1X7AL

Porcine factor ixa complexed to 1-{3-[amino(imino)methyl]phenyl}-n-[4-(1h-benzimidazol-1-yl)-2-fluorophenyl]-3-(trifluoromethyl)-1h-pyrazole-5-carboxamide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
QCEPNPCLNGGLCKDDINSYECWCQVGFEGKNCELDATCNIKNGRCKQFCKTGADSKVLCSCTTGYRLAPDQKSCKPAVPFPCGRVSVSHSPTTLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAR and factor IXa crystal structure of a dual inhibitor of factors IXa and Xa
pubmed doi rcsb
molecule tags Blood clotting,hydrolase
molecule keywords Coagulation Factor IXa
total genus 17
structure length 97
sequence length 97
ec nomenclature ec 3.4.21.22: Coagulation factor IXa.
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
L PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1x7aL01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1x7aL02
1IQHL 2OYEP 2ADXA 1FSBA 3KK6A 4NG9L 4PH9A 5EGMB 1IJQA 1HCGB 3H5CB 3TK5B 2JKHL 4RRYA 3K9XA 3MQEA 2MGRA 2WG3C 1APOA 2UWLB 4TGFA 5JW1A 5CKQA 3N8WB 3TGFA 2NPRA 1CCFA 4YT7L 1HX2A 1M1XB 1HZ8A 2FD6A 3BT1A 3LTFB 5IKVA 1AUTL 4Y7BB 1XDTR 4JYUL 1HRFA 1XFEA 4BTTA 2W86A 1N1IA 5I46L 1B9WA 1FE2A 1L5GB 4ZH8B 2Y82B 2XBWL 3RR3A 1EQHA 2BMGA 2P94L 1IOXA 5KIRA 1NFUB 4JZEL 2WYJB 2KB9A 4Z6AL 5L2YL 4E1GA 1PFXL 1DDXA 2DDUA 1FAXL 2J94B 2WPLE 3LC3B 1G1RA 2K2SB 4BTIA 1EAIC 1G2LB 3V64C 3GCWE 1EPHA 1ATEA 3KQEL 4Y71B 5IKRA 2VWOL 3FFGL 1DX5I 1NT0A 4LORA 4ZXYL 4COXA 4X8VL 3TBDA 1WHEA 2VWLL 1BF9A 5FDQA 2J38B 3KQCL 1UZPA 4RRZA 3SOBB 3LTGD 5CISA 1EGFA 3TK6B 3N8VA 2P28B 1I0UA 2WYGB 2W3IB 2J4IB 4D0FA 2J2UB 4RRXA 5JBAE 2EI6B 2XC4L 1LPZA 4Z0LA 1NFYB 1IQKL 2GD4A 2W2QE 1IQFL 1HREA 2BQ6A 2PR3B 1PXXA 3N8YA 1QFKL 2XBYL 1LQDA 2BOUA 6COXA 4JZDL 3BT2A 1GK5A 1MQ5L 4MMXB 4Y6DB 3M37L 3HO4A 5JB8E 4D0EA 1K37A 4ISHL 2W2PE 3CS7L 1XKBA 2J34B 2YGPA 1F0SB 1TOZA 5E8DA 2KL7A 3FBYA 1F0RB 1PTHA 4BDWA 1UZJA 1FF7A 3ASIA 1EMOA 1PRHA 2WPKE 3SW2A 4ZXXL 1IGXA 1HJ7A 3KQBL 5F19A 1IQEL 3HPTA 1W8BL 3Q7DA 1CVUA 1N7DA 3CA7A 1G2MB 1F7EA 3LAQA 4XL1A 3NJPC 3KQDL 1JL9A 1WU1B 1L3YA 3LN1A 3NTGA 2I9AA 3N8XA 2Y5FL 1Q4GA 2KV4A 1TLEA 2H9EL 2W2NE 2PUQL 2BQWA 3ZYIB 2VVUL 2F9BL 3MDLA 1CX2A 1EPGA 4X8TL 2VH6B 4Y79B 2VJ3A 5CKNA 3DEMA 2MHPA 2FLGA 1ATAA 1KSNB 2Y38A 1V3XB 2VWNL 1CQEA 2UWOB 3F1SB 2Y5GL 1YO8A 2FLRL 2WPME 2BZ6L 2P16L 1CVWL 3CFWA 3ENSA 2VVVL 3N8ZA 4XBMA 5COXA 4XLWA 1MQ6L 1HAFA 1YUFA 1JBUL 2WPJE 1ATDA 5CKMA 4CUDA 1A3PA 1YUGA 3QH0A 3KRKA 4O1ZA 1U67A 1URKA 2FZZL 4CSYA 4ISIL 1NFXB 1OB1C 1Z6CA 1IQJL 5K0HB 1ZAQA 2P3TA 2RA0L 2Q1JB 3F6UL 2W2ME 4JYVL 2WG4B 4A7IA 4D90A 3TZIA 5JBCE 2Y7XB 4RUTA 2PHBB 1EMNA 5L30L 2EI7B 5JVZA 4FM5A 1XKAL 2K2TA 1IQLL 1COUA 2WFXB 2Y81B 4NA9L 4M10A 3Q3KB 1IGZA 1EPIA 1G1QA 4YT6L 1DQBA 4M11A 2P95L 2UWPB 1K36A 2Y7ZB 1EZQB 1MOXC 5L2ZL 5IKQA 1HT5A 3ZYGA 1NFWB 4Y7AB 4MMYB 5JBBE 4JZFL 1NZIA 3P5BL 1X7AL 2M74A 3C9AC 3QCWA 2D1JB 5IKTA 1IVOC 2I9BA 2WPIE 4ZAEB 2RHPA 1SZBA 3OLTA 4BXWA 3CENL 1PGEA 1IOEL 2W26B 3FCSB 2W2OE 1ATBA 1YGCL 3KCGL 4Y76B 1EQGA 4X8SL 2RNLA 3GCXE 