA 4M75E 3HFOA 1ZHIA 1OPKA 1AZEA 2CUDA 5J39A 2YUQA 2QDYB 1VQ8Q 1VQMT 2YXYA 3S3NA 2CZ6B 4LXCA 3LH5A 2KVQG 3EG1A 4AMCA 2ZZDA 2E3HA 2ZPEB 4C92D 5I2SA 2K7AA 1RAFB 5I2MA 3CC7T 3CCEQ 1VQ8A 5AT1B 3PVLA 1VQ7T 1WNLA 4YTLA 2VVKA 2EBPA 3CCEA 1WJSA 5L8RE 3SFMA 1AHJB 1TU0B 1JBMA 1K0XA 2RK1A 1UGPB 2EQMA 2EKOA 2SRCA 2L5QA 3WVEB 1D0XA 2HSEB 2V26A 4O6JA 4ME7A 1FX7A 2O4XA 3I35A 4QVZA 2DZ9A 1K8AR 4ORZA 1ZA2B 4DBQA 1N8RR 1VIEA 2RO0A 2KXCA 1TS9A 2MMPA 2DX1A 2CSQA 1Q7YC 5KYNA 3KBGA 1OOTA 2ZGWA 3CBPA 4Z89A 3ME9A 5GAOm 2YRCA 1NE8A 1UGSB 4JJBA 1YITQ 4XTXA 4L6V5 4O5VA 5C6SA 1VQ6T 3UDCA 4PFZA 3A1PA 5CKFA 1YITA 3PMIA 1M1GA 2OTLT 1MNDA 2K5LA 1WQWA 5I21A 3TEEA 5GANf 4BUGA 3M0TA 4II1A 1X6GA 4X9CA 2DA9A 4R56A 4IKFA 4A4KA 6AT1B 4J7IA 1KD1C 2DIQA 1KIKA 2GFAA 4D6WA 4M7DF 2HMAA 2QYZA 3E19A 3U23A 2RNAA 3VS5A 1GBRA 4CC2A 3VS6A 3VRZA 3V7RA 1YBYA 1TXQA 2FHDA 1DJ7B 1VQKT 1RI0A 2LNVA 4JRPA 1GCQC 2E10A 2KT8A 2G6FX 4RG8A 5FW9A 3HHTB 1G83A 2JM8A 1PNJA 1TUCA 1NM7A 3O5ZA 2R57A 2LQNA 2NUTB 3EGXB 5KYUA 1UGRB 5GMKh 1H3ZA 5LL6S 2OJ2A 1B7TA 3JB9D 3CCQQ 2COZA 3CD6Q 1W70A 1M5Q1 2K3YA 2PZ1A 1ZUUA 1NJIU 2LP5A 3CCQA 3M0PA 3SWNB 3PT9A 1YJWQ 3CD6A 3FRNA 2LZ6B 5HCKA 4FU6A 2KY9A 3CCSQ 4PL6A 3MP8A 4C8QF 2CKKA 1M3AA 4IIMA 2K57A 2O88A 4J83A 2WSEE 2KMTA 4QVCA 1YJWA 2RK2A 1YHQT 2EJFA 3T9NA 3D7SB 4XU1A 3DB4A 4JDSA 3G1JA 4KUIA 1K8AC 3I56T 4XTVA 1PG5B 1N8RC 1O75A 4J9FA 1VOMA 4M75G 4XU0A 1AWJA 2BKDN 3C4SA 2ESWA 2KT1A 2YT6A 2JTFA 1HSQA 2KYBA 4K11A 3M54A 3CC2Q 4MZTA 4OF1A 1SRLA 3EHQA 1I1JA 2JTEA 1KG1A 2ZPFB 4BE2A 1Y0MA 1YWOA 2RD1A 1UDLA 3CC2A 2DL4A 2JNGA 2CZ1B 1SSHA 3E9GA 4JJDA 1BIBA 2E5KA 3TCJA 4M7AF 4KGVB 3H41A 2QEXT 2LJ0A 3ZL7C 4C92B 1VQOT 1FMWA 1YIJQ 1V76A 3RBBB 1MV3A 3L2QA 4KH1B 1I81A 2M1HA 2OTJT 3CMEQ 2CZ7B 3THKA 1FMKA 3PIOA 1UHCA 3A5ZB 1LVKA 1YIJA 2EJGA 4QQDA 4GLKA 4E7SA 1ZSZA 1Q95G 4LDYA 3CMEA 2ROTA 3L1AA 4OP0A 5D6WA 4N4HA 4AFUC 2ZAEA 3GOXA 4HA8A 4N4IA 2FVUA 1WIEA 2PTKA 1LOJA 5GAMd 2F2XA 3CPWA 1FMVA 3JCMe 2X3XD 3G6EQ 4M7DE 5LJ3h 3VS1A 3A98A 1M4ZA 3CCJT 2AZVA 2QXFA 2P0QA 1UJYA 5GAN6 4PJOD 3RKWA 4M78C 2GGRA 3G6EA 1BB9A 1NLPC 2M16A 1JO8A 2BE7D 2X4YA 2EQUA 1GCPA 1M3BA 4OMFB 1QVFS 2DL3A 4J9CA 4XTYA 1S1NA 4WTOB 3NTIA 2HNIA 3RMSA 3M4GA 3TREA 2ECZA 1Q81R 1RABB 1UB4A 2M0YA 3E1SA 2ZCFB 3OYFA 1B07A 3FJ5A 2CP5A 2JMAA 3QYHB 1T3SA 2X9HA 3QHSA 1SRMA 3QG1A 2O4XB 3H6ZA 1YFNA 3JCMh 4C8QE 4RTVA 2FYKA 3HRTA 2LT4A 4HVUA 2E12A 4OMMA 1RADB 2VGNA 3CCVQ 2Y90A 4J7FA 1HK9A 3SEMA 4MMKA 2VB6A 4LE9A 1XNIA 5A0LA 3MKDA 1UGQB 3CCVA 1UTIA 2PVGB 1T0JA 2R5MA 1W2BP 1ZLMA 1YCSB 2DXUA 4ELYC 1VYTA 1GFDA 1MMAA 1KC8R 1G3YA 5GJVB 5CAIA 4RTZA 1AT1B 4E7JA 1MMDA 3HP9A 1W2BA 4LDXA 1LNXA 2XMFA 1WPYA 3ER0A 4ELZC 4J6XA 3CBMA 2DRMA 1X6BA 3QYGB 1ZSZC 2ENMA 2LJ3A 1TOVA 1M8MA 2RHXA 1NLOC 2DAQA 4KGZB 3TSZA 3L2VA 4E7KA 4M7AE 4M75F 1BCMA 4KH0B 2VV5A 4QW2A 2RJFA 2H3EB 1VQ8T 1ZUKA 4DEXA 3OW2P 5KYUB 1WXTA 4PFPA 4OVAA 1AZGB 1WHKA 3CCET 1SHGA 4C5EA 4OMQA 2LQWA 5KCOA 3JB9H 1C1AA 2K5IA 1CKAA 4RUGA 1FXXA 1Z9ZA 2CT4A 2FRYA 3A8LB 2QK0A 5FROA 2D6FA 1Q81C 4D8DA 2XDDA 1AWOA 3P8BB 4X1VA 3LWIA 4P5NA 5D6YA 1WHMA 1VUBA 2HKNA 2QASA 1K76A 1QMCA 1YN8A 3FLGA 2C0OA 3EFRA 3IQLA 4JUVA 4JLIA 1I0CA 3CCRQ 3LGFA 3M0QA 1B34A 1PHTA 4DOVA 2YUOA 3JSCA 5CQXA 2LVMA 1OV3A 1QKXA 4HKEA 1TG0A 2O9SA 1JXOA 3CCRA 3TSWA 5GAN7 4KBMB 1WI7A 2EYYA 2EYZA 4M7DG 2YUNA 4ZNXA 1IHWA 2X3WD 2COYA 4RKUE 1IREB 3DLMA 2YRVA 5IXBA 5CKEA 1C0MA 2DXTA 4ANJA 2V1QA 3C95A 2QA4T 3NPFA 2RJDA 1K73R 3H0HA 5CKDA 3HSBA 1OX8A 1MV0B 2EWNA 3TU4K 1RAIB 2C06A 1KC8C 1U06A 3FC3A 4NL2A 4BE1A 2DPPB 5LJ3g 2XICA 3UWNA 2VXEA 5KYWB 1K9AA 4UC4A 4C5IA 2FPDA 3M53A 3TQ7P 3L2RA 2HQHA 4BI4A 4M77F 2F1LA 2WSCE 1YWPA 2GBQA 2GFUA 4AG2C 3AT1B 4C8QG 1ZSZB 2AIRB 1U1TA 3FEOA 3M9QA 2ED1A 3RDVA 5GAN3 5I22A 2LCCA 3CCQT 1Q82R 3X26B 3CD6T 5GAMj 4JLGA 4M75C 5D6XA 4C92F 3SDZA 1GXIE 3CPWS 2LQKA 2MWOA 4FSSA 3JCMg 2K5FA 8ATCB 1YJWT 2P4RA 3QPHA 1XQHA 1VQLT 3CBOA 3V8JA 1RACB 1GCQA 3CCST 5FU7C 2K3XA 3L2ZA 1SSFA 2KQWA 5KYXA 4JRKA 4N0AC 1TSFA 2HEQA 5KYYA 5CK9A 4RG2A 1WDXA 3RKXA 2C0IA 2I2LA 4LDVA 2NUZA 5LJ5d 4OMOA 1E6HA 2HD0A 3ZBDA 4M7AG 2VUBA 3X24B 2Y4YA 5DLQE 4E7LA 1JU5C 2HAXA 2RPNA 3CC2T 2J6OA 3SD4A 1VQ4Q 2A7YA 2EYWA 4ZGDB 4HCCA 1VQPQ 3HRSA 3M57A 5CO7A 2PNIA 2LC4A 4C0DB 1K73C 3JCMX 3JCMc 1VQ4A 1IRXA 1K9MR 1OEBA 1VQPA 1CKBA 4XTUA 1WYXA 4OGEA 5GAMe 1YCYA 2NWMA 1N27A 1YIJT 2OAUA 3MJXA 4BB7A 2LRQA 5CVIA 1ABOA 2HQXA 2BZ8A 3CMET 2L3PA 4IUQA 1YJ9Q 1Q86U 1N9SA 3L2WA 1J3TA 3HFNA 2CS7A 3M56A 1VQ5Q 2HZYA 4PKCC 4EMKC 1PC0A 1YJ9A 3LLRA 3JRZA 2E4HA 1QP3A 2DEQA 1YI2T 5GANj 1VQ5A 1NG2A 2EKHA 3NFCA 4XK8E 5HK0A 3M0SA 3JB9F 2RQVA 3EAEA 4BY6B 1LJOA 4EIKA 2LX7A 1Q82C 4FYXB 3CMAA 3G6ET 4HXJA 1BK2A 4R55A 3VRYA 3R6NA 2EJ9A 1I4K1 1SKUB 2MWPA 2YDLA 1OZ3A 3CC4T 4M77E 4IIOA 2X4XA 4ESRA 2B86A 1X75C 1OU8A 4JS5A 2V8IA 5FU7B 1RAGB 1V29B 2IG0A 3VV0A 4A4FA 5KE3A 2A28A 5HY6A 1G2BA 3REAB 4BI3A 3OBWA 3OYJA 4RTYA 3G71Q 2FB7A 2K79A 4C92E 2QDLA 4Y92A 4C5HA 1Q7YU 3H9NA 3VS7A 2DVJA 3EG2A 3UA6A 4DQ2A 4M78A 5A0GA 1IGQA 3G71A 3NTHA 4Z8AA 3UPUA 2BIVA 2E3IA 2XDBA 5LJ3f 1B34B 1GL5A 4CC4B 2JT4A 1D1AA 2CP2A 1S72T 2X4JA 3CCVT 1ZBXA 1G3TA 5KH6A 4E7HA 2F5TX 3NMZC 1YNZA 4IUTA 2JS0A 3EG3A 3H0IA 3NGPA 2DD5A 1M1FA 5GANe 2L2PA 1K9MC 1Z9QA 3OS2A 1IZ6A 3REBB 1KD1U 1E7OA 1OQKA 5HKCA 3RESA 2EGCA 2MAMA 5CCAA 2K2VA 2C0TA 2ZPGB 2E65A 2J7IA 4PJLA 3RR6A 3EH2A 2NYSA 3JCMf 4QT7A 4M78D 1T3LA 2DIGA 1E6GA 2YLCA 1Y96A 2KRNA 2D0NA 2QI2A 1X01A 1D3BA 