1X7DA

Crystal structure analysis of ornithine cyclodeaminase complexed with nad and ornithine to 1.6 angstroms
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
340
Chain Sequence
TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
molecule keywords ornithine cyclodeaminase
total genus 112
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1x7dA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x7dA02
3N58A 2W2LD 4B8WA 1M76A 2J3HA 1UDAA 1LLQA 1X1TA 1LQTA 3PJGA 1WP4A 2GR9A 3M2TA 4ILKA 4DPLA 2VUUA 2GN8A 4MVJM 3SEFA 3GPIA 3I9KA 3QVSA 4AJ1A 5A05A 2AQKA 2YHUA 4BKPA 5AOVA 3U4CA 3PHJA 2DKNA 2ZYAA 4LVUA 3VTZA 4C7JA 2NTNA 2ZB8A 2CDCA 3WGZA 1NTOA 1H94A 4J0FA 5JCJA 1E5LA 1N8KA 1GYPA 4J9VA 3S55A 2DBRA 3NT2A 4IY1A 4JJIA 4BO2A 2FWMX 3DQPA 3ON5A 1IOLA 4NU5A 4JNKA 4CJXA 3W6ZA 4TKMA 4WK6A 4IXWA 1NNUA 2DAPA 3ZV3A 1GUZA 1I30A 3MEQA 3LU1A 2G82A 4YDRA 1IULA 1KERA 2D0IA 2I99A 1YBAA 2Y1FA 4BNKA 1YDEA 1P31A 4RDIA 1TVEA 5TIIA 4OGWA 3I9LA 2IODA 4MKRA 1NWCA 2R00A 4XYBA 4ZQEA 1PL8A 2IZ0A 2Y0EA 3AY7A 4YVFA 4FSHA 2C54A 3ROMA 1MV8A 4UEJA 1ZIDA 1I2ZA 3CXRA 4P38A 4DQVA 3IIEA 2O23A 2HJRA 1D3AA 3HQ4O 5FI5A 2AQHA 2O3JA 1LRKA 3DHYA 2I9PA 3G17A 2B0JA 5TT1A 3GFBA 1LNQA 3QQPA 1A5ZA 2JCVA 3HE3A 5I9MA 1GV1A 4WECA 1E7QA 4ROSA 2PKQP 1JN0A 4RVHA 1LLDA 1T1RA 1U3TA 3BXXA 4M89A 5JS6A 5HTOA 3H9GA 2BFAA 2QRJA 4IINA 3TSCA 3FBTA 3PHHA 1PR9A 2OBYA 4DIOA 4YXFA 3FF4A 3OIDA 4YEDA 3KVOA 3KSUA 1C1DB 5I8WA 3Q2IA 4FC7A 5CEJA 2Q1UA 1R15A 4NNJA 4BKQA 2NQ8A 3ONFA 3BTUA 4CM9D 1MGOA 2G1UA 3JQAA 4RVDA 1ZXLA 1L1FA 3W8DA 3QVTA 1PJQA 1YKFA 5IZ4A 4AG3A 4GWKA 4TSKA 3ZW9A 4BO7A 1HDZA 1ZK2A 1EBFA 4IDGA 1RPNA 4NK5A 3VPFA 4AJKA 2VHYA 1Y8QA 3BMCB 4LRSB 2Q2QA 2CVOA 1YL5A 3L6OO 4BO8A 2YZ7A 2DQ4A 1Y1PA 3BHJA 3KV3O 3QLJA 4Y98A 5COAA 1RWBA 1BGVA 1QXSA 2CF5A 3ZCXA 3UCFA 2PGDA 3L0DA 3F5QA 3AOEA 4BO0A 5ER9A 4NH4A 3GEGA 4J7UA 2EW8A 3AFNA 1ISIA 3HFGA 5I9NA 4JROA 3OMLA 1YWGO 2OXIA 3FSRA 3KXDA 3DMTC 1RM0A 1DHRA 5B12A 4K6FA 4EJMA 1NPTO 5TT0A 4RPJA 3OA2A 4NFHA 3ROQA 3EGOA 2PZMA 4IDFA 3RUEA 4G5HA 3IS3A 3WFJA 3LT2A 4M54A 1I8TA 3OH8A 3PPIA 5K6AC 3LF2A 4H15A 3VZSA 1DC3A 4CUZA 3DDNA 1W73A 3AI3A 3IKVA 3GNQA 1GCOA 3ZU5A 1E1NA 1LDBA 4MDHA 4ALLA 2JCYA 3QIVA 3K2BA 4PVCA 5LDGA 3MJ4A 3U9LA 4D42A 5A5FA 1XGKA 2I67A 4GVLA 4FJ1A 4R3WA 5COBA 4I9NA 5LCXA 3F1LA 4IDBA 1B0AA 2X58A 3FPLA 1ENPA 1GDHA 2QQ5A 4BNGA 4CQMD 2H9IA 4BNIA 2YV3A 4CV2A 1GAEO 1Q2XA 3KB6A 2PKQO 3VPHA 4EEXA 3JD0A 3OIGA 4MOWA 1VPDA 3KETA 3QVOA 5F1PA 1EK5A 1YL6A 3UH1A 1A71A 4G65A 5A03A 5L53A 1EDZA 2W4QA 3WJAA 6ADHA 4Q39A 1NPDA 4MP8A 1LRJA 3JQ7A 1XKQA 1XQ6A 1V3VA 1SOVA 4YJFB 1ZO8A 2I76A 2O3TA 5I7FA 3NV9A 1EE2A 2O7QA 4U0KA 4DXHA 5KOIA 5ITWA 1R6DA 3UAGA 3QV1A 2Y1CA 4EZBA 1E3LA 3I1JA 3MJCA 1YVEI 3LT1A 4QUKA 1UZNA 3A14A 2NNLD 4BB6A 5JSFA 2CDAA 4L75A 1I3MA 1QYVA 1B8VA 1AUPA 5TJ9A 4J1QA 4DREA 5T5QA 1QYDA 2DT5A 3D0OA 4XRGA 1XSEA 1KC3A 2O3QA 2JCXA 3TNLA 1PQWA 1DRWA 1UDBA 4FN4A 3RVDA 3FBGA 1SPXA 1GY8A 1P74A 4OKNA 1JAXA 1PJ3A 3JQAD 2VUTA 1BXZA 1XHLA 2DUWA 1RM3A 3M2PA 5T6BA 5L95A 4CMJA 4JCOA 5DBIA 5A06A 2EKLA 4RVFA 3T4EA 4J2OA 1BG6A 3DAFA 5TRTA 4BV9A 3RCBA 4BNMA 2QX7A 4G81A 3GUCA 2WWRA 3DFUA 3ZNPA 1WPQA 5ADHA 3M6IA 4INAA 3FN4A 1P45A 5GZ6A 4CLOB 1WWKA 1CEQA 1YBVA 2DBVO 2EV9A 3KZVA 1PX0A 2IXAA 4I8XA 1NFFA 3DBRA 1LJ8A 3WIEA 1NYTA 4EI2A 3TZKA 1VL0A 3KSZO 4ZA2A 3O26A 1LSJA 3DBRB 5IJZA 1YGYA 1Z82A 2GSDA 1DSSG 2IEDA 1ORRA 3AUUA 3I9OA 4MO2A 1CERA 4BNUA 1NR1A 1L7DA 2UUOA 7MDHA 3L9XA 1G0OA 1UZLA 4WLOA 3B6ZA 2GUGA 2Q2VA 4JLWA 4W6ZA 3WMWA 3GOHA 3RBVA 4F46A 1PWXA 2BGMA 2Q45A 3ONEA 3DHEA 5A9SA 1WW8A 1BMDA 2NWQA 2IZ1A 1CJCA 4PG6A 2VHVA 2VUSA 3JQGB 4RF5A 2BLLA 4PLZA 1SO8A 3PIDA 4GSKA 2ZTUA 1UXGA 2BMAA 5IDQA 3A9WA 4CQMB 3JQAB 3FWZA 4Y67A 3GZNA 5JXWA 4ZN6A 1I0ZA 3KYCB 4PG4A 3GQVA 4J90A 1P77A 1P9LA 4EUFA 3OF2A 5IDXA 5ENDA 1JU9A 1EMDA 4CMAA 4EJ6A 1PGPA 5T64A 5JDCC 1MX3A 2CFCA 1XA0A 2NLOA 1RM5A 4ND3A 4RPHA 3UCXA 3CSDA 4YPOA 8LDHA 3R3SA 3AW9A 4XQEA 4PVDA 2GN4A 1ZEMA 4ZGWA 1UP4A 3E9MA 4I1IA 5LDHA 3ZU4A 3PYMA 1EFLA 4LSMA 3DZJA 3JCZA 4YJDA 5G2OA 4OH1A 2HQ1A 4E2ZA 3Q11A 4II3A 2I66A 3FNFA 5BSFA 3EDMA 4HADA 1PGOA 2ZCUA 4IDEA 3W4JA 2WE8A 4B4VA 4HY3A 4WCFC 5BR7A 1QR6A 2FPGA 4ZVVA 2GN6A 1E1LA 3ICPA 3R0IA 4FIZA 2O4CA 5KTKA 3KO8A 4QX6A 2FR0A 3O8QB 3B1FA 3DHNA 3PWKA 3AUTA 2WMDA 1C1XA 3HDYA 5IG2A 4NJMB 2E4AA 4IS2A 1ZFNA 5ILGA 3S1LA 4DC1A 3RWBA 2QZ9A 3OEWA 2ZYDA 4L4SA 3D5TA 1YE3A 4XJTA 1HSZA 3L07A 3JTMA 4A03A 4GGPA 1UZMA 3AFMA 2NVWA 2RBEA 4Y6PA 3T7CA 1M67A 5T8KA 2C5EA 1NQ5A 2GRAA 5FI3A 1IPFA 4CM4B 2LDBA 1U2DA 3GPDG 5GMOA 3W8EA 4NG5A 4PLFA 4MIYA 4YAIA 2POQX 1KVQA 4BNYA 3NTOA 5A3JA 4YJHB 5L7YA 4HV4A 5B37A 1ULSA 2VZ8A 3VH4A 4I5DA 2E37A 3WYBA 3DFZA 1E77A 1L7EA 3I6QA 4HX5A 4FGWA 3MWEB 2RCYA 4XWYA 3GG9A 4TRRA 2P68A 4GAEA 4NR0A 3PRJA 2B69A 3L4BC 1PEDA 5I7VA 2JFHA 4RZIA 1VJTA 1F12A 2PA3A 1WXDA 1HDOA 1M66A 1YL7A 4HFRA 3VZQA 1C0IA 4ALIA 3NDJA 1T25A 4PIVA 5L9AA 4H3VA 4IXTA 4JQCA 1ARZA 4GX2A 4I08A 1NQOA 1A7KA 4N5NA 3ENNA 4E5MA 3RC7A 3CH6A 3GFGA 4CL3A 