1X7DA

Crystal structure analysis of ornithine cyclodeaminase complexed with nad and ornithine to 1.6 angstroms
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
340
Chain Sequence
b'TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ornithine cyclodeaminase
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
total genus 112
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1x7dA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x7dA02
1BXKA 3WXBA 1GY8A 5J23A 3CH6A 2VZ9A 2Y1CA 4CMKA 4R1SA 5EIOA 5JYDA 2XXBA 4NFSA 1HSZA 5MDHA 5TF4A 3RFVA 3K73O 3WQSB 2NU9A 2Y0CA 4C7JA 4U6QA 3K8ZA 2EWMA 4BKUA 3ZU2A 4S1VA 2HJSA 4OSPA 2Y68A 3WDSA 3U4IA 5JAZA 4KDFA 1Z74A 1G6KA 2PNFA 3UCFA 4HNHA 4CR8A 3L6DA 3V1YA 3MJTA 4YRAA 4OXKA 1R12A 1KERA 2DUWA 5ENVA 5DBIA 4I5EA 4M54A 4OIMA 4OM8A 2DPGA 1YBMA 3AWDA 3UKOA 1F0YA 4U7WA 2FPGA 3RU7A 4YWJA 1ZK3A 4I5FA 4AJKA 5HWSA 4EBFA 2E37A 3WX0A 3HUDA 5CDTA 4MP8A 3HB5X 2Q4EA 1KC1A 5K6AA 3DXFA 3I23A 2O7QA 5TQVA 4FJ1A 3HE3A 1P1KA 4A10A 4TKMA 4J0EA 3DWFA 4O1MA 4XR4A 2O50A 3VPXA 1RWBA 2HMTA 2P68A 5LC1A 1HDGO 2C0CA 1QG6A 4URFA 2CVQA 3KYCB 4BNYA 1VKNA 4KTVE 3RC7A 3A9WA 4JK3A 3GK3A 1YBVA 2Y1DA 1CEQA 5JC8A 4BKOA 4GL4A 4H16A 3U4CA 2IE0A 2V65A 5EERA 4OQYA 2CUKA 3CPSA 4IMRA 2C5AA 4A26A 2NM0A 2D8AA 1DHTA 4J3FA 3KYCA 1J6UA 4IQGA 4WCFA 2OP0A 4FBGA 5TIIA 1NYTA 1PL7A 3K92A 1UXIA 2WJPA 2OUIA 4MP6A 2X8LA 3PTZA 4IINA 1U2GA 1ZSNA 1H5QA 1ZW1A 4OKNA 1NPDA 1PTJA 4DLAA 3F1KA 4D79A 4ZU3A 4JLWA 1UAYA 1PQUA 4J2HA 1O89A 1PX0A 2PR2A 4CLDA 5B4VA 4XGIA 1F8GA 2DBRA 1ISHA 2W2KA 3JYQA 1VJ1A 5JPIA 3TPCA 2VYNA 2RH4A 1YH3A 1P9LA 4YA6A 4PLHA 2WM3A 4OXYA 5F1PA 3W1VA 3RFXA 1C1DB 2WSBA 2EJVA 3O4RA 1YOVA 1HF3A 3ZHXA 3C7CB 2P9GA 3E82A 4CM5A 5ADHA 3AI3A 5U1PA 4YAJA 5IDXA 1MA0A 5FF9A 4ESOA 2EIHA 3GG2A 3VVBA 4XR9A 2QRJA 4RVUA 3CXRA 4YJDA 4UUPA 4MVJE 4FS3A 1ZEMA 4R3NA 4BV9A 1LLCA 3ZH2A 4ZN6A 1T4BA 2Q1WA 1U28A 5G4KB 1ADCA 3AK4A 4Y6SA 3ZDFA 1B14A 2G0TA 1JWBB 2C20A 2C2YA 3V2HA 4A0SA 5ENDA 1QR6A 2OFPA 1HE5A 4NBRA 1Q0QA 1ZNQO 3D3WA 1OC2A 1SBYA 2B36A 3JD3A 2DAPA 3PHHA 3WGTA 4GX0A 4XJSA 3KRTA 5KNLA 4L73A 4XGNA 3ICPA 3W4JA 3ZWAA 3DBRB 1R0SA 3QQPA 1E1MA 1I0ZA 2WD8A 3INRA 4ZICA 2HLPA 4TQGA 3Q9NA 3VTZA 4GBJA 5T67A 4UVGA 1PEDA 1NAHA 5KKCA 3QVTA 4HBGA 3OICA 3HDQA 2FRDA 3ZNOA 2UYYA 1ZMOA 1R4NA 3E9MA 4GI2A 3BAZA 5BR7A 1E7SA 2E49A 3KSUA 2AMFA 4OAQA 5CEJA 1PGPA 1Y5RA 3DAGA 3FD8A 1DIGA 1TA4A 4J4HA 1E77A 1WZIA 4DPKA 4KUGA 4O5OA 4OYRA 3EY4A 3INGA 1P44A 5A1TA 1ZBQA 3KLMX 1I3MA 5EN4A 3QJ5A 4D7AA 3AI2A 3EDMA 3JD0A 1YE3A 4F6LA 1LSOA 3RC9A 1KBZA 3Q0EA 3RAJA 3MOIA 3CMCO 3WGOA 4CV1A 4IJKA 3FPCA 4RDHA 5AXBA 3L4BC 2GD1O 3MEQA 2QRLA 4A5OA 1J49A 1EK5A 4OH1A 2GF2A 1I8TA 3NDRA 1LA2A 4EYEA 1HXHA 2WYWA 5IF3A 4KOAA 4L0QA 1O95A 3ROQA 3HWRA 3GVXA 4ALKA 3LLSA 3S2GA 2YDXA 4OMUA 1M75A 3I9NA 1N7GA 3DDNA 3RC2A 2J3IA 2PH5A 3OBBA 3IJRA 3FTNA 2Y1GA 2WD7A 3V8BA 3DMTC 4JQCA 2OBYA 3DBLA 3QA9A 1V3UA 4BO8A 3H3FA 2V6FA 5EESA 1PR3A 1UDAA 2HO5A 3DFUA 3PFWO 3WB9A 4L4RA 1DFIA 4JP2A 3H65A 4CODB 2I76A 4ITUA 3H9JA 1DDOA 4HUJA 2W98A 4RVGA 3ON5A 4L74A 3OIDA 3GNTA 3KLPX 3LT4A 1WDLA 4R41A 4RZIA 4UVIA 4P22A 1UDBA 4BUCA 4YT5A 1SOWA 1JKFA 1LDGA 1ZUD1 3OJEA 4CLRA 2A94A 3NGLA 2GRAA 1GZ4A 3K96A 1HDOA 3TJRA 4TSKA 2HDHA 1HDXA 3DOCA 1DJNA 2ZTMA 3DC2A 8LDHA 4TMFA 4J4BA 2PV7A 4PCVA 4Y6RA 2YHIB 4J9UE 4OO3A 3R6DA 3TNLA 2FPIA 1EFKA 3RFTA 3JYNA 1A7AA 3OFSA 3JTMA 2FZWA 1U4OA 4UVEA 3V2GA 2YQ4A 5FI5A 1A4IA 1UZLA 4ALMA 3FNHA 4CM6A 3INTA 2WTBA 2OORA 2DPHA 3TRIA 4BV8A 1O9BA 4U6SA 4DIBA 5TX7A 3GT0A 4OQZA 1B26A 5THQA 2PKQO 3GNSA 3LC2O 3K6JA 1F12A 2GN8A 4GGOA 5IZCC 3ZHYA 1YB5A 3K30A 1AXEA 2BI7A 4CL3A 2JJYA 3DZKA 4CQMB 4W7IA 1DHRA 1U1IA 1PGNA 5KJ6A 3KEQA 1U2DA 2UDPA 3H9UA 1LDNA 3RSHA 4CM8A 3P5SA 3O38A 5DOVA 2ZK7A 3E5MA 5GZ3A 4CPDA 1G0OA 4IGFA 4BHTA 5JY1A 4IDCA 3ZV3A 1HTBA 4NBWA 5A9RA 4U5QA 1FK8A 5DT9A 1GUYA 4CJXA 4CMBA 1E1LA 4A03A 2NQ8A 3PGJA 3NJ8A 5L45A 3GVPA 1QORA 1JWAB 1AHIA 1MG0A 2GCGA 3IAHA 4L76A 3UFXA 4XB1A 1B8UA 2I65A 2IDZA 1N92A 1YQDA 3L9XA 4YQZA 1U4SA 5HTOA 1UXKA 3E1KA 2Y0EA 1EQ2A 1Z82A 2PD4A 1P1JA 1UH5A 1OZAA 3GRKA 2YY7A 4B3IA 3BXXA 2BGLA 4BMVA 1K6XA 3VDRA 4FIZA 1LI4A 3N74A 2EKQA 3VTFA 2PGDA 1JDJA 4D3DA 1GCUA 1AUPA 4GSKA 1MP0A 4RPLA 4EITA 3DONA 3HB4X 3PZBA 1PGQA 4XD2A 5K0ZA 5AXDA 3Q11A 3KBOA 3GA0A 1M66A 3GR6A 3U5TA 3Q2IA 3ANLA 2FN7A 4MVJA 4ZQGA 1GDHA 3R1IA 5ILOA 4FFPA 4NNJA 2UV8A 2QYSA 3K5PA 4WUVA 1O5IA 4B4WA 3WJ7A 4YAIA 3NV9A 3TWOA 1HYHA 2VUTA 2AEFA 1AHHA 4J0FA 4PIVA 4YR9A 2VYVD 1IZ0A 3FHLA 1HRDA 2Z1MA 3RJ5A 4FN4A 2POQX 1U3WA 4D45A 2V6GA 3GHHA 4XRRA 3RUEA 5KJ1A 1H6AA 1E6UA 3ZHBA 1A71A 1NQOA 1VC2A 3LYLA 4EDFA 5TC4A 4JIGA 2BFPA 2V7PA 4MKXA 4MIOA 3ENKA 3VAZA 1Y8RA 1U5AA 4QECA 4P38A 2X5OA 1JLLA 4RLSA 1J0XO 3EAGA 3ZW9A 4FD3A 4AL4A 2O7SA 1HYGA 3EGOA 1C3VA 1R66A 3H8VA 3L4BA 4QFDA 4BNMA 2ET6A 1SB9A 2EHDA 3FNFA 1GYQA 4BNZA 4UUNA 1ISMA 4W82A 4YT2A 5DCYA 1I2ZA 1U7HA 3AUTA 4FCCA 4YPOA 4IDGA 1ZEJA 4LK3A 3PJGA 1MX3A 2F1KA 4E0BA 3GFGA 1GEGA 1PZEA 4MO2A 1FXSA 1ULUA 1OAAA 2RHRA 3M1AA 4FPXA 1HT0A 4MKZA 1X13A 3NYWA 5I7EA 5LDGA 2E4AA 