4FYYB 4ZTFA 2DBKA 4MDWA 2G3RA 3I9QA 2LTOA 1R8OB 3A8HB 2OI3A 1WHHA 1VQ7Q 2XU8A 1JRIA 1PCXA 2O31A 3URGA 3OYGA 1NYGA 1U5SA 1JQQA 4HCKA 4RMOA 2DILA 4F7UF 1TWBA 1W6XA 2HBWA 4WCIA 5KYWA 2E64A 1QLYA 3OYYA 3M4YA 4J9GA 3QDRB 5FU6C 1VQ7A 2CYZB 5IAYA 2QGFB 5IHIA 4M7AA 4XQ3A 1TUDA 4PJOF 3CCUQ 2E41A 2FZKB 3OYKA 3LWHA 2J6FA 1OI1A 2E5QA 4MZMA 3C12A 1TUGB 1C6VX 2KXDA 4MMLA 1KFZA 4M7DC 2AT1B 3CCUA 4XU3A 2LNHB 4E47A 2ABLA 2ED0A 4FT4A 2MPXC 4NS5A 5GAN5 1K8AU 4F14A 1TTHB 1N8RU 1Y71A 7AT1B 1HXDA 3OQ5A 5KYXB 2RF0A 3OYLA 4LD6A 2DTOA 3CCRT 2MYSA 3GP8A 1M1KR 1K0SA 4L59A 5KYYB 1VQ6A 1I5LA 2YSQA 1H8KA 2KRMA 2PQWA 1WHJA 3M5AA 3ASKA 2JZ2A 3OMGA 5LJ5j 3GNFB 2CZ0B 1EX4A 1ZQ1A 4J6WA 5AYFA 2K4YA 3X20B 2Y4XA 4JZ4A 5J26A 4FM4B 4C8QC 4M77G 2RQWA 1TH7A 5DY9A 1HJDA 2V8KA 4DBHA 1M90R 3RMQA 4HCZA 3EGUA 3Q1JA 4JS4A 5IT9E 3QJYA 2HBPA 3V7CA 4XTZA 4KT0E 3S3OA 4ZTJA 1G5VA 4WF2A 2RN8A 4HT9A 3QWYA 3OS0A 1R77A 3M0UA 5IHNA 3JV3A 5FWBA 1VQNQ 2VXFA 1QVPA 1P92A 3INZA 3G4SQ 3CCMT 4C92G 1KQ1A 2RI5A 3EGDA 2K6DA 3MEUA 5GAOn 2CP3A 2CSIA 5C0MA 1VQNA 1M2OA 3V8KA 3G4SA 1PKTA 3QUIA 2DZCA 3A8OB 4XAXB 4E7IA 1OU9A 1BKBA 3KUFA 5EC7A 2DVEA 2DETA 4J9HA 4QKUA 2LMJA 1YP5A 1I5OB 1Y57A 2LCLA 2NUPA 2L8DA 1WJRA 1JJ2P 2LDMA 1MMNA 3LGLA 2HL3A 3RKYA 2WACA 1NEBA 2CUBA 3HL8A 3E2UA 4HT8A 2DRKA 3UF4A 2DYIA 2QTXA 1WZOA 4RTTA 1JJ2A 2A08A 2V8JA 1AD5A 3EG0A 3AHUA 4M7AC 1K1ZA 3JCMP 1YJNQ 3JCMQ 3OSVA 3I56Q 5LJ5e
chains in the Genus database with same CATH topology
2K5LA 2GFUA 5LJ3e 1WQWA 1NPPA 3QXEB 3MHXA 1OYXA 3TEEA 5I21A 4PJOA 4C8QG 5GANf 5GANd 4PJOC 2WSFE 3V8LA 1YJNA 4BUGA 2PU9B 1U1TA 1EIFA 4II1A 3FEOA 3I56A 4X9CA 4R56A 4IKFA 3M9QA 5KCHA 3L42A 4F7UE 4A4KA 3GPLA 4OGCA 4J5YA 2JN0A 2XI9A 5GAN3 2O01E 2IVWA 4J7IA 1KD1C 2FL7A 2DIQA 1K9MU 2LCCA 2QQ9A 2GFAA 2GQVA 4IUPA 3JB9I 3X26B 3A8GB 4D6WA 3CCQT 3CD6T 4M7DF 5GAMj 4M75A 3E19A 4JLGA 4M75C 5D6XA 4C92F 4FIBA 4J6YA 4N4GA 3QIIA 3SDZA 1BIAA 2NLUA 3CPWS 2LQKA 1GXIE 2MWOA 4PJOE 3JCMJ 3QJ6A 2QQSA 3JCMg 2K5FA 1M1KC 2LQ8A 1QW1A 1YJWT 3V7RA 1YBYA 3QPHA 1XQHA 1VQLT 2FHDA 4L5GA 1DJ7B 3CBOA 1RI0A 3V8JA 4IUVA 1VQKT 2LNVA 4JRPA 3CCST 3M55A 3OW2A 2E10A 3VU3C 5FU7C 4M78B 5FRNA 1BI1A 1X6OA 2K3XA 4RG8A 4A4EA 3L2ZA 3I55T 2PUKB 3HPWA 3F70A 3HHTB 4DOWA 3P8DA 1SSFA 2EIFA 4EDUA 3ZEHA 2R57A 4OB2B 2OTLA 2KQWA 4M7AD 5GMKh 1UGRB 4JRKA 1H3ZA 1VQ4T 5LL6S 5LJ5h 4N0AA 4N0AC 1O9SA 3BY7A 3JB9D 2GCXA 1YI2A 4NL3A 1VQPT 2E70A 3MEAA 4A4HA 1WQ7A 3H8ZA 3S6WA 3OYDA 5CK9A 4RG2A 3MO8A 1M5Q1 5GMKi 4FT2A 2K3YA 4A53A 4ZN3A 1M90C 1XOVA 5GAN4 3J80E 2OTJA 3RKXA 5A0DA 1NJIU 2I2LA 4LDVA 3CXCA 4LDWA 5LJ5f 5LJ5d 3CCQA 3SWNB 3PT9A 3CD6A 3FRNA 5J3BA 2HD0A 3VUZA 3ZBDA 4EMHA 5M9OA 3KXTA 4FU6A 2KY9A 2VUBA 3J7AF 3PGGA 4M7AG 3X24B 4PL6A 3MP8A 4C8QF 1G3SA 2CKKA 2P0PA 2Y4YA 2VYTA 5DLQE 3JB9G 4E7LA 3CC4A 2K57A 4PNOA 4J83A 2WSEE 2KMTA 3DLLA 4QVCA 1YJWA 5FRMA 2HAXA 2QQBA 3CC2T 1VQKA 2RK2A 3SD4A 1G3WA 3MEVA 3OYAA 4Z02A 3PTAA 4M78E 1YJ9T 2MF2A 1YITT 4FL6A 1YHQT 2EJFA 3T9NA 5GAMg 2A7YA 3QKJA 4ZGDB 4XU1A 3DB4A 4HCCA 3I55A 1MGQA 4IUUA 3HRSA 3M57A 1BI0A 5CO7A 4JDSA 2LC4A 5A2QE 3GIBA 1VQ5T 2L3RA 4KUIA 4C0DB 1K73C 2BUDA 3JCMX 1K8AC 3MP1A 3JCMc 2KK4A 3I56T 5GAOr 4XTVA 3OYIA 1VQ4A 1N8RC 1KHCA 1O75A 1NPRA 2RHZA 4Y28E 2EAYA 3OS1A 4M75G 4B9WA 1VQPA 1Y96B 4XU0A 3C4SA 2BKDN 4XTUA 1D3BB 2D9TA 4OGEA 5GAOp 3RIRA 5GAMe 3DB3A 1YCYA 3V7SA 2DKGA 1N27A 1I8FA 2OAUA 2H3JA 1YIJT 4BB7A 2ZPBB 4JJNK 2LRQA 5CVIA 3M59A 2JTFA 3MP6A 4MZPA 2HQXA 4BDZA 3M54A 3CMET 4CI0C 3BW1A 4MZTA 4IUQA 4OF1A 4V2SA 1BI2A 2VGMA 3FB9A 1Q86U 1KG1A 1N9SA 2ZPFB 3L2WA 5FU6B 4BE2A 2KDSA 2XKOC 2RHYA 4M7AB 2PVDB 1S72A 3HFNA 2CS7A 2RD1A 3M56A 3FDRA 3PMIA 3CC2A 4PKCC 4EMKA 3X28B 4EMKC 2JNGA 3OB9A 1YJ9A 4BDYA 1Q81U 2CZ1B 3LLRA 1YHQA 3E9FA 3E9GA 3JRZA 1BIBA 2E6NA 2JVVA 1QP3A 3LYIA 4IURA 2DEQA 3TCJA 3PIPA 1BI3A 1YI2T 4M7AF 5GANj 3A8MB 3FJPA 4OB0B 2QEXT 1VQ5A 4M7DB 3NFCA 4XK8E 2JTMA 3VUBA 4C92B 5HK0A 3CEYA 1VQOT 3JB9F 3S3MA 3EAEA 4BY6B 5GAOl 1LJOA 2L89A 2HQEA 3L2QA 1I81A 2M1HA 1Q82C 2XG8D 3CMAA 2OTJT 3G6ET 2RJEA 2DXCA 3G71T 4R55A 3QSUA 2EJ9A 2CZ7B 1I4K1 4ATOA 5CKHA 3PIOA 3A5ZB 3X25B 1KQ2A 2X4WA 2MWPA 1M8VA 1YIJA 2EJGA 4QQDA 4QQ6A 4GLKA 3PNWC 3WXMB 5DM7R 1OZ3A 4LDYA 4M77E 3CC4T 3CMEA 2E1HA 5CIUA 2VC8A 4C0ZA 3L1AA 2X4XA 3OYEA 4OP0A 2X35A 4N4HA 5D6WA 3GOXA 1UEBA 3GLXA 4HA8A 2FVUA 4N4IA 1X75C 5GAOq 2B8AA 4JS5A 2V8IA 2EYQA 5FU7B 1LOJA 1V29B 2IG0A 3VV0A 4A4FA 5KE3A 2JUFA 2RI3A 5GAMd 4A54A 3HKSA 4BI8B 5HY6A 2DTIA 2EQKA 4C5GA 3CPWA 4BI3A 3BDUA 3OBWA 3JCMe 1M9SA 3OYJA 4M7DE 2FB7A 4C92E 3OS5A 5LJ3h 4PLLA 2QEXA 1KC8U 2P4TA 1QVGS 2EFIA 4KUDK 1M4ZA 1VQOA 4FSXA 3CCJT 2D0QB 4C5HA 1Q7YU 3VJPA 2QXFA 2RB6A 2P0QA 3META 3MEWA 2ZPIB 4C8QB 5GAN6 2ZPHB 4DQ2A 4M78A 4M78C 3RKWA 5A0GA 4PJOD 3G6EA 3G71A 3NTHA 4JRQA 3OYMA 2M16A 5GAN2 5GMKj 2X4YA 3UPUA 2BIVA 2EQUA 5HK3A 2XDBA 5LJ3f 3CPFA 3GF5A 5LJ3d 1B34B 3BFMA 4OMFB 1PSFA 4F7UG 1MHNA 2M0OA 5GANg 1QVFS 4VUBA 2XHCA 4DA4A 4XTYA 2R5AA 3NTIA 2HNIA 3O8VA 3M4GA 3RMSA 4C0GA 4Y91A 4M75D 3TREA 1S72T 3GNGA 2X4JA 1UB4A 3CCVT 1ZBXA 2RM4A 3E1SA 4ZGEB 4PJOG 1G3TA 5KH6A 2ZCFB 3OYFA 4E7HA 4J8OA 2F5TX 4GY5A 4ZN1A 1BYMA 4IUTA 3SWNA 3SWNC 4PLIA 1N9RA 3QYHB 4NOYA 4HCBA 1QP2A 1M1FA 2DD5A 3N5BB 5GANe 1QVFA 4RCBA 5IN1A 1K9MC 5GMKm 3JAME 2XK0A 3OS2A 1IZ6A 3QHSA 4Q5WA 3G7ZA 1KD1U 3M58A 5CQYA 2DXBA 3QG1A 5EG2A 5HKCA 2O4XB 4X34A 3H6ZA 4OB1B 3CMAT 3JCMh 2DO3A 4KULA 3ZFJA 2LX9A 3LH0A 4C8QE 3CCJA 1NZ9A 3RESA 2XDPA 4A4GA 