4UUMA 2ZQZA 2X1HA 3WNVA 2IEBA 3LSYA 3FTNA 3GT0A 2G17A 3I83A 4AICA 4GL4A 1U7TA 3B1KA 3U4DA 2D1YA 3CPSA 3LZ6A 3IP1A 1HRDA 1PJBA 2IRWA 2P4HX 2ZQYA 2AEFA 4EJ0A 3GC6A 3QVWA 4B7CA 1ZH8A 1WMBA 3GVXA 3JQBC 1LSSA 5TSDA 5DDIP 3TZQA 3UVEA 5JAIA 1UDCA 2B4TO 5MDHA 3VDQA 1AN9A 3ZHXA 4BO4A 2AEMA 4BO1A 2EGHA 5L45A 1ID1A 1RM4A 3FR7A 2RH4A 1T2EA 4CM3A 4WNIA 1HETA 2NVUB 2AE2A 5AXAA 3HNPA 2FHSA 3FR8A 4XGKA 4MVJP 1HE4A 2XPCA 1ENZA 3PTZA 1V8BA 3DEYX 4EBFA 4L4RA 4Z9FA 2VNAA 1VLLA 2QIOA 4ND5A 3VH1A 5KJ6A 3GN1A 3PK0A 4RF3A 5CDYA 3E9NA 4CM6A 4IDCA 3LT0A 4O59O 1ZJYA 3NRCA 4J3FA 4BGIA 5H82A 3NT4A 5C3MA 2Z95A 2P2SA 3GZNB 1NQTA 1Y6JA 4D41A 3RC2A 4WASA 2C82A 1MLDA 1I36A 3K96A 2GYYA 5TGDA 3NTQA 3F3SA 3KEQA 1BW9A 4J7XA 2E48A 4UEKA 1LTHR 4MKZA 4WCDA 4PLVA 5EINA 3HN2A 2PZKA 2G5CA 4LRTB 2NU6A 3WQSB 3WX0A 1WMAA 4L0QA 1HZJA 5JLAA 2NACA 3JD3A 3F9IA 1CYDA 3ZWNA 5FEUA 3I4FA 3ZWMA 3F6YA 1ZSYA 5THKA 3QRWA 2JJYA 3WWZA 1T2DA 4E31A 5DBGA 4RF2A 2WYWA 4PLWA 3VPGA 3WJ7A 1PZEA 5G4KA 3DC2A 3U4IA 5JAZA 5BT9A 5ILOA 1V6AA 2OORA 3PHIA 2E82A 2J3JA 1ZMOA 3NEPX 4DPMA 3E18A 3GHYA 3OEYA 1OOEA 1PJTA 4R9RA 4XR4A 4ID9A 4YB8A 4KOAA 1NPYA 2YV1A 1Z74A 2TMGA 1HYGA 3OJ0A 3GUYA 3PDUA 3QJ5A 3MCVA 4CLRA 4BKRA 3C3XA 4P4LA 3L77A 2YDXA 3BIOA 1GFSA 1KVRA 4BQRA 1TA4A 1QG6A 1E6WA 2ZCVA 5G0TA 1NVMB 1E5QA 2EHDA 2X7HA 1Y9EA 2Q3EA 4KP7A 4B79A 4A7PA 1DEHA 1ZSNA 5GZ3A 3KYCA 1CIVA 2JHFA 2JKVA 5DCUA 1M6WA 3KOUA 3PGJA 3A06A 5B1YA 1DIGA 1OZAA 2Y99A 2Q46A 2DFVA 3IP3A 1HDCA 4YQYA 5DBFA 3D4NA 4KUHA 5F5LA 3RQSA 4CQLA 4PLPA 1P1FA 2EP7A 2VQ3A 4FC6A 3VAZA 3C7AA 4CV3A 3U4HA 1N92A 2P9GA 3KEOA 5FYDA 2IYOA 3WGGA 3ICCA 3N74A 1ONOA 1GZ3A 3K9QO 4ZRNA 3GGPA 4YAEA 3UGKA 1C0KA 5DCWA 2GNAA 1ENOA 1PS0A 3O4RA 5TF4A 4E6PA 1B3RA 1R4NB 4AJIA 1DBVO 4BNWA 3ASVA 3AK4A 1QMGA 1DJQA 1NHWA 1FMCA 2W8ZA 1TT5B 5DN9A 2PLAA 2X23A 4CM1A 3KYDA 2C29D 4XB1A 2X4GA 2JFGA 4PLCA 1UAGA 3F47A 3VH3A 1QYXA 4Z3DA 3ZU2A 4PLTA 3V1UA 3MJSA 3IAHA 4XKJA 5EESA 1YDWA 4WOKA 2Y93A 3R6DA 3PHLA 1OAAA 9LDTA 4J0EA 2X5OA 3MTGA 3OFSA 5JO9A 3WGQA 4W82A 4N54A 1LSOA 4BL5A 2NSDA 4XGIA 4CMEA 3P7MA 4MVJG 4D0SA 3OHSX 3RBZA 3H65A 5EJ2A 2EJVA 2Y1EA 1HDGO 4XGNA 1ISFA 2P91A 4EITA 2B5WA 1FK8A 2QW8A 1VKOA 1IL0A 4BO5A 2JAHA 5ICMA 3PEFA 1KVUA 2JL1A 3H2SA 3H5NA 1D4FA 4XDZA 3MOIA 2GASA 2OOSA 1DB3A 4S3MA 4JXKA 1DIAA 1M6HA 4KZPA 3QWAA 1XQ1A 4P22A 4WLEA 1B14A 3TJRA 3QVXA 1VM6A 1XYGA 1FDWA 3OJEA 4E21A 3OJOA 2W2KA 4IJKA 4XYGA 1LA2A 3KYBA 1P1IA 2J3KA 1PJCA 3A4VA 3ITKA 3U49A 1ISJA 1E7WA 4TQGA 2OGUA 1AHIA 4QFCA 3UF0A 5DOZA 1JVSA 1K89A 1LLUA 1EZ4A 2UUPA 4FJ0A 3JD1A 4K1LA 3E48A 1YBMA 3MZ0A 3FNGA 3EHEA 3NX4A 3K92A 4CQLB 1H9BA 1DXYA 3OQ1A 4GI2A 4FGSA 4J91A 4I9HA 3G49A 1JKIA 1F8FA 4IIVA 3NGXA 4QTZA 4BMVA 1B7GO 4JGBA 1TEHA 3ETDA 4AJ4A 4EYEA 5CDTA 1I32A 5JYDA 4ZRMA 3GH3A 4MVJI 3ZWVA 4BNZA 3AJRA 2ZK7A 2XF8A 4II2A 2VTDA 5I7EA 1E92A 1PSDA 1VSUA 3M1AA 4Z0HO 1Z75A 2EEZA 1C3VA 3QP9A 1I3NA 2RAFA 5JDIC 3KUXA 1HDXA 2HU2A 1NFQA 5JCXA 1IYZA 2FSVA 1MP0A 2DPHA 2NVUA 3DBLB 5KVSA 2O3RA 2AG5A 4BMNA 3C8MA 3AI2A 3BYZA 3H3JA 4UVGA 4DMMA 1PJSA 1IZ0A 1NFRA 1SC6A 1T26A 1SNYA 4OQYA 3RKUA 1YOVB 2BD0A 3GMDA 3ZGYA 1YB5A 3V2GA 2BH9A 2GGSA 4BUCA 2NQTA 3UCEA 1U9JA 3DZHA 5A9TA 3GVHA 2X9NA 4OJNA 5FF9A 4M86A 4M49A 4OMUA 4W7HA 4CLEA 2O3SA 4K26A 5TC4A 2VNSA 4B7UA 2EJWA 1DLIA 2HCTA 3BMCA 5IFLA 3AUAA 1H6DA 1MXFA 1ZVMA 1BW9B 2FZEA 1ZK4A 5HM8A 3ETGA 2BI8A 1U3WA 4CM5A 3NUGA 3HG7A 3QWFA 4W9NC 2Z1NA 2OBNA 4GPD1 3G1TA 3WG9A 3QW2A 2A4KA 3H9UA 3D3WA 3BMQB 3GK3A 3PJFA 3NJ8A 4EUHA 1ZK3A 1C0LA 1LDNA 2X5JO 4U5QA 5C7OO 2BGLA 4MVJH 4ALMA 4NBVA 3C7DB 4DPKA 3E82A 1ZKMA 3D4OA 4I5EA 4EDFA 4PZDA 2OHXA 3UXYA 3ORFA 4Q3NA 5G0WA 4FDAA 3PLNA 2JFFA 4L4XA 1GCUA 5DP2A 3WNQA 2RHRA 2OP0A 1ADFA 4E2YA 1SOWA 3AM4A 4ESOA 4BGEA 1R4MA 1WDMA 8ADHA 3PQFA 3VHRA 1H93A 2CNBA 4CMBA 4TVBA 1NVTA 4RQTA 4EGFA 1QV7A 4QO8A 1H6CA 1GUFA 2JD2A 3PZRA 3HFSA 1GADO 2WM3A 3GEDA 4TVOA 4H16A 3D4PA 4K28A 5CG1A 4TZKA 4P4NA 4WOJA 5KKCA 2UYYA 4OKIA 1G1AA 2VTEA 2X0JA 3JYNA 3NJ4A 1LI4A 1F17A 1HLDA 2W98A 5KWEA 1KS9A 1GUYA 2VOJA 1NHGA 4LGVA 1U5CA 3ADOA 1DAOA 2VN8A 5JDIA 1UR5A 3UKOA 3SLGA 4RO0A 1VE9A 4L76A 4ZQBA 1MUUA 2VYNA 3AOGA 3Q0EA 4WUVA 1PS8A 5EMHA 4NZ9A 1GEEA 1UUFA 2GZ2A 3VDRA 2J5KA 4DQUA 4BB5A 4OXKA 1X14A 3AY3A 3JYLA 3IL2A 3FWNA 3H9QA 4OSPA 5CDSA 1XU7A 2DUUA 2EGGA 3DBHA 5AQ1A 4O63O 5MGBA 1NXQA 4MIOA 3RI3A 1E3EA 1P3DA 3FNHA 4GBJA 4KQWA 4D45A 2PY6A 2AEJA 2I65A 4M8SA 3PFFA 5K9ZA 1WLYA 1U7HA 2C2XA 1QLJA 2O2YA 5CG2A 2YFHA 1IY8A 2F00A 3ZNQA 1ADGA 1XELA 3O38A 4K6CA 4OM8A 4D3SA 3LC2O 1KEUA 1MC5A 1I33A 1VJ1A 2Q49A 1HF3A 3KBOA 4RLSA 3PGXA 2X0RA 4RPGA 1C1XB 1UJMA 4XD2A 5COQA 2JD1A 2NV6A 3EMKA 4RPKA 2W2KB 1A27A 1X13A 2VT2A 4G2NA 2ZTLA 2HMUA 3INRA 2DTXA 5EL0A 2Y67A 2GZ1A 4LW8A 1E3JA 2WSBA 1YONA 3ZV5A 1ADBA 1EBUA 3CUKA 3GMSA 4CM8B 2YY7A 1M2WA 3BTVA 3WQRA 3I9MA 3JQFC 3GR6A 2JD0A 5JCJD 3SVTA 5KJ1A 1X1EA 3KSDO 3WSWA 2O7SA 1QLHA 4ZQGA 4M1QA 3EW7A 3EVNA 5L4LA 1M75A 1R4NA 1HKUA 4IJWA 1JTVA 4LVCA 3WGYA 4DWVA 5F1OA 3RROA 4PLGA 3G1UA 1KY5A 3H7AA 3GRPA 