3N8YB 1IP0A 1IQNL 1JV2B 1EPJA 2XC5L 1W7XL 1G1TA 2P3UA 2CJIB 2Y80B 3ELAL 1KLJL 4OTYA 2BO2A 3OLUA 3LN0A 4RRWA 3TH3L 3HS5A 1P9JA 4BDXA 3NT1A 2XBVL 1CCVA 4Z0KB 4MMZB 4G1MB 3U73A 1FAKL 1LPKA 1U8CB 3SOQA 1HT8A 1KIGL 3HO5A 2J95B 2VH0B 1RFNB 3M36L 5JB9E 1EBVA 4BXSA 1FJSL 3HO3A 2G00L 1Z6EL 2WPHE 1F7MA 4X8UL 3ZYJB 3V65B 4AQTA 1WHFA 5KN5C 3HS7A 3HS6A 2OYUP 2P26A 2BQ7A 4RS0A 1IQML 1KLOA 1UZQA 2MGPA 1G1SA 2FLBL 2WFTA 1LPGA 2AYLA 4CUFA 1APQA 2EI8B 3LC5B 2B7DL 3EGFA 3POYA 1C5MF 3U7UG 4ZHAB 2P93L 3BPSE 3NTBA 1ADXA 4O02B 5F1AA 1YUKB 2VVCK 3N8WA 1CEJA 2Y5HL 2BOHA 1KLIL 3QMOA 2BOXA 1UZKA 4CUEA 2BOKL 1IQGL 1P0SL 4C16A 4LMFA 1DVAL 2XC0L 2P3FN 4OTJA 2YGOA 2W3KB 2XBXL 1DIYA 3SOVA 1J9CL 3LIWB 3IJEB 1NQLB 4NGAL 3GISX 2P3FL 1TPGA 3IITB 2TGFA 3PGHA 4BTUA 1FFMA 2VWMK 1HAEA 1LMJA 4YZUB 1O5DL 1IQIL 5JVYA 3R05A 3KL6B 1NPEB
chains in the Genus database with same CATH superfamily
1IQHL 2OYEP 2ADXA 1FSBA 3KK6A 4NG9L 4PH9A 5EGMB 1IJQA 1HCGB 3H5CB 3TK5B 2JKHL 4RRYA 3K9XA 3MQEA 2MGRA 2WG3C 1APOA 2UWLB 4TGFA 5JW1A 5CKQA 3N8WB 3TGFA 2NPRA 1CCFA 4YT7L 1HX2A 1M1XB 1HZ8A 2FD6A 3BT1A 3LTFB 5IKVA 1AUTL 4Y7BB 1XDTR 4JYUL 1HRFA 1XFEA 1KKEA 4BTTA 2W86A 1N1IA 5I46L 1B9WA 1FE2A 1L5GB 4ZH8B 2Y82B 2XBWL 3RR3A 1EQHA 2BMGA 2P94L 1IOXA 5KIRA 1NFUB 4JZEL 2WYJB 2KB9A 4Z6AL 5L2YL 4E1GA 1PFXL 1DDXA 2YGQA 2DDUA 1FAXL 2J94B 2WPLE 3LC3B 1G1RA 2K2SB 4BTIA 1EAIC 1G2LB 3V64C 3GCWE 1EPHA 1ATEA 3KQEL 4Y71B 5IKRA 2VWOL 3FFGL 1DX5I 1NT0A 4LORA 4ZXYL 4COXA 4X8VL 3TBDA 1WHEA 2VWLL 1BF9A 1V1IA 5FDQA 2J38B 3KQCL 1UZPA 4RRZA 3SOBB 3LTGD 5CISA 1EGFA 3TK6B 3N8VA 2P28B 1I0UA 2WYGB 1LMMA 2W3IB 2J4IB 4D0FA 2J2UB 4RRXA 5JBAE 2EI6B 2XC4L 1LPZA 4Z0LA 4GU4A 1NFYB 1IQKL 2GD4A 2W2QE 1IQFL 1HREA 2BQ6A 2PR3B 1PXXA 3N8YA 1QFKL 2XBYL 1LQDA 2BOUA 6COXA 4JZDL 3BT2A 1GK5A 1MQ5L 4MMXB 4Y6DB 3M37L 3HO4A 5JB8E 4D0EA 1K37A 4ISHL 2W2PE 3CS7L 1XKBA 2J34B 2YGPA 1F0SB 1TOZA 5E8DA 2KL7A 3FBYA 1F0RB 1PTHA 4BDWA 1UZJA 1FF7A 3ASIA 1EMOA 1PRHA 2WPKE 3SW2A 4ZXXL 1IGXA 1HJ7A 3KQBL 5F19A 1IQEL 3HPTA 1W8BL 3Q7DA 1CVUA 1N7DA 3CA7A 1G2MB 1F7EA 3LAQA 4XL1A 3NJPC 3KQDL 1JL9A 1WU1B 1L3YA 3LN1A 3NTGA 2I9AA 3N8XA 2Y5FL 1Q4GA 2KV4A 1TLEA 2H9EL 2W2NE 4GU3A 2PUQL 2BQWA 3ZYIB 2VVUL 2F9BL 3MDLA 1CX2A 1EPGA 4X8TL 2VH6B 4Y79B 2VJ3A 5CKNA 3DEMA 2MHPA 2FLGA 1ATAA 1KSNB 2Y38A 1V3XB 2VWNL 1CQEA 2UWOB 3F1SB 2Y5GL 1YO8A 2FLRL 2WPME 2BZ6L 2P16L 1CVWL 3CFWA 3ENSA 2VVVL 3N8ZA 4XBMA 5COXA 4XLWA 1MQ6L 1HAFA 1YUFA 2BSFA 1JBUL 2WPJE 1ATDA 5CKMA 4CUDA 1A3PA 1YUGA 3QH0A 3KRKA 4O1ZA 2HORA 1U67A 1URKA 2FZZL 4CSYA 4ISIL 1NFXB 1OB1C 1Z6CA 1IQJL 5K0HB 1ZAQA 2P3TA 2RA0L 2Q1JB 3F6UL 2W2ME 4JYVL 2WG4B 4A7IA 4D90A 3TZIA 5JBCE 2Y7XB 4RUTA 4A94C 2PHBB 1EMNA 5L30L 2BT7A 2EI7B 5JVZA 4FM5A 1XKAL 2K2TA 1IQLL 1COUA 2WZPP 2WFXB 2Y81B 4NA9L 4M10A 3Q3KB 1IGZA 1EPIA 1G1QA 4YT6L 1DQBA 4M11A 2P95L 2UWPB 1K36A 2Y7ZB 1EZQB 1MOXC 5L2ZL 5IKQA 1HT5A 3ZYGA 1NFWB 4Y7AB 4MMYB 5JBBE 4JZFL 1NZIA 2JJLA 3P5BL 1X7AL 2M74A 3C9AC 3QCWA 2D1JB 5IKTA 1IVOC 2I9BA 2WPIE 4ZAEB 