2FYKA 2MAMA 2LT4A 3HRTA 2E12A 5CCAA 1KQSS 2K2VA 3LX7A 2F69A 4OB3B 4XTWA 2ZPGB 3OY9A 4X9DA 2PUOB 2E65A 3OBYA 3DKMA 2VGNA 2KSSA 4C0DC 2Y90A 3JCMf 3JCMd 4J7FA 1HK9A 3CCUT 4M78D 2DIGA 2XIDA 4MMKA 3SB2A 1JJ2S 1XNIA 2YLCA 1W2BS 4BD3A 3P8HA 3OYHA 3VYHB 1XTDA 1Y96A 4EPCA 5A0LA 2QI2A 4F7UB 1X01A 1D3BA 1UGQB 2R58A 3CCVA 3PFSA 2R5MA 1KHIA 2PVGB 4ZTFA 1RL2A 4MDWA 2G3RA 4ZGJB 2LTOA 1R8OB 3A8HB 1VIFA 1H641 2RJCA 5LJ5g 4RCCA 2DXUA 4ELYC 2XU8A 1JRIA 3OYGA 3URGA 5KE2A 3LW5E 4RMOA 3WVDB 1WJQA 1G3YA 4PJOB 4F7UF 4XU2A 5CAIA 4M77A 4M77C 2RA2A 4M78G 2E64A 4QQGA 4EMGA 1NJIC 4TVRA 1M90U 4E7JA 3PMTA 3OYYA 2F5KA 3HP9A 1JB0E 3M4YA 1W2BA 3QDRB 5FU6C 4MDXA 3NTKA 1VQ7A 2CYZB 2GF7A 4LDXA 5IAYA 1LNXA 2RH2A 4LD9K 1OZ2A 4M7AA 1WPYA 4LDUA 3C94A 4XQ3A 3ER0A 4ELZC 4PJOF 5GMKe 3L2UA 3CCLT 2E41A 1W4SA 3OYKA 3LWHA 1OI1A 2E5QA 3MCAB 3C12A 4J6XA 4MZMA 4M75B 3CCMA 3CBMA 3VKIA 2AHJB 1VQ9T 4C0FA 3QYGB 2JOYA 4MMLA 3BDLA 5GAMh 5FLXE 4M7DA 3OYBA 4M7DC 4C92A 4C92C 3QO3A 3CCUA 3QBYA 4XU3A 4E47A 2QA4A 2RHXA 2DAQA 4BY6C 5CR2A 3L2VA 3OMCA 4E7KA 4M7AE 4M75F 4FT4A 3JB9J 2DK3A 1Y7XA 3OW2S 2RHUA 3VYGA 4NS5A 2VV5A 5GAN5 1K73U 1K8AU 4QW2A 3JCMW 5GAMf 2RJFA 1VQ8T 1N8RU 3OA6A 2MI6A 1Y71A 1HXDA 3OQ5A 3RERA 4BE0A 3OYLA 2E6ZA 4LD6A 2DTOA 4QVDA 2XD0A 2QQAA 4OVAA 3CCET 3QZ9B 5DLOA 3GP8A 3CCRT 3RUXA 2P0KA 4L59A 1FWZA 1M1KU 1VQ6A 4C5EA 1I5LA 2RI2A 2QQRA 2LT1A 3EFSA 5KCOA 3JB9H 1PSEA 2K5IA 2EQJA 2PQWA 1Q86C 4M77D 1FXXA 2YHTA 4CRIA 3M5AA 3ASKA 2JZ2A 3CXCS 3CCLA 3A8LB 4M75E 3OMGA 5LJ5j 3HFOA 1U8RA 1ZHIA 3GNFB 2CZ0B 5FROA 1ZQ1A 4J6WA 5J39A 5GAN8 5LJ3j 3UT1A 1VQNT 2D6FA 5AYFA 1VQ9A 2K4YA 3X20B 3G4ST 1Q81C 2Y4XA 4M78F 2XDDA 1QVGA 2QDYB 5J26A 3P8BB 4FM4B 1VQMT 3LWIA 4P5NA 3S3NA 2CZ6B 5D6YA 1VUBA 2KAFA 4C8QA 4C8QC 2KVQG 3FIFA 2DD4A 4B9XA 2ZZDA 4M77G 4M7DD 3JCMb 1TH7A 3FLGA 3QZ5B 2ZPEB 5DY9A 4C92D 3EFRA 4JUVA 2V8KA 5I2SA 4JLIA 3CC7T 5I2MA 2PVOB 3LGFA 4HCZA 3RMQA 1VQ8A 1B34A 1N6AA 3OYNA 1Q82U 3Q1JA 4DOVA 4JS4A 5IT9E 3QJYA 2HBPA 3JSCA 3V7CA 5CQXA 4XTZA 2LVMA 1VQ7T 4HKEA 4KT0E 3S3OA 1WNLA 4YTLA 4ZTJA 1G5VA 4WF2A 3CCEA 4HT9A 3CCRA 5GAN7 3OS0A 1VQLA 4JRIA 1WJSA 4KBMB 5L8RE 2VXFA 1QVPA 3SFMA 3CCSA 4M7DG 1P92A 1AHJB 3INZA 3CCMT 4C92G 2CGHA 1KQ1A 4RKUE 1IREB 3DLMA 1JBMA 2RI5A 3HRUA 3JCMV 2YRVA 2RK1A 2A3LA 1UGPB 1Y07A 2EQMA 3MEUA 5CKEA 1YJNT 2EKOA 5GAOn 2DXTA 2L5QA 5C0MA 3WVEB 1VQNA 3C95A 4O6JA 4ME7A 2QA4T 1FX7A 2RJDA 3V8KA 1U1SA 3G4SA 2O4XA 3QUIA 2DZCA 2DZ9A 3A8OB 4QVZA 4XAXB 5CKDA 5GMKl 4E7IA 3HSBA 1BKBA 3KUFA 1WGSA 1VQMA 1VIEA 2DVEA 2RO0A 2EWNA 3TU4K 2LCLA 2DTHA 2L8DA 1WJRA 1KQSA 2LDMA 4EMKB 2C06A 1KC8C 2MMPA 2RHIA 3LGLA 5CKBA 3FC3A 3OYCA 3RKYA 2WACA 1Q7YC 4NL2A 3HL8A 3KBGA 4BE1A 2DPPB 5LJ3g 2XICA 3UWNA 2ZGWA 3CC7A 3CBPA 4HT8A 3ME9A 4C8QD 2VXEA 4M77B 5GAOm 2QTXA 1JJ2A 1NE8A 1UGSB 4XTXA 4L6V5 4O5VA 4UC4A 2V8JA 5C6SA 5GANh 4C5IA 1VQ6T 3R6OA 4F7UA 3AHUA 3J81E 3M53A 4M7AC 3UDCA 4BACA 3JCMP 3L2RA 2DJZA 2M9UA 3OSSC 3JCMQ 2YLBA 4BI4A 5CKFA 3OSVA 5LJ5e 4M77F 1YITA 2WSCE 1M1GA 2OTLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C06 A;  3JRZ A;  5CKB A;  1UB4 A;  4ELY C;  5CCA A;  5DLO A;  2MF2 A;  1VUB A;  3TCJ A;  5CK9 A;  4MZP A;  3NFC A;  3VUB A;  4MZT A;  1X75 C;  5HK0 A;  5CR2 A;  4OF1 A;  5CO7 A;  5CKE A;  1NE8 A;  4MDX A;  1M1F A;  3HPW A;  4ME7 A;  5HK3 A;  2VUB A;  3G7Z A;  3JSC A;  5CQY A;  5CQX A;  5CKD A;  4ELZ C;  4HKE A;  4VUB A;  5CKH A;  5HKC A;  5CKF A;  4MZM A;  2KMT A; 
#chains in the Genus database with same CATH topology
 1NPP A;  3QXE B;  3MHX A;  1OYX A;  4J9E A;  4PJO C;  5GAN d;  2L3Q A;  2WSF E;  3V8L A;  1YJN A;  3EG9 A;  2PU9 B;  1EIF A;  3I56 A;  1LPL A;  3L42 A;  4F7U E;  3GPL A;  4OGC A;  2JN0 A;  2M51 A;  2QAZ A;  2XI9 A;  2KGT A;  2JW4 A;  2FL7 A;  5L23 A;  2QQ9 A;  4IUP A;  2GQV A;  3JB9 I;  8AT1 B;  4FCY A;  1PD1 A;  4M75 A;  4N4G A;  4F17 A;  3QII A;  2EW3 A;  3JCM J;  4PJO E;  3QJ6 A;  2QQS A;  1M1K C;  2LQ8 A;  1QW1 A;  1VYU A;  4L5G A;  4IUV A;  2CP7 A;  4JZ3 A;  2KRO A;  1PM3 A;  3OW2 A;  4M78 B;  5FRN A;  1X6O A;  2MOX A;  2HSP A;  2EIF A;  1GBQ A;  3ZEH A;  2YWW A;  2A37 A;  3MPU B;  1VQ4 T;  2OTJ Q;  5LJ5 h;  1OUL A;  4N0A A;  3CXC P;  1O9S A;  3BY7 A;  2K9G A;  1VQP T;  2RQR A;  2E70 A;  3MEA A;  1WQ7 A;  3H8Z A;  4GBQ A;  3S6W A;  3OYD A;  3MO8 A;  4FT2 A;  2BTT A;  4A53 A;  1M90 C;  2OTJ A;  5A0D A;  2OAW A;  2GTO A;  3CXC A;  4LDW A;  4AFZ C;  3QWX X;  3VUZ A;  3KXT A;  1RAE B;  2LCS A;  1D1B A;  2VYT A;  3JB9 G;  3I55 Q;  4PNO A;  2ATC B;  4AFQ C;  2DMO A;  3PTA A;  1YJ9 T;  1YIT T;  4FL6 A;  2A36 A;  3I55 A;  1MGQ A;  2L3S A;  4OMN A;  5A2Q E;  1VQ5 T;  2L3R A;  1UGV A;  2KK4 A;  2JXB A;  1KHC A;  2RHZ A;  2M02 A;  4Y28 E;  4OMP A;  3OS1 A;  3I5S A;  4B9W A;  1Y96 B;  1D3B B;  2D9T A;  4CC3 A;  5GAO p;  3RIR A;  3NHN A;  3DB3 A;  1I8F A;  2H3J A;  4JJN K;  2L0A A;  2KR3 A;  2F2V A;  4CI0 C;  3BW1 A;  1BI2 A;  2VGM A;  3FB9 A;  2KDS A;  2XKO C;  4M7A B;  2PVD B;  2K2M A;  2BZX A;  4EMK A;  3X28 B;  3OB9 A;  4BDY A;  1Q81 U;  2CP6 A;  4DEY A;  2E6N A;  2JVV A;  2DFU A;  3LYI A;  3PIP A;  4OB0 B;  2HKQ B;  3VUB A;  4E7Z A;  2JTM A;  2DEU A;  2EPD A;  2D8H A;  3CEY A;  1NJI R;  2HQE A;  1JEG A;  3RNJ A;  3G71 T;  4M4Z A;  3PVQ A;  3QSU A;  2FPE A;  2DE0 X;  4ATO A;  5CKH A;  1NBE B;  3X25 B;  2X4W A;  1M8V A;  4QQ6 A;  3TVT A;  1KK7 A;  2E1H A;  4C0Z A;  3OYE A;  1QQJ A;  4OML A;  1ZUY A;  