1E7RA 3HWRA 3CZMA 3JV7A 1E0DA 4U8GA 1GQQA 2DU8A 4DA9A 3DL2A 4CLXA 1I10A 1VL8A 4CMIA 2W2LA 1U8FO 4OAQA 4JJGA 4RQUA 4IGEA 3BHIA 3H9JA 4O6VA 1T4BA 3MJVA 1T24A 2DLDA 3WQQA 5JO0A 3FHLA 2QHXA 3WR5A 3RAJA 5AXBA 3H3FA 4XQGA 4TROA 4WEOA 2B35A 1GQ2A 4FQ8A 3Q6IA 4B4WA 1ZBQA 3ANNA 3TZHA 1MXHA 1N9GA 1R16A 1OFGA 3K2EA 4MVJE 4IQGA 3ST7A 1TI7A 3H2ZA 2CSUA 3RFVA 2BRUA 3RC1A 4LISA 4FFMA 1GQYA 1F8GA 4YTEA 1HXHA 5DNAA 5ENVA 4KDFA 2YHIA 5DP1A 4JBGA 4EEZA 1W8DA 2ILTA 2X9GA 1YB1A 3E9QA 1AE1A 1ZK1A 2B5VA 4QQRA 3C85A 1WVGA 3CIFA 3WBBA 3ZDFA 2Y0DA 1Z6ZA 1E3WB 2VCYA 4J43A 4YJFA 3TWOA 3VPSA 3SJUA 3AWDA 3WTCA 1J49A 4AJ2A 4DBVO 1RYEA 3RUDA 1D8AA 1BTOA 3D64A 2VWPA 5G0SA 5EN4A 4GMFA 3HDJA 1OC4A 5JNLA 4AJPA 3K73O 3BTOA 2AXQA 4IZIA 4TWRA 5A3VA 4AJOA 2JHGA 1Z7BA 3OP4A 4PRKA 3W8FA 4JP3A 5U9CA 2I3AA 1A9ZA 4MJLA 3GZ4A 4KQXA 3INTA 1SEPA 1NR7A 2B4QA 4CPDA 4A0SA 2Y68A 4CMHA 1N7HA 3HN7A 3CKYA 3RUFA 1A4UA 4RV9A 3OJFA 5CFZA 4RPLA 3DMTA 3L9WA 3RASA 1LUAA 1Q1NA 5HRUA 1Z45A 2YUTA 5JW6A 4LCJA 5IZCC 2VHXA 4WLVA 4BNVA 1I5RA 3H8VA 2BFPA 3B20A 5L4SA 5HWSA 4J7CA 3UHAA 3H6KA 2AQ8A 3GRKA 4XEHA 1PJ2A 5CPFA 1P44A 3K8ZA 1I3LA 4BQPA 4UUOA 4MP6A 3BMOA 3S2EA 3D3WB 1JVBA 4WCFB 4FPXA 4J4TA 5IXSA 4E4YA 3DWFA 3TOXA 3WGOA 3F4BA 3JD2A 2J3IA 2X8LA 4ALNA 2HK8A 3F46A 4IGFA 4XX0A 3X2FA 3ZWXA 4TZTA 4XCVA 4HNHA 4R3NA 3GVPA 3RIHA 3L6DA 5ICSA 3ZU3A 5CHEA 1GZ6A 3TFQA 4B3HA 1ENYA 2YV2A 3PDJA 4UVIA 2EG9A 1PQUA 4GSLA 5ITVA 5HS4A 2P9EA 2ZKLA 4P8RA 4ND1A 3KLPX 4YT8A 2JAPA 4IS3A 3JSAA 1P0FA 1UH5A 4YAGA 1U3UA 2LDXA 4Z6KA 4GX0A 3LVFO 3PFWO 2PFGA 4HWKA 1UXKA 1O8CA 5U1PA 5B4TA 4F6CA 4B7XA 4BNLA 1K3TA 3GVIA 5C7IO 1ULUA 5CEEA 3G0OA 1DFIA 4XB2A 5TJHA 3OECA 3P2YA 1DDOA 5GY7A 2A35A 4EUEA 1HE3A 1KEWA 3UN1A 2PZJA 4DRYA 3R1IA 5B4UA 1PZHA 4DL9A 4IZHA 3FD8A 2J5QA 2C20A 4RORA 3WXBA 3S8MA 2X0NA 4B8ZA 3AM5A 4BOYA 1ADCA 5AVOA 5IXYA 4A5OA 2VYVD 4HBGA 3CMCO 2FN7A 2IYPA 4OXYA 4RF4A 3NDIA 3D7LA 2NVBA 2FY8A 3LQFA 3DB2A 1N7GA 3UICA 3C1AA 1FDVA 3COSA 4PLHA 4UVEA 1CQIA 3T7EA 5L7WA 1E6EA 4NJMA 5JY1A 1Q7BA 3QWHA 4FB5A 1R37A 3I9NA 1X7HA 2P4QA 1WDKA 4IDDA 2X5KO 1YOVA 2OP1A 3BMOB 4NIMA 2E49A 1GZ4A 1Y81A 2PH3A 1HZZA 3FI9A 4NBRA 4NFYA 4CV0A 3HDHA 4FR5A 3JQ9C 3I3OA 3GN2A 1P1HA 4RDHA 3ASUA 3H5RA 3VVCA 3CZRA 4E5YA 4FOOA 2FPIA 4D79A 5L4NA 1MFPA 1N2SA 3IC5A 1R0SA 1LRLA 2A9FA 3NGLA 1WZIA 3WTBA 4CMEC 3WYCA 1EQUA 1HLPA 3L6EA 3QE3A 3ZNNA 2YYYA 3WS7A 3ZH2A 1J6UA 1I3KA 3WWYA 1Q0QA 4F45A 4YAKA 4DIFA 4QT0A 4RGBA 2OMEA 5BSEA 3T4XA 4NBUA 4LMRA 1RKXA 1VKNA 1XU9A 2X22A 1A4IA 2ZB4A 3BHMA 3LC7O 1NBOA 3G79A 2P5YA 4PG5A 5IF3A 1CWUA 2V6BA 4YR9A 3H5AA 5L40A 3RJ5A 3AU8A 2BFOA 4JK3A 1V35A 5HBRA 5JC8A 3RU9A 3HHPA 2D2IA 3S2IA 4NBTA 4RVGA 4YT5A 1JA9A 2F1KA 3SJ7A 2DBQA 2IE0A 2Q2WA 4DYVA 1R0LA 3PJEA 3F1KA 4ZJUA 4FFNA 1EFKA 3OM9A 1E7YA 9LDBA 1N5DA 4ND4A 1FDUA 4UREA 4WKGA 1N1EA 4DMLA 2RIRA 4DLBA 3W6UA 4PG8A 1LBEA 3CINA 5FFFA 3NYWA 1K0UA 2EKQA 2B37A 2EIHA 4AVYA 3IUSA 4OSOA 4ZHSA 3JQ7B 2ZJ1A 1WZEA 1T2CA 1BSVA 1GPJA 4BKUA 1ONNA 4PCVA 3IOYA 4GKBA 4MP3A 3BMNA 2Q99A 1PIWA 3UOGA 2OZPA 4FCCA 1YO6A 3U5TA 1BDBA 4Y8VA 5J23A 2ZTMA 4FFRA 1PGNA 4MVJA 3EZLA 1SCUA 1KVTA 5A1TA 1BDMA 2YW9A 4QO7A 1C0PA 4E32A 4WLNA 4AL4A 3RUIA 1HE5A 1GD1O 3GDFA 4MPDA 1HWYA 4WLUA 1LSUA 3LT4A 4YA6A 4D7AA 4DIBA 1Q7GA 2WDZA 1ML3A 2C7VA 3AY6A 3RUCA 3WLEA 2O2SA 3ZWWA 1W6UA 4BS9A 1XDWA 4CLDA 2WD8A 3LYLA 5T57A 5KIAA 1PGQA 1JAYA 1DC4A 3ANMA 4U7WA 1E3SA 2BF7A 1RJWA 2C7GA 2NTJA 3DZFA 1O89A 3GAZA 3IDSA 3JQDA 4P4GA 4W4TA 1J0XO 3ADPA 2ZIZA 4IBOA 3BMNB 1GTMA 2VRCD 3VTFA 1T4DA 5KJFA 1HL3A 5JE8A 4BVAA 4CLRB 5FWNA 2HRBA 2HMTA 3I9JA 4XJSA 4YACA 1NQAO 5IDYA 4ALKA 4XIJA 1EE9A 5TX7A 2DTDA 4FS3A 1ZUD1 1J5PA 1V0JA 4J1NA 4Z3KA 4U6SA 4PFJA 1CRWG 4IUYA 3TZCA 4CLOA 3VKVA 2VRCA 4CM7A 3JQEA 3DONA 3ZNOA 3SXPA 2GERA 1A9YA 4WJZA 4RLHA 4BHTA 3PJDA 4YJGA 5JC1A 3PZBA 3SC4A 4TRJA 2YQ4A 1P1RA 2FRDA 3DZGA 5EQFA 4B3JA 2HMSA 1KETA 4O1MA 1I01A 5BSGA 3B1JA 3WMXA 3NDRA 1Z73A 2O50A 1Y8QB 1R66A 3L4SO 1UXJA 1KC1A 3RU7A 4AJNA 3ANLA 5H83A 1U4SA 5TQVA 1XLTA 2DFDA 5KVQA 1X0XA 1KIFA 2HUNA 3TOZA 3EK2A 1Y8RB 2GLXA 3P5SA 3V2HA 3BAZA 4AJJA 4XZ3A 5CDGA 4CMIB 1CETA 4DGSA 4DBZA 4HFMA 4URFA 1PR3A 4OOFA 4Q9NA 5HA5A 1X15A 3DBHB 3PXXA 1GU7A 3UFXA 1KYQA 5IZCA 4ONEA 4A27A 1YS4A 2DBZA 1SB8A 1C14A 3JYQA 3EVTA 2E6UX 1UP7A 2NU9A 4E2XA 1QV6A 1A7AA 1KOLA 1DRUA 3U0BA 3HB5X 3RSHA 4CR6A 4B3IA 1JDJA 1BRMA 3E5MA 1VJ0A 2X6TA 4Q3BA 4U0JA 2Q4BA 2RH8A 3W4IA 2V6GA 1NAIA 3QWBA 4Z9XA 2BI7A 2FR8A 4OO3A 2VHZA 4BNXA 3WB9A 4F3YA 4BO6A 3TPCA 1E6UA 1Y5RA 1PZGA 2D5AA 2QG4A 4JBHA 1SEVA 2HAEA 4E5NA 3C24A 4PGFA 3OIFA 2BKAA 2Z1MA 4KMSA 4N18A 4IJVA 2V7PA 4FJ2A 4N5MA 3TQHA 3OSUA 2GZ3A 1WDLA 4NK4A 4CMCA 1U8XX 1YB4A 1NM5A 4XDYA 3PVZA 3BTSA 4CLHA 5A9RA 4DVJA 3AI1A 2PD4A 1UP6A 4QECA 4ND2A 1NP3A 1KBZA 1R4MB 3V1TC 4L8VA 4OXNA 4E33A 2ZTVA 3MTJA 1B3BA 1XG5A 3IJPA 1DIRA 1P1JA 4CMKA 4WCFA 3ZW8A 1KY4A 1E1KA 3I4CA 3QY9A 2Q50A 4XYMA 4R4JA 3A28A 3GAFA 3FRJA 3CMMA 3DBLA 3LLVA 4JIGA 4RVSA 1H6AA 4CUKA 5K0ZA 1TT7A 4XRRA 2SCUA 3D5QA 4NI5A 1BVUA 1Y5MA 4OQZA 