4AFNA 1MGOA 2RCYA 4CM4A 3I4CA 5JFOA 1PZGA 2B69A 2HSDA 5F5NA 3VPFA 3WGQA 2WYVA 1NQ5A 4DIOA 3DMTA 1Q2XA 3GOHA 1JKIA 1VRWA 3ZI0A 1UUFA 2LDXA 1XYGA 4N54A 4FJ2A 3B70A 2PKRA 4NMHA 2ZTLA 3F5QA 4MVJF 1NM5A 2HJRA 3WYBA 4B8WA 1Y81A 3SC4A 3COSA 4IDDA 2W2LA 4A7PA 1R37A 4JJFA 4QFCA 1Y8QB 5EL0A 4FGSA 3TSCA 3BHJA 1EQUA 4YEDA 4WNIA 3MTGA 4IBOA 3U9LA 1RM4A 3OIGA 4N5MA 4BKPA 3SX2A 1HLDA 3GMDA 3IP1A 4YJFA 5L4SA 1BW9B 2IYPA 2J6IA 4O63O 4J1SA 1DFGA 1ONPA 1X7HA 1JAYA 1ZJYA 2NVBA 1RYDA 3Q2KA 2VOEA 1FDWA 1WVGA 5U4QA 4DPLA 1IUKA 1HETA 1ID1A 5CPFA 2H6EA 3W4KA 1D3AA 1KIFA 1BW9A 2GGSA 2P5YA 3S1LA 4FC6A 3WIEA 1Y1PA 5A3JA 2YFQA 1MFZA 5L9AA 2VN8A 2VRCA 2E48A 2UVDA 5JYEA 3H5NA 4ZA2A 3W8EA 3PQEA 3BMOA 5JCXA 2RBEA 1DBVO 2CY0A 1MLDA 2Q1SA 2OBNA 2YQ5A 3K9QO 3ZWBA 1LQTA 2B35A 5F21A 1MV8A 5ES3A 3K2BA 2ZQZA 1PZHA 1SB8A 1TT5A 1HE4A 1Y9AA 2EW8A 3OH8A 4KUHA 3RWBA 3UHAA 2ZQYA 5CDYA 2O23A 1YL7A 4Z0HO 3LF1A 3SLKA 3CZRA 4Y67A 3S2EA 3WGHA 3O03A 1K6JA 3JQAD 3PHJA 5IAAA 4CQLB 1ARZA 4NG5A 4IM7A 5LDHA 3UH1A 2AW5A 5TS3A 3WNQA 4AJ4A 4BB6A 5G0UA 3ZWWA 1N9GB 1Q7GA 4E30A 1A9ZA 4GPD1 3DHYA 5CEFA 2WE7A 3ASUA 2ZIZA 3VPHA 3VVCA 5DNAA 5B37A 3ZWXA 1PGJA 3L0DA 4OHUA 3ULKA 5T57A 4BKRA 1DIAA 1B16A 1Y6JA 3CTMA 5KVVA 4IQ8A 2PWZA 3SC6A 1PWZA 3OMLA 4NDNE 2D1YA 4I1IA 5JE8A 2GYYA 5CFZA 3KETA 2FPPA 3ZU4A 1JTVA 1V3TA 3E9QA 3WMWA 3OECA 1FDTA 3AOEC 4JROA 4C7KA 5EQDA 1WAMA 4XYBA 4RVFA 1NVGA 4I9NA 4O59O 4PG4A 5AQ1A 2OL4A 4PZEA 4LN1A 2OO5A 1EVJA 1X15A 1P74A 3Q6IA 4E3ZA 1B7GO 4D42A 3WSVA 3HFSA 3GG9A 4II3A 4IIVA 4IIUA 1GPDG 2RIRA 1RJWA 3OA2A 3OEYA 4X54A 3VKUA 4B7XA 1ZSVA 2HMSA 3NTQA 4XB2A 3ITKA 4NI5A 1B8VA 3H9GA 4YJGB 2FY8A 1Z75A 5JDIC 3IQDB 4QX6A 3RUDA 1DB3A 1Q1NA 1ZVMA 2G76A 1H2BA 3AUAA 3NAQA 3QW2A 4HFMA 5EPOA 4BB5A 4BNFA 3DQPA 5TT1A 4Q3AA 4CM3A 4CMCA 1VLLA 1FDSA 2EF1A 3B1KA 2GZ2A 4WGGA 3RD5A 4UUMA 1AN9A 1XA0A 4ZQFA 4TZTA 5ER9A 4CL8A 3W6UA 4DL9A 5KVCA 2HMWA 5AVOA 1DFHA 4W7HA 3JQBC 4OGWA 4E12A 1F8FA 1P33A 3CZMA 1QLHA 3PRJA 2YV2A 5KIAA 3QVSA 3H4VA 3EVTA 4ZQHA 4CMHA 4RVHA 3QVXA 5FWNA 2AQIA 1IYZA 5C3MA 4S3MA 3WLFA 5JCJD 1WW8A 4IDFA 4WLOA 1I01A 4L75A 5JBIA 1GAEO 3GEDA 2X7HA 4J1TA 5HA5A 3U4HA 1BSVA 2C54A 2O3TA 3ONFA 3LZ6A 1CJCA 4XJTA 2NTVA 4B3HA 3NDIA 1SOVA 3EVNA 1OOEA 3DZHA 4IGEA 2AE1A 3DZJA 4LRSB 4R01A 3I9OA 1R4MA 3RCBA 3I9KA 4UREA 2A92A 4DXHA 3LT0A 4R1NA 3JQGB 4E5NA 4GLOA 3JV7A 4QT0A 4MOWA 1NR7A 4DPMA 1P1RA 3H6KA 5IDYA 5K9ZA 4IY1A 1MUUA 4R5HA 2PLAA 2F00A 3VH2A 2GASA 3L6OO 1HL3A 4PN3A 4LSWA 1AGNA 1SMKA 1GCOA 4Y98A 3WSWA 1GV1A 3MZ0A 2PGLA 3PP8A 2WE8A 1R15A 1I30A 3UUWA 3ZWYA 3PHGA 3PYLA 3SBOA 3SEFA 3HSKA 2P91A 4D0SA 1X0XA 3DL2A 5B1YA 3QHAA 3QLJA 4EW6A 1HDZA 3JSAA 2VTDA 3OA0A 3DHNA 2JCVA 5IDQA 3PI7A 4YAEA 1LSSA 2D3TA 3DBHB 3EZLA 3O8QB 2Q4BA 3JCZA 3EMKA 3PEFA 1GADO 2P2SA 4Y6PA 1DXYA 3RUAA 3B20A 4A73A 1HYEA 1Q7BA 4Q3BA 2JAHA 4IDAA 5KJCA 5JS6A 1A4UA 1R0KA 3EW7A 2Q49A 3BMQB 2HRBA 4QXMA 4XWYA 3QWAA 4E31A 3JYLA 3V1UA 4DYDA 2A35A 2X6TA 3PFFA 2YDYA 3O8QA 4HKTA 3JQEA 4PRLA 3GH3A 3ZV4A 1DO8A 1OI7A 1T1RA 1LEHA 3PJFA 3ROMA 4HP8A 4OXNA 3H2SA 1YS4A 1H6BA 3DO5A 3K31A 3WR5A 3WYCA 4BNUA 4YDRA 5CDGA 1U9JA 1V9LA 3DHEA 5JDCC 4WLNA 1ZK0A 1B0AA 3AW9A 3VPGA 4IS2A 1CWUA 5G0VA 1M76A 4U8GA 3D4OA 1EBUA 1Y9EA 4BO2A 4GMGA 4YACA 1LBEA 1UZMA 3RUFA 4KDEA 2WEKA 1RM0A 2AA3A 3FR7A 4YXFA 3A14A 3GUYA 2AG8A 3FTPA 4GX5A 3CEAA 3EUWA 2D0IA 2D4AA 2YW9A 4IQ0A 4J2OA 4E5MA 2X58A 1XQ6A 4J7XA 4ZQEA 5L95A 3HN2A 5KCZA 2NACA 1KY4A 4LSMA 2ZYGA 4L4SA 4BO0A 4EI2A 3ROKA 3DB2A 1GQ2A 3N7UA 4JBHA 1E5LA 3E48A 1QV7A 4BKQA 3DZGA 3UVEA 1Z45A 1KVQA 3GFBA 3GVIA 4C4OA 3H9EO 3OP4A 1YVEI 3HNPA 1B3RA 5HRUA 4OOFA 1EUCA 3OQBA 3RI3A 1LX6A 4R1UA 4YBZA 1C1DA 4RL6A 2FWMX 4JGBA 3FBGA 5EQFA 3PQFA 1NQAO 3TQHA 4RZHA 1UZNA 1U3TA 1EVIA 3H7AA 4PLFA 3PWSA 4M55A 2NADA 4XDYA 2EV9A 3W8DA 4NK4A 1WLYA 4RQTA 2EERA 3GZNB 4ONEA 5ITVA 4UUOA 1T1SA 4YAGA 4J16A 5G4KA 3H2ZA 1I32A 4ALIA 5C7OO 6LDHA 1M67A 2J3KA 2O3UA 2VWQA 3D1LA 3ZWCA 4Y9DA 5B4TA 3CSDA 3OQ6A 4I9UA 2D5CA 1DLJA 1X1EA 4ROSA 3LDHA 4NH4A 1ZZEA 2A4KA 1YWGO 4FOSA 1M6WA 1E3WB 3PIIA 4Z3KA 1E92A 2Q46A 2B0JA 3QE3A 5TT0A 3WQRA 5CPBA 1ONOA 3JQDA 2VUSA 1I3KA 2PA3A 2DLDA 3UCEA 3WOHA 1SEPA 3U3XA 5CEEA 5DULA 5CDSA 1Y7TA 3AI1A 1LLQA 3DBRA 3F47A 2J5KA 4WKGA 5L40A 2E82A 4NIMA 4EEZA 1RKXA 3PK0A 3NT4A 3DTTA 3JQBA 1KVRA 2I99A 1MC4A 4CLOB 9LDTA 2Q1TA 3HQ4O 4R16A 5CDUA 1E1KA 1EMDA 2QG4A 3PHLA 3KO8A 1QMGA 3NRCA 4FGWA 2B5VA 4O6VA 2B5WA 3FCOA 3DOJA 3WQQA 1ZK4A 1I2CA 5DP2A 3HHPA 1ONNA 4DBVO 4TRMA 4A2CA 1D1TA 2IYOA 4KP7A 2YFHA 4WEOA 2AQ8A 3SJ7A 4Q39A 5KJEA 1JVSA 5T8KC 4H15A 6ADHA 1PGOA 1BDMA 5BSEA 4HX5A 4J49A 1JAXA 1JA9A 3WNVA 4B4OA 3PLRA 1T26A 3ETEA 4O0LA 1ZMTA 4HFRA 3TFQA 3R3SA 1PZFA 3IL2A 1GPJA 1DC4A 3I6QA 5HBRA 1C1XB 1VM6A 2AXQA 2OXIA 2BHLA 2GO1A 2ZB8A 4BO4A 1E7YA 4DTIA 1K6IA 1E3LA 5AOVA 3OSUA 4Y8VA 2GSDA 3LF2A 4WK6A 2Q2QA 3VH3A 4Q9NA 2BLLA 4IS3A 5FFFA 4JXKA 1UP6A 3JQCA 3LC1O 1GZ6A 2XXJA 2JD2A 1OBFO 2AEMA 3ADPA 4E32A 3AY6A 1P1HA 4BNLA 1IOLA 3DAPA 3VOSA 3UAGA 2YV3A 4CMIB 1CYDA 1ZO8A 1NR1A 3WFJA 4RPJA 4ZGWA 1NQTA 1ZKMA 2YUTA 2BKAA 3WWZA 4B3JA 3GC6A 