2EYQ A;  1X43 A;  2OX7 A;  4A54 A;  1VYV A;  3HKS A;  4BI8 B;  2DYB A;  2DTI A;  5IXF A;  1M9S A;  1M30 A;  4J9I A;  1KC8 U;  2EFI A;  2D0Q B;  3VJP A;  2FZG B;  3MEW A;  2ZPH B;  3EH1 A;  1RAH B;  3OYM A;  5GAN 2;  5GMK j;  2DM1 A;  2H8H A;  1H3H A;  2DJQ A;  1WXB A;  3BE3 A;  3CPF A;  4F7U G;  1MHN A;  2M0O A;  4VUB A;  2O2O A;  1UEC A;  3O8V A;  4C0G A;  1QVF P;  1KJW A;  3GNG A;  1F1B B;  4PJO G;  1IHV A;  1NEG A;  3PE0 A;  1BYM A;  3SWN C;  3EGD B;  4NOY A;  1QP2 A;  3N5B B;  1QVF A;  5IN1 A;  2XK0 A;  3G7Z A;  3M58 A;  5EG2 A;  4KUL A;  3ZFJ A;  2EYX A;  2LX9 A;  5D7U A;  4HVW A;  4A4G A;  2NUP B;  2DLP A;  1PRM C;  2CT3 A;  1D0Z A;  4XTW A;  3HTR A;  4X9D A;  2PUO B;  3OBY A;  5GJW B;  3CCU T;  4DBF A;  4D8K A;  3SB2 A;  1JJ2 S;  1RI9 A;  2A0F B;  2CDT A;  2VKN A;  1W2B S;  4BD3 A;  3P8H A;  4AT1 B;  3OYH A;  2EGA A;  2J05 A;  4PFO A;  1ZBJ A;  1KHI A;  2FPF A;  4AG1 C;  1RL2 A;  4ZGJ B;  4FW2 A;  5I11 A;  1VIF A;  2JMC A;  5LJ5 g;  4F04 B;  4RCC A;  2KBT A;  3CMA Q;  3WVD B;  4XU2 A;  4QQG A;  4M77 C;  2RA2 A;  1NJI C;  3EG9 B;  4LD9 K;  1CSK A;  3C94 A;  2YUP A;  3CQT A;  5GMK e;  1W4S A;  2ROL A;  1BBZ A;  1BCO A;  4PJN A;  2QA4 Q;  4RTU A;  4M75 B;  1HYO A;  2AHJ B;  2JOY A;  3BDL A;  5GAM h;  4M7D A;  3OYB A;  4PJM A;  4C92 C;  3QO3 A;  2QA4 A;  2FG0 A;  3JB9 J;  2W10 A;  2DK3 A;  1IGU A;  1Y7X A;  3OW2 S;  1IB8 A;  4LN2 A;  3VYG A;  1K73 U;  1QWF A;  3JCM W;  4B6M A;  2DL8 A;  4PK4 A;  2RQT A;  3RER A;  3EHR A;  4BE0 A;  2E6Z A;  2XD0 A;  3CCL Q;  2QQA A;  3RUX A;  1FWZ A;  1UFF A;  2RI2 A;  1VQ9 Q;  2QQR A;  2LT1 A;  1QVG P;  3ULR B;  2YHT A;  2D8J A;  4CRI A;  4FW1 A;  2J6K A;  3CCL A;  3CXC S;  1U3O A;  1U8R A;  5GAN 8;  1VQN T;  2FRW A;  3UT1 A;  5LJ3 j;  1VQ9 A;  3G4S T;  4M78 F;  1FYN A;  3VS0 A;  2QG9 B;  2EGE A;  1QVG A;  1D0Y A;  2KAF A;  4C8Q A;  1EZZ B;  1X69 A;  1H92 A;  3FIF A;  2DD4 A;  4B9X A;  3QDF A;  4M7D D;  3JCM b;  3QZ5 B;  1M3C A;  2PVO B;  1VQL Q;  2KE9 A;  1N6A A;  3OYN A;  1Q82 U;  2K3B A;  2JJ9 A;  1UHF A;  2DF6 A;  1VQL A;  4JRI A;  3CCS A;  4FYW B;  2CGH A;  1A0N B;  1R0C B;  3HRU A;  3JCM V;  1NYF A;  1R0B G;  1VQM Q;  2A3L A;  1Y07 A;  1YJN T;  1KQS P;  1WFW A;  1MNE A;  1U1S A;  5GMK l;  3C0C A;  3CC7 Q;  1WGS A;  1VQM A;  2DTH A;  4RTW A;  1KQS A;  2EVR A;  4EMK B;  2RHI A;  5CKB A;  3OYC A;  1LCK A;  1T0H A;  4E6R A;  3CC7 A;  2HDA A;  4C8Q D;  4M77 B;  1XJW B;  5GAN h;  3R6O A;  4F7U A;  3J81 E;  2EQI A;  4BAC A;  2DJZ A;  2M9U A;  3OSS C;  2YLB A;  4J9D A;  1X2Q A;  2DNU A;  5LJ3 e;  2Z0W A;  4PJO A;  3KFV A;  1UUE A;  5KCH A;  2CH4 W;  2KYM A;  4J5Y A;  2O01 E;  2IVW A;  1K9M U;  2IIM A;  2MK5 A;  3A8G B;  4RTX A;  4PJJ A;  1MMG A;  4FIB A;  4J6Y A;  1VQ6 Q;  1BIA A;  2NLU A;  2DER A;  1M2V A;  3EFO A;  1D09 B;  3CPW P;  2OTL Q;  1I07 A;  1ZSG A;  3M55 A;  3SHW A;  3VU3 C;  1BI1 A;  4A4E A;  1YI2 Q;  4DBR A;  3I55 T;  2PUK B;  1ZA1 B;  3HPW A;  3F70 A;  4DOW A;  2MIO A;  2JS2 A;  4E2F B;  3P8D A;  2O9V A;  1ARK A;  4EDU A;  4OB2 B;  2OTL A;  4M7A D;  1YI2 A;  2GCX A;  4NL3 A;  4A4H A;  1QCN A;  4A63 B;  3H0F A;  5GMK i;  2KNB B;  4ZN3 A;  1HD3 A;  2DL5 A;  1XOV A;  5GAN 4;  3J80 E;  4R0K A;  3CC4 Q;  3VS2 A;  1WA7 A;  5LJ5 f;  1PWT A;  2FZC B;  5J3B A;  1VQK Q;  4EMH A;  1K4U S;  5M9O A;  3J7A F;  3PGG A;  3GBQ A;  1RUW A;  1G3S A;  2P0P A;  3CC4 A;  1SPK A;  3DLL A;  1EFN A;  5FRM A;  2AKK A;  4FYV B;  2QQB A;  1VQK A;  1GRI A;  3OYA A;  1G3W A;  3MEV A;  4Z02 A;  1WLP B;  4M78 E;  1SHF A;  2MF2 A;  5GAM g;  3QKJ A;  2BE9 B;  2W0Z A;  2YRD A;  1QWE A;  4IUU A;  1BI0 A;  3GIB A;  2BUD A;  3MP1 A;  5GAO r;  3OYI A;  1PKS A;  1NPR A;  2EAY A;  1WXU A;  3V7S A;  2DKG A;  2X51 A;  1B3Q A;  2ZPB B;  3M59 A;  4MZP A;  3MP6 A;  1D1C A;  4BDZ A;  1S72 Q;  4V2S A;  4JPB W;  1IXD A;  1YHQ Q;  5FU6 B;  1PRL C;  5FWC A;  5IHK A;  2RHY A;  1S72 A;  1AWX A;  2GNC A;  1PD0 A;  3FDR A;  2I0N A;  2VAS A;  1YHQ A;  3E9F A;  1UJ0 A;  4IUR A;  1BI3 A;  3UAT A;  4M7D B;  3A8M B;  3FJP A;  1V1C A;  1WHL A;  1G8X A;  3S3M A;  1UE9 A;  5GAO l;  2L89 A;  1RLQ C;  2XG8 D;  3UA7 A;  2DBM A;  2RJE A;  2DXC A;  4HVV A;  2IPO B;  1KQ2 A;  3PNW C;  2JM9 A;  3WXM B;  2P84 A;  5DM7 R;  5CIU A;  2VC8 A;  2V1R A;  2X35 A;  3I5R A;  1UEB A;  3GLX A;  5GAO q;  2B8A A;  2CP0 A;  4CC7 A;  2F2W A;  4LUE A;  1ABQ A;  2JUF A;  2RI3 A;  2QGG A;  2QEX Q;  1X2K A;  1VQO Q;  4C5G A;  2EQK A;  2MCN A;  3BDU A;  1OX9 A;  4KGX B;  2VWF A;  3OS5 A;  4PLL A;  2QEX A;  4KUD K;  1WX6 A;  2P4T A;  1QVG S;  1VQO A;  4FSX A;  3VS3 A;  2RB6 A;  3MET A;  4C8Q B;  2ZPI B;  1ZX6 A;  4JRQ A;  1Q86 R;  5HK3 A;  3GF5 A;  5LJ3 d;  3BFM A;  5ECA A;  3EGX A;  1PSF A;  2NUT A;  3M0R A;  5GAN g;  2XHC A;  4DA4 A;  2R5A A;  4Y91 A;  1UG1 A;  4M75 D;  2FO0 A;  1X27 A;  2RM4 A;  2GTJ A;  4ZGE B;  1AWW A;  1N5Z A;  1QCO A;  2QTV A;  4J8O A;  4GY5 A;  4ZN1 A;  2J06 A;  3SWN A;  2GQI A;  4PLI A;  1N9R A;  4HCB A;  3CCJ Q;  1MUZ A;  4RCB A;  4GLM A;  5GMK m;  3JAM E;  2BZY A;  4Q5W A;  5CQY A;  2DXB A;  2AKL A;  4X34 A;  4OB1 B;  2KI7 A;  3CMA T;  2DO3 A;  3LH0 A;  2CRE A;  1QKW A;  1NZ9 A;  3CCJ A;  2XDP A;  1M1K U;  1KQS S;  3LX7 A;  2F69 A;  4OB3 B;  3OY9 A;  1SF9 A;  3DKM A;  2KSS A;  4C0D C;  4LNP A;  3JCM d;  1RAA B;  1ACM B;  2XID A;  1AOJ A;  2HL5 C;  1SEM A;  3VYH