2RHPA 1SZBA 3OLTA 4BXWA 3CENL 1PGEA 1IOEL 2W26B 3FCSB 2W2OE 1ATBA 1YGCL 3KCGL 4Y76B 1EQGA 4X8SL 2RNLA 3GCXE 3N8YB 1IP0A 2KNIA 1IQNL 1JV2B 1EPJA 2XC5L 1W7XL 1G1TA 2P3UA 2CJIB 2Y80B 3ELAL 1KLJL 4OTYA 2BO2A 3OLUA 3LN0A 4RRWA 3TH3L 3HS5A 1P9JA 4BDXA 3NT1A 2XBVL 1CCVA 4Z0KB 3S6XA 4MMZB 4G1MB 3U73A 1FAKL 1LPKA 1U8CB 3SOQA 2H9EC 1HT8A 1KIGL 3HO5A 2J95B 2VH0B 1RFNB 3M36L 5JB9E 1EBVA 4BXSA 1FJSL 3HO3A 2G00L 1Z6EL 2WPHE 1F7MA 4X8UL 3ZYJB 3V65B 4AQTA 1WHFA 5KN5C 3HS7A 3HS6A 2HOXA 2OYUP 2P26A 2BQ7A 4RS0A 1IQML 1LK9A 1KLOA 1UZQA 2MGPA 1G1SA 2FLBL 2WFTA 1LPGA 2AYLA 4CUFA 1APQA 2EI8B 3LC5B 2B7DL 1V1HA 3EGFA 2VRSA 3POYA 1C5MF 3U7UG 4ZHAB 2P93L 3BPSE 3NTBA 1ADXA 4O02B 5F1AA 1YUKB 2VVCK 3N8WA 1CEJA 2Y5HL 2BOHA 1KLIL 3QMOA 2BOXA 1UZKA 4CUEA 2BOKL 1IQGL 1P0SL 4C16A 4LMFA 1DVAL 2XC0L 2P3FN 4OTJA 2YGOA 2W3KB 2XBXL 1DIYA 3SOVA 1J9CL 3LIWB 2BT8A 3IJEB 1NQLB 4NGAL 3GISX 2P3FL 1TPGA 3IITB 2TGFA 3PGHA 4BTUA 1FFMA 2VWMK 1HAEA 1LMJA 1QIUA 4YZUB 1O5DL 1IQIL 5JVYA 3R05A 3KL6B 1NPEB
chains in the Genus database with same CATH topology
1IQHL 2OYEP 2ADXA 1FSBA 3KK6A 4NG9L 4PH9A 5EGMB 1IJQA 1HCGB 3H5CB 3TK5B 2JKHL 4RRYA 3K9XA 3MQEA 2MGRA 2WG3C 1APOA 2UWLB 4TGFA 5JW1A 5CKQA 3N8WB 3TGFA 2NPRA 1CCFA 4YT7L 1HX2A 1M1XB 1HZ8A 2FD6A 3BT1A 3LTFB 5IKVA 1AUTL 4Y7BB 1XDTR 4JYUL 1HRFA 1XFEA 4BTTA 2W86A 1N1IA 5I46L 1B9WA 1FE2A 1L5GB 4ZH8B 2Y82B 2XBWL 3RR3A 1EQHA 2BMGA 2P94L 1IOXA 5KIRA 1NFUB 4JZEL 2WYJB 2KB9A 4Z6AL 5L2YL 4E1GA 1PFXL 1DDXA 2YGQA 2DDUA 1FAXL 2J94B 2WPLE 3LC3B 1G1RA 2K2SB 4BTIA 1EAIC 1G2LB 3V64C 3GCWE 1EPHA 1ATEA 3KQEL 4Y71B 5IKRA 2VWOL 3FFGL 1DX5I 1NT0A 4LORA 4ZXYL 4COXA 4X8VL 3TBDA 1WHEA 2VWLL 1BF9A 5FDQA 2J38B 3KQCL 1UZPA 4RRZA 3SOBB 3LTGD 5CISA 1EGFA 3TK6B 3N8VA 2P28B 1I0UA 2WYGB 1LMMA 2W3IB 2J4IB 4D0FA 2J2UB 4RRXA 5JBAE 2EI6B 2XC4L 1LPZA 4Z0LA 1NFYB 1IQKL 2GD4A 2W2QE 1IQFL 1HREA 2BQ6A 2PR3B 1PXXA 3N8YA 1QFKL 2XBYL 1LQDA 2BOUA 6COXA 4JZDL 3BT2A 1GK5A 1MQ5L 4MMXB 4Y6DB 3M37L 3HO4A 5JB8E 4D0EA 1K37A 4ISHL 2W2PE 3CS7L 1XKBA 2J34B 2YGPA 1F0SB 1TOZA 5E8DA 2KL7A 3FBYA 1F0RB 1PTHA 4BDWA 1UZJA 1FF7A 3ASIA 1EMOA 1PRHA 2WPKE 3SW2A 4ZXXL 1IGXA 1HJ7A 3KQBL 5F19A 1IQEL 3HPTA 1W8BL 3Q7DA 1CVUA 1N7DA 3CA7A 1G2MB 1F7EA 3LAQA 4XL1A 3NJPC 3KQDL 1JL9A 1WU1B 1L3YA 3LN1A 3NTGA 2I9AA 3N8XA 2Y5FL 1Q4GA 2KV4A 1TLEA 2H9EL 2W2NE 2PUQL 2BQWA 3ZYIB 2VVUL 2F9BL 3MDLA 1CX2A 1EPGA 4X8TL 2VH6B 4Y79B 2VJ3A 5CKNA 3DEMA 2MHPA 2FLGA 1ATAA 1KSNB 2Y38A 1V3XB 2VWNL 1CQEA 2UWOB 3F1SB 2Y5GL 1YO8A 2FLRL 2WPME 2BZ6L 2P16L 1CVWL 3CFWA 3ENSA 2VVVL 3N8ZA 4XBMA 5COXA 4XLWA 1MQ6L 1HAFA 1YUFA 1JBUL 2WPJE 1ATDA 5CKMA 4CUDA 1A3PA 1YUGA 3QH0A 3KRKA 4O1ZA 1U67A 1URKA 2FZZL 4CSYA 4ISIL 1NFXB 1OB1C 1Z6CA 1IQJL 5K0HB 1ZAQA 2P3TA 2RA0L 2Q1JB 3F6UL 2W2ME 4JYVL 2WG4B 4A7IA 4D90A 3TZIA 5JBCE 2Y7XB 4RUTA 4A94C 2PHBB 1EMNA 5L30L 2EI7B 5JVZA 4FM5A 1XKAL 2K2TA 1IQLL 1COUA 2WZPP 2WFXB 2Y81B 4NA9L 4M10A 3Q3KB 1IGZA 1EPIA 1G1QA 4YT6L 1DQBA 4M11A 2P95L 2UWPB 1K36A 2Y7ZB 1EZQB 1MOXC 5L2ZL 5IKQA 