3IC5A 4XDZA 4W99A 2X5KO 3MJSA 3TZKA 3I3OA 1SO8A 4QSMA 1P1FA 3K2EA 1U3UA 3JQFC 4MPDA 2W8ZA 4F45A 3NDJA 3DEYX 5G0SA 2YHIA 4KWIA 4XKJA 3W6ZA 2FSSA 5JDCA 2BGMA 1EZ4A 3OJ0A 1D7OA 3T4XA 1PQWA 5I8WA 3VZQA 2CVZA 1K0UA 3G17A 3R3JA 2O4CA 3QWIA 1ORRA 2JCYA 4IJVA 3MCVA 4ALJA 1VL0A 2R00C 3F5SA 4GKBA 3AU8A 4XYLA 5JAMA 4MKRA 5A5EA 1EE9A 2NTNA 1IPEA 4JP3A 1ENYA 1ENOA 2BMAA 3ETDA 3JQAB 2YV1A 4CV0A 4NPCA 4FQ8A 4CMEC 1T2CA 4AJLA 4CQMA 4NZ9A 3VZSA 4XEHA 1DOHA 1KVTA 3RQSA 5JC1A 1E3SA 3GGGA 3L9WA 4KTTE 2CDAA 3LC7O 2BELA 1C0KA 4L4XA 1L7DA 3JQAA 1NX6A 1HKUA 2PD3A 4XQCA 2C7VA 3ZWNA 2VYND 1YJ8A 2C07A 2JFFA 3JQ9C 5A9SB 3ENNA 3KSDO 2I6TA 5IXSA 4PG7A 3FF4A 4BGIA 4CM1A 4PLWA 1T25A 3ICCA 2GR9A 3T4EA 4M8SA 1E3IA 4TRRA 3TZ6A 1NPYA 1KEPA 1LRJA 3A4VA 5GZ6A 5I7VA 3PVZA 4PLTA 4BL5A 5TLSA 4DMMA 1F14A 3BMCB 4PG6A 4W6ZA 3LK7A 2EG9A 3W8FA 4AJOA 3FN4A 1AXGA 1ZCJA 4BO7A 1H9BA 4XYMA 3P2YA 5TSDA 2JCXA 3ZWMA 4D3SA 1EVYA 1GEEA 2J8ZA 3S8MA 3L07A 1QYVA 1W4ZA 3KVOA 3NT5A 1I36A 4IDEA 2VHWA 4HV4A 1IZ9A 3F3SA 4BNIA 3BZUA 1DPGA 5CAEA 4XCVA 1KS9A 3WWYA 3VH4A 2CMDA 4R9SA 3IS3A 3B1FA 1SCUA 3TOXA 4YB8A 4NQZA 3UN1A 3BMNB 3ZNPA 1GTMA 4E6PA 4AJ2A 1BRMA 3PHIA 4DQUA 2TMGA 5GY7A 5A4DA 4OL9A 4IUYA 2VHXA 2X9NA 3KYBA 2CFCA 2DTXA 2D2IA 1NTOA 4EUHA 1SC6A 1EE2A 1YQGA 3JD1A 3QWBA 2XOXA 1X14A 4BMNA 3KXDA 3N58A 4UAGA 3LVFO 2HAEA 5IFLA 3CUKA 1SNYA 1XKQA 2G1UA 1R0LA 1CETA 1AE1A 2ZJ0A 4AJHA 2Y99A 3E18A 4IXTA 1C14A 3JQ7B 3DZIA 1XHLA 4D43A 4IZIA 3D5QA 4DQXA 1LDBA 3F4BA 4R4JA 4NJOA 2NU8A 1PR9A 4XRGA 1R6DA 2QZ9A 3PDJA 3QWHA 3RC1A 4FB5A 3G0OA 3VKVA 3ZWOA 1E1NA 2WWRA 1QYWA 2X86A 1GU7A 3EYWA 4UULA 4YTEA 4M87A 4FSHA 1GUFA 3OM9A 4HFNA 1ZK1A 3I4FA 2ZKLA 4XQEA 4RQUA 5GMOA 3RJ9A 2EKPA 2D5AA 4CM9A 1JN0A 4BNJA 1K89A 4R3WA 4RPHA 1PJBA 3OQ1A 4I8XA 3F46A 3PIDA 4ZJUA 5JCJA 1C0LA 1BVRA 2GN4A 4DYVA 4TROA 4LMPA 4R1TA 2Q45A 1BHSA 1GUZA 2DM6A 3F4LA 4KUEA 3Q1LA 4L9RA 3ASVA 2B4RO 3ZU3A 4NFHA 1X0VA 1ZH8A 3RKUA 3UF0A 4OJNA 2G82A 1R16A 4UEJA 1VPDA 3PWKA 2Z1NA 4YJHB 3VZPA 4B4VA 5AXAA 2LDBA 1ZK2A 2EXXA 1XLTA 1TXGA 3W4IA 2ZCVA 4K9DA 3TZCA 2ZTVA 3GY0A 3GLQA 2WDZA 4Z9FA 3KOUA 4JCOA 3TL3A 2Y1FA 4RF4A 1T4DA 3C24A 4R54A 2BRUA 5DN9A 4FC7A 7ADHA 3Q3CA 5JAIA 4UVHA 4KQXA 4WJZA 1LXCA 5IDWA 2VNAA 2W4QA 3DBVO 4XYEA 1MG5A 4Q3EA 5I7SA 4ZHSA 4R5MA 5DBFA 5KVSA 2EP5A 4GVLA 4RJTA 2DVMA 1YDEA 1Y8QA 4IPTA 2NVUB 2VT3A 1BTOA 2X0IA 3NEPX 3GAZA 4JNKA 1UAGA 2X5JO 3GVCA 5L3ZA 1P3DA 3E5RA 5LCXA 4B79A 3JQFA 4U0JA 4GSLA 3UCXA 1RM5A 1LLDA 4CLXA 3ZU5A 2GLXA 3RBZA 1HE3A 2CZCA 2GDZA 1IHXA 1O0SA 2JHFA 3KZVA 5DF1A 4Z0TA 4BNVA 4FFMA 3MJCA 1MB4A 4TKLA 5IZCA 4AICA 1TI7A 1GZ3A 3AOGA 1VSVA 4I5GA 2GUGA 4NJMB 5K6AC 1LDYA 3QY9A 1ZXLA 2VWPA 3GZ4A 2AQHA 3C7DB 4HADA 3QP9A 4ALLA 4P4GA 3HG7A 3RUCA 1H94A 1YGYA 1GYRA 1PU2A 1RYEA 5A06A 4R69A 1E0DA 4NJMA 3QWFA 2G17A 3M1LA 1WNTA 4EJ0A 3NUGA 1FJHA 2O2YA 1F06A 5DCWA 4PVDA 3QV1A 4PLVA 2DTEA 1U3VA 1WP4A 2XF8A 2RHCA 2OOSA 3S2FA 2UAGA 1T2EA 3KYDB 4WCFC 3WJAA 4BNWA 2VOJA 4CQLA 4CR6A 1S6YA 4J7UA 1DRWA 1Z6ZA 4WLUA 1ADGA 3OIFA 4CM7A 2VWHA 2OMEA 5TRTA 2PZKA 4ALNA 4LCEA 3RIHA 5I8ZA 2Q2WA 4BQPA 1GQQA 1N9GA 2X4GA 1F17A 1T24A 4WNCA 2OGUA 3KYDA 4QO7A 4XGKA 3KM0A 1DIHA 3H9QA 4LVUA 3OF2A 2ZB3A 2QHXA 4EJ6A 4JBGA 3GDFA 4RPGA 5T6BA 5BSHA 5COBA 1IL0A 4E13A 5G0WA 4QTZA 1FMCA 1EK6A 1YJQA 5L51A 3ANNA 1NNUA 3TOZA 1ENPA 1I3NA 1YL6A 2IXAA 3IMFA 4BNTA 5L4NA 3EHEA 4U0KA 9LDBA 3H5AA 4E5YA 4BNHA 4EZBA 2HK7A 3LU1A 3HN7A 1BWSA 3L6EA 5DZSA 3H3JA 1D4FA 3GUCA 3MOGA 4HXYA 4P8RA 1S7CA 4MVJD 2HQ1A 4MVJG 1KEWA 3QVWA 1A5ZA 4FFOA 1P0FA 3IJPA 4RORA 2ZCUA 3OJFA 3WGZA 2Q1UA 4Q3CA 3S2IA 5BSFA 1HDCA 1P1IA 1ZJZA 1ZXBA 1UR5A 3AU9A 3FPLA 5F1OA 2NTJA 1KVSA 1JU9A 2FZEA 2I9PA 3JYOA 1HWYA 4LW8A 4JX8A 2I3GA 2DT5A 4RVDA 4Z3DA 2H1SA 2J3JA 3JYPA 1PJ3A 3I52A 5FI3A 3AY3A 1EDOA 2NQTA 2ZYDA 5IJZA 3JD2A 1DAPA 1H0KA 1QYDA 1X7GA 3U4DA 3ANMA 2EGGA 1WWKA 4YJGA 1KYQA 2Z5LA 2Y66A 2I5PO 4DUPA 5C7LO 4QUKA 1DIBA 1A27A 2SCUA 3ABIA 4DIFA 1VE9A 3SJUA 2FP4A 3B1JA 3NT2A 4ILKA 5DOZA 5IN4A 4GAEA 1TVEA 1ML3A 4Q3NA 1I24A 4RPKA 3LQFA 4BNGA 3MJVA 1UJMA 3RROA 2YZ7A 1YRLA 2YHUA 5EMHA 3I6IA 3ZGYA 4LISA 2JD0A 4ND2A 1EDZA 1GFSA 2FSVA 2ZTUA 5F3RA 5BNTA 3PXXA 3MTJA 5TGDA 3QVOA 5CG2A 1H2HA 3ST7A 2J5QA 5COAA 1YBAA 3GNQA 2HUNA 3GGOA 4R9RA 3BTVA 4AJEA 3ZWVA 1G0NA 1W8DA 2VZ8A 2PY6A 1HSOA 1V6AA 1XELA 4DLBA 4GGPA 4MVJM 4NR0A 2P9CA 5A03A 2ZYAA 3NJ4A 2VCYA 4GVXA 2GZ3A 4BNKA 4MIYA 2QIOA 2C82A 2IZ1A 3NKLA 3GHYA 4QQRA 3B6ZA 3KB6A 3V2UA 4E2XA 5F5LA 2PZLA 3BTSA 3JQGA 3KSZO 4YRBA 1CQIA 3JQ8B 1U7TA 1CIVA 4K6FA 3CKYA 2W2LD 2AEJA 2H63A 4AJPA 5L53A 3MJEA 3VZRA 3JD4A 3WBFA 1HEUA 2GN9A 2VQ3A 4HNGA 1L1FA 4J43A 3C3XA 1J5PA 3WGYA 1D8AA 3HZZA 3JQ8A 4MIEA 3O9ZA 3NGXA 1H6CA 1I10A 2CDCA 3V1TC 4BGVA 2UUOA 3U62A 2Y67A 2O3RA 3GEMA 4HWKA 4M86A 1DC5A 1H6DA 1NP3A 3DBHA 1K2WA 2IRWA 5C7IO 4RF5A 4Z0PA 1XWFA 1T2FA 1OFGA 5A9TA 4ZQBA 1BXZA 3U49A 4DGSA 5AYVA 4AVYA 5A02A 3DOOA 3G3EA 5HM8A 2VTEA 4PRKA 1K3TA 2VRCD 2BFMA 2O3JA 1P77A 2UUPA 4B4UA 1B2LA 3AM5A 3BMQA 2RAFA 1E3EA 3I5MA 3UXYA 1PL6A 4BGEA 4FFLA 2OZPA 3H5RA 4EJMA 1ISJA 4YYZA 3SXPA 4BO9A 2P4QA 