B;  1XTD A;  4Z88 A;  4EPC A;  1GFC A;  1KSW A;  1BU1 A;  4F7U B;  2R58 A;  2HCK A;  4J9B A;  3PFS A;  5IH2 A;  1AEY A;  2DL7 A;  1H64 1;  4JJC A;  2RJC A;  2CH4 A;  5KE2 A;  1WHG A;  3LW5 E;  1WJQ A;  2COW A;  2LJ1 A;  4PJO B;  1Q7Y R;  4M77 A;  2AK5 A;  4M78 G;  4EMG A;  1M90 U;  2SEM A;  4TVR A;  3PMT A;  2AZS A;  2F5K A;  4MDX A;  1JB0 E;  3CCM Q;  3NTK A;  2GF7 A;  2RH2 A;  1OZ2 A;  4LDU A;  2KEA A;  3CCL T;  3L2U A;  1OPL A;  3MCA B;  2RQU A;  1SG5 A;  3CCM A;  3VKI A;  1VQ9 T;  4C0F A;  5FLX E;  4C92 A;  1M2V B;  3QBY A;  3EFO B;  1JXM A;  4BY6 C;  5CR2 A;  1QCF A;  3OMC A;  2RHU A;  2FEI A;  5GAM f;  4LUD A;  2KRS A;  4KRT A;  3OA6 A;  1KD1 R;  2MI6 A;  1VA7 A;  4QVD A;  1IO6 A;  4F16 A;  3QZ9 B;  1AVZ C;  5DLO A;  2P0K A;  9ATC B;  3VS4 A;  2D1X A;  3EFS A;  1M27 C;  1PSE A;  2EQJ A;  1Q86 C;  4M77 D;  4AFS C;  1W1F A;  1RLP C;  2RMO A;  4M75 E;  3HFO A;  1ZHI A;  1OPK A;  1AZE A;  2CUD A;  5J39 A;  2YUQ A;  2QDY B;  1VQ8 Q;  1VQM T;  2YXY A;  3S3N A;  2CZ6 B;  4LXC A;  3LH5 A;  2KVQ G;  3EG1 A;  4AMC A;  2ZZD A;  2E3H A;  2ZPE B;  4C92 D;  5I2S A;  2K7A A;  1RAF B;  5I2M A;  3CC7 T;  3CCE Q;  1VQ8 A;  5AT1 B;  3PVL A;  1VQ7 T;  1WNL A;  4YTL A;  2VVK A;  2EBP A;  3CCE A;  1WJS A;  5L8R E;  3SFM A;  1AHJ B;  1TU0 B;  1JBM A;  1K0X A;  2RK1 A;  1UGP B;  2EQM A;  2EKO A;  2SRC A;  2L5Q A;  3WVE B;  1D0X A;  2HSE B;  2V26 A;  4O6J A;  4ME7 A;  1FX7 A;  2O4X A;  3I35 A;  4QVZ A;  2DZ9 A;  1K8A R;  4ORZ A;  1ZA2 B;  4DBQ A;  1N8R R;  1VIE A;  2RO0 A;  2KXC A;  1TS9 A;  2MMP A;  2DX1 A;  2CSQ A;  1Q7Y C;  5KYN A;  3KBG A;  1OOT A;  2ZGW A;  3CBP A;  4Z89 A;  3ME9 A;  5GAO m;  2YRC A;  1NE8 A;  1UGS B;  4JJB A;  1YIT Q;  4XTX A;  4L6V 5;  4O5V A;  5C6S A;  1VQ6 T;  3UDC A;  4PFZ A;  3A1P A;  5CKF A;  1YIT A;  3PMI A;  1M1G A;  2OTL T;  1MND A;  2K5L A;  1WQW A;  5I21 A;  3TEE A;  5GAN f;  4BUG A;  3M0T A;  4II1 A;  1X6G A;  4X9C A;  2DA9 A;  4R56 A;  4IKF A;  4A4K A;  6AT1 B;  4J7I A;  1KD1 C;  2DIQ A;  1KIK A;  2GFA A;  4D6W A;  4M7D F;  2HMA A;  2QYZ A;  3E19 A;  3U23 A;  2RNA A;  3VS5 A;  1GBR A;  4CC2 A;  3VS6 A;  3VRZ A;  3V7R A;  1YBY A;  1TXQ A;  2FHD A;  1DJ7 B;  1VQK T;  1RI0 A;  2LNV A;  4JRP A;  1GCQ C;  2E10 A;  2KT8 A;  2G6F X;  4RG8 A;  5FW9 A;  3HHT B;  1G83 A;  2JM8 A;  1PNJ A;  1TUC A;  1NM7 A;  3O5Z A;  2R57 A;  2LQN A;  2NUT B;  3EGX B;  5KYU A;  1UGR B;  5GMK h;  1H3Z A;  5LL6 S;  2OJ2 A;  1B7T A;  3JB9 D;  3CCQ Q;  2COZ A;  3CD6 Q;  1W70 A;  1M5Q 1;  2K3Y A;  2PZ1 A;  1ZUU A;  1NJI U;  2LP5 A;  3CCQ A;  3M0P A;  3SWN B;  3PT9 A;  1YJW Q;  3CD6 A;  3FRN A;  2LZ6 B;  5HCK A;  4FU6 A;  2KY9 A;  3CCS Q;  4PL6 A;  3MP8 A;  4C8Q F;  2CKK A;  1M3A A;  4IIM A;  2K57 A;  2O88 A;  4J83 A;  2WSE E;  2KMT A;  4QVC A;  1YJW A;  2RK2 A;  1YHQ T;  2EJF A;  3T9N A;  3D7S B;  4XU1 A;  3DB4 A;  4JDS A;  3G1J A;  4KUI A;  1K8A C;  3I56 T;  4XTV A;  1PG5 B;  1N8R C;  1O75 A;  4J9F A;  1VOM A;  4M75 G;  4XU0 A;  1AWJ A;  2BKD N;  3C4S A;  2ESW A;  2KT1 A;  2YT6 A;  2JTF A;  1HSQ A;  2KYB A;  4K11 A;  3M54 A;  3CC2 Q;  4MZT A;  4OF1 A;  1SRL A;  3EHQ A;  1I1J A;  2JTE A;  1KG1 A;  2ZPF B;  4BE2 A;  1Y0M A;  1YWO A;  2RD1 A;  1UDL A;  3CC2 A;  2DL4 A;  2JNG A;  2CZ1 B;  1SSH A;  3E9G A;  4JJD A;  1BIB A;  2E5K A;  3TCJ A;  4M7A F;  4KGV B;  3H41 A;  2QEX T;  2LJ0 A;  3ZL7 C;  4C92 B;  1VQO T;  1FMW A;  1YIJ Q;  1V76 A;  3RBB B;  1MV3 A;  3L2Q A;  4KH1 B;  1I81 A;  2M1H A;  2OTJ T;  3CME Q;  2CZ7 B;  3THK A;  1FMK A;  3PIO A;  1UHC A;  3A5Z B;  1LVK A;  1YIJ A;  2EJG A;  4QQD A;  4GLK A;  4E7S A;  1ZSZ A;  1Q95 G;  4LDY A;  3CME A;  2ROT A;  3L1A A;  4OP0 A;  5D6W A;  4N4H A;  4AFU C;  2ZAE A;  3GOX A;  4HA8 A;  4N4I A;  2FVU A;  1WIE A;  2PTK A;  1LOJ A;  5GAM d;  2F2X A;  3CPW A;  1FMV A;  3JCM e;  2X3X D;  3G6E Q;  4M7D E;  5LJ3 h;  3VS1 A;  3A98 A;  1M4Z A;  3CCJ T;  2AZV A;  2QXF A;  2P0Q A;  1UJY A;  5GAN 6;  4PJO D;  3RKW A;  4M78 C;  2GGR A;  3G6E A;  1BB9 A;  1NLP C;  2M16 A;  1JO8 A;  2BE7 D;  2X4Y A;  2EQU A;  1GCP A;  1M3B A;  4OMF B;  1QVF S;  2DL3 A;  4J9C A;  4XTY A;  1S1N A;  4WTO B;  3NTI A;  2HNI A;  3RMS A;  3M4G A;  3TRE A;  2ECZ A;  1Q81 R;  1RAB B;  1UB4 A;  2M0Y A;  3E1S A;  2ZCF B;  3OYF A;  1B07 A;  3FJ5 A;  2CP5 A;  2JMA A;  3QYH B;  1T3S A;  2X9H A;  3QHS A;  1SRM A;  3QG1 A;  2O4X B;  3H6Z A;  1YFN A;  3JCM h;  4C8Q E;  4RTV A;  2FYK A;  3HRT A;  2LT4 A;  4HVU A;  2E12 A;  4OMM A;  1RAD B;  2VGN A;  3CCV Q;  2Y90 A;  4J7F A;  1HK9 A;  3SEM A;  4MMK A;  2VB6 A;  4LE9 A;  1XNI A;  5A0L A;  3MKD A;  1UGQ B;  3CCV A;  1UTI A;  2PVG B;  1T0J A;  2R5M A;  1W2B P;  1ZLM A;  1YCS B;  2DXU A;  4ELY C;  1VYT A;  1GFD A;  1MMA A;  1KC8 R;  1G3Y A;  5GJV B;  5CAI A;  4RTZ A;  1AT1 B;  4E7J A;  1MMD A;  3HP9 A;  1W2B A;  4LDX A;  1LNX A;  2XMF A;  1WPY A;  3ER0 A;  4ELZ C;  4J6X A;  3CBM A;  2DRM A;  1X6B A;  3QYG B;  1ZSZ C;  2ENM A;  2LJ3 A;  1TOV A;  1M8M A;  2RHX A;  1NLO C;  2DAQ A;  4KGZ B;  3TSZ A;  3L2V A;  4E7K A;  4M7A E;  4M75 F;  1BCM A;  4KH0 B;  2VV5 A;  4QW2 A;  2RJF A;  2H3E B;  1VQ8 T;  1ZUK A;  4DEX A;  3OW2 P;  5KYU B;  1WXT A;  4PFP A;  4OVA A;  1AZG B;  1WHK A;  3CCE T;  1SHG A;  4C5E A;  4OMQ A;  2LQW A;  5KCO A;  3JB9 H;  1C1A A;  2K5I A;  1CKA A;  4RUG A;  1FXX A;  1Z9Z A;  2CT4 A;  2FRY A;  3A8L B;  2QK0 A;  