1HT5A 3ZYGA 1NFWB 4Y7AB 4MMYB 5JBBE 4JZFL 1NZIA 3P5BL 1X7AL 2M74A 3C9AC 3QCWA 2D1JB 5IKTA 1IVOC 2I9BA 2WPIE 4ZAEB 2RHPA 1SZBA 3OLTA 4BXWA 3CENL 1PGEA 1IOEL 2W26B 3FCSB 2W2OE 1ATBA 1YGCL 3KCGL 4Y76B 1EQGA 4X8SL 2RNLA 3GCXE 3N8YB 1IP0A 2KNIA 1IQNL 1JV2B 1EPJA 2XC5L 1W7XL 1G1TA 2P3UA 2CJIB 2Y80B 3ELAL 1KLJL 4OTYA 2BO2A 3OLUA 3LN0A 4RRWA 3TH3L 3HS5A 1P9JA 4BDXA 3NT1A 2XBVL 1CCVA 4Z0KB 3S6XA 4MMZB 4G1MB 3U73A 1FAKL 1LPKA 1U8CB 3SOQA 2H9EC 1HT8A 1KIGL 3HO5A 2J95B 2VH0B 1RFNB 3M36L 5JB9E 1EBVA 4BXSA 1FJSL 3HO3A 2G00L 1Z6EL 2WPHE 1F7MA 4X8UL 3ZYJB 3V65B 4AQTA 1WHFA 5KN5C 3HS7A 3HS6A 2OYUP 2P26A 2BQ7A 4RS0A 1IQML 1KLOA 1UZQA 2MGPA 1G1SA 2FLBL 2WFTA 1LPGA 2AYLA 4CUFA 1APQA 2EI8B 3LC5B 2B7DL 3EGFA 3POYA 1C5MF 3U7UG 4ZHAB 2P93L 3BPSE 3NTBA 1ADXA 4O02B 5F1AA 1YUKB 2VVCK 3N8WA 1CEJA 2Y5HL 2BOHA 1KLIL 3QMOA 2BOXA 1UZKA 4CUEA 2BOKL 1IQGL 1P0SL 4C16A 4LMFA 1DVAL 2XC0L 2P3FN 4OTJA 2YGOA 2W3KB 2XBXL 1DIYA 3SOVA 1J9CL 3LIWB 3IJEB 1NQLB 4NGAL 3GISX 2P3FL 1TPGA 3IITB 2TGFA 3PGHA 4BTUA 1FFMA 2VWMK 1HAEA 1LMJA 4YZUB 1O5DL 1IQIL 5JVYA 3R05A 3KL6B 1NPEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQH L;  2OYE P;  2ADX A;  1FSB A;  3KK6 A;  4NG9 L;  4PH9 A;  5EGM B;  1IJQ A;  1HCG B;  3H5C B;  3TK5 B;  2JKH L;  4RRY A;  3K9X A;  3MQE A;  2MGR A;  2WG3 C;  1APO A;  2UWL B;  4TGF A;  5JW1 A;  5CKQ A;  3N8W B;  3TGF A;  2NPR A;  1CCF A;  4YT7 L;  1HX2 A;  1M1X B;  1HZ8 A;  2FD6 A;  3BT1 A;  3LTF B;  5IKV A;  1AUT L;  4Y7B B;  1XDT R;  4JYU L;  1HRF A;  1XFE A;  4BTT A;  2W86 A;  1N1I A;  5I46 L;  1B9W A;  1FE2 A;  1L5G B;  4ZH8 B;  2Y82 B;  2XBW L;  3RR3 A;  1EQH A;  2BMG A;  2P94 L;  1IOX A;  5KIR A;  1NFU B;  4JZE L;  2WYJ B;  2KB9 A;  4Z6A L;  5L2Y L;  4E1G A;  1PFX L;  1DDX A;  2DDU A;  1FAX L;  2J94 B;  2WPL E;  3LC3 B;  1G1R A;  2K2S B;  4BTI A;  1EAI C;  1G2L B;  3V64 C;  3GCW E;  1EPH A;  1ATE A;  3KQE L;  4Y71 B;  5IKR A;  2VWO L;  3FFG L;  1DX5 I;  1NT0 A;  4LOR A;  4ZXY L;  4COX A;  4X8V L;  3TBD A;  1WHE A;  2VWL L;  1BF9 A;  5FDQ A;  2J38 B;  3KQC L;  1UZP A;  4RRZ A;  3SOB B;  3LTG D;  5CIS A;  1EGF A;  3TK6 B;  3N8V A;  2P28 B;  1I0U A;  2WYG B;  2W3I B;  2J4I B;  4D0F A;  2J2U B;  4RRX A;  5JBA E;  2EI6 B;  2XC4 L;  1LPZ A;  4Z0L A;  1NFY B;  1IQK L;  2GD4 A;  2W2Q E;  1IQF L;  1HRE A;  2BQ6 A;  2PR3 B;  1PXX A;  3N8Y A;  1QFK L;  2XBY L;  1LQD A;  2BOU A;  6COX A;  4JZD L;  3BT2 A;  1GK5 A;  1MQ5 L;  4MMX B;  4Y6D B;  3M37 L;  3HO4 A;  5JB8 E;  4D0E A;  1K37 A;  4ISH L;  2W2P E;  3CS7 L;  1XKB A;  2J34 B;  2YGP A;  1F0S B;  1TOZ A;  5E8D A;  2KL7 A;  3FBY A;  1F0R B;  1PTH A;  4BDW A;  1UZJ A;  1FF7 A;  3ASI A;  1EMO A;  1PRH A;  2WPK E;  3SW2 A;  4ZXX L;  1IGX A;  1HJ7 A;  3KQB L;  5F19 A;  1IQE L;  3HPT A;  1W8B L;  3Q7D A;  1CVU A;  1N7D A;  3CA7 A;  1G2M B;  1F7E A;  3LAQ A;  4XL1 A;  3NJP C;  3KQD L;  1JL9 A;  1WU1 B;  1L3Y A;  3LN1 A;  3NTG A;  2I9A A;  3N8X A;  2Y5F L;  1Q4G A;  2KV4 A;  1TLE A;  