1SZJG 1H93A 1LDEA 4WCFB 4BQRA 3BHMA 5HS6A 5KWEA 2Q2VA 5CP8A 1PJSA 4IMPA 3GGPA 4XX0A 3WICA 2VT2A 4CLHA 1QSGA 1KOLA 4AJ1A 1CERA 3AM4A 1DLIA 4PLCA 5JMPA 2NLOA 2CNBA 1NASA 1IULA 4NFYA 2C2XA 1ADBA 3D4PA 3IUPA 1O8CA 3STHA 2VHVA 1YB4A 2JD1A 2JFHA 3D5TA 4AG3A 1K5HA 1PIWA 2W2KB 1LRKA 5EJ2A 4OSOA 4GWKA 2DBQA 1SEVA 1VSUA 3ONEA 1QRRA 3C7AA 2YJZA 3E9NA 2BF7A 3X2EA 4BNNA 1WDMA 3RBXA 2HKIA 4UEKA 4E4YA 1PJCA 3WS7A 1YOVB 2VRBA 2QX7A 4JN6B 4W4TA 1PQPA 3ZN2A 2A9FA 2OP1A 1JKJA 2X9GA 3E6AA 3HDYA 1PJ4A 3GVHA 2EW2A 4FR5A 4ZD6A 3AOEA 4YQYA 4XQ9A 3PPIA 3P7MA 4G2NA 4PG8A 1Q7CA 5DP1A 4DC0A 2CF5A 4MVJI 3RASA 3TDKA 2HMVA 4RF2A 3GMSA 4NBTA 4FOOA 3R0IA 2CVOA 2X9VA 1I5RA 1BVUA 2ZB4A 3OEWA 3D3WB 4W9NC 3WLEA 2HK9A 1MFPA 1V3VA 4BO5A 4AJJA 1XU7A 3G1TA 4OKIA 3PYXA 1IE3A 3F9IA 5JDIA 2ZATA 2R6JA 5C5IA 5COQA 3GZNA 3HDJA 4M49A 1QLJA 1V8BA 1E7MA 1OMOA 4QO8A 1NWHA 1PJTA 1N5DA 4WLFA 4CR7A 1DC6A 1BMDA 1E6WA 4B7UA 4B8ZA 3T7EA 4XYGA 5AXCA 4YAKA 1TLTA 1R4NB 4WOKA 4CUZA 4FFRA 2R2GA 1E3WA 1EUZA 2BFAA 2VYVA 1PS0A 1U8FO 1YKFA 5KVQA 2X0JA 1QXSA 1GD1O 3DR3A 2Y05A 1SAYA 2VWGA 3PLNA 2PD6A 2Q99A 2D59A 5TNXA 2DTDA 4H7PA 5G0TA 1P45A 5CHEA 3X2FA 3ZNNA 1LQUA 3I83A 2DC1A 1BXGB 1N1EA 2NSDA 3OHSX 2CSUA 4NU6A 5KOIA 1Z7EA 2BI8A 4E33A 4CLOA 4BIIA 1FF9A 4TRNA 3T7CA 1FDVA 4UVDA 4WCDA 1YDWA 3GEGA 3HJAA 1A72A 1IHYA 1QP8A 3RU9A 1JQBA 1LC3A 1BXGA 3GF4A 2AHRA 1GL3A 1GV0A 1XU9A 1XCBA 1IY8A 4JJGA 3AUUA 4E2ZA 3BHIA 4D3FA 8ADHA 3G1UA 2J3HA 3I9MA 4P4NA 2WD7B 4J4TA 1EVZA 1NWCA 2AE2A 3DBLB 4DA9A 1TT7A 5TJ9A 1UP7A 1EBFA 1WZEA 4WOJA 4AJIA 1NHGA 3PQDA 2VUUA 1C0IA 1RPNA 1B15A 3HFGA 5BNFA 2BGKA 4EUEA 3UOGA 5JY6A 4WECA 2DBZA 1N8KA 5H81A 3MWEB 3IUSA 1VJTA 1TEHA 1C1XA 3D4NA 4RV9A 1N7HA 2IZZA 3FWNA 4J9VA 3WFIA 3DZBA 2V6MA 4BMSA 4CUKA 4F6CA 3LLVA 3WGIA 4CLRB 2EP7A 4KZPA 4KMSA 1QYXA 3FRJA 3PYMA 1TB4A 2H5LA 2J5RA 3C1AA 1YO6A 2QQ5A 4UEOA 2DFVA 1FDUA 3M2TA 4NBVA 4KWHA 5FYDA 4BS9A 2GZ1A 4XZ3A 1P31A 1VKOA 4N5NA 2VNSA 4MINA 4CMIA 1E5QA 1UP4A 2PK3A 2XAAA 4F46A 5JXWA 2P5UA 2PGJA 1YXMA 2FHSA 4FJ0A 3RKRA 2ZB7A 4TVBA 3TN7A 1IB6A 1HDYA 2I66A 1DC3A 3RVDA 2QZZA 4K28A 1BGVA 5DDIP 1HLPA 3EC7A 3QIVA 3C1OA 2DQ4A 2VHZA 3ZV6A 5ICSA 3GAFA 3V5NA 4GH5A 2JHGA 5H82A 4XA8A 5JLAA 4CMAA 2HCTA 4CM8B 3F6YA 3ROPA 1T2DA 2PZJA 3UW3A 3IKVA 4CMGA 4I5DA 2RH8A 4TVOA 1Z7BA 5THKA 3OJOA 5BSGA 2NWQA 3NTRA 2GERA 3BTUA 1Q0HA 3FI9A 4RLHA 2NU6A 3QSGA 4J91A 3CMMA 4RGBA 1E6EA 3ZNQA 3BA1A 4DLLA 2GPTA 1Y5MA 3ZW8A 3GRPA 5B12A 4PLPA 3E8XA 1A7KA 1NVTA 2IZ0A 1MC5A 1NHWA 1QKIA 1VL6A 2FR1A 3DAFA 4M89A 3JQ6A 4K26A 3VDQA 5I7FA 5JW6A 1YL5A 5L7WA 3IOYA 2X0RA 2CD9A 4CMJA 3LSYA 1EUDA 2VZ0A 1ULSA 3IIEA 5BT9A 2PZMA 3IDSA 2AG5A 2YYYA 4PVCA 4WLVA 1LNQA 2C5EA 1WPQA 3FNEA 1V35A 2Y1EA 1B8PA 1W6UA 1CQJA 5ITWA 5L7TA 2HMUA 4IJWA 5T5QA 1C0PA 1PJQA 3GQVA 2DBVO 2FOIA 5A9SA 3IKTA 1NXQA 2I3AA 5L7YA 5IG2A 3VPSA 2FR0A 1M2WA 3U0BA 4MVJH 4II2A 1RM3A 5JMWA 3G79A 5IN5A 1NVMB 2B4TO 4RF3A 3AFMA 2OHXA 3EK2A 1Z73A 3I1JA 2C7GA 4BVAA 1DRVA 4BO3A 5A5FA 3BMCA 4J90A 4H3VA 1ZIDA 4I08A 4W9NA 2W90A 5G2OA 4PLYA 5JNLA 3UICA 3DFZA 4NHEA 1KEVA 4XQGA 4AJNA 4ND3A 1KC3A 3TL2A 4GMFA 2EGHA 1NFQA 2CDBA 2QW8A 3TFOA 4WPGA 1CDOA 4E5KA 3HDHA 3LT1A 5BQFA 3FWZA 2AQKA 1QV6A 1HE2A 1LU9A 4LGVA 1L7EA 3BMNA 4PGFA 4ID9A 1I33A 5IXYA 4A27A 3I9JA 4EEXA 4E2YA 2V6BA 3KEOA 1I3LA 2ZJ1A 4BNXA 1UXGA 4PG5A 2C29D 3TF5A 3RBVA 1H9AA 4N7RA 1XQ1A 4GLLA 3ADOA 2B37A 4DVJA 4MP3A 4NU5A 3FR8A 4INAA 2BH9A 3M6IA 3PGXA 3ZZNA 1Y8RB 4QEDA 3O26A 3VHRA 1X7DA 1U5CA 3WTBA 1DEHA 4TRJA 3VH1A 3TZHA 3DMYA 3JQ7A 2Y93A 1EEHA 2PFGA 3C8MA 1A9YA 2BD0A 1NFRA 5T8KA 2G5CA 1VL8A 5A04A 3F1LA 3GPDG 4CV3A 3KUXA 3PJDA 5ER6A 1E3JA 4I9HA 3PWZA 2VHYA 3OJLA 2B4QA 3HADA 3GN2A 3U09A 1GYPA 1W0CA 3G49A 1DSSG 2Y0DA 4Z9YA 1MXHA 4ND4A 3P19A 1GQYA 1OC4A 3PDUA 4K1LA 4N5LA 4CM4B 2Z95A 4DQVA 1NAIA 3L77A 2B83A 1KETA 2WMDA 5H83A 4DRYA 4D41A 2QYTA 4R68A 3BIOA 2NVWA 2HK8A 3D7LA 3ZCXA 5FEUA 1N2SA 1Q0LA 3AFNA 1XDWA 4J1NA 2QRKA 4WE3A 5B4UA 1GR0A 1LC0A 1XIVA 1XGKA 4BO1A 1LDMA 4F3YA 4N18A 5DBGA 4YJHA 3EZYA 2CF6A 1CF2O 4MDHA 1KY5A 2O3SA 3WGGA 4D44A 4HFJA 4J7CA 1E7WA 4K6CA 1VI2A 3I9LA 1VJ0A 4RCVA 4YJFB 5F1KA 4YVFA 5A3VA 2IEBA 3AM3A 4LVCA 4PZDA 3DTYA 4ZRMA 1ENZA 4BOYA 1XSEA 4J6FA 2FMUA 2DU8A 2JKVA 1O6ZA 4IJUA 1XR3A 2PKQP 3CE6A 1PL8A 4PLZA 2X1HA 3WYEA 4E2WA 3AJRA 3AY7A 2ILTA 5JAQA 4D0RA 4EGFA 1LJ8A 1XEAA 1YONA 3LT2A 3FSRA 3KV3O 4WLEA 2Y1OA 3GDGA 4PLGA 1IPFA 4E21A 5IZ4A 3RUHA 4DREA 3WTCA 2NVUA 3A06A 3NX4A 3ONDA 4XIYA 1EFLA 3A28A 4DMLA 1B3BA 2X0NA 3FBTA 4FDAA 4WEQA 3WMXA 2NU7A 5T64A 1NFFA 1XG5A 3GPIA 2XPCA 2R00A 4YCAA 4GKVA 4ND1A 1PWXA 3BMOB 4YT4A 4MVJP 1BDBA 1LLUA 3PZRA 1DIRA 2DUUA 1JVBA 1LSUA 2JAPA 1TT5B 1ADFA 1HDRA 3C85A 3C1TA 3GDOA 1DRUA 4NK5A 4Q3DA 4YT8A 5KKAA 4CMEA 4BGUA 3Q9UA 2IODA 3WBBA 1HZZA 4CV2A 1MXFA 4ND5A 5L4LA 3BTOA 2O48X 1WMBA 1PS8A 4DC1A 3QRWA 2NV6A 3RUIA 3E03A 3DZFA 2HU2A 5U9CA 3D3EA 2GN6A 4WASA 5JO9A 4CQMD 4TZKA 3D0OA 3ZHZA 1LTHR 3D64A 1V0JA 3JQ9A 3MJ4A 5I9MA 2HRZA 1ISIA 3UGKA 5C37A 1PJ2A 2O2SA 3ITDA 4NBUA 1WXDA 4PZCA 5JO0A 1I2BA 3S55A 5CG1A 4JJIA 3NTOA 1HZJA 2PTGA 4BO6A 