5FRO A;  2D6F A;  1Q81 C;  4D8D A;  2XDD A;  1AWO A;  3P8B B;  4X1V A;  3LWI A;  4P5N A;  5D6Y A;  1WHM A;  1VUB A;  2HKN A;  2QAS A;  1K76 A;  1QMC A;  1YN8 A;  3FLG A;  2C0O A;  3EFR A;  3IQL A;  4JUV A;  4JLI A;  1I0C A;  3CCR Q;  3LGF A;  3M0Q A;  1B34 A;  1PHT A;  4DOV A;  2YUO A;  3JSC A;  5CQX A;  2LVM A;  1OV3 A;  1QKX A;  4HKE A;  1TG0 A;  2O9S A;  1JXO A;  3CCR A;  3TSW A;  5GAN 7;  4KBM B;  1WI7 A;  2EYY A;  2EYZ A;  4M7D G;  2YUN A;  4ZNX A;  1IHW A;  2X3W D;  2COY A;  4RKU E;  1IRE B;  3DLM A;  2YRV A;  5IXB A;  5CKE A;  1C0M A;  2DXT A;  4ANJ A;  2V1Q A;  3C95 A;  2QA4 T;  3NPF A;  2RJD A;  1K73 R;  3H0H A;  5CKD A;  3HSB A;  1OX8 A;  1MV0 B;  2EWN A;  3TU4 K;  1RAI B;  2C06 A;  1KC8 C;  1U06 A;  3FC3 A;  4NL2 A;  4BE1 A;  2DPP B;  5LJ3 g;  2XIC A;  3UWN A;  2VXE A;  5KYW B;  1K9A A;  4UC4 A;  4C5I A;  2FPD A;  3M53 A;  3TQ7 P;  3L2R A;  2HQH A;  4BI4 A;  4M77 F;  2F1L A;  2WSC E;  1YWP A;  2GBQ A;  2GFU A;  4AG2 C;  3AT1 B;  4C8Q G;  1ZSZ B;  2AIR B;  1U1T A;  3FEO A;  3M9Q A;  2ED1 A;  3RDV A;  5GAN 3;  5I22 A;  2LCC A;  3CCQ T;  1Q82 R;  3X26 B;  3CD6 T;  5GAM j;  4JLG A;  4M75 C;  5D6X A;  4C92 F;  3SDZ A;  1GXI E;  3CPW S;  2LQK A;  2MWO A;  4FSS A;  3JCM g;  2K5F A;  8ATC B;  1YJW T;  2P4R A;  3QPH A;  1XQH A;  1VQL T;  3CBO A;  3V8J A;  1RAC B;  1GCQ A;  3CCS T;  5FU7 C;  2K3X A;  3L2Z A;  1SSF A;  2KQW A;  5KYX A;  4JRK A;  4N0A C;  1TSF A;  2HEQ A;  5KYY A;  5CK9 A;  4RG2 A;  1WDX A;  3RKX A;  2C0I A;  2I2L A;  4LDV A;  2NUZ A;  5LJ5 d;  4OMO A;  1E6H A;  2HD0 A;  3ZBD A;  4M7A G;  2VUB A;  3X24 B;  2Y4Y A;  5DLQ E;  4E7L A;  1JU5 C;  2HAX A;  2RPN A;  3CC2 T;  2J6O A;  3SD4 A;  1VQ4 Q;  2A7Y A;  2EYW A;  4ZGD B;  4HCC A;  1VQP Q;  3HRS A;  3M57 A;  5CO7 A;  2PNI A;  2LC4 A;  4C0D B;  1K73 C;  3JCM X;  3JCM c;  1VQ4 A;  1IRX A;  1K9M R;  1OEB A;  1VQP A;  1CKB A;  4XTU A;  1WYX A;  4OGE A;  5GAM e;  1YCY A;  2NWM A;  1N27 A;  1YIJ T;  2OAU A;  3MJX A;  4BB7 A;  2LRQ A;  5CVI A;  1ABO A;  2HQX A;  2BZ8 A;  3CME T;  2L3P A;  4IUQ A;  1YJ9 Q;  1Q86 U;  1N9S A;  3L2W A;  1J3T A;  3HFN A;  2CS7 A;  3M56 A;  1VQ5 Q;  2HZY A;  4PKC C;  4EMK C;  1PC0 A;  1YJ9 A;  3LLR A;  3JRZ A;  2E4H A;  1QP3 A;  2DEQ A;  1YI2 T;  5GAN j;  1VQ5 A;  1NG2 A;  2EKH A;  3NFC A;  4XK8 E;  5HK0 A;  3M0S A;  3JB9 F;  2RQV A;  3EAE A;  4BY6 B;  1LJO A;  4EIK A;  2LX7 A;  1Q82 C;  4FYX B;  3CMA A;  3G6E T;  4HXJ A;  1BK2 A;  4R55 A;  3VRY A;  3R6N A;  2EJ9 A;  1I4K 1;  1SKU B;  2MWP A;  2YDL A;  1OZ3 A;  3CC4 T;  4M77 E;  4IIO A;  2X4X A;  4ESR A;  2B86 A;  1X75 C;  1OU8 A;  4JS5 A;  2V8I A;  5FU7 B;  1RAG B;  1V29 B;  2IG0 A;  3VV0 A;  4A4F A;  5KE3 A;  2A28 A;  5HY6 A;  1G2B A;  3REA B;  4BI3 A;  3OBW A;  3OYJ A;  4RTY A;  3G71 Q;  2FB7 A;  2K79 A;  4C92 E;  2QDL A;  4Y92 A;  4C5H A;  1Q7Y U;  3H9N A;  3VS7 A;  2DVJ A;  3EG2 A;  3UA6 A;  4DQ2 A;  4M78 A;  5A0G A;  1IGQ A;  3G71 A;  3NTH A;  4Z8A A;  3UPU A;  2BIV A;  2E3I A;  2XDB A;  5LJ3 f;  1B34 B;  1GL5 A;  4CC4 B;  2JT4 A;  1D1A A;  2CP2 A;  1S72 T;  2X4J A;  3CCV T;  1ZBX A;  1G3T A;  5KH6 A;  4E7H A;  2F5T X;  3NMZ C;  1YNZ A;  4IUT A;  2JS0 A;  3EG3 A;  3H0I A;  3NGP A;  2DD5 A;  1M1F A;  5GAN e;  2L2P A;  1K9M C;  1Z9Q A;  3OS2 A;  1IZ6 A;  3REB B;  1KD1 U;  1E7O A;  1OQK A;  5HKC A;  3RES A;  2EGC A;  2MAM A;  5CCA A;  2K2V A;  2C0T A;  2ZPG B;  2E65 A;  2J7I A;  4PJL A;  3RR6 A;  3EH2 A;  2NYS A;  3JCM f;  4QT7 A;  4M78 D;  1T3L A;  2DIG A;  1E6G A;  2YLC A;  1Y96 A;  2KRN A;  2D0N A;  2QI2 A;  1X01 A;  1D3B A;  4FYY B;  4ZTF A;  2DBK A;  4MDW A;  2G3R A;  3I9Q A;  2LTO A;  1R8O B;  3A8H B;  2OI3 A;  1WHH A;  1VQ7 Q;  2XU8 A;  1JRI A;  1PCX A;  2O31 A;  3URG A;  3OYG A;  1NYG A;  1U5S A;  1JQQ A;  4HCK A;  4RMO A;  2DIL A;  4F7U F;  1TWB A;  1W6X A;  2HBW A;  4WCI A;  5KYW A;  2E64 A;  1QLY A;  3OYY A;  3M4Y A;  4J9G A;  3QDR B;  5FU6 C;  1VQ7 A;  2CYZ B;  5IAY A;  2QGF B;  5IHI A;  4M7A A;  4XQ3 A;  1TUD A;  4PJO F;  3CCU Q;  2E41 A;  2FZK B;  3OYK A;  3LWH A;  2J6F A;  1OI1 A;  2E5Q A;  4MZM A;  3C12 A;  1TUG B;  1C6V X;  2KXD A;  4MML A;  1KFZ A;  4M7D C;  2AT1 B;  3CCU A;  4XU3 A;  2LNH B;  4E47 A;  2ABL A;  2ED0 A;  4FT4 A;  2MPX C;  4NS5 A;  5GAN 5;  1K8A U;  4F14 A;  1TTH B;  1N8R U;  1Y71 A;  7AT1 B;  1HXD A;  3OQ5 A;  5KYX B;  2RF0 A;  3OYL A;  4LD6 A;  2DTO A;  3CCR T;  2MYS A;  3GP8 A;  1M1K R;  1K0S A;  4L59 A;  5KYY B;  1VQ6 A;  1I5L A;  2YSQ A;  1H8K A;  2KRM A;  2PQW A;  1WHJ A;  3M5A A;  3ASK A;  2JZ2 A;  3OMG A;  5LJ5 j;  3GNF B;  2CZ0 B;  1EX4 A;  1ZQ1 A;  4J6W A;  5AYF A;  2K4Y A;  3X20 B;  2Y4X A;  4JZ4 A;  5J26 A;  4FM4 B;  4C8Q C;  4M77 G;  2RQW A;  1TH7 A;  5DY9 A;  1HJD A;  2V8K A;  4DBH A;  1M90 R;  3RMQ A;  4HCZ A;  3EGU A;  3Q1J A;  4JS4 A;  5IT9 E;  3QJY A;  2HBP A;  3V7C A;  4XTZ A;  4KT0 E;  3S3O A;  4ZTJ A;  1G5V A;  4WF2 A;  2RN8 A;  4HT9 A;  3QWY A;  3OS0 A;  1R77 A;  3M0U A;  5IHN A;  3JV3 A;  5FWB A;  1VQN Q;  2VXF A;  1QVP A;  1P92 A;  3INZ A;  3G4S Q;  3CCM T;  4C92 G;  1KQ1 A;  2RI5 A;  3EGD A;  2K6D A;  3MEU A;  5GAO n;  2CP3 A;  2CSI A;  5C0M A;  1VQN A;  1M2O A;  3V8K A;  3G4S A;  1PKT A;  3QUI A;  2DZC A;  3A8O B;  4XAX B;  4E7I A;  1OU9 A;  1BKB A;  3KUF A;  5EC7 A;  2DVE A;  2DET A;  4J9H A;  4QKU A;  2LMJ A;  1YP5 A;  1I5O B;  1Y57 A;  2LCL A;  2NUP A;  2L8D A;  1WJR A;  1JJ2 P;  2LDM A;  1MMN A;  3LGL A;  2HL3 A;  3RKY A;  2WAC A;  1NEB A;  2CUB A;  3HL8 A;  3E2U A;  4HT8 A;  2DRK A;  3UF4 A;  2DYI A;  2QTX A;  1WZO A;  4RTT A;  1JJ2 A;  2A08 A;  2V8J A;  1AD5 A;  3EG0 A;  3AHU A;  4M7A C;  1K1Z A;  3JCM P;  1YJN Q;  3JCM Q;  3OSV A;  3I56 Q;  5LJ5 e; 