2H9E L;  2W2N E;  2PUQ L;  2BQW A;  3ZYI B;  2VVU L;  2F9B L;  3MDL A;  1CX2 A;  1EPG A;  4X8T L;  2VH6 B;  4Y79 B;  2VJ3 A;  5CKN A;  3DEM A;  2MHP A;  2FLG A;  1ATA A;  1KSN B;  2Y38 A;  1V3X B;  2VWN L;  1CQE A;  2UWO B;  3F1S B;  2Y5G L;  1YO8 A;  2FLR L;  2WPM E;  2BZ6 L;  2P16 L;  1CVW L;  3CFW A;  3ENS A;  2VVV L;  3N8Z A;  4XBM A;  5COX A;  4XLW A;  1MQ6 L;  1HAF A;  1YUF A;  1JBU L;  2WPJ E;  1ATD A;  5CKM A;  4CUD A;  1A3P A;  1YUG A;  3QH0 A;  3KRK A;  4O1Z A;  1U67 A;  1URK A;  2FZZ L;  4CSY A;  4ISI L;  1NFX B;  1OB1 C;  1Z6C A;  1IQJ L;  5K0H B;  1ZAQ A;  2P3T A;  2RA0 L;  2Q1J B;  3F6U L;  2W2M E;  4JYV L;  2WG4 B;  4A7I A;  4D90 A;  3TZI A;  5JBC E;  2Y7X B;  4RUT A;  2PHB B;  1EMN A;  5L30 L;  2EI7 B;  5JVZ A;  4FM5 A;  1XKA L;  2K2T A;  1IQL L;  1COU A;  2WFX B;  2Y81 B;  4NA9 L;  4M10 A;  3Q3K B;  1IGZ A;  1EPI A;  1G1Q A;  4YT6 L;  1DQB A;  4M11 A;  2P95 L;  2UWP B;  1K36 A;  2Y7Z B;  1EZQ B;  1MOX C;  5L2Z L;  5IKQ A;  1HT5 A;  3ZYG A;  1NFW B;  4Y7A B;  4MMY B;  5JBB E;  4JZF L;  1NZI A;  3P5B L;  1X7A L;  2M74 A;  3C9A C;  3QCW A;  2D1J B;  5IKT A;  1IVO C;  2I9B A;  2WPI E;  4ZAE B;  2RHP A;  1SZB A;  3OLT A;  4BXW A;  3CEN L;  1PGE A;  1IOE L;  2W26 B;  3FCS B;  2W2O E;  1ATB A;  1YGC L;  3KCG L;  4Y76 B;  1EQG A;  4X8S L;  2RNL A;  3GCX E;  3N8Y B;  1IP0 A;  1IQN L;  1JV2 B;  1EPJ A;  2XC5 L;  1W7X L;  1G1T A;  2P3U A;  2CJI B;  2Y80 B;  3ELA L;  1KLJ L;  4OTY A;  2BO2 A;  3OLU A;  3LN0 A;  4RRW A;  3TH3 L;  3HS5 A;  1P9J A;  4BDX A;  3NT1 A;  2XBV L;  1CCV A;  4Z0K B;  4MMZ B;  4G1M B;  3U73 A;  1FAK L;  1LPK A;  1U8C B;  3SOQ A;  1HT8 A;  1KIG L;  3HO5 A;  2J95 B;  2VH0 B;  1RFN B;  3M36 L;  5JB9 E;  1EBV A;  4BXS A;  1FJS L;  3HO3 A;  2G00 L;  1Z6E L;  2WPH E;  1F7M A;  4X8U L;  3ZYJ B;  3V65 B;  4AQT A;  1WHF A;  5KN5 C;  3HS7 A;  3HS6 A;  2OYU P;  2P26 A;  2BQ7 A;  4RS0 A;  1IQM L;  1KLO A;  1UZQ A;  2MGP A;  1G1S A;  2FLB L;  2WFT A;  1LPG A;  2AYL A;  4CUF A;  1APQ A;  2EI8 B;  3LC5 B;  2B7D L;  3EGF A;  3POY A;  1C5M F;  3U7U G;  4ZHA B;  2P93 L;  3BPS E;  3NTB A;  1ADX A;  4O02 B;  5F1A A;  1YUK B;  2VVC K;  3N8W A;  1CEJ A;  2Y5H L;  2BOH A;  1KLI L;  3QMO A;  2BOX A;  1UZK A;  4CUE A;  2BOK L;  1IQG L;  1P0S L;  4C16 A;  4LMF A;  1DVA L;  2XC0 L;  2P3F N;  4OTJ A;  2YGO A;  2W3K B;  2XBX L;  1DIY A;  3SOV A;  1J9C L;  3LIW B;  3IJE B;  1NQL B;  4NGA L;  3GIS X;  2P3F L;  1TPG A;  3IIT B;  2TGF A;  3PGH A;  4BTU A;  1FFM A;  2VWM K;  1HAE A;  1LMJ A;  4YZU B;  1O5D L;  1IQI L;  5JVY A;  3R05 A;  3KL6 B;  1NPE B; 
#chains in the Genus database with same CATH topology