1DAOA 3CIFA 5I9LA 3PJEA 2GNAA 1NBOA 1CRWG 4G65A 2P9EA 4LRTB 4Z9XA 1UXJA 5EINA 1D1SA 1T2AA 2NNLD 3MWDB 5HS4A 1YQXA 1W73A 4LMRA 3KHUA 4HY3A 1E7RA 4XIJA 4GQAA 4G5HA 4D46A 4DWVA 1G1AA 5BNIA 1X1TA 3KTDA 2X23A 4LCJA 2BFOA 5ICMA 3OETA 4FW8A 5KJFA 5G4LA 1PSDA 1J4AA 2WYUA 5A05A 1ZSYA 3P2OA 4MJLA 1O94A 1LSJA 5ILGA 4J1QA 3M2PA 1PS9A 4L8VA 4YRDA 3FNGA 2PH3A 2X22A 2O4UX 4E5PA 5KTKA 1ISFA 1WMAA 1PJLA 2O3QA 3GN1A 1KEUA 4GWGA 3WIDA 5DCUA 1YB1A 2FR8A 3SVTA 3IP3A 1LRLA 4ZVVA 1SPXA 2NUAA 1WDKA 2DKNA 3CINA 5JSFA 1ZFNA 4GX2A 5MGBA 2EEZA 5I9NA 4GX1A 2E6UX 4M1QA 7MDHA 4CLEA 4P4LA 4PFJA 4TWRA 3ORFA 1BG6A 2IXBA 2C59A 2JL1A 1P0CA 1DJQA 1UDCA 1E7QA 2DFDA 3WG9A 1KVUA 1JW9B 3ZV5A 2JFGA 3ETGA 4G81A 4JBIA 5TJHA 1UXHA 2Q3EA 4RDIA 2Q50A 4IXWA 4R51A 3TZQA 4CUJA 4RO0A 4RVSA 1ISGA 3AUSA 2H9IA 1M6HA 4CM9D 5GZ1A 4KQWA 1QYCA 4ZRNA 3SLGA 3A1NA 2P4HX 3L4SO 4DBZA 4IZHA 4OOEA 2IEDA 2TMDA 3ZWPA 1R4MB 4FFNA 4Z6KA 2EJWA 2EKLA 2I67A 1U8XX 1NPTO 3VC7A 1N1GA 4B7CA 1LUAA 4EUFA 4IDBA 3BYZA
chains in the Genus database with same CATH superfamily
3ILVA 2OTCA 2BDUA 1GUDA 4Q19A 1GY8A 2HT6A 4FGJA 2Y1CA 1BIFA 2O0LA 4A3SA 4B3FX 5EIOA 1GTSA 4WA8A 2IU6A 2R6FA 2Q6OA 4NFSA 4DARA 2RGRA 1HSZA 1WSWA 2X6RA 2ZREA 4B4KA 4Q7QA 2IZ6A 5TF4A 1TQ6A 3JX9A 1TGVA 3K73O 1G38A 3TLBA 1X80B 2NU9A 3TAXA 2QK4A 1YMVA 2BSXA 4MEAA 4AY5A 4YHBA 5B55A 5JJKA 4IHAA 3T3HA 2PRYA 4FYJA 4U7HA 5HGJA 2VJNA 1IQ0A 3EW9A 4KN9S 1WEHA 4M46A 5LIPA 3U4IA 1Z7WA 5JAZA 4KDFA 2Q1YA 4MKGA 3SK0A 1MF7A 5A3QA 3UCFA 4QYSA 3OHPA 4BVGA 1SQ0A 2FZCA 2PX8A 2QM7A 1VE7A 2QUKA 4D02A 1AMOA 2HSJA 3T3MB 1O57A 2CJFA 1R12A 5EHIA 3DE4X 2GS9A 3T5PA 3AR4A 3M3HA 5DBIA 5LP6B 3G2MA 5LZ4A 4M54A 1N2JA 2DPGA 2YINC 3CLHA 4P35A 1YA6A 5ALWA 3AWDA 3LLUA 4O4IB 3W1WA 1EGHA 1F0YA 5J2UA 3INYA 3KKEA 721PA 4U7WA 2FPGA 4U7FA 1WQ3A 3OLCX 4XIGS 2W6ZA 2AWOA 1F7VA 1Q2UA 2CHVA 3O8BA 2A9KA 3WX0A 3HUDA 3I8OA 4IDOA 3MA0A 5K6AA 1UPAA 1PFQA 1NIJA 2BTOA 3ZHTA 4DIDA 2EP8A 2WJ6A 4HZUA 3W5DA 1YUNA 3HE3A 4C7XA 4TKMA 3A4LA 4Q3LA 4J0EA 1SU4A 3T3PB 1BCSA 3DWFA 1C0EA 2HFJA 2PL9A 4XCXA 3VPXA 4RETA 1RWBA 1HURA 4H59A 3NVMB 4X93A 1QG6A 3GCWA 2JLSA 3RRXA 3RC7A 4GUAA 5JS8A 1SKQA 3TQRA 1LZKA 1DC8A 3F96A 1I80A 4GL4A 2NTYC 4H16A 4GYJA 3A25A 4U02A 5AJYA 1UEJA 5C1BA 4EPXA 3BJRA 3V3TA 3CPSA 1JR2A 3OAAD 1TA9A 2GEVA 2R25B 3IHTA 3G5UA 4GXQA 2V1UA 2ZGVA 2LWIA 3LHIA 3OC0A 2NM0A 3SYNA 3ZY3A 5FPPA 2DKOA 4I6GA 4NMMA 1QHXA 1DHTA 1E3QA 3DOUA 3KYCA 1H1LA 4JI7B 2OP0A 4FBGA 4NJEA 1NVBA 1LI7A 3G8DA 4E5SA 1W0KA 2I7XA 2WJPA 1E2UA 2BHNA 4RMGA 1QM5A 1TK2A 2YWXA 4IDQA 1SU6A 4WGFA 1GGNA 4UEQA 1U2GA 4Y2GA 2Q5FA 5FOTA 2W70A 1J24A 3M9LA 1J2TA 2AK2A 1ETHA 4GIBA 2CLCX 4V0NA 3R7SA 3IT2A 3EXFB 1SCDA 2JGJA 4D79A 4V1CA 1M2FA 2ZYRA 2YS7A 5AM2A 1C9JA 3UWPA 4EPRA 5HMMA 4KXFB 3UBMA 2P75A 2IITA 1U1GA 2DBRA 4J29A 1JXQA 2W2KA 3FFTA 4NYJQ 1PNRA 1NXPA 3QIAA 4MB2A 3V7NA 1VJ5A 4N0DA 3ZK8A 2RHWA 2VYNA 5EJ7A 5LUAA 1MW8X 4BE7B 5SZJA 1GGMA 4HUTA 4YA6A 3THYA 2PSSA 4PXSA 2WM3A 3OPNA 4HRYA 3TQIA 1DUSA 3W1VA 3L79A 4RSMA 2ATEA 2RG7A 1YOVA 1HF3A 4LIPD 3C7CB 3ZYCA 1N2CB 5JZOA 1YMUA 5TMBA 5ADHA 4B3MB 4GP7A 2IYXA 3BFKA 5U1PA 5F3WB 5AW0A 2X3UA 2UZ4A 1ORIA 2X19A 2DUMA 4O29A 2YJGA 5JNRA 4F60A 3H75A 3WIVA 2D8MA 3CXRA 2NO4A 2JGRA 4MUGA 1RI1A 4YFYA 3ZH2A 3SIRA 1DCFA 1ZH2A 3IV6A 5G4KB 1U28A 4OJMX 2G0TA 2B9VA 2XUHA 1E63A 1F4LA 4I19A 2GJ9A 1V8OA 2JA1A 1NMYA 2C20A 4PS0A 4OHCA 1NBAA 3UMBA 3ZHQA 4EKGA 3CH4B 4EUSA 4Q6BA 3NH6A 4Z4CA 3T7IA 2QUJA 3UEOA 4NBRA 3DYBA 2PGNA 5I7WA 1MAHA 1NU6A 1Q0QA 1ZNQO 1IJKA 3RU7A 1OC2A 4BBZA 4EOGA 3KTAB 2EC5A 1RHRA 2D06A 3ND6A 4EGCB 2VKQA 1NLYA 1UC8A 2HPAA 2RC6A 3C70A 2CLFB 5EWLB 4XGNA 3AEKA 3ICPA 3O8OB 3ZWAA 1IJEA 5AOCA 3QQPA 2CXTA 1E1MA 2WD8A 2RGGA 2HLPA 1XZIA 4TQGA 5IAJA 1Z16A 4PY2A 1M2EA 3UATA 1CUAA 3SHQA 4IFEA 5KKCA 3QVTA 3E5HA 3ORYA 4LQCA 2FRDA 3NOQA 5LQSA 4FCVA 1V7QA 3ZNOA 1R4NA 4GI2A 4F3CA 2JVIA 3BAZA 4F1WA 2Q21A 2RD2A 6REQA 2F2TA 2G7MC 2F67A 3O75A 1L5GB 4DRXB 5E7JA 1EXMA 1XRRA 4JMPA 1PGPA 1Y5RA 3R2JA 3HXQA 3FD8A 1GT91 1LW6E 1TA4A 1L8QA 1E77A 1G41A 1MT0A 1QFSA 1WZIA 3MERA 4HBZA 4LUCA 4FZJA 2PXCA 4HXEB 4EHLA 3F7MA 1AHNA 1P44A 3INGA 3CRNA 3O4FA 4JBNA 1EH5A 1ZI8A 3PFGA 1I9GA 1KQOA 5C35A 3BULA 3KLMX 1QWSA 4KQKA 1I3MA 5EN4A 1D03A 1E96A 1XRNA 3THOA 2IIPA 3AI2A 4EY3A 1E64A 4YMVA 2O8BB 3P9ZA 3Q0EA 3WGOA 4CV1A 5J4HA 5DTRA 3BWXA 4BUZA 4ECEA 1R3UA 3O1JC 1YVPA 3CO0S 2VAPA 2GD1O 2IOHA 3EC2A 3L4BC 3MIZA 1OLXA 1TPYA 2IK8A 2QRLA 1J49A 2J9ZB 2ZRFA 3F6PA 3ZLTA 1BXRB 1L3IA 2YOGA 4OH1A 3JASA 3HA7A 4YAWA 2TSYB 3IEXA 1S3IA 4JI4B 4WTOA 1Y4ZA 4C6TA 1GZ5A 3UNXA 2VNJA 1UDRA 4EYEA 2WYWA 1K06A 4NYMQ 3LDFA 5IF3A 1J0DA 3C43A 4G8DA 1CYEA 2DR2A 2V6JA 2XB6A 4ALKA 2PCLA 3I8XA 3LLSA 4W1PA 2YDXA 4OMUA 3S2GA 3UJNA 4H7FA 1N7GA 4C4ZA 3M5WA 3LQQA 5BMVB 3E58A 3P27A 3STYA 3A11A 3OBBA 3MUFA 3IJRA 3DL7A 5I9TA 2OYSA 2AJCA 1REQA 3FTNA 1V6SA 4ZIRB 2Y1GA 2WG2A 4HGYA 3V8BA 3DMTC 3DBLA 3QOYA 1YSCA 3QA9A 2O2JA 4FNAA 1U4NA 3JATB 1ATZA 1JJAA 4BO8A 4MW6A 4BX2A 2ZWMA 3GLSA 4TTRA 2ADMA 1WKCA 4XPIA 1N1DA 3JVUA 3LJKA 4EHHA 4X44A 3CF4A 3ZX4A 3TZEA 4JP2A 1TIPA 1TU4A 1ZIOA 