#chains in the Genus database with same CATH homology
 2K5L A;  2GFU A;  5LJ3 e;  1WQW A;  1NPP A;  3QXE B;  3MHX A;  1OYX A;  3TEE A;  5I21 A;  4PJO A;  4C8Q G;  5GAN f;  5GAN d;  4PJO C;  2WSF E;  3V8L A;  1YJN A;  4BUG A;  2PU9 B;  1U1T A;  1EIF A;  4II1 A;  3FEO A;  3I56 A;  4X9C A;  4R56 A;  4IKF A;  3M9Q A;  5KCH A;  3L42 A;  4F7U E;  4A4K A;  3GPL A;  4OGC A;  4J5Y A;  2JN0 A;  2XI9 A;  5GAN 3;  2O01 E;  2IVW A;  4J7I A;  1KD1 C;  2FL7 A;  2DIQ A;  1K9M U;  2LCC A;  2QQ9 A;  2GFA A;  2GQV A;  4IUP A;  3JB9 I;  3X26 B;  3A8G B;  4D6W A;  3CCQ T;  3CD6 T;  4M7D F;  5GAM j;  4M75 A;  3E19 A;  4JLG A;  4M75 C;  5D6X A;  4C92 F;  4FIB A;  4J6Y A;  4N4G A;  3QII A;  3SDZ A;  1BIA A;  2NLU A;  3CPW S;  2LQK A;  1GXI E;  2MWO A;  4PJO E;  3JCM J;  3QJ6 A;  2QQS A;  3JCM g;  2K5F A;  1M1K C;  2LQ8 A;  1QW1 A;  1YJW T;  3V7R A;  1YBY A;  3QPH A;  1XQH A;  1VQL T;  2FHD A;  4L5G A;  1DJ7 B;  3CBO A;  1RI0 A;  3V8J A;  4IUV A;  1VQK T;  2LNV A;  4JRP A;  3CCS T;  3M55 A;  3OW2 A;  2E10 A;  3VU3 C;  5FU7 C;  4M78 B;  5FRN A;  1BI1 A;  1X6O A;  2K3X A;  4RG8 A;  4A4E A;  3L2Z A;  3I55 T;  2PUK B;  3HPW A;  3F70 A;  3HHT B;  4DOW A;  3P8D A;  1SSF A;  2EIF A;  4EDU A;  3ZEH A;  2R57 A;  4OB2 B;  2OTL A;  2KQW A;  4M7A D;  5GMK h;  1UGR B;  4JRK A;  1H3Z A;  1VQ4 T;  5LL6 S;  5LJ5 h;  4N0A A;  4N0A C;  1O9S A;  3BY7 A;  3JB9 D;  2GCX A;  1YI2 A;  4NL3 A;  1VQP T;  2E70 A;  3MEA A;  4A4H A;  1WQ7 A;  3H8Z A;  3S6W A;  3OYD A;  5CK9 A;  4RG2 A;  3MO8 A;  1M5Q 1;  5GMK i;  4FT2 A;  2K3Y A;  4A53 A;  4ZN3 A;  1M90 C;  1XOV A;  5GAN 4;  3J80 E;  2OTJ A;  3RKX A;  5A0D A;  1NJI U;  2I2L A;  4LDV A;  3CXC A;  4LDW A;  5LJ5 f;  5LJ5 d;  3CCQ A;  3SWN B;  3PT9 A;  3CD6 A;  3FRN A;  5J3B A;  2HD0 A;  3VUZ A;  3ZBD A;  4EMH A;  5M9O A;  3KXT A;  4FU6 A;  2KY9 A;  2VUB A;  3J7A F;  3PGG A;  4M7A G;  3X24 B;  4PL6 A;  3MP8 A;  4C8Q F;  1G3S A;  2CKK A;  2P0P A;  2Y4Y A;  2VYT A;  5DLQ E;  3JB9 G;  4E7L A;  3CC4 A;  2K57 A;  4PNO A;  4J83 A;  2WSE E;  2KMT A;  3DLL A;  4QVC A;  1YJW A;  5FRM A;  2HAX A;  2QQB A;  3CC2 T;  1VQK A;  2RK2 A;  3SD4 A;  1G3W A;  3MEV A;  3OYA A;  4Z02 A;  3PTA A;  4M78 E;  1YJ9 T;  2MF2 A;  1YIT T;  4FL6 A;  1YHQ T;  2EJF A;  3T9N A;  5GAM g;  2A7Y A;  3QKJ A;  4ZGD B;  4XU1 A;  3DB4 A;  4HCC A;  3I55 A;  1MGQ A;  4IUU A;  3HRS A;  3M57 A;  1BI0 A;  5CO7 A;  4JDS A;  2LC4 A;  5A2Q E;  3GIB A;  1VQ5 T;  2L3R A;  4KUI A;  4C0D B;  1K73 C;  2BUD A;  3JCM X;  1K8A C;  3MP1 A;  3JCM c;  2KK4 A;  3I56 T;  5GAO r;  4XTV A;  3OYI A;  1VQ4 A;  1N8R C;  1KHC A;  1O75 A;  1NPR A;  2RHZ A;  4Y28 E;  2EAY A;  3OS1 A;  4M75 G;  4B9W A;  1VQP A;  1Y96 B;  4XU0 A;  3C4S A;  2BKD N;  4XTU A;  1D3B B;  2D9T A;  4OGE A;  5GAO p;  3RIR A;  5GAM e;  3DB3 A;  1YCY A;  3V7S A;  2DKG A;  1N27 A;  1I8F A;  2OAU A;  2H3J A;  1YIJ T;  4BB7 A;  2ZPB B;  4JJN K;  2LRQ A;  5CVI A;  3M59 A;  2JTF A;  3MP6 A;  4MZP A;  2HQX A;  4BDZ A;  3M54 A;  3CME T;  4CI0 C;  3BW1 A;  4MZT A;  4IUQ A;  4OF1 A;  4V2S A;  1BI2 A;  2VGM A;  3FB9 A;  1Q86 U;  1KG1 A;  1N9S A;  2ZPF B;  3L2W A;  5FU6 B;  4BE2 A;  2KDS A;  2XKO C;  2RHY A;  4M7A B;  2PVD B;  1S72 A;  3HFN A;  2CS7 A;  2RD1 A;  3M56 A;  3FDR A;  3PMI A;  3CC2 A;  4PKC C;  4EMK A;  3X28 B;  4EMK C;  2JNG A;  3OB9 A;  1YJ9 A;  4BDY A;  1Q81 U;  2CZ1 B;  3LLR A;  1YHQ A;  3E9F A;  3E9G A;  3JRZ A;  1BIB A;  2E6N A;  2JVV A;  1QP3 A;  3LYI A;  4IUR A;  2DEQ A;  3TCJ A;  3PIP A;  1BI3 A;  1YI2 T;  4M7A F;  5GAN j;  3A8M B;  3FJP A;  4OB0 B;  2QEX T;  1VQ5 A;  4M7D B;  3NFC A;  4XK8 E;  2JTM A;  3VUB A;  4C92 B;  5HK0 A;  3CEY A;  1VQO T;  3JB9 F;  3S3M A;  3EAE A;  4BY6 B;  5GAO l;  1LJO A;  2L89 A;  2HQE A;  3L2Q A;  1I81 A;  2M1H A;  1Q82 C;  2XG8 D;  3CMA A;  2OTJ T;  3G6E T;  2RJE A;  2DXC A;  3G71 T;  4R55 A;  3QSU A;  2EJ9 A;  2CZ7 B;  1I4K 1;  4ATO A;  5CKH A;  3PIO A;  3A5Z B;  3X25 B;  1KQ2 A;  2X4W A;  2MWP A;  1M8V A;  1YIJ A;  2EJG A;  4QQD A;  4QQ6 A;  4GLK A;  3PNW C;  3WXM B;  5DM7 R;  1OZ3 A;  4LDY A;  4M77 E;  3CC4 T;  3CME A;  2E1H A;  5CIU A;  2VC8 A;  4C0Z A;  3L1A A;  2X4X A;  3OYE A;  4OP0 A;  2X35 A;  4N4H A;  5D6W A;  3GOX A;  1UEB A;  3GLX A;  4HA8 A;  2FVU A;  4N4I A;  1X75 C;  5GAO q;  2B8A A;  4JS5 A;  2V8I A;  2EYQ A;  5FU7 B;  1LOJ A;  1V29 B;  2IG0 A;  3VV0 A;  4A4F A;  5KE3 A;  2JUF A;  2RI3 A;  5GAM d;  4A54 A;  3HKS A;  4BI8 B;  5HY6 A;  2DTI A;  2EQK A;  4C5G A;  3CPW A;  4BI3 A;  3BDU A;  3OBW A;  3JCM e;  1M9S A;  3OYJ A;  4M7D E;  2FB7 A;  4C92 E;  3OS5 A;  5LJ3 h;  4PLL A;  2QEX A;  1KC8 U;  2P4T A;  1QVG S;  2EFI A;  4KUD K;  1M4Z A;  1VQO A;  4FSX A;  3CCJ T;  2D0Q B;  4C5H A;  1Q7Y U;  3VJP A;  2QXF A;  2RB6 A;  2P0Q A;  3MET A;  3MEW A;  2ZPI B;  4C8Q B;  5GAN 6;  2ZPH B;  4DQ2 A;  4M78 A;  4M78 C;  3RKW A;  5A0G A;  4PJO D;  3G6E A;  3G71 A;  3NTH A;  4JRQ A;  3OYM A;  2M16 A;  5GAN 2;  5GMK j;  2X4Y A;  3UPU A;  2BIV A;  2EQU A;  5HK3 A;  2XDB A;  5LJ3 f;  3CPF A;  3GF5 A;  5LJ3 d;  