 1IQH L;  2OYE P;  2ADX A;  1FSB A;  3KK6 A;  4NG9 L;  4PH9 A;  5EGM B;  1IJQ A;  1HCG B;  3H5C B;  3TK5 B;  2JKH L;  4RRY A;  3K9X A;  3MQE A;  2MGR A;  2WG3 C;  1APO A;  2UWL B;  4TGF A;  5JW1 A;  5CKQ A;  3N8W B;  3TGF A;  2NPR A;  1CCF A;  4YT7 L;  1HX2 A;  1M1X B;  1HZ8 A;  2FD6 A;  3BT1 A;  3LTF B;  5IKV A;  1AUT L;  4Y7B B;  1XDT R;  4JYU L;  1HRF A;  1XFE A;  1KKE A;  4BTT A;  2W86 A;  1N1I A;  5I46 L;  1B9W A;  1FE2 A;  1L5G B;  4ZH8 B;  2Y82 B;  2XBW L;  3RR3 A;  1EQH A;  2BMG A;  2P94 L;  1IOX A;  5KIR A;  1NFU B;  4JZE L;  2WYJ B;  2KB9 A;  4Z6A L;  5L2Y L;  4E1G A;  1PFX L;  1DDX A;  2YGQ A;  2DDU A;  1FAX L;  2J94 B;  2WPL E;  3LC3 B;  1G1R A;  2K2S B;  4BTI A;  1EAI C;  1G2L B;  3V64 C;  3GCW E;  1EPH A;  1ATE A;  3KQE L;  4Y71 B;  5IKR A;  2VWO L;  3FFG L;  1DX5 I;  1NT0 A;  4LOR A;  4ZXY L;  4COX A;  4X8V L;  3TBD A;  1WHE A;  2VWL L;  1BF9 A;  1V1I A;  5FDQ A;  2J38 B;  3KQC L;  1UZP A;  4RRZ A;  3SOB B;  3LTG D;  5CIS A;  1EGF A;  3TK6 B;  3N8V A;  2P28 B;  1I0U A;  2WYG B;  1LMM A;  2W3I B;  2J4I B;  4D0F A;  2J2U B;  4RRX A;  5JBA E;  2EI6 B;  2XC4 L;  1LPZ A;  4Z0L A;  4GU4 A;  1NFY B;  1IQK L;  2GD4 A;  2W2Q E;  1IQF L;  1HRE A;  2BQ6 A;  2PR3 B;  1PXX A;  3N8Y A;  1QFK L;  2XBY L;  1LQD A;  2BOU A;  6COX A;  4JZD L;  3BT2 A;  1GK5 A;  1MQ5 L;  4MMX B;  4Y6D B;  3M37 L;  3HO4 A;  5JB8 E;  4D0E A;  1K37 A;  4ISH L;  2W2P E;  3CS7 L;  1XKB A;  2J34 B;  2YGP A;  1F0S B;  1TOZ A;  5E8D A;  2KL7 A;  3FBY A;  1F0R B;  1PTH A;  4BDW A;  1UZJ A;  1FF7 A;  3ASI A;  1EMO A;  1PRH A;  2WPK E;  3SW2 A;  4ZXX L;  1IGX A;  1HJ7 A;  3KQB L;  5F19 A;  1IQE L;  3HPT A;  1W8B L;  3Q7D A;  1CVU A;  1N7D A;  3CA7 A;  1G2M B;  1F7E A;  3LAQ A;  4XL1 A;  3NJP C;  3KQD L;  1JL9 A;  1WU1 B;  1L3Y A;  3LN1 A;  3NTG A;  2I9A A;  3N8X A;  2Y5F L;  1Q4G A;  2KV4 A;  1TLE A;  2H9E L;  2W2N E;  4GU3 A;  2PUQ L;  2BQW A;  3ZYI B;  2VVU L;  2F9B L;  3MDL A;  1CX2 A;  1EPG A;  4X8T L;  2VH6 B;  4Y79 B;  2VJ3 A;  5CKN A;  3DEM A;  2MHP A;  2FLG A;  1ATA A;  1KSN B;  2Y38 A;  1V3X B;  2VWN L;  1CQE A;  2UWO B;  3F1S B;  2Y5G L;  1YO8 A;  2FLR L;  2WPM E;  2BZ6 L;  2P16 L;  1CVW L;  3CFW A;  3ENS A;  2VVV L;  3N8Z A;  4XBM A;  5COX A;  4XLW A;  1MQ6 L;  1HAF A;  1YUF A;  2BSF A;  1JBU L;  2WPJ E;  1ATD A;  5CKM A;  4CUD A;  1A3P A;  1YUG A;  3QH0 A;  3KRK A;  4O1Z A;  2HOR A;  1U67 A;  1URK A;  2FZZ L;  4CSY A;  4ISI L;  1NFX B;  1OB1 C;  1Z6C A;  1IQJ L;  5K0H B;  1ZAQ A;  2P3T A;  2RA0 L;  2Q1J B;  3F6U L;  2W2M E;  4JYV L;  2WG4 B;  4A7I A;  4D90 A;  3TZI A;  5JBC E;  2Y7X B;  4RUT A;  4A94 C;  2PHB B;  1EMN A;  5L30 L;  2BT7 A;  2EI7 B;  5JVZ A;  4FM5 A;  1XKA L;  2K2T A;  1IQL L;  1COU A;  2WZP P;  2WFX B;  2Y81 B;  4NA9 L;  4M10 A;  3Q3K B;  1IGZ A;  1EPI A;  1G1Q A;  4YT6 L;  1DQB A;  4M11 A;  2P95 L;  2UWP B;  1K36 A;  2Y7Z B;  1EZQ B;  1MOX C;  5L2Z L;  5IKQ A;  1HT5 A;  3ZYG A;  1NFW B;  4Y7A B;  4MMY B;  5JBB E;  4JZF L;  1NZI A;  2JJL A;  3P5B L;  1X7A L;  2M74 A;  3C9A C;  3QCW A;  2D1J B;  5IKT A;  1IVO C;  2I9B A;  2WPI E;  4ZAE B;  2RHP A;  1SZB A;  3OLT A;  4BXW A;  3CEN L;  1PGE A;  1IOE L;  2W26 B;  3FCS B;  2W2O E;  1ATB A;  1YGC L;  3KCG L;  4Y76 B;  1EQG A;  4X8S L;  2RNL A;  3GCX E;  3N8Y