2XQKA 2ZU0C 4M6WB 4ACBA 4CODB 3W5BA 1WHTB 1V5EA 4ITUA 1WHSB 1J42A 2R97A 3L0OA 2W98A 1XKXA 4RVGA 2BEUB 4L74A 5DGIA 2V9ZA 1WDLA 4Y1FA 4BUCA 1UDBA 5JXJA 4CF7A 5IVHA 3T1OA 3GLGE 1LDGA 1ZUD1 5JCOA 2E87A 2ZE6A 2ZBFA 1XYYA 2BRUC 3NGLA 1GZ4A 3OE4A 4F3NA 4DUZB 4QWMA 1DJNA 2JAQA 3T3OA 1CUWA 2ZVPX 3MBKA 4KIUA 4J4BA 4DM4A 4Y6RA 4F56A 2BMDA 4ZZ0A 2I55A 4J9UE 4Q7KA 3B51X 1T2NA 3FIJA 1DQRA 1B8NA 1NMQA 1Y3CE 2ORVA 3AR7A 3QUTA 1EFKA 4HF7A 4UHBA 5AUQA 1R5JA 2IE8A 4N6OA 3WK9A 4R8SA 1WJGA 4BFCA 3V2GA 4UVEA 3B8HA 5FI5A 1THZA 3H05A 1OE0A 2I2AA 3HXOA 2WTBA 2JLXA 4G0VA 1FNSA 3AFIA 1G5PA 3V7UA 1P2TA 1QAOA 4B6FA 4QNMA 5TX7A 3SD7A 4C08A 2PRIA 4GI1A 1AQ6A 3QI7A 1G17A 5K3FA 4YRGA 2BSAA 3ADKA 3K15A 3KJXA 2YWRA 4OQZA 1MB2A 5FPHA 3RYIA 3WJ2A 2I4LA 2AXEA 1F12A 3AERB 2Q29A 1KI6B 2V7QA 2XRYA 2ZRHA 4GGOA 4REQA 2QRHA 3RIEA 3DVAA 4HQ0A 2GTIA 4CL3A 4BXOA 4WAUA 5FLYA 2QX4A 4CQMB 1MC8A 4WT7A 4W7IA 4FYXA 2II6A 4NBNA 1FSPA 3B9RA 2H4ZA 2MSNA 3KEQA 1WUIS 1U2DA 4KBYA 5AVJA 3IODA 1TVKA 3S2YA 1I2MA 1OYVA 3QUBA 2O1WA 5JVDB 5F2OA 4DFDA 2D2XA 3LHDA 5CYFA 1QZUA 5F73A 4IGFA 3L06A 3KFLA 2PANA 4YMGA 1SXJA 1OFUX 1E4EB 1HTBA 4KRXA 5LXTF 5A9RA 3E23A 3LYUA 1GSIA 3EIXA 1FK8A 4I9GA 4RXTA 4RYDA 4U5QA 4C03A 2ISQA 3V80A 5EKDA 1BA3A 1P2SA 5BUSA 3PGJA 4AULA 1OF1A 3GVPA 4QDUA 2QTGA 4MTLA 1FJ2A 1NG9A 3HU2A 3FNQA 1P4RA 5KWIA 3P9QA 1XCGB 3O47A 1FFYA 1TZBA 3KQOA 5JYCA 2A7XA 4KHPB 2I65A 2CKDA 3OJXA 1L6IA 5AVQA 4LHWA 1ORDA 1UXKA 1JTFA 3E1KA 1N1MA 1EQ2A 1Z82A 3UMFA 1YCFA 1P1JA 1P0MA 2YY7A 4GZMA 5DTEA 3SSAA 4B3IA 4L16A 1ZKDA 2YVKA 3H11A 2DWQA 5J63A 5CAEB 3VDRA 4F97A 1LI4A 5H16A 2VT7A 1V45E 5BPHA 2QKYA 2CGEA 1R74A 2V7WA 1ULZA 1B73A 1QOZA 4GSKA 1MP0A 3KE8A 1P4SA 1SD5A 4I8IA 3ZC3A 1AZWA 4YS6A 1U8YA 2GF0A 2ZVDA 4LC1A 4PCAA 1PGQA 2WU4A 4XD2A 3UUGA 4KFTA 2Z9CA 1GUAA 3DV0A 5K0ZA 4ND8B 4CCSA 4RV4A 4OJQA 1M66A 3U5TA 3Q2IA 2I80A 3MLEA 1OKKD 3ZHVA 4MMZB 4PS1A 4ZQGA 4QWWA 5A4JA 1GDHA 1MN6A 4DCUA 1FY2A 4RXUA 2BL4A 4FFPA 4JC4A 4NNJA 4RCZA 1OA1A 4B6EA 3RNOA 4QKQA 3CEMA 1UF9A 3JAKB 2QYSA 1MD9A 2QV0A 1J07A 3K5PA 5J40A 4I1UA 3GEIA 3TQSA 3O5AA 1SULA 3EGXA 3WJ7A 1NTRA 2ALJA 1T6NA 3NV9A 5FBWB 4BMOB 3TWOA 4LOHA 1Z7GA 5JH7B 2AEFA 4Q6WA 1AHHA 3PNVA 4PZ0A 4FU0A 5AWFC 3E22A 3BRWA 1QIGA 2CK3D 2Z1MA 3HNOA 1BS1A 1ZX1A 2JH8A 3PVSA 4X92A 1U1DA 1Z17A 4P84A 2KS6A 2X0DA 3GHHA 4EVRA 5HFAA 3EBPA 4K86A 1TC2A 1A71A 5BSTA 3SC2B 1O7JA 4M76B 4EDFA 5D84A 4DB2A 1UPUA 1XO1A 2BFPA 2V7PA 3CX7A 4G0MA 3VSEA 5G3YA 3L7DA 2EQ5A 5E95A 1RRMA 2JGMA 2TMYA 4IHJB 1NY6A 3VAZA 2VJQA 4WZBE 3AVPA 3EH2A 2X5OA 3R8XA 2P9HA 2GM3A 5D1HA 4WZ6A 2EEPA 4IEIA 4ZPXA 3RC8A 3EAGA 4X6UA 2V6IA 4RPCA 3NIWA 4QFDA 1J2RA 2L69A 3L4BA 4C4XA 1C3XA 2ET6A 2EHDA 3TKLA 4C87A 2CFTA 1PYOA 3CRVA 4UUNA 4HWOA 1HNXB 1NVAA 1OX4A 2MINB 1L7RA 1N25A 1GG8A 1I2ZA 4JJ4A 1C41A 3R75A 4B80A 1U7HA 1E1YA 2XMSA 3WRYA 4GYKA 1ZEJA 3ETJA 4CTOA 2R751 2DULA 4JI1B 1T9GS 4YMIA 4E0BA 1GEGA 1ULUA 3OEED 3UHFA 2FETA 4G5GA 4JVLA 1XVLA 3PNOA 2IZ5A 3PGMA 4KEAA 3NYWA 4Z9BA 2DLCX 1UKZA 3H2BA 5LDGA 5I7EA 2E4AA 3SMQA 1ZCAA 1D0SA 5HIMA 5JFOA 2B69A 3OZCA 1Y5IA 3DMTA 3BCSA 1N57A 1TU0A 1W85A 1XF1A 3GOHA 5G1PA 2ZJ6A 5A3SA 4YN3A 3S3TA 1EG7A 1UUFA 6CHYA 3F0TA 4EI7A 2FW0A 2HGSA 1J0EA 1BJKA 3AEUA 2B6NA 3KQWA 5LBUA 1TM7E 4NMHA 3QNUA 4MVJF 2G1KA 4AMBA 4EG1A 1PR4A 2HJRA 3UTDA 4HDOB 3WYBA 1XVAA 3RYFB 5JMTA 1K4YA 4H4CA 3SC4A 2PSEA 2QVYX 2XJ4A 2ON6A 4IDDA 2W8BA 3H13A 3G0CA 3LMKA 1N4DA 3G6KA 2IIVA 4QFCA 4YH1A 5EL0A 1JB9A 4RUKA 1RYMA 2A9OA 2FPLA 1DCTA 3U9LA 2CLKB 4PZUA 5IT5A 2Z8ZA 3IA7A 4N8DA 1A7UA 1NDUA 2QN1A 5T4BA 4BKPA 4EI9A 5EY5B 1MVLA 2MHCA 4MI6A 3IP1A 1TRKA 1HK7A 1K0FA 4J1SA 5DHRA 4L5IA 3WMFA 2RKOA 2NVBA 1RYDA 2PZBA 1AK9A 2CNOA 2HU5A 421PA 3HYCA 5FOQA 3OQMA 3A6HA 4UATA 4CHTA 5EJ5A 2P78A 3AVVA 3DCNA 4YALA 1JDNA 2AFRA 2YASA 3NIBA 5KPDA 1ID1A 4KO1S 2O2DA 2BMFA 2HDWA 1X7YA 3KT3A 3PF9A 4RK4A 4F9FA 1ELOA 3H42B 1D6NA 1JI3A 1FEZA 4A0RA 2P5YA 1YFZA 3EIUA 2EBFX 1QIEA 2CL7X 4F6RB 3PC8A 1GRNA 4FUTA 5KTOA 5L9AA 3Q9LA 2N46A 3RS9A 1Z7YA 3DEIA 4E11A 5KX5B 3VJLA 4YAUA 4EB3A 2E48A 4TL6A 2QSYA 1PEAA 4K9NA 1FSSA 4QTXA 1X7WB 2D1SA 2UVDA 3PICA 3DBOB 4HK4A 4LJYA 3QPDA 3SZOA 1D5CA 4JBYA 3PQEA 4L22A 2CY0A 1Z3CA 4KQ6A 4OEHA 4EB6B 3VR5H 2HZBA 2B35A 3GA7A 1NVXQ 3LRXA 3Q7EA 4UHEA 3EHDA 1AV7A 1PZHA 2AH5A 1GPYA 1TT5A 4JR2A 4U3JB 3WWPA 2H57A 5ELXA 2EW8A 4GNKA 1R6BX 2JIZD 3RWBA 1QR2A 1MRZA 5HKAA 2VTBA 4HVAA 1BH6A 2PCJA 4I2VA 4RY2A 4Z0HO 4F6RA 3LF1A 4UFNA 5IAEA 5LUBA 5HE8A 4RANA 2DHDA 1A95A 1K6JA 3JQAD 1Q1ZA 4P0PB 3AUKA 4TM8A 2PSDA 1OSNA 4CQLB 5AW5A 2OBBA 4NNOA 4NG5A 2WWIA 3TSYA 1ZA1A 2Z5FA 3M5PA 1WU8A 4RWZA 3MWGA 3QU4A 5TS3A 1IN1A 3WNQA 1W19A 2NAPA 1N9GB 1Q7GA 4LQDA 1DJPA 4MARA 3G0HA 1JIUA 2IOQA 4YECA 4ENPA 2ZPTX 3RFXA 1XJQA 2F1OA 1IWBB 3DHYA 4ZHQF 5CD1A 2I2BA 4MUXA 2PJRA 4KR3A 3ASUA 4ENSA 3OLQA 4PNZA 1RE1A 1UMKA 2EL9A 2QRMA 4PZYA 2PX2A 4MSUA 5B37A 4HDRB 3D43A 4OHUA 2VK4A 3ULKA 1DIAA 5KNLA 4H7EA 4GM4A 4DJFC 3CTMA 3PC4A 4NU0A 3T12A 1QOQB 1USKA 1TMGE 2ZU6A 4IQ8A 2I3DA 3BBPA 4RAOA 1PWZA 3OMLA 2XMZA 1IEWA 3SC6A 5IM4F 5JE8A 2FPRA 4ZDKA 4QOJA 1FL9A 2YJ3A 