5GZ1A 3R3JA 3QSGA 3AUSA 1QYCA 2CY0A 2CVZA 1HYEA 4U6QA 4DUPA 1T2FA 4E13A 2WJPA 1YRLA 4E3ZA 1DC6A 4WGGA 2B36A 5C37A 4J4HA 3KLMX 4BGUA 3WIDA 1PZFA 1UXIA 1YJ8A 2VT3A 2EWMA 4A2CA 4IJUA 1MG0A 1Q0HA 2VYVA 1PS9A 2J8ZA 4FBGA 4PN3A 1BWSA 1X7GA 3B70A 5JAMA 4FW8A 4NQZA 3ZWYA 2G0TA 4I5GA 4YQZA 3KHUA 1ZEJA 2GCGA 3IQDB 1VC2A 1J4AA 3NAQA 1C1DA 3D3EA 5EIOA 2EERA 1YQDA 1UXHA 3Q9NA 3DZKA 3O9ZA 3GLQA 4HFJA 1YQXA 3C1TA 4HUJA 4BV8A 3WBFA 3DAPA 1S7CA 3PLRA 4IDAA 3W4KA 2W90A 1MB4A 1GYRA 4R51A 2OO5A 2PK3A 3K6JA 3ZWAA 1R0KA 2Y05A 1F0YA 1EUCA 2GPTA 5ES3A 4B4UA 4CL8A 4MVJF 1ONPA 2YHIB 4R68A 3SC6A 1AHHA 2WE7A 3FCOA 1K6IA 5KNLA 5DULA 1YQGA 3I6IA 3ZV4A 3TF5A 4NJOA 1T1SA 1DHTA 1U4OA 2GF2A 3ULKA 1S6YA 4M87A 3BMQA 1O95A 3KM0A 2V6FA 3S2FA 4HKTA 3FTPA 4XR9A 5JFOA 4W7IA 3MOGA 2D3TA 1JKJA 4KWHA 2Q1WA 1DIHA 1Y8RA 1DC5A 2NADA 1FDTA 2A92A 1JW9B 3WOHA 5DF1A 2GD1O 3EYWA 3WSVA 4CR8A 2QZZA 3JD4A 5EERA 5LC1A 5AXDA 3V2UA 2I6TA 1B15A 2AMFA 3S2GA 1XR3A 2NU8A 3RJ9A 3DO5A 3MJEA 3TZ6A 3U62A 1K6JA 1X0VA 3DBVO 4NHEA 1VRWA 1O5IA 3LDHA 4NBWA 3Q2KA 1LDMA 4NPCA 5DZSA 2J5RA 2FP4A 1PJ4A 1BHSA 2HJSA 2I5PO 3IJRA 2HLPA 5L7TA 3M1LA 5I8ZA 3OICA 4R1SA 4YAJA 3RUHA 4KUEA 4BNNA 1XWFA 2FPPA 2WTBA 4RVUA 3WFIA 1IZ9A 3RKRA 2D5CA 1E3WA 4YYZA 3L4BA 1U28A 4JP2A 1O6ZA 2B83A 4XYLA 4MIEA 1H0KA 4XQCA 4FFOA 1KVSA 3PYXA 4WLFA 3RFXA 2AG8A 1CQJA 2HDHA 2VWQA 3DOOA 5A4DA 5IN4A 1EUZA 1H2BA 4BO9A 4CR7A 1YH3A 3LK7A 2BFMA 4YT2A 2G76A 5C7LO 2HO5A 4C4OA 1N9GB 1W0CA 4GKVA 3JQ8A 3ZZNA 3D1LA 1OBFO 3WGIA 2Y0CA 3TDKA 5T8KC 1GR0A 4Z0TA 4XIYA 4CQMA 3LF1A 1W4ZA 1GPDG 4DLAA 2NUAA 2GO1A 3ZV6A 2PR2A 5JAQA 3AM3A 2FZWA 5I9LA 1DIBA 2PD3A 2AHRA 4PZEA 4Y6RA 4YRBA 2EW2A 2XOXA 4A10A 2FOIA 2VHWA 3KTDA 1VL6A 4Q3AA 4O5OA 5KVVA 3DOJA 1E7MA 3HZZA 5DT9A 4QXMA 5KJCA 2DM6A 1FJHA 1X7DA 2UAGA 3EY4A 4LN1A 4YWJA 1HDYA 5G0VA 5B4VA 4YRAA 3V1YA 2VZ9A 4ITUA 1ZZEA 2DTEA 4E0BA 3DAGA 2CVQA 3ABIA 2PH5A 5IAAA 1D7OA 1DFGA 4N5LA 2PD6A 2PTGA 1OMOA 4GLOA 3AOEC 1DAPA 1MC4A 1B8UA 2C5AA 3WICA 4RJTA 1GYQA 1U3VA 1DO8A 1B8PA 4HXYA 1LC0A 2YDYA 1V3UA 1H2HA 4D3DA 2PNFA 1QORA 1ZCJA 5AYVA 4CUJA 4FOSA 1G0NA 4JN6B 5DCYA 1ZSVA 3ZWOA 1XEAA 4TMFA 3OQBA 3RUAA 3JQ8B 3RBXA 3VPXA 4D44A 3UW3A 1G6KA 4YCAA 1NASA 1LDYA 1HSOA 5EQDA 3IMFA 4CMGA 4DQXA 1BXKA 4ZD6A 4BNTA 1AXEA 2HMWA 5JPIA 4A73A 3GDGA 1ZMTA 1VI2A 2HK9A 5KJEA 4KDEA 1FF9A 4X54A 2CD9A 1JKFA 1EQ2A 4YBZA 1F06A 1DOHA 5TNXA 1EK6A 4BIIA 4OIMA 2NM0A 4L74A 3RD5A 1F14A 4UVHA 4Y6SA 1LU9A 4UVDA 4A26A 4CM8A 2ZYGA 2GDZA 4HFNA 3GNTA 1BXGB 1DRVA 1LLCA 4J1SA 4KTTE 3ZN2A 5BNFA 3PI7A 1VSVA 2NTVA 2WD7B 3W1VA 5JY6A 3U3XA 4UAGA 3SX2A 2DVMA 2IDZA 5F21A 4AFNA 4CM9A 3NT5A 1SZJG 4GMGA 4GQAA 2YJZA 4BKOA 1EVYA 1OC2A 5TS3A 4YT4A 4E30A 4UULA 4OHUA 3PHGA 3PWZA 1MFZA 5KCZA 1HYHA 3X2EA 1N1GA 3K31A 1LC3A 2CUKA 1SMKA 1R12A 3QWIA 4R54A 5HS6A 3WGTA 3CTMA 1I2BA 2PV7A 3GA0A 5THQA 1WNTA 1NAHA 2P9CA 1EVZA 1NX6A 4R1NA 2H6EA 3INGA 1EEHA 3DZIA 4GWGA 2QYSA 3OJLA 1UAYA 2QRKA 4IQ0A 4L9RA 2OUIA 2WYVA 2WYUA 2VOEA 3HB4X 4E5PA 2AE1A 4MINA 5BSHA 1PU2A 3ONDA 3CEAA 2R2GA 3MWDB 1WAMA 3TRIA 4KUGA 3Q1LA 4GX1A 5EPOA 4UUNA 1MG5A 1HDRA 4LMPA 2H63A 1P0CA 4ZU3A 5ER6A 4GX5A 2H5LA 1GL3A 4DLLA 5JYEA 3TFOA 3DOCA 2VYND 1O94A 1BVRA 4HP8A 4J16A 4R1TA 3VKUA 1MA0A 1T2AA 3I5MA 4Y9DA 4YJHA 1LX6A 3BA1A 1RYDA 5KKAA 3TL2A 2B4RO 4KTVE 4IMRA 2FR1A 2Y1DA 2HMVA 3JQCA 3A1NA 2PZLA 4LSWA 3E6AA 1NWHA 1JWBB 4R9SA 3V8BA 1ISGA 5CPBA 3TL3A 3ROPA 1SB9A 4BNHA 2RHCA 1KEVA 5JMPA 2C0CA 1IUKA 1YJQA 3LLSA 5TLSA 3GY0A 1LQUA 2D8AA 3BZUA 3O03A 3F5SA 4Q3CA 2C59A 3PYLA 1D1TA 2V65A 3ENKA 4E12A 2H1SA 4RL6A 2VZ0A 2HRZA 4E2WA 3HJAA 1TB4A 4BGVA 2CDBA 3AU9A 2AQIA 4I9UA 2WEKA 4OOEA 4QFDA 1P33A 2EF1A 4HNGA 3Q3CA 1DFHA 5U4QA 4XYEA 2O3UA 5A5EA 4J2HA 1I2CA 4JJFA 1ISMA 5KVCA 3QHAA 3VZRA 1B16A 2WD7A 4RCVA 1NVGA 2DPGA 2QRLA 1FXSA 1A72A 5I7SA 1LDGA 1BXGA 1QYWA 2ZATA 2IXBA 2XXJA 4GH5A 5BQFA 3GDOA 4RZHA 4GVXA 4TRMA 3ZHYA 1PGJA 2EP5A 2GN9A 4ZQFA 3OETA 4O0LA 1IPEA 2VRBA 3JQ9A 2HSDA 1SBYA 1V9LA 4R41A 3Q9UA 5DOVA 1XCBA 2Q1SA 2UVDA 4C7KA 4KWIA 4IPTA 3E03A 4PRLA 1ZNQO 4DYDA 4PG7A 6LDHA 4BNJA 5IDWA 2BELA 4WNCA 1AXGA 1K2WA 2HKIA 2UV8A 4H7PA 1E3IA 4I5FA 3HUDA 2PKRA 5CEFA 4R5HA 2V6MA 3I52A 5L51A 1CDOA 4FD3A 5T67A 2UDPA 3EUWA 4Z0PA 1CF2O 3ZHBA 1P1KA 2CF6A 3K5PA 3OQ6A 4Q3EA 1K5HA 3GG2A 3V5NA 5CAEA 4XA8A 2X9VA 4UUPA 1GEGA 1HT0A 1TLTA 3ETEA 1O0SA 4BMSA 3GEMA 3GNSA 2O4UX 4GGOA 5F1KA 4R01A 3QA9A 3JYPA 3ROKA 4E5KA 5G0UA 4CODB 3JQFA 3DZBA 1SAYA 3WGHA 2TMDA 5C5IA 3JQ6A 1B26A 1HEUA 1B2LA 2DC1A 2Y1OA 4XQ9A 1Q7CA 1QSGA 2D4AA 1IHYA 1E7SA 4PLYA 3E5RA 4OL9A 4R5MA 3VC7A 3VZPA 4AJLA 3PQEA 3E8XA 4WEQA 2YQ5A 1ZXBA 4R69A 5CP8A 2CMDA 2ZJ0A 3DTYA 1PJLA 2YFQA 3GHHA 4ALJA 3ZWCA 2HK7A 1EVJA 4CM4A 1ZK0A 2NU7A 4J4BA 4NFSA 2Q1TA 4BNFA 3IKTA 4Q3DA 2Z5LA 2X0IA 3ITDA 2FSSA 1EUDA 1DPGA 2EKPA 1H9AA 1PQPA 3PP8A 3JQGA 4OYRA 5JMWA 1U5AA 3WLFA 1XIVA 3JQBA 3ZI0A 2P5UA 1QKIA 3GF4A 1ZJZA 3KRTA 5G4LA 2CZCA 4AJHA 1YXMA 4J49A 4LK3A 4N7RA 1PTJA 2R00C 4YJGB 1U2GA 2J6IA 1K6XA 2Y1GA 3O8QA 1U1IA 3CE6A 5BNTA 3U09A 5F3RA 3ZHZA 