B;  1IP0 A;  2KNI A;  1IQN L;  1JV2 B;  1EPJ A;  2XC5 L;  1W7X L;  1G1T A;  2P3U A;  2CJI B;  2Y80 B;  3ELA L;  1KLJ L;  4OTY A;  2BO2 A;  3OLU A;  3LN0 A;  4RRW A;  3TH3 L;  3HS5 A;  1P9J A;  4BDX A;  3NT1 A;  2XBV L;  1CCV A;  4Z0K B;  3S6X A;  4MMZ B;  4G1M B;  3U73 A;  1FAK L;  1LPK A;  1U8C B;  3SOQ A;  2H9E C;  1HT8 A;  1KIG L;  3HO5 A;  2J95 B;  2VH0 B;  1RFN B;  3M36 L;  5JB9 E;  1EBV A;  4BXS A;  1FJS L;  3HO3 A;  2G00 L;  1Z6E L;  2WPH E;  1F7M A;  4X8U L;  3ZYJ B;  3V65 B;  4AQT A;  1WHF A;  5KN5 C;  3HS7 A;  3HS6 A;  2HOX A;  2OYU P;  2P26 A;  2BQ7 A;  4RS0 A;  1IQM L;  1LK9 A;  1KLO A;  1UZQ A;  2MGP A;  1G1S A;  2FLB L;  2WFT A;  1LPG A;  2AYL A;  4CUF A;  1APQ A;  2EI8 B;  3LC5 B;  2B7D L;  1V1H A;  3EGF A;  2VRS A;  3POY A;  1C5M F;  3U7U G;  4ZHA B;  2P93 L;  3BPS E;  3NTB A;  1ADX A;  4O02 B;  5F1A A;  1YUK B;  2VVC K;  3N8W A;  1CEJ A;  2Y5H L;  2BOH A;  1KLI L;  3QMO A;  2BOX A;  1UZK A;  4CUE A;  2BOK L;  1IQG L;  1P0S L;  4C16 A;  4LMF A;  1DVA L;  2XC0 L;  2P3F N;  4OTJ A;  2YGO A;  2W3K B;  2XBX L;  1DIY A;  3SOV A;  1J9C L;  3LIW B;  2BT8 A;  3IJE B;  1NQL B;  4NGA L;  3GIS X;  2P3F L;  1TPG A;  3IIT B;  2TGF A;  3PGH A;  4BTU A;  1FFM A;  2VWM K;  1HAE A;  1LMJ A;  1QIU A;  4YZU B;  1O5D L;  1IQI L;  5JVY A;  3R05 A;  3KL6 B;  1NPE B; 
#chains in the Genus database with same CATH homology
 1IQH L;  2OYE P;  2ADX A;  1FSB A;  3KK6 A;  4NG9 L;  4PH9 A;  5EGM B;  1IJQ A;  1HCG B;  3H5C B;  3TK5 B;  2JKH L;  4RRY A;  3K9X A;  3MQE A;  2MGR A;  2WG3 C;  1APO A;  2UWL B;  4TGF A;  5JW1 A;  5CKQ A;  3N8W B;  3TGF A;  2NPR A;  1CCF A;  4YT7 L;  1HX2 A;  1M1X B;  1HZ8 A;  2FD6 A;  3BT1 A;  3LTF B;  5IKV A;  1AUT L;  4Y7B B;  1XDT R;  4JYU L;  1HRF A;  1XFE A;  4BTT A;  2W86 A;  1N1I A;  5I46 L;  1B9W A;  1FE2 A;  1L5G B;  4ZH8 B;  2Y82 B;  2XBW L;  3RR3 A;  1EQH A;  2BMG A;  2P94 L;  1IOX A;  5KIR A;  1NFU B;  4JZE L;  2WYJ B;  2KB9 A;  4Z6A L;  5L2Y L;  4E1G A;  1PFX L;  1DDX A;  2YGQ A;  2DDU A;  1FAX L;  2J94 B;  2WPL E;  3LC3 B;  1G1R A;  2K2S B;  4BTI A;  1EAI C;  1G2L B;  3V64 C;  3GCW E;  1EPH A;  1ATE A;  3KQE L;  4Y71 B;  5IKR A;  2VWO L;  3FFG L;  1DX5 I;  1NT0 A;  4LOR A;  4ZXY L;  4COX A;  4X8V L;  3TBD A;  1WHE A;  2VWL L;  1BF9 A;  5FDQ A;  2J38 B;  3KQC L;  1UZP A;  4RRZ A;  3SOB B;  3LTG D;  5CIS A;  1EGF A;  3TK6 B;  3N8V A;  2P28 B;  1I0U A;  2WYG B;  1LMM A;  2W3I B;  2J4I B;  4D0F A;  2J2U B;  4RRX A;  5JBA E;  2EI6 B;  2XC4 L;  1LPZ A;  4Z0L A;  1NFY B;  1IQK L;  2GD4 A;  2W2Q E;  1IQF L;  1HRE A;  2BQ6 A;  2PR3 B;  1PXX A;  3N8Y A;  1QFK L;  2XBY L;  1LQD A;  2BOU A;  6COX A;  4JZD L;  3BT2 A;  1GK5 A;  1MQ5 L;  4MMX B;  4Y6D B;  3M37 L;  3HO4 A;  5JB8 E;  4D0E A;  1K37 A;  4ISH L;  2W2P E;  3CS7 L;  1XKB A;  2J34 B;  2YGP A;  1F0S B;  1TOZ A;  5E8D A;  2KL7 A;  3FBY A;  1F0R B;  1PTH A;  4BDW A;  1UZJ A;  1FF7 A;  3ASI A;  1EMO A;  1PRH A;  2WPK E;  3SW2 A;  