2DH6A 3IT0A 3DV2A 3OOEA 4FZ5A 4PM4A 3N5CA 2NMVA 1V3TA 3WMWA 1RRFA 1FDTA 1XZBA 5E2AA 1GPWB 3PFKA 1FNBA 3KQYA 4O59O 2MSKA 3OIWA 5AQ1A 1A1VA 2OL4A 2VDUE 4ETWA 2OO5A 1LPNA 4D1YA 1X15A 3C8UA 3QW4B 4RIEA 3NBQA 3ODPA 3OQNA 2ZYHA 4W5OA 1SCNE 4YMLA 4N40A 4ZI3A 1G6Q1 3X2SA 4EENA 1HEIA 5F33A 1UEIA 2OHOA 4Z4QA 3VKUA 1PKXA 4B7XA 4BNDA 4MR7A 2UZIR 3QPBA 3DWGA 2NNWB 4BPRA 5H70A 3ITKA 4GZ3A 4O2BF 3HFRA 4BXOB 4AW9A 2FY8A 3E15A 2AI3A 5K0JA 3IQDB 2SECE 1TDJA 1ZVMA 2R87A 3TXYA 1H2BA 4Z3KA 1PT7A 2PMFA 5ITZB 3EPLA 2PXXA 2Y4NA 2NYAA 3DQPA 2FP4B 3BERA 1J70A 4K81B 1D0IA 1VLLA 4Z4GA 2AN9A 3T7KA 2QE7D 4KR7A 1H05A 4YP1A 4OK6A 4CI0B 5ISMA 5JHGB 3VR4A 4UUMA 1GPLA 3OZWA 3I62A 4JT2A 4ZQFA 3CUSA 3UXEA 3W6UA 1IATA 3JWPA 4RVOA 5AVOA 4OU5A 4YBRA 1JXAA 2GO7A 2I03A 4I8DA 2D54A 4LGYA 3OOJA 3SQMA 3CZMA 4E12A 5BNWA 3PRJA 1I6WA 5KIAA 3PA6A 3ESQA 3RVJA 4ZQHA 4NE2A 1VI6A 4CMHA 3CNEA 4RVHA 2WJ3A 3OMXA 2YZMA 1UPTA 2NSYA 4S3MA 3WLFA 1YHZA 2WSIA 5C3MA 1Q3KA 2HBRA 5IKPA 5JCJD 1ESDA 2BZ1A 4IDFA 3UENA 1PFGA 3EPKA 1I01A 3JVDA 3RSOA 4J1TA 2X7HA 2Y3IA 3BSSA 3H18A 4KN6A 4WD3A 4AN1A 4HSEA 4U39A 3TLMA 3N53A 3ONFA 3DZCA 1CJCA 2CCKA 2Y92A 5CX1B 4B3HA 2XNDA 3NDIA 1SOVA 4IH9A 4WVLA 2GHTA 3K9FC 1XZNA 3KVRA 4IGEA 1WXWA 1T6BY 3CNLA 2QR3A 1R4MA 2HA4A 3EB9A 3I9KA 4UREA 5KYNA 4BY9E 1RFLA 5EUQB 1QRDA 2IYVA 1L8LA 1QVAA 3LT0A 4RKEA 1L8AA 5F2KA 3ZIAA 2KI5A 2R6GA 4GLOA 4FHCA 4HWGA 4QOHA 5U4XA 4E5NA 2QE6A 2IS6A 2PM8A 3UHJA 4DPMA 1PFKA 1P1RA 5DXAA 3TW8A 4AWXA 3FH0A 1V48A 1Z0IA 3CNQS 2XUDA 3PHCA 3R6WA 4IY1A 4N3NA 3EOZA 5AHXA 5IDYA 3PL5A 1V6CA 1NKTA 2QR2A 4FWIB 2H4JA 4PN3A 4OHYA 3K9LA 16PKA 4KYIB 2DCMA 1SMKA 4LYFA 1POWA 1O54A 4KQGA 4OQMA 4UMVA 4Y98A 1RLUA 3C7KA 4JSTA 4UHKA 1PJ8A 2IX9A 1SKBA 1U0GA 2PZ8A 5HZGA 2H54A 4DLNA 2HWUA 3O73A 5EJMA 1XYVA 4B17A 4C76A 3A9VA 3PYLA 2GD2A 1QDLB 9ABPA 2O8NA 2M2IA 2OGSA 3WK6A 1UWVA 3QHAA 2FGJA 1HDZA 3QLJA 1RLIA 2X4IA 3B5JA 2FH5B 1Z5UA 2VTDA 3E1SA 3K09C 3OA0A 4AUMA 4DDVA 3L0YA 1J56A 3GLTA 4YAEA 2WD9A 1LSSA 2GOYA 4LZNA 3S0JA 2C9BA 4QXAA 1DKQA 2REOA 3WYFA 3PEFA 3ZDBA 1GADO 2P2SA 4FKMA 4Y6PA 4YLGA 3RUAA 3A3PA 4JZYA 2VTBB 4IGKA 1HYEA 4UU0A 5LA6F 3ACBA 3LOPA 1VLJA 4F2DA 3L8HA 5JS6A 1A4UA 2OD7A 2F3RA 1LLFA 2P1ZA 3CVJA 2VHUA 3GT4A 5T3UA 3F8SA 3T54A 1V8DA 4A82A 3EW7A 3UGQA 2Q49A 3WLAA 4JWTA 4QXMA 1BFUA 2IC5A 1FDIA 1K4MA 2MR6A 3JYLA 1D6MA 1WVIA 4WESB 5DM4A 1KDVA 3O8QA 2QT1A 3NBUA 5D6NA 3FB1A 3P1JA 4AO6A 3W5SA 3GLFA 3GH3A 4RTQA 2Z56A 2NYVA 3CZ5A 4GNRA 3RR2A 1ZL2A 3HKCB 2IUTA 4QGGA 3U7EB 4HP8A 3H2SA 1U7DA 1MAUA 1L2TA 3DO5A 3WR5A 1SXJE 3BA6A 5BOVA 1YI1A 2DWUA 1U9JA 2CXHA 4GICA 2W00A 1QS0A 3MUOA 4WLNA 4XW2A 4XX0B 4DWJA 3IALA 2JLAA 3Q72A 1M0TA 2R86A 3VPGA 4AZWA 4H1TA 4QLOA 3UPDA 4C0JA 3DLTA 3W6PA 4U8GA 3FPHA 1Y9EA 4GXNA 3G2JA 4TYMA 2P2DA 4BO2A 4C4TA 1GM5A 3VJRA 5CYPA 3DZ8A 4U9HS 4WX2B 1U1FA 4CKYA 2CCJA 3C5VA 4KDEA 1WR8A 2WEKA 4DMUB 4EPWA 4YXFA 3A14A 2AG8A 2ZT7A 4BWVA 2JAXA 1QG0A 1UBLS 3QPAA 4MJ7A 2ZSHA 4IV8A 4ZKDA 4D8TA 2D4AA 4I1VA 4KVZA 2LUOA 5DHAA 4KGVA 3O8DA 4J2OA 4ZEVA 1BFKA 1XD8A 2CEKA 2HJGA 2YC2C 3G85A 3K6SB 4UU8A 3QEOA 1Y9ZA 5CFPA 2NACA 2X40A 3KEMA 4LSMA 3VYTB 1ILEA 1M6YA 2HU7A 2UXCB 4BO0A 3ZJTA 2HSGA 2WVJA 5ESWA 5JNVA 3ZH9B 1WIWA 1QO7A 1Y8CA 3B6MA 1U5BB 3N7UA 3BRQA 3PQ6A 4HMPA 4JBHA 3E48A 1ZGJA 3EULA 9GPBA 3IAS1 2QTCA 3UVEA 3GFBA 1TQDA 3CUWA 4LJAA 4LF9B 3IVCA 4OHRA 4BLSA 3RVLA 5EFZA 3HNPA 5HKLA 4NF2A 4EY6A 4B48A 3WKDA 1UMCA 4R1UA 4E2FA 5HK8A 1Q1GA 1C1DA 5LQUA 3FI0A 1JG1A 3LAWA 4EM6A 4H4DA 3N87A 3I6BA 1U3TA 3MILA 1Y6QA 3EEOA 2PVSA 4M55A 2V3WA 4LMAA 4M1WA 2GLUA 4XDYA 2FZ4A 4HDNA 1NN5A 2ZDGA 1WLYA 3GJRA 2XA2A 1TVMA 4YXWA 2R2AA 3AIIA 4ALIA 2W71A 3DXXA 4ZO9A 2J3KA 5HM6A 1Z3IX 2G67A 1ISPA 3EJWA 4BJ6A 5B4TA 1D2GA 3L8MA 1JIXA 2YWFA 1PYDA 3E7FA 2C7RA 5C2JB 5E3IA 1N9ZA 4ROSA 1AK1A 3TBKA 3LDHA 2QY6A 1ZZEA 3GQBA 3RS3A 1YWGO 3IAAA 2QRVA 3U40A 3QE3A 1SFRA 3FKJA 2YJ5A 2XEDA 3WQRA 4FX2A 1X42A 3TLGB 2V9CA 2QDXA 3PUIA 2QTZA 2WIGA 4PPNA 3FOEC 4LBYA 4HYTA 1SEPA 3WOHA 1QZZA 4U7JA 5DULA 5KTPA 3GRRA 2J5KA 1KJIA 1ZQ1A 2QU7A 3L7KA 3O91A 3U60B 1YMQA 1UJCA 2E82A 4NIMA 3T41A 1QHYA 4EEZA 5JS2A 4E4YA 5LOVB 1TIBA 1JHQA 3PITA 4OLFA 2C99A 3A3KA 2Q5OA 3NT4A 3PXUA 2MJLA 1P5JA 2IUFA 4ER6A 2I99A 1B00A 1MC4A 1MVOA 4WQMA 3UV7A 3TGPA 4R16A 4QBHA 1A77A 1E1KA 1ODCA 4I55F 2GFQA 3RFUA 3NRCA 4CF6A 1B6TA 3VNQA 3HI4A 4GC9A 5L3QB 4C7OB 2B5WA 2C61A 4KPYA 2ACVA 1IN7A 2NXCA 1ZK4A 3A05A 1H3NA 3GEBA 3STUA 1I2CA 3BH6A 3JAWB 2I1WA 2V96A 1ONNA 5IAGA 4HQ6A 1L5LA 5BN4A 3ND8A 4G9BA 1P91A 2QPAA 1D1TA 2IYOA 2XZDA 1USUA 4IJMA 4P5PA 3R5XA 3GJ3A 4DRZA 4FD2A 5AK4A 3OF5A 1NW4A 4POOA 4KE7A 4NU8X 1PP4A 6ADHA 3A26A 4X24A 2OCPA 1BDMA 3CUYA 2IL1A 4L95C 1U0LA 1CNEA 3CEPB 5AKYA 3TRJA 4HNRA 1JEQA 4X3PA 3H6GA 4HC4A 4EECA 2QMYA 2PLNA 1S89A 1T26A 2VHQA 4IWXA 4BN4A 1QQAA 1GHTA 1X19A 2HA7A 3ETEA 2HA5A 3U6KA 3G2LA 3TFQA 2A30A 5DN6A 2G7ZA 1QG2A 1DC4A 5HBRA 1C1XB 1VM6A 1JKMA 1Y9DA 3GH1A 1PUIA 1NOJA 1W49A 3A9RA 2BHLA 1W59A 2GO1A 3KFXA 3QVGB 3QYPA 4AO8A 2A3NA 5AOVA 3OSUA 3QBJA 4Y8VA 3ZGOA 1SZDA 1P75A 1XLTC 4DIEA 5H4GA 4D9JA 1E5TA 5GJCA 3VH3A 2BLLA 