1HTBA 1IB6A 2PGJA 2A94A 1HE2A 1KEPA 2O48X 2X86A 3OA0A 4UEOA 1AGNA 4DTIA 2ZB3A 1EVIA 1TXGA 5AXCA 3EC7A 1Q0LA 4L73A 4ZICA 1ZW1A 2D59A 4CV1A 2OFPA 3FNEA 1LEHA 3GGOA 4JBIA 1QP8A 3TN7A 1Z7EA 4NU6A 5CDUA 3DTTA 3K30A 3GGGA 4JX8A 3NTRA 3HSKA 4K9DA 1H5QA 5G4KB 2XAAA 4AJEA 5F5NA 4DC0A 3VOSA 4IIUA 2C07A 1LXCA 7ADHA 1H6BA 4J6FA 3SBOA 3HDQA 3RFTA 4BO3A 4FFPA 2PWZA 5IN5A 3DXFA 4YRDA 5H81A 3MJTA 1O9BA 4MVJD 3E1KA 3RC9A 2Y66A 1DLJA 1V3TA 3WDSA 1OI7A 3C1OA 4W99A 1PL6A 5A02A 4M55A 3ZWPA 4PZCA 3EAGA 4LCEA 4QSMA 1GV0A 4WE3A 1EDOA 4D3FA 3P2OA 4MKXA 2FMUA 4R1UA 1JLLA 4J1TA 4J9UE 4D0RA 4WPGA 5A9SB 3EZYA 1LDEA 1IE3A 1Y7TA 3HADA 2AW5A 3JYOA 3STHA 3UUWA 3H9EO 2VWGA 4NMHA 5K6AA 1Y9AA 3P19A 3NKLA 1PWZA 3LC1O 4Z9YA 3OBBA 3KYDB 3WYEA 2XXBA 4B4OA 4TRNA 4ZQHA 1ISHA 4D46A 2QYTA 2Q4EA 2BGKA 2AA3A 1TT5A 2VWHA 3PIIA 4IMPA 1FDSA 3ZWBA 1QRRA 2ET6A 3F4LA 1JQBA 5L3ZA 3C7CB 4QEDA 3DR3A 2PGLA 3FPCA 5BNIA 4W9NA 3IUPA 3N7UA 1IHXA 1JWAB 3PQDA 4GLLA 3VVBA 1DJNA 3GVCA 1D1SA 3DMYA 4IQ8A 4EW6A 1I24A 3SLKA 4FFLA 3H4VA 2C2YA 2OL4A 3G3EA 2BHLA 4IM7A 3I23A 5JDCA 4NDNE 5JBIA 4R16A 2I3GA 4D43A 5A04A 3VH2A 2EXXA 4S1VA 4TKLA 1PL7A 2ZB7A 3PWSA 1E1MA 4F6LA 2IZZA 2R6JA
chains in the Genus database with same CATH superfamily
3RV3A 4B8WA 5TV2A 1K3FA 1UDAA 1LLQA 3R7LA 3ZQ4A 1LQTA 3PJGA 1ZJ6A 5E6SA 1LTQA 2GN8A 3F6BX 3PT9A 5SYMA 1DKLA 4V0QA 3GLIE 1VSQA 1VE3A 3HCOA 1NBEA 1WKBA 2QSUA 2X5NA 2YHUA 4CT4B 2UYGA 1E4YA 3EGEA 2W43A 2HLNA 2KE5A 3GARA 4YPFA 4LVUA 3VTZA 4C7JA 2XGOA 3TQIA 4OHFA 6YASA 3TOSA 5LMNB 3O4FA 1QLWA 3TRJA 3K0KA 3WAKA 4YLYA 1TU0A 4K6HA 4N03A 5JARA 1E5LA 4ZT6A 2ZBUA 4YREA 2K4MA 4CEIA 2CL6X 2IHBA 3ORYA 3Q7SA 4IRXA 4QXPA 2QN6A 5CDHA 2CVFA 1U8UA 1X7YA 1KHTA 2E4XA 3NT2A 2QRVB 3IP5A 3F9CA 1S8FA 2FUG1 4CEHA 4W5RA 4K3UA 4FP9A 1KEKA 4HQ6A 3K0FB 2NZXA 4H1WA 4AO7A 1K5GA 4IXWA 2V7EA 2AFIA 2DAPA 4ZAXA 1J97A 3N0RA 3HU5A 1P18A 1D2EA 4OK6A 2C97A 1WSBA 3DT9A 2RC6A 1GRVA 2VZEA 2H17A 1Z7WA 5E7MA 4KPEC 2I99A 1YBAA 4BNKA 5TIIA 3KQWA 4RDIA 2A9KA 4ZO6A 3REQA 5JZMA 5CB4B 4WXPA 3AF1A 4BGDA 3QOYA 1RWPA 1TYCA 1N7IA 2D0PB 3AHIA 3I9LA 4MKRA 1NWCA 4L22A 2OOKA 5JNVA 3DDWA 2NGRA 1J39A 4MJXA 4BZXA 5A4FS 4Y3UA 3AY7A 2R62A 3GL9A 3IB3A 2FN9A 1MV8A 1KJZA 1ND6A 3ZE1B 2XB6A 3F2VA 2I2BA 4KE9A 4Y1GA 4EARA 2HWKA 3ZH9B 4NYJQ 4XLLA 3ELYA 1D3AA 3WDKA 2PJRA 3Q0IA 3UMMA 4MS1B 2O3JA 4TKUA 4MRRA 2J46A 3LL7A 4JUBA 4TTQA 5JS2A 1VXOA 4YR7A 4EYOA 3FKSA 3GFBA 2VYFA 4P98A 1M74A 2JCVA 3JATB 4KMOA 3WAGA 1FRNA 2SCUB 3AEKB 4IHJA 4ROSA 4UNSA 1XDZA 1LLDA 1JMVA 3BXXA 3H9GA 2QRJA 4ABYA 4RMJA 3HVRA 3TSCA 2G4CA 4D9IA 4A8JC 2MYNA 1H65A 3OIDA 4UEWA 4CVNA 1F9EA 1OXVA 2WUWE 5HRAA 1C1DB 2H85A 3WL7A 1IY1A 5I8WA 4BWGA 4MTLA 1TJNA 5CEJA 2Q1UA 3U7IA 3HCDA 5AK4A 3ZU6A 1YA6A 1QHIA 3OCJA 1GDTA 5HKBA 3ONFA 4CDGA 4YCJA 2AOXA 1GUDA 3NIBA 4P58A 4RVDA 3W8DA 2P9QA 5EFZA 4HATA 3QVTA 2BM9A 4AG3A 1G4UR 2IDKA 3EF3A 3GJ4A 1JL3A 2Z2IA 4QBGB 4QQKA 1B6GA 2GPWA 1L5LA 2M6LA 3RB8A 4I0WB 1R0YA 1Y1SA 3NTUA 4IDGA 2CHUA 1UJ2A 2ZLBA 4NK5A 4K2AA 1Y8QA 3BMCB 1QHNA 4F9TA 3THXA 3DE3X 4RD3A 5DCLA 4PPGA 1WQ4A 4GOMD 2CVOA 2WU8A 1VIMA 4JFAA 5C31A 4BO8A 2JJ1A 4G5YA 4JS0A 4KLZA 4DV0B 4OUKX 2Q3JA 1RC0A 3DM9B 1GTVA 1ISSA 1H3FA 1R6TA 2C9BA 2YYSA 3ZVKA 4HRAA 3K8YA 3LZDA 1UOOA 3AOEA 4C0JA 4QARA 4YUZA 2IH5A 1GT6A 4C07A 4FIDA 3G89A 2FP3A 2Z0MA 4A2PA 1YWGO 2RIPA 3HB9A 3FSRA 1RM0A 1DHRA 4K6FA 2NYRA 3RT1A 2X1LA 5IBCA 3BXHA 4XGQA 1M0WA 1FQJA 3PR3A 3PQCA 4JNCA 3DP7A 3OA2A 3QLUA 1PK7A 3EGOA 4P7GA 3ROQA 3UK6A 3V3TA 2PZMA 1NTRA 3IMGA 3RVKA 2V9ZA 4TSRA 4Y0NA 5KDOA 4G5HA 1VGRA 1L0BA 4CKXA 2OGWA 3LT2A 1PUJA 4M54A 3WFJA 3BRQA 5FJJA 3TVTA 2VK8A 1SG0A 5EIAA 1Y9JA 3VZSA 5JRZA 3PLAE 3AI3A 1FS6A 1XTUA 1FP1D 2MYTA 1T1GA 3IKVA 4KBYA 1HMPA 4MUAA 4NFLA 4A8PA 3ZY4A 4NY1A 2CMGA 3L8FA 1LDBA 4ALLA 5A5VA 4WW0A 2XIJA 1RP1A 1JPUA 2QT9A 2VSFA 4DJDC 1A5SB 1OPXA 2QSJA 3LC0A 3MJ4A 4HQRA 1JRLA 4GVLA 2YNMC 2YNMD 3OD5A 4R2JA 4R3WA 3MJHA 4WNAB 3QXXA 5IP5A 4A0HA 4BXOA 3ILVA 5CFLA 1QRUA 2VP5A 1C1HA 1V1MA 2TSYB 4CQMD 2H9IA 1Y8CA 1EG2A 3G2LA 3V8QA 5C8YF 1WZ2A 3BDVA 3KB6A 3OE4A 1CUBA 2XTMA 3VPHA 3H04A 2RH5A 3QIAA 4EEXA 3OIGA 3ORSA 1Z8NA 1K4YA 1T6XA 3B2QA 1R50A 3CNLA 3T7IA 1EK5A 1YL6A 1Z0DA 1V16A 5LSAA 1C9EA 1OXMA 4L6CA 3JAWA 5FAKA 6ADHA 1Y80A 4Q39A 4CCYB 2C9CA 2HA3A 4TWBA 4BQNA 4F4FA 1NPDA 5FUQA 4C6HA 4KWEA 4YX9A 4Y9RA 1Z16A 2YV4A 1XKQA 4YJFB 1SOVA 1ZO8A 2I76A 3HXOA 5IEJA 2HK6A 2ATCA 5DI9A 3VNUA 1Q1QA 5ITWA 2LZ0A 4ER3A 5KS2A 4Z7QB 3QV1A 5EJ4A 3DV2A 3WVNA 4M1ZA 4DLSA 3AERA 3I1JA 1Z17A 2YY6A 1YVEI 3CUVA 3IUJA 3MJCA 5BQ5A 3V8MA 2YW2A 1QYVA 2BFCB 1B8VA 3L7OA 3W6PA 5CGQB 5JD5A 3PA6A 4C7BA 5JFTA 5TJ9A 4DREA 1SUEA 3MWJA 4HB4A 1Y3FE 1D09A 2JHCA 1F2VA 1NLFA 3IV6A 4A2WA 4XRGA 5CB6A 3HV0A 5DWDA 4AB1A 1HL7A 2YVKA 2CJWA 2QN9A 3DNPA 3TNLA 4PSAA 1DRWA 3GJYA 1GGJA 2C1XA 5E1DA 1UJ5A 3HKCA 2X13A 4R2IA 1SPXA 1WF6A 3UH0A 1D8TA 1PJ3A 2VUTA 1R00A 3FMFA 2QTCA 1QE0A 1VBFA 1IY9A 1XHLA 1KMHA 3M2PA 1LF5A 3CV3A 2VP4A 1ZGGA 2BP7A 5DBIA 5A06A 1WHTA 1IMJA 3B6KA 3OSZA 2P77A 5F51A 4TMWA 3AJDA 2NUTB 