4ZXX L;  1IGX A;  1HJ7 A;  3KQB L;  5F19 A;  1IQE L;  3HPT A;  1W8B L;  3Q7D A;  1CVU A;  1N7D A;  3CA7 A;  1G2M B;  1F7E A;  3LAQ A;  4XL1 A;  3NJP C;  3KQD L;  1JL9 A;  1WU1 B;  1L3Y A;  3LN1 A;  3NTG A;  2I9A A;  3N8X A;  2Y5F L;  1Q4G A;  2KV4 A;  1TLE A;  2H9E L;  2W2N E;  2PUQ L;  2BQW A;  3ZYI B;  2VVU L;  2F9B L;  3MDL A;  1CX2 A;  1EPG A;  4X8T L;  2VH6 B;  4Y79 B;  2VJ3 A;  5CKN A;  3DEM A;  2MHP A;  2FLG A;  1ATA A;  1KSN B;  2Y38 A;  1V3X B;  2VWN L;  1CQE A;  2UWO B;  3F1S B;  2Y5G L;  1YO8 A;  2FLR L;  2WPM E;  2BZ6 L;  2P16 L;  1CVW L;  3CFW A;  3ENS A;  2VVV L;  3N8Z A;  4XBM A;  5COX A;  4XLW A;  1MQ6 L;  1HAF A;  1YUF A;  1JBU L;  2WPJ E;  1ATD A;  5CKM A;  4CUD A;  1A3P A;  1YUG A;  3QH0 A;  3KRK A;  4O1Z A;  1U67 A;  1URK A;  2FZZ L;  4CSY A;  4ISI L;  1NFX B;  1OB1 C;  1Z6C A;  1IQJ L;  5K0H B;  1ZAQ A;  2P3T A;  2RA0 L;  2Q1J B;  3F6U L;  2W2M E;  4JYV L;  2WG4 B;  4A7I A;  4D90 A;  3TZI A;  5JBC E;  2Y7X B;  4RUT A;  4A94 C;  2PHB B;  1EMN A;  5L30 L;  2EI7 B;  5JVZ A;  4FM5 A;  1XKA L;  2K2T A;  1IQL L;  1COU A;  2WZP P;  2WFX B;  2Y81 B;  4NA9 L;  4M10 A;  3Q3K B;  1IGZ A;  1EPI A;  1G1Q A;  4YT6 L;  1DQB A;  4M11 A;  2P95 L;  2UWP B;  1K36 A;  2Y7Z B;  1EZQ B;  1MOX C;  5L2Z L;  5IKQ A;  1HT5 A;  3ZYG A;  1NFW B;  4Y7A B;  4MMY B;  5JBB E;  4JZF L;  1NZI A;  3P5B L;  1X7A L;  2M74 A;  3C9A C;  3QCW A;  2D1J B;  5IKT A;  1IVO C;  2I9B A;  2WPI E;  4ZAE B;  2RHP A;  1SZB A;  3OLT A;  4BXW A;  3CEN L;  1PGE A;  1IOE L;  2W26 B;  3FCS B;  2W2O E;  1ATB A;  1YGC L;  3KCG L;  4Y76 B;  1EQG A;  4X8S L;  2RNL A;  3GCX E;  3N8Y B;  1IP0 A;  2KNI A;  1IQN L;  1JV2 B;  1EPJ A;  2XC5 L;  1W7X L;  1G1T A;  2P3U A;  2CJI B;  2Y80 B;  3ELA L;  1KLJ L;  4OTY A;  2BO2 A;  3OLU A;  3LN0 A;  4RRW A;  3TH3 L;  3HS5 A;  1P9J A;  4BDX A;  3NT1 A;  2XBV L;  1CCV A;  4Z0K B;  3S6X A;  4MMZ B;  4G1M B;  3U73 A;  1FAK L;  1LPK A;  1U8C B;  3SOQ A;  2H9E C;  1HT8 A;  1KIG L;  3HO5 A;  2J95 B;  2VH0 B;  1RFN B;  3M36 L;  5JB9 E;  1EBV A;  4BXS A;  1FJS L;  3HO3 A;  2G00 L;  1Z6E L;  2WPH E;  1F7M A;  4X8U L;  3ZYJ B;  3V65 B;  4AQT A;  1WHF A;  5KN5 C;  3HS7 A;  3HS6 A;  2OYU P;  2P26 A;  2BQ7 A;  4RS0 A;  1IQM L;  1KLO A;  1UZQ A;  2MGP A;  1G1S A;  2FLB L;  2WFT A;  1LPG A;  2AYL A;  4CUF A;  1APQ A;  2EI8 B;  3LC5 B;  2B7D L;  3EGF A;  3POY A;  1C5M F;  3U7U G;  4ZHA B;  2P93 L;  3BPS E;  3NTB A;  1ADX A;  4O02 B;  5F1A A;  1YUK B;  2VVC K;  3N8W A;  1CEJ A;  2Y5H L;  2BOH A;  1KLI L;  3QMO A;  2BOX A;  1UZK A;  4CUE A;  2BOK L;  1IQG L;  1P0S L;  4C16 A;  4LMF A;  1DVA L;  2XC0 L;  2P3F N;  4OTJ A;  2YGO A;  2W3K B;  2XBX L;  1DIY A;  3SOV A;  1J9C L;  3LIW B;  3IJE B;  1NQL B;  4NGA L;  3GIS X;  2P3F L;  1TPG A;  3IIT B;  2TGF A;  3PGH A;  4BTU A;  1FFM A;  2VWM K;  1HAE A;  1LMJ A;  4YZU B;  1O5D L;  1IQI L;  5JVY A;  3R05 A;  3KL6 B;  1NPE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...