1B34 B;  3BFM A;  4OMF B;  1PSF A;  4F7U G;  1MHN A;  2M0O A;  5GAN g;  1QVF S;  4VUB A;  2XHC A;  4DA4 A;  4XTY A;  2R5A A;  3NTI A;  2HNI A;  3O8V A;  3M4G A;  3RMS A;  4C0G A;  4Y91 A;  4M75 D;  3TRE A;  1S72 T;  3GNG A;  2X4J A;  1UB4 A;  3CCV T;  1ZBX A;  2RM4 A;  3E1S A;  4ZGE B;  4PJO G;  1G3T A;  5KH6 A;  2ZCF B;  3OYF A;  4E7H A;  4J8O A;  2F5T X;  4GY5 A;  4ZN1 A;  1BYM A;  4IUT A;  3SWN A;  3SWN C;  4PLI A;  1N9R A;  3QYH B;  4NOY A;  4HCB A;  1QP2 A;  1M1F A;  2DD5 A;  3N5B B;  5GAN e;  1QVF A;  4RCB A;  5IN1 A;  1K9M C;  5GMK m;  3JAM E;  2XK0 A;  3OS2 A;  1IZ6 A;  3QHS A;  4Q5W A;  3G7Z A;  1KD1 U;  3M58 A;  5CQY A;  2DXB A;  3QG1 A;  5EG2 A;  5HKC A;  2O4X B;  4X34 A;  3H6Z A;  4OB1 B;  3CMA T;  3JCM h;  2DO3 A;  4KUL A;  3ZFJ A;  2LX9 A;  3LH0 A;  4C8Q E;  3CCJ A;  1NZ9 A;  3RES A;  2XDP A;  4A4G A;  2FYK A;  2MAM A;  2LT4 A;  3HRT A;  2E12 A;  5CCA A;  1KQS S;  2K2V A;  3LX7 A;  2F69 A;  4OB3 B;  4XTW A;  2ZPG B;  3OY9 A;  4X9D A;  2PUO B;  2E65 A;  3OBY A;  3DKM A;  2VGN A;  2KSS A;  4C0D C;  2Y90 A;  3JCM f;  3JCM d;  4J7F A;  1HK9 A;  3CCU T;  4M78 D;  2DIG A;  2XID A;  4MMK A;  3SB2 A;  1JJ2 S;  1XNI A;  2YLC A;  1W2B S;  4BD3 A;  3P8H A;  3OYH A;  3VYH B;  1XTD A;  1Y96 A;  4EPC A;  5A0L A;  2QI2 A;  4F7U B;  1X01 A;  1D3B A;  1UGQ B;  2R58 A;  3CCV A;  3PFS A;  2R5M A;  1KHI A;  2PVG B;  4ZTF A;  1RL2 A;  4MDW A;  2G3R A;  4ZGJ B;  2LTO A;  1R8O B;  3A8H B;  1VIF A;  1H64 1;  2RJC A;  5LJ5 g;  4RCC A;  2DXU A;  4ELY C;  2XU8 A;  1JRI A;  3OYG A;  3URG A;  5KE2 A;  3LW5 E;  4RMO A;  3WVD B;  1WJQ A;  1G3Y A;  4PJO B;  4F7U F;  4XU2 A;  5CAI A;  4M77 A;  4M77 C;  2RA2 A;  4M78 G;  2E64 A;  4QQG A;  4EMG A;  1NJI C;  4TVR A;  1M90 U;  4E7J A;  3PMT A;  3OYY A;  2F5K A;  3HP9 A;  1JB0 E;  3M4Y A;  1W2B A;  3QDR B;  5FU6 C;  4MDX A;  3NTK A;  1VQ7 A;  2CYZ B;  2GF7 A;  4LDX A;  5IAY A;  1LNX A;  2RH2 A;  4LD9 K;  1OZ2 A;  4M7A A;  1WPY A;  4LDU A;  3C94 A;  4XQ3 A;  3ER0 A;  4ELZ C;  4PJO F;  5GMK e;  3L2U A;  3CCL T;  2E41 A;  1W4S A;  3OYK A;  3LWH A;  1OI1 A;  2E5Q A;  3MCA B;  3C12 A;  4J6X A;  4MZM A;  4M75 B;  3CCM A;  3CBM A;  3VKI A;  2AHJ B;  1VQ9 T;  4C0F A;  3QYG B;  2JOY A;  4MML A;  3BDL A;  5GAM h;  5FLX E;  4M7D A;  3OYB A;  4M7D C;  4C92 A;  4C92 C;  3QO3 A;  3CCU A;  3QBY A;  4XU3 A;  4E47 A;  2QA4 A;  2RHX A;  2DAQ A;  4BY6 C;  5CR2 A;  3L2V A;  3OMC A;  4E7K A;  4M7A E;  4M75 F;  4FT4 A;  3JB9 J;  2DK3 A;  1Y7X A;  3OW2 S;  2RHU A;  3VYG A;  4NS5 A;  2VV5 A;  5GAN 5;  1K73 U;  1K8A U;  4QW2 A;  3JCM W;  5GAM f;  2RJF A;  1VQ8 T;  1N8R U;  3OA6 A;  2MI6 A;  1Y71 A;  1HXD A;  3OQ5 A;  3RER A;  4BE0 A;  3OYL A;  2E6Z A;  4LD6 A;  2DTO A;  4QVD A;  2XD0 A;  2QQA A;  4OVA A;  3CCE T;  3QZ9 B;  5DLO A;  3GP8 A;  3CCR T;  3RUX A;  2P0K A;  4L59 A;  1FWZ A;  1M1K U;  1VQ6 A;  4C5E A;  1I5L A;  2RI2 A;  2QQR A;  2LT1 A;  3EFS A;  5KCO A;  3JB9 H;  1PSE A;  2K5I A;  2EQJ A;  2PQW A;  1Q86 C;  4M77 D;  1FXX A;  2YHT A;  4CRI A;  3M5A A;  3ASK A;  2JZ2 A;  3CXC S;  3CCL A;  3A8L B;  4M75 E;  3OMG A;  5LJ5 j;  3HFO A;  1U8R A;  1ZHI A;  3GNF B;  2CZ0 B;  5FRO A;  1ZQ1 A;  4J6W A;  5J39 A;  5GAN 8;  5LJ3 j;  3UT1 A;  1VQN T;  2D6F A;  5AYF A;  1VQ9 A;  2K4Y A;  3X20 B;  3G4S T;  1Q81 C;  2Y4X A;  4M78 F;  2XDD A;  1QVG A;  2QDY B;  5J26 A;  3P8B B;  4FM4 B;  1VQM T;  3LWI A;  4P5N A;  3S3N A;  2CZ6 B;  5D6Y A;  1VUB A;  2KAF A;  4C8Q A;  4C8Q C;  2KVQ G;  3FIF A;  2DD4 A;  4B9X A;  2ZZD A;  4M77 G;  4M7D D;  3JCM b;  1TH7 A;  3FLG A;  3QZ5 B;  2ZPE B;  5DY9 A;  4C92 D;  3EFR A;  4JUV A;  2V8K A;  5I2S A;  4JLI A;  3CC7 T;  5I2M A;  2PVO B;  3LGF A;  4HCZ A;  3RMQ A;  1VQ8 A;  1B34 A;  1N6A A;  3OYN A;  1Q82 U;  3Q1J A;  4DOV A;  4JS4 A;  5IT9 E;  3QJY A;  2HBP A;  3JSC A;  3V7C A;  5CQX A;  4XTZ A;  2LVM A;  1VQ7 T;  4HKE A;  4KT0 E;  3S3O A;  1WNL A;  4YTL A;  4ZTJ A;  1G5V A;  4WF2 A;  3CCE A;  4HT9 A;  3CCR A;  5GAN 7;  3OS0 A;  1VQL A;  4JRI A;  1WJS A;  4KBM B;  5L8R E;  2VXF A;  1QVP A;  3SFM A;  3CCS A;  4M7D G;  1P92 A;  1AHJ B;  3INZ A;  3CCM T;  4C92 G;  2CGH A;  1KQ1 A;  4RKU E;  1IRE B;  3DLM A;  1JBM A;  2RI5 A;  3HRU A;  3JCM V;  2YRV A;  2RK1 A;  2A3L A;  1UGP B;  1Y07 A;  2EQM A;  3MEU A;  5CKE A;  1YJN T;  2EKO A;  5GAO n;  2DXT A;  2L5Q A;  5C0M A;  3WVE B;  1VQN A;  3C95 A;  4O6J A;  4ME7 A;  2QA4 T;  1FX7 A;  2RJD A;  3V8K A;  1U1S A;  3G4S A;  2O4X A;  3QUI A;  2DZC A;  2DZ9 A;  3A8O B;  4QVZ A;  4XAX B;  5CKD A;  5GMK l;  4E7I A;  3HSB A;  1BKB A;  3KUF A;  1WGS A;  1VQM A;  1VIE A;  2DVE A;  2RO0 A;  2EWN A;  3TU4 K;  2LCL A;  2DTH A;  2L8D A;  1WJR A;  1KQS A;  2LDM A;  4EMK B;  2C06 A;  1KC8 C;  2MMP A;  2RHI A;  3LGL A;  5CKB A;  3FC3 A;  3OYC A;  3RKY A;  2WAC A;  1Q7Y C;  4NL2 A;  3HL8 A;  3KBG A;  4BE1 A;  2DPP B;  5LJ3 g;  2XIC A;  3UWN A;  2ZGW A;  3CC7 A;  3CBP A;  4HT8 A;  3ME9 A;  4C8Q D;  2VXE A;  4M77 B;  5GAO m;  2QTX A;  1JJ2 A;  1NE8 A;  1UGS B;  4XTX A;  4L6V 5;  4O5V A;  4UC4 A;  2V8J A;  5C6S A;  5GAN h;  4C5I A;  1VQ6 T;  3R6O A;  4F7U A;  3AHU A;  3J81 E;  3M53 A;  4M7A C;  3UDC A;  4BAC A;  3JCM P;  3L2R A;  2DJZ A;  2M9U A;  3OSS C;  3JCM Q;  2YLB A;  4BI4 A;  5CKF A;  3OSV A;  5LJ5 e;  4M77 F;  1YIT A;  2WSC E;  1M1G A;  2OTL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...