3LRXA 3O8RA 1FMJA 3CX4A 4CKEB 4BNMA 3TLKA 2WWRA 3SZOA 4QJ4A 3EARA 3ZNPA 1LS6A 1Z4LA 4INAA 4OGLA 4JLOA 3ZDEA 1JH9A 1VHLA 1P5ZB 2EV9A 2WR8A 5LVAA 3KHTA 1PX0A 2HIMA 1CZUA 1EIZA 4I8XA 4KW7A 3F6PA 4L5BA 5BUCA 1AD2A 2VDVE 1WB5A 1BNCA 2RCNA 5CFMA 1VECA 1NUTA 4I8DA 1S2GA 1YA8A 3T7SA 1GAJA 4ZDWA 1LSJA 1QIDA 2FPPB 5IJZA 3DTVD 2BDEA 4A16A 3Q3HA 3BC1A 2EFDB 2IEDA 3NB0A 1ORRA 4LOHA 4WESA 2PEYA 3AUUA 2G6BA 3I9OA 1CERA 4MO2A 3C87A 4IHQA 3L1JA 1NR1A 4R31A 2F90A 4TM7A 1J8VA 1I5OA 3STWA 1XD9A 4C06A 1K98A 2L19A 4AIIA 1UZLA 3HXKA 1XHEA 1Z0KA 2Q6TA 3PXEA 1UWVA 4KLNA 3RGGA 4JOQA 4W6ZA 2Q5FA 1UQTA 2MIIA 3TLMA 1PR0A 4FX5A 1QOPB 5JYCA 3UJ9A 1YCGA 5CMLA 2BGMA 4BX9A 4F46A 3ELWA 3DHEA 3AFIA 3ODPA 3EIQA 5A9SA 2XOEA 4F84A 1BH6A 1BMDA 1VP3A 4U2CA 4CTOA 1G20B 2A9OA 5DHTA 5H5JA 2GVNA 1OYYA 2CFOA 2O2IA 4IL5A 1NUAA 3JQGB 4XXHA 3KU4A 1JR3D 1ODJA 1MO6A 1SO8A 2JI7A 3PIDA 1INLA 2BMAA 1ILWA 1QOZA 1VRCA 1XYYA 3O5AA 4GOND 4WV3A 3RYFB 3ML1A 4EJFA 2ZJZA 4JLVA 4DR3B 4Q24A 5JXWA 4ZN6A 4HZIA 2OE2A 5TGZA 2ID4A 4LOAA 5JC1A 3GQVA 4LY9A 2IPNA 3PXCX 4NCJA 1NE7A 1ZI8A 3A6FA 5ENDA 3R7SA 3T4PA 2JHAA 1YS6A 4A0QA 1OI2A 4BFYA 4XTCS 3GI1A 4D8WA 2XH8A 4ND3A 3S1AB 1RM5A 4LTDA 3VZBA 1EHYA 2ZR7A 4B3CA 1UMDA 5GV7A 3P9XA 4KXWA 1EWQA 5J9FA 1NVFA 4R2LA 1A1VA 2C04A 2ZIWB 1OI3A 2D2XA 4QOFA 4O1HA 4OUDB 5A5DA 4LSMA 1JPJA 4I2VA 2GJSA 4N5DA 2B8JA 1XRMA 2ZVPX 3W8NA 2HQ1A 2ATIA 4LDAA 5C51B 1YZHA 1H2XA 1X87A 1KRHA 1VTKA 3FNFA 3IE0A 5BSFA 1VZ3A 4HADA 4H7JA 1TC1A 3FGNA 1QG2A 4HY3A 4TKUB 3U61B 3KTAA 5BR7A 2FPGA 2J5BA 4EYQA 4AQ7A 3OPVA 4P80A 4C7VA 4ECEA 2QSZA 5B3LA 1YVPA 1SCIA 2O4CA 4L5CA 5KTKA 1Q1AA 3WSTA 1LPBB 4JVOA 2IYFA 2DPYA 4EATA 3B1FA 4REOA 5C1IA 3HZRA 4Y2RA 1O57A 4NJMB 2E4AA 2OV2A 4ZARA 2VKTA 4M9CA 1E9FA 1L4MA 2XZDA 2IPOA 5I9TA 3S1LA 4MUGA 4WK0B 1UBRS 4MQ5A 3RWBA 3RFUA 2ZYDA 1YE3A 4YIHA 4DT1A 3WRXC 3R5XA 4KGXA 5C1PA 1ZZGA 4B47A 2WU0A 3HUTA 4RHUA 2O57A 4GGPA 4UHFA 5G1NA 2PUEA 2EIXA 1Z08A 4Y6PA 1UCFA 5EIWA 5T8KA 2C5EA 2JKYA 1XQXA 3SHFA 1DUVG 2LDBA 5GMOA 3GPDG 1BS1A 1T8SA 3BZBA 3W8EA 4AM8A 1ADJA 1V43A 2POQX 3G5LA 2ZVQX 2LCQA 4JLNA 5ALDA 1NY6A 2C5GA 5YASA 1OGIA 4PSKA 1Z4JA 4GG1A 3U7GA 1XZGA 3PD7A 2VDLB 3NTOA 3AP1A 3L0OA 4UHCA 1RZRA 1XV5A 4TLLB 5B37A 5ABPA 4CEIB 3VH4A 2E37A 2IHZA 3DFZA 1QHYA 1S4QA 1RHJA 1L7EA 2JFZA 2ZS9A 2P2LA 3I6QA 4V0LA 3KVVA 4BMZA 4HX5A 2VH5R 3MWEB 4XWYA 5AM1A 3RH0A 1T1EA 5LWHA 4QU9A 1WXEA 4Q93A 1ZHHA 5I7VA 1MEJA 2JFHA 2Q9CA 4RZIA 5IBPA 1TKBA 3DBIA 4TT3D 4YDQA 1F12A 1FFAA 1DX4A 1WXDA 2MSKA 3AKDA 3HKBA 1I94B 1PLJA 2B1GA 2GSWA 4RANA 1G5IA 5GVSA 2ZM6B 3MMNA 1T25A 3WADA 5L9AA 4JB3A 1ARZA 4GX2A 4HEA6 1A7KA 3ZK9A 3NHUA 4QYTA 3ZEIA 2ISSD 5ITZA 5KQPA 2ZQZA 4RIIA 4U7FA 3U37A 2QAGA 2WTMA 3ICOA 4GL4A 1U9IC 3B5JA 3CPSA 1VJGA 3IP1A 2IOFK 1FNDA 2Y1WA 1QFZA 1XKXA 3KU1A 3M6VA 4DLUA 2AJDA 3H1TA 3X2SA 4EKEA 1QC5A 2HDOA 5E4YA 5DWQA 1ZA1A 3OMXA 1E4EB 3VDQA 2CSXA 3EAFA 3RU3A 3GLFE 3FCEA 2RJOA 2UYOA 1JXOA 1LV8A 2EGHA 2VTKA 4F3RA 3GMIA 2P27A 3SKXA 2NXEA 1N3YA 2YS7A 4IXNA 1T2EA 4CM3A 1TPZA 2EHJA 3NFYA 4BAUA 2O1EA 4BTLA 4RZ2A 2NVUB 2XEDA 5AXAA 4DKXA 3FR8A 2B1RA 3BB4A 1VBMA 2ZBGA 4MVJP 4F3TA 1YRQA 1YDMA 1B8OA 3BCSA 3DKIA 3DVAB 4IHJB 3JTEA 4AKIA 4UPDA 3OM8A 4LPSA 5IS2A 2OZEA 5ICEA 3AVVA 4DNPA 2IZ6A 4X1IB 4PGGA 2PRYA 3GN1A 4G0VA 5JI3E 1K4KA 4EO7A 2AX4A 3TI7A 4CM6A 4O59O 4H1TA 1RADA 2J0UA 3NRCA 4J3FA 4LYEA 4P81A 1SVNA 2R1TB 1FLAA 3W05A 1DXHA 5C3MA 1ONSA 2REBA 4TS9A 3TMYA 2P2SA 4EHHA 1Y6JA 4IJQA 1ODLA 4BYGA 4YRIA 4XJXA 3MS4A 4LVNA 4WASA 5ESDA 3OLWA 2C82A 4Y1FA 3KFLA 2IUFA 3RC2A 4D97A 1A7JA 1L1QA 3D8TA 3CM0A 1QHHB 3FY4A 3LA8A 3F3SA 3KEQA 5C4IA 3R0JA 2JLXA 5AUPB 3MWGA 3OOYA 4HXGA 4WCDA 4PNHA 1E79A 3GELA 3HN2A 3CLSD 3CLSC 3GAAA 4YJ3B 3DMRA 5EINA 1FTYA 5CB4A 2IT1A 1U8TA 1KSHA 2ODBA 3ZCQA 1GPUA 4LA4A 3PSAA 1F7UA 3OEHD 4L0QA 3TSWA 1VIVA 2HYDA 1JG2A 2NACA 3JD3A 1CYDA 3M3HA 4JJZA 4O2AA 3RVBA 3S70A 3ZWNA 4YASA 2X3FA 2AI3A 3ZWMA 4DLKA 3PC8C 1JSLA 2QVBA 5H16A 2G72A 2OCPA 1T2DA 1UEJA 4EVQA 4PLWA 1W1IA 3SNHA 1CY4A 3RF7A 3U4IA 1RCUA 1Y8AA 2YXEA 3LDUA 4GRAA 2W0MA 4H7FA 5CFRA 2OORA 2J3JA 2JHPA 4DPMA 1OYVA 3E18A 1OOEA 3ZUPA 5GOZA 2YWCA 3U4QA 5F4BA 3LCVB 4XR4A 3K15A 2VPWA 3P1JA 2HM7A 4C5CA 4UCXA 1NPYA 4CKBA 1OX4A 1Z74A 1TK9A 1D2AA 2DFKB 2ZQ5A 1XAGA 4Y18A 2NU9B 4BKRA 4K9SA 4B2IA 4GXRA 3C3XA 3QOFA 4P4LA 1Q84A 1GA4A 2J9YB 4WXHA 3T7DA 3VFDA 5IULC 1XD2B 2BTOA 3ZE8A 4EG1A 1KMIY 1U0HC 2PX6A 4KITB 1CY8A 2GPSA 3B6MA 1Y1TA 2X7HA 2ASEA 4O8CA 1VKZA 2Q3EA 3NKVA 2CMHA 2AZ4A 3VMMA 3KTFA 3BBPA 4Y2YA 2H0QA 5FTMA 2EL7A 2OV3A 1UBEA 3QBEA 2YNMA 2JHFA 2JKVA 4GPEA 2IOHA 5DCUA 3C5VA 1E6CA 3A05A 3KOUA 3PGJA 3BE6A 3FHJA 1FB5A 3A8TA 2BEJA 2P69A 5DMXA 4AKHA 2Q46A 5JAPA 2IUTA 2VJLA 3D4NA 4KUHA 4CQLA 1T0HB 3A4TA 4O33A 1TCBA 1TMGE 2EP7A 3K0HA 3RSLA 3U3OA 1WMDA 4LV6A 2VQ3A 1GG5A 1ZJJA 3I0ZA 2XITA 5DPMA 3U4HA 1B0ZA 1TOAA 2OTCA 2P9GA 1HH4A 5FYDA 2IYOA 3WGGA 3A6PC 1V5EA 4C0WA 3HVIA 1U7OA 5E3JA 3BKXA 3PNMA 4F1KA 4Z49A 3O8LA 5D3ZA 4ZRNA 4V0SA 4YALA 2KS6A 2JNWA 3L8ZA 4AMVA 1GILA 3WGMA 1CC1S 1JB9A 4MZXA 