2VUHB 1KZGB 1F2TA 3K09A 4IS3A 4UOQA 4JXKA 4L8FA 1G6HA 4MLCA 1XTSA 3LC1O 3NIFB 3IR5A 1PBTA 3A1VA 1IVNA 5GP1A 3PD7A 1OH7A 3A6LA 2QVBA 4J7AA 5BRAA 1NN0A 3DAPA 2XYRA 4ANFA 5C1OA 3GLIB 4CMIB 3DEZA 4Y1EA 3OI7A 1EJ6A 4RPJA 1JDUA 1NQTA 1TTPB 2HXYA 2Q0HA 2YUTA 3TAUA 4A1OA 2J4FA 2ZRQA 4HS4A 3BAFA 4JOBA 4U2BA 5HF6A 1ZBDA 3NDBB 1XKTA 3GZTB 2V0NA 2Z2KA 4W99A 3MJSA 4OGKA 2DQSA 3DE7X 2W2TA 3I3OA 1WXEA 1Q95A 4QSMA 2HPVA 5GOTA 2IH4A 1P0PA 1P1FA 2CYAA 1U3UA 2O5RA 2WM9B 1SQSA 5IVPA 2W8ZA 4NQRA 2ADFA 4LOJA 2GJKA 3U3RA 5SZHB 1FXWF 1HE1C 1T9DA 2YHIA 3QU2A 5HIKA 2J41A 2NYRA 3SE0A 1VGVA 1T4GA 4LV6A 3FLMA 2R4QA 4YJ3A 4ERXA 2OY0A 1D0VA 1P19A 2FSSA 1XPJA 3IELA 4TTQA 7GPBA 2H9YA 2XMCA 1MGPA 2GJ4A 1KAMA 5ALHA 2F3UA 3GD7A 4R2JA 2J48A 3LTEA 4CCYB 1JFSA 5A5DA 3C5HA 3FUCA 5J4VA 2R00C 3F5SA 3JARA 4GKBA 2COEA 2NU6B 2MCFA 3SHTA 4O4LF 5JSZA 2QAGB 5KBYA 3R3YA 1EE9A 1W0KD 3OTQA 2QUAA 1RU3A 1O58A 4QDKA 3C8HA 4LDAA 1YFLA 3C48A 5IJWA 3MS4A 2PUHA 1XDSA 1EXNA 3EGWA 4BX3A 1QANA 3IIMA 1T2CA 3N8NA 4EPTA 1F5NA 4RABA 2J33A 5DGXA 5EOVA 5FBRB 2BGGA 3NHFA 2F55A 1KVTA 2GN2A 5HR5A 2I7CA 4Y6QA 1FFSA 1E3SA 3P5BA 3GGGA 4DGQA 3G5MA 3AVWA 1GO2A 3LQKA 1JJFA 2KX7A 2VJLA 3V7WA 1PG5A 3LC7O 2EYQA 1UBCA 4L4XA 5THXA 4EL0A 1CQJB 4PAGA 1HKUA 2PUWA 1GCIA 1CZOA 1FQKA 1ZDMA 2PL3A 2VYND 2VZEA 1YJ8A 2JFFA 2WJJA 1TYCA 1JP7A 2H2WA 1RPTA 3H8SA 3MQ4A 4BQIA 3IAS6 5HDBB 3M0EA 3QFCA 4P5EA 1FZTA 1ZLYA 3QJYA 5HZHA 3O6VA 1XJ0A 2E9SA 1R4ZA 2Q7XA 3QUAA 4M8SA 4R84A 4EG3A 1NPYA 1UPFA 2W37A 2GXQA 1BKSB 3LG2A 5EP4A 1YA8A 4BL5A 1LBSA 2WF7A 5TLSA 3H1GA 3TUIC 4DMMA 1DVRA 1PG2A 4PG6A 4W6ZA 5CTJA 4V3BA 4ZEMA 1Z35A 1AXGA 2PSJA 3HI6A 2PUCA 3P2YA 4D3SA 4G1VA 1GEEA 3ZJ5A 3L07A 1T0UA 3AESA 4QJ4A 2VK2A 3KVOA 1I36A 4IDEA 4DG5A 4TMVA 1DTSA 2MYPA 3QTTA 1P62B 3BZUA 4I3GA 1DPGA 2IEYA 4KV9A 2EJBA 2F1HA 1L5FA 2WKRA 4IZOA 4XCVA 1PN3A 1K68A 1AUXA 4BBAA 1W36C 3Q0TA 1H2XA 4FYKA 1VDMA 3B1FA 3RTDA 1SCUA 5KYYA 1SRRA 4UTXA 1PNOA 4YASA 2IUEA 1JT2A 3WKBA 1QRTA 1RBZA 2I7DA 2YVLA 3D7SA 3FGZA 4TV9B 3TLJA 5AIAA 3ZQKA 4DNXA 5A4DA 1CEEA 1DINA 2IPXA 3GRUA 3KL4A 3NMUF 1E3DA 1CLEA 2R7AA 4WUTA 2DTXA 2BUCA 3DT8A 4Z53A 2DPXA 4FMBB 1MQSA 1EE2A 3R8FA 2G5PA 1YQGA 3JD1A 4GLBA 1Z68A 3QWBA 1MB3A 4L4ZA 3KXDA 4B2PA 2HIAA 4BCBA 3OU2A 2ST1A 4MS4B 3TCNA 1NXOA 2C2GA 3MINA 1PZNA 2TMKA 1EPUA 1WULS 2Y99A 4IXTA 4I50F 3KCNA 1FP2A 3DZIA 3IVXA 2BKUA 5FWXB 4GDFA 1MAWA 1P2BA 1G8SA 4IZIA 3RVNA 2R8PA 1Z34A 1JHYA 1LDBA 4ZU6X 4BLOA 2NU8A 1RXVA 4TS1A 1R6DA 4GOKA 1T0HB 4MUFA 3D8NA 5DLDA 3GXOA 2W2QA 5IH3A 2DXIA 1LY1A 3SSOA 3AEYA 4IIEA 1ZJJA 2IT1A 2NPIA 2MMGA 4RD3A 4M87A 3I39X 3MF4A 2AC7A 1MIOB 5GMOA 3I4FA 1WXHA 4XQEA 3FMOB 4RQUA 2O20A 1YAJA 1BQEA 2NUPA 1PV1A 1DS6A 1KI9A 4WINA 1GXSA 4CDNA 2IEIA 1ZH4A 3VAYA 4N9QA 3B82A 3F46A 3PIDA 2P11A 4ZJUA 5JXHA 4MQFA 3GP5A 3M5CA 1EFRA 4G9GA 3IAM6 3BT7A 2DM6A 2GXSA 2QP4A 4N1AA 5EIBD 3Q1LA 4KQIA 4EKNB 1OFIA 2B4RO 2WPNA 3ZU3A 4NFHA 5EIEA 1ZC3A 1X0VA 3HU1A 4QEZA 1C3LA 4ESHA 2AS0A 1R16A 5EMJA 1JBQA 3LXMA 2Z1NA 3F6CA 4MULA 1E89A 1Y89A 3MSXA 3TDNA 2NG1A 1XLTA 2JFQA 4F91B 2UZ3A 2P4SA 1I1OA 1ORTA 3GY0A 2Z5VA 5FBKA 3TL3A 1FNCA 1VFNA 1KOFA 3DOHA 3HJRA 1QF6A 4P86A 5DN9A 1HEYA 2HIHA 1BQ4A 2CL6X 1U9IC 5KTNA 1ULBA 2PGOA 3NBMA 3FYDA 4D57A 3Q3CA 4KQXA 2IQIA 4IX9A 3EXG1 4Q7MB 1MG5A 5H3HA 3GLFE 1UOOA 4JI8B 2WSYB 5DBFA 1SUDA 4BLWA 2EYUA 3ZHBA 3C8DA 2IHNA 1AGPA 1QH9A 5MN6A 4IXMA 4EHJA 2GTPA 2P4UA 2OCLA 1UWLA 3PQ2A 4JNKA 1UAGA 4G0NA 1D2CA 2LZ0A 5DTMA 2GFIA 1Y48E 3D6HA 3E5RA 3MSCA 4L15A 1W0JA 4BWFB 4GSLA 4CLXA 2W6NA 3TTXA 2GLXA 5C8YA 4OHKA 2QGNA 1O0SA 2NOAA 4J07A 4Z0TA 5FPKA 3UMYA 4MV3A 3K0EA 4DXAA 3MJCA 4EG6A 3TKAA 4YJKA 1DUVG 4XAQA 3L40A 2FRXA 1T0PA 4AUEA 2R1ZA 1VSVA 4I5GA 2QD2A 4P31A 3WIBA 1FJXA 2DFKB 2I6FA 4NATA 1AUOA 2OCAA 1EK1A 2V7QD 4UM9B 1ORVA 4ALLA 4ZYZA 2CFOA 2XNSA 1D5WA 5KTRA 2ODTX 4A0FA 1N77A 2COKA 1L4LA 3AETA 2QTNA 1BKDR 2QJWA 3DDSA 2YICA 3GJ0A 5A0VA 3A9SA 3O84A 1PU2A 1Y6GA 3C3YA 4PXAA 2WHPB 2EDCA 3P71T 1BMFA 4R69A 5A06A 2XGSA 3MGBA 3LI2A 1G21A 2REQA 2Y2VA 5CFQA 3NUGA 1T6XA 2AIRA 1UZAA 3UXHA 1I4OA 2HHCA 4QHSA 1SXJD 4PVDA 3OOYA 4PLVA 2DTEA 3UJ6A 1TM1E 2FOXA 2ZAMA 4BFZA 3O92A 5BVGB 2I4IA 3X1XA 1U31A 1TA0A 2C58A 4YRFA 3S2FA 2OOSA 4L57A 1VJCA 2UAGA 4WCFC 2J9FA 3VR0A 3LP6A 1JAIA 1VSTA 3ND9A 1WBDA 3CH5A 2J3EA 2VOJA 5KMGA 3FLBA 4J7UA 2BUAA 1U0FA 5EXXA 3TRHA 1ADGA 3MUNA 5EJ9A 1TM4E 1DXQA 2GRUA 5KYTA 2PZKA 3ITEA 5HW0A 2NAFA 2R6DA 1J8FA 1EVQA 2PLWA 1DKOA 1ND5A 2Q2WA 1GQQA 3WK4A 3GWGA 4JLMA 4LZJA 4X85A 1DAMA 2X4GA 3MWLA 2AG1A 1T24A 3OKAA 2JJMA 1WZUA 2OGUA 3KYDA 4WNCA 2WAXA 1RR6A 3JU3A 4BFTA 1DIHA 4LVUA 4HTFB 4IGIA 4URHA 5CMLA 2ZB3A 2QHXA 3GDFA 5E4JA 1OH8A 2O2XA 2ODQA 1FMCA 1EK6A 1YJQA 2QUHA 2YXPX 2HV9A 2BBWA 2PX4A 3IKMB 2ID9A 4PSCA 5TQ2A 5JXGA 2R65A 1E94E 1T9KA 3OO0A 3SSMA 3U56A 4BTEA 4GW3A 2FHPA 1ZJ5A 1ENPA 1W5AA 2QRQA 3STTA 4B3SB 9LDBA 2RG1A 1BGWA 3TNJA 3DMRA 3FCXA 4I3FA 5DZSA 3BWEA 5DM2A 3VM6A 1H0RA 3I30X 1ULHA 3ZYZA 4DKJA 4B31A 1S7CA 2DETA 2I7TA 1I2AA 1KEWA 3QVWA 1TGYA 2RFLA 1BDJA 5BSFA 1GL7A 1CR0A 4Q3CA 4QICA 3FTQA 1CDZA 1XDGA 2OAQ1 3EDOA 4NYIR