1X7ZA 4DLTA 1PS0A 1A82A 3E3MA 1R4NB 4AF8A 1DBVO 2IW1A 2QVCA 3BIWA 3EIWA 3FVQA 3AK4A 1OTXA 3R6GA 2Q9UA 1CXZA 1NHWA 3RYIB 1XO1A 1TT5B 2PYZA 2PLAA 4QG7A 5AKYA 1OX4B 1UINA 2K2WA 3D8RA 3T7RA 3K9GA 4I6EA 1N75A 3KEMA 4XM0A 3U1VA 1COWD 1HEYA 3DPUA 4PY2A 1GQRA 4FBLA 4YXWD 2R8ZA 4ZYUA 5C32A 2R8BA 2X4GA 3E15A 4PRZA 2V1XA 4PLCA 3Q7QA 1UAGA 4L27A 5DXFA 3F47A 3VH3A 1QYXA 4RTMA 4G5SA 4PLTA 3V1UA 2HXGA 4HEA1 1K6MA 3PCRB 1LBHA 3QXGA 4RSHA 1TJPB 2NXCA 2ERYA 2H4YA 2Y93A 3CB4A 4IHKA 1MEOA 1KI2A 1SCDA 5CD1A 1OAAA 2QUBA 2EKZA 3W5AA 4GC9A 3G2PA 4MUKA 1Y4SA 1NQUA 2BSAA 2XVYA 2WHYA 3U7JA 4DJ5X 4P5EA 2O14A 2W93A 4MW5A 3WMEA 2B78A 2I3BA 4P1ZA 2NSDA 4L5AA 4M0EA 2VJQA 3NEAA 1QFJA 3V8NA 4MJ3A 3CFYA 4PWYA 3M6MD 4IF6A 4F4DA 2G0AA 2PX0A 1QPZA 5CA1B 1E8NA 4LVOA 4KAAA 1XJCA 5K3DA 2I0FA 2EJVA 1KDOA 1NXSA 3CZ4A 2JLAA 5B2FA 1XNRB 3NU1A 1M1YB 4EITA 1HQKA 2B5WA 3EZNA 1IL0A 3LIPA 4BO5A 2PUAA 4IDNA 2HA5A 3PEFA 4D4MA 5KWSA 2C3PA 1KVUA 1MTZA 2MINB 4HAYA 3SI7A 3KXPA 2R1UA 4XE5A 3U7QA 3KD2A 2AGVA 3H5NA 5I48A 4KE8A 4L4ZA 3UIEA 5KU1A 1MH1A 5AVQA 2TMKA 2GASA 3AEQB 2VA9A 3K9WA 5CR9A 4KIJA 4GPBA 4V2UA 4B0PA 3CUWA 4S3MA 4B3TB 1UBSB 2XYRA 4S1OA 3IMCA 1YZYA 1NYRA 3AEUA 2WAXA 1H85A 3AR7A 3CJTA 1XTRA 3OPMA 3EYAA 1J33A 4KZPA 3ZXYA 1PR4A 4FB4A 1EXDA 1F60A 1XQ1A 3UBTA 4WLEA 5IJ0A 5IF9A 1FU8A 3IMKA 4RM2A 2XR1A 2FPOA 3G88A 1VJCA 2J45A 3VOBA 4EQ6A 5KX5A 3KYBA 2FWIA 1QO0A 1P1IA 4IGAA 5DWVA 5BPFA 3K70D 2JEZA 3A4VA 4QPNA 3K70C 4LF5B 4ZQIA 1E7WA 4HGNA 2JFNA 2PT7A 2YKGA 3NDBB 3WLSA 2V54A 1YGPA 2IYSA 5DOZA 1RRGA 3RRJA 1LLUA 1HDIA 3DT8A 3NAZA 4RSRA 3MMZA 4WX2B 3BJMA 2UUPA 2CCJA 5BQOA 3E7FA 3TZLA 3VO8A 5JZVA 1W35A 1OV6A 3JD1A 4NCAA 1KWKA 2GM4A 3FNGA 3EHEA 3D8BA 4FMPA 1WUHS 4IFEA 1YFZA 4QLAA 2FE4A 2R8EA 2WBLC 3LQ4A 4DWJA 3NOVA 5ARBA 2JAOA 3E5NA 2M1XA 3FMGA 1F8FA 2FHPA 3GMTA 4IIVA 4LHSA 4BMVA 4JGBA 5ITSA 3Q3EA 5JAUA 3ETDA 4GZLA 2VCHA 3FYHA 1OFUX 4DZZA 4JLJA 5CH5A 1OGYA 3TECE 1M2VA 3FOEC 3DLCA 3QTLA 4IIBA 3NC4A 1UKBA 3O7MA 2Z2YA 3ZWVA 3AJRA 4QC2A 2XF8A 4II2A 1A3CA 4BNZA 4DXDA 1FMFA 2CDRA 2RKOA 1UM9B 1V71A 1M1UA 4Z0HO 1AZWA 3P2MA 2YWDA 4B5KA 2RGXA 3EIFA 2H1WA 4GYKA 2ZJAA 9GPBA 2ZITA 4G37A 5HMLA 1PD1A 1ONBA 4IICA 1HDXA 1IOWA 4PXAA 4K8RB 4IVPA 3UMCA 4MWZA 2BN4A 2IUUA 2NVUA 1HFKA 2W00A 3DBLB 5EZ6B 2AG5A 4O8ZA 1KDRA 4MO9A 3JWGA 5ICCA 3R0QA 5KZMB 4RA9A 1FC0A 1Y5IA 2MSLA 5G02A 1AS0A 3H3JA 2BOVA 1CP3A 1M6YA 4CT0A 1SC6A 3D8HA 4GI3A 1SNYA 3KSRA 4O4JF 4QBTA 4Z3OA 3G9UA 3GMDA 5T3YA 4U3JA 5K03A 1YB5A 2QOEA 3V2GA 2GGSA 2M2IA 2NQTA 1C50A 1U9JA 4S24A 5IBRA 4E1AA 1T4MA 3LUFA 3GCGA 3I5AA 3GVHA 4P5PA 5A9TA 1SKMA 4C6RA 4PZZA 5KOYA 3FI0A 1IPHA 4JQOA 1EGMB 4YRGA 5KYUA 3DEHA 2PUWA 3HKDA 5TC4A 1VCIA 4RVNA 2HCTA 5E95A 5BPHA 5I7RA 3VO1A 4PAWA 1BW9B 2GK3A 1Q6YA 3SBDA 3A6ZA 3G8CA 1T8RA 4OQFA 2BI8A 3HO1A 2GRJA 1MW8X 5J1TB 1JZSA 3HG7A 3FFXA 4W9NC 5CM2Z 4B6JA 3NS7A 1KK2A 3G1TA 4WK4B 1E9CA 2CXQA 5K3SA 1OE0A 1VPEA 2EF0A 3UATA 3X1YA 2CE7A 4ZK2A 1M2NA 3MTDA 3T7KA 5KC8A 5LQJA 3GK3A 2P1DA 4COOA 1Q0UA 1KFBB 3ORQA 2FMKA 3FPJA 4AY5A 4U5QA 4MH0R 3KL2A 3QFSA 3ABOB 1ZKMA 5D5QA 2JLQA 3NHZA 5GJVC 1MRSA 2F9FA 2CJPA 3HB0A 4IIGA 2OHXA 3A2MA 3DFIA 1O96B 3DQQA 2HR1A 3GFTA 9ABPA 3PLNA 1AXRA 5DP2A 3I9V6 4E7OA 2GXSA 2RHRA 5C52B 2J32A 3QMMA 1SOWA 2VPYA 4ZJYA 1FNNA 3AM4A 1X1RA 5KYYB 4ESOA 3NWOA 1R4MA 5FT9A 1WDMA 4HDQB 1LFAA 4IIYA 8ADHA 3LI2A 2HRCA 4LC0A 3KJXA 4I4TF 1KJ9A 5EEGA 1WR8A 3H2HA 1KZ4A 1NVTA 3GDWA 5DLDA 4BTVA 1RFLA 1TRHA 1JDTA 3K9NA 2FEKA 3R3UA 4G01B 4ZJZA 3GJ6A 2WM3A 3LDFA 4B85A 1PYOA 4K28A 1U99A 2NT3A 1T8UA 4KGDA 5CLGA 4LDZA 2G06A 5FNVA 2JLRA 1V41E 2UYYA 1KU6A 4HZUA 4IKEA 4OQXA 4PF1A 1XDSA 5BW8A 2VXOA 4BUZA 1G20A 1OXXK 1LKZA 4PGHA 4H18A 2C4UA 4Z4GA 1IHOA 1KS9A 4TTVA 2VQDA 1GUYA 2BEWA 1TMYA 2OFWA 3H17A 4CIBA 4UNRA 4ZAZA 3CVUA 3PR2B 3WRVA 4GMXA 2CWDA 2B98A 5IVIA 1ECJA 1ZH0A 1JXQA 2FEAA 3SQWA 3UAZA 4KH0A 5JDIA 1M1ZA 4IMIB 2IIPA 5DTRA 1G66A 3IA7A 5A6SA 4ZQBA 5JG7A 5LFAA 5IVHA 2KJQA 4D3ZA 2OHIA 4WUVA 3C97A 4LIPD 4RZXA 1OLXA 1GEEA 1M83A 1RNLA 2CXRA 3PXUA 4OAOA 4M83A 4DQUA 2A84A 4RSGA 3EEFA 4BB5A 3VOTA 1QVRA 3C70A 2A1UA 2B2NA 3HU2A 5K0BA 4OSPA 1U2GC 4JEHA 4AG5A 1XU7A 4EZBA 2OO5C 3UTDA 3VX3A 3DMGA 1ODCA 3UMVA 3E2MA 2J85A 1NXQA 2EZ4A 2B4AA 3FLBA 4TN5A 1TDJA 3DMDA 1ZGCA 3D8NA 3KWLA 1SUBA 4HGRA 4MIOA 3RM3A 3LKBA 4GBJA 3W2IA 4JLSA 1QIGA 2V45A 3INYA 4RK7A 4M8SA 3SE0A 3PFFA 1LJLA 4ETMA 4CKEA 1YTLA 2O8DA 4YAOA 4W1SA 1XPRA 1W6RA 4AY2A 1CQXA 2I29A 3RTGA 4LZJA 3IEXA 4F5EA 1WXXA 4V0OA 3RS8A 3E70C 2JLWA 3JZIA 4DJJA 1OWOA 3D6HA 2NYVA 1GLNA 4C3ZA 3LC2O 1KJJA 3OCUA 4D3SA 5IANA 3O1HB 1RXEA 2Q49A 1F8UA 2IGBA 2V5AA 4OU5A 4P53A 5GINE 1IATA 3PGXA 4HDSB 5E6RA 3DFKA 1C1XB 2OZLB 4TTAA 3UGQA 3IPCA 1ZMBA 5COQA 3V4FA 1G21A 1CVIA 4WHMA 2B7CA 4KLAA 4NZNA 5TPZD 5G41A 4EGQA 2ZSDA 4DRZA 3W79A 2IZ7A 2ZTLA 3KQNA 2ERXA 4TWIA 2IXTA 1IOVA 1WEKA 1P0MA 3CUKA 3GMSA 1Q74A 5IVDA 3N2LA 1Q6ZA 1L4GA 2ZJ4A 2FDXA 3KSBC 1SXHA 4I1OA 1M2WA 3AESA 1UBHS 3H7IA 1IBLB 2A14A 3Q4GA 5JCJD 4B3FX 1KXZA 1R1DA 5HOEA 3WSWA 1FX1A 2HF9A 1QLHA 2O7SA 1W59A 1PYGA 1ZI9A 3MT7A 4ZVSA 1XMPA 3KKEA 1R4AA 4Q1CA 5HF5A 3WGYA 5F1OA 3G1UA 1UK7A 4F4IA 1JLHA 2ACVA 3R7NA 4CF5A 5FWYA 3ZE2B 1GQQA 2B0CA 4DA9A 2COEA 2R751 4TL7A 5L3SA 3T61A 4G1MB 4AMZA 3SIXA 1IUNA 3CVWA 4CU5A 1O77A 3FPKA 4BV3A 1R5NA 2FQXA 3UAVA 2BPOA 5HM6A 3T9FA 3EWSA 1ZAYA 2YRXA 4ZAWA 1QIKA 3HMKA 3K8OE 3MG9A 4IGEA 2B34A 2QRZA 3WHPA 1W85A 2P6NA 2VFAA 4CI0B 1KAOA 1JB1A 1QFMA 1G2IA 3LWNA 2V03A 4H08A 2H5IA 1L4LA 2QHXA 1A50B 3NHAA 4TS3A 4YRSA 3HCFA 4Z4IA 3DLHA 4B4WA 4D99A 3KE9A 3OTGA 3KXLA 2D00A 1OFGA 3LM8A 1XTPA 3JWPA 3O2JA 1AGPA 3SEZA 4DE5A 5JSHA 5CX1A 1DNPA 3LLMA 1KI6A 5DBOA 2CSUA 5LL6P 1F8GA 5HG0A 5DNAA 4QTUB 4LQLA 4KDFA 2YHIA 4RHTA 5PNTA 5HUJA 2ZRLA 3BL6A 4JBGA 2FQQA 3AERB 4RKFA 5LXTF 4EA7A 5AD1A 3A1VA 1YB1A 2QTAA 4HLNA 2AG0A 1LV7A 1VJDA 4OPMA 2BLNA 1J0EA 2BW0A 2PGOA 2GEKA 4ZI7F 2Y0DA 1G2PA 3A1EA 3CX7A 4J43A 3V4ZA 4BLRA 3TUJC 1SPBS 4YJFA 3VPSA 1EX1A 1MO5A 3AWDA 4M7PA 1J49A 1GGHA 4EFMA 3ROZA 1BTOA 1UK6A 5G0SA 1N5JA 1NVUQ 3FBWA 5DYYA 4GMFA 3FOZA 3EFBA 1OC4A 2JGNA 5G3YA 1Z63A 4QLBA 3K73O 2B8EA 2UXCB 2AXQA 4XCQA 4JCCA 3F5DA 4OA5A 3LP8A 1IOZA 2PSEA 3OKPA 3ZIDA 4P0QB 3N0TA 1DUSA 1G7CA 4MCJA 1T5OA 4TWRA 3AYZB 4OHZA 5EE9A 2B7LA 1L6IA 1GU1A 3GROA 5B6PA 4TM8A 2WB2A 3PC7A 1VJRA 3RIMA 4Z4FA 2QUAA 4BXOB 4PRKA 2FH5B 1IJFA 4OHRA 5IAJA 3NG1A 3UGTA 3W8FA 3ZGOA 4GOOD 4P33A 5FWDA 2Z4RA 2QM8A 1K4MA 4LXTA 3GZ4A 4YAFA 4I8IA 3COVA 1H05A 4M98A 3I62A 4CPDA 2B4QA 2GD2A 2Y68A 1U31A 1EM8A 4NAUA 4CTMA 1XL1A 1ND5A 1PDWA 2PKXA 3BGIA 5HK9A 1EHCA 1OHHA 3KJQA 3L04A 3AUJB 2VZLA 4MVCA 3CKYA 1S2NA 1KTVA 4M3NA 5BSHA 1J7JA 3BQNB 3BXEA 1PT6A 2GTHA 3TG8A 3B9BA 2FSHA 3P9SA 3BJIC 4FCWA 4N8EA 4QDOA 3BF7A 5P21A 2IW3A 4G4JA 2XYHA 2COUA 1ZNXA 4ZT3A 1NMZA 4IO0A 5JD6A 2GPJA 3M83A 5JW6A 1Y6RA 2A1UB 5KB3A 5IZCC 2VHXA 5JUWA 3VYTB 3H97A 4NXNB 2AZDA 3HJNA 2A5YB 5DMHA 3KZCA 3SFTA 2XXAA 3H05A 3WLIA 5KPDA 2K5UA 2AQ8A 1W5SA 3EG9B 4GI1A 4PNPA 1VKHA 2XCQA 3LGAA 4LYGA 2RGAA 2VRNA 4JHXA 4MP6A 3BMOA 4BQPA 3V48A 2GBPA 1U4NA 1VKJA 4WY2A 1NW6A 2QPAA 1J22A 2WWFA 4GZ5A 4J4TA 1SHZA 4KU4A 4PYIA 3O4JA 4LC9A 2WSMA 1LVGA 3F4BA 3K4HA 2EZTA 1CJTC 1TX4B 1QK4A 2CJXA 2R7LA 1ZIPA 2EJBA 2R60A 3QPAA 4XX0A 5HIMA 1T29A 1QO9A 4CTNA 1ZUNA 2HCJB 2NSHA 4P3NA 4TZTA 3U26A 3O73A 1C8BA 3DE6X 5JU6A 4C89A 3HA7A 2B9VA 2QPTA 1M34E 1P4HA 4FR2A 4HMOA 1ZOLA 2ZTHA 4NCKA 5E8RA 4YJ2A 2YHSA 1R8XA 3U0VA 2YV2A 1Z0FA 2WDPA 1JFLA 3MIIA 1JG4A 2BFEB 3LIIA 4LRYA 4NNOA 3W5VA 5ITVA 1E9DA 3ZXSA 3BB3A 4H9GA 3UJAA 2ZR0A 5AJYA 4IS3A 3JSAA 4E4RA 1UH5A 4YAGA 4XIFA 2I2FA 3UENA 2J08A 3PFWO 1OWMA 2Z9BA 3W7VA 2FMFA 4QM6A 1I4WA 4HWKA 4QYXA 4QJ3A 4F6CA 2WWGA 3LKVA 1E6LA 4BRWA 5JNWA 4FYVA 3GCZA 3ZGLA 2EQAA 2ZYWX 3EOZA 4KMMA 3EPJA 3T7TA 3GVIA 4DS3A 4CEHB 1ULUA 3EJWA 3WJ2A 2QRVA 5CEEA 2IK8A 2JJMA 4D4GA 2BEVB 3OLCX 4E14A 1LPPA 2AHOA 1YVDA 2F3RA 4PC1A 4BVEA 1DDOA 1P7VA 1KZ7B 2EL9A 2IBTA 5GY7A 2A35A 4EUEA 3PKIA 4U2KA 4OQDA 1QU2A 4MGEA 1K66A 1IHPA 2VJPA 4DMCA 3R1IA 5B4UA 3ICVA 1BN7A 1PZHA 4DL9A 1DZ3A 1EFHA 1WE2A 1J00A 4M1WA 3D7SA 4J2TA 3D0RA 3TTXA 2X76A 4IHJF 4IZHA 1G21E 3FD8A 1ICEA 4AWXA 3U3DA 1XQYA 1XZPA 1AS2A 1HX7A 1E2DA 1FBTA 1HFJA 4B8ZA 2QQGA 4MPRA 3B52X 4ZCPA 3QQ5A 3SF8A 4HBGA 4BOYA 4DA0A 4DJEC 4XUEA 4OK3A 2AYZA 3L6CA 4OXYA 3RG8A 4HNAB 1GPWB 1JE1A 2FY8A 3P27A 3BPSA 4JGIA 1N7GA 2HCBA 5L3RA 2FSGA 2XDYA 5KKNB 5KYUB 4WSOA 4PLHA 3T7EA 1UAAA 3H2KA 2WJGA 4TS1A 2QY6A 4YFYA 3SXUB 3G2HA 5KYWA 1ZL0A 4FB5A 1N6KA 2IYRA 2D8MA 3B8EA 3LW7A 2MHCA 4U9UA 3I8OA 3GAMA 3JWEA 3P45A 3H5OA 4H6PA 4D8TA 1LK5A 2X5KO 2FWRA 2EJCA 5IUJC 2OP1A 3DW3X 3GLIB 4PQYA 4B33A 1HZZA 1RLTA 2EFHB 3ND6A 1P75A 1CS4C 3JW8A 3VJLA 4LJ6A 4JYPA 2UXDB 1CLUA 4RDHA 1DC8A 3IDFA 4JVSB 1DJPA 1JQKA 2FPIA 2XNCA 4E5YA 2IH2A 3IC5A 5AI6A 2BJHA 1E98A 4V03A 5DISB 4UU8A 4MDFA 1JE0A 4CMEC 3WYCA 1LB1B 2ZU6A 3PNVA 4E51A 2OC4A 4G1FA 4DLNA 4RTRA 1WUKS 4QT4A 4DIFA 1LZKA 3UA3A 5MN5A 3TBFA 3DEJA 1UKEA 2D7CA 1EG7A 2OMEA 3E61A 3TLXA 3JS5A 4N7JA 4KR2A 1DBWA 3WIUA 2JGMA 3K8QA 4LMRA 1ZN2A 4EHLA 1VKNA 1I4EB 1A4IA 1ACJA 2XYQA 2ZB4A 2X42A 4XJVA 4D26A 1CUWA 3HWSA 3I09A 2RHBA 5ALZA 3AVYA 3ITEA 2R6AA 5IF3A 1EFTA 1AKYA 1XRRA 3UJCA 1U04A 3ETCA 2QTTA 4WNYA 3UMYA 4IEFB 3KUCA 1E60A 4MCAA 3H5AA 2PWYA 3OG9A 4TLEA 4YRQA 1QM5A 4MSUA 5DH9A 3AU8A 3SC3A 1A1SA 4EA6A 5FPYA 2O0KA 4PSVA 4U9HS 2OHGA 3RU9A 3QSYA 1PK8A 2D2IA 2DUMA 2J9FA 2X9LA 4TWJA 5CIQA 1NBMA 3IOBA 4I3FA 2HH9A 5KQSA 2BAGA 3H0KA 3L0BA 3M70A 3SZGA 2C7QA 2VAPA 2C78A 2CFRA 4EPRA 4ZEOA 1JHUA 3OX2A 4LJAA 1CUYA 3E0XA 1T1IA 3PJEA 1YKSA 5KX5B 2P2CA 4FFNA 1EFKA 3OM9A 1C3JA 2O2JA 4INJA 5IJ0B 2Q5QA 1NE2A 4ZZIA 1SKAA 1II8B 2V3VA 1G17A 4DLBA 3EIXA 4LTMA 1ZN7A 2VF4X 4YJ3F 5EE0A 2ZSIA 4PG8A 3NYWA 1NY5A 3ZDQA 3NVKI 4OV6B 1QGZA 2RGBA 4CKWB 3AHJA 3GZJA 2ZEJA 4QUJA 1MABA 2WABA 1GL7A 3OZRA 3LP5A 4PCVA 3MT0A 4Y2XA 3IODA 3IOYA 2ABWA 3U48A 3BMNA 2BI4A 1R2QA 1RWWA 2HNAA 1MIOA 2DFNA 2Q99A 4R2MA 3UOGA 5I3ZA 1UZAA 4Y2JA 3R7WA 1M1YA 5LZ5A 1R0ZA 2UKDA 4Q66C 3KJZA 3OY7A 3SM3A 3I8SA 3SIPA 5A1TA 1LH0A 2YW9A 4QO7A 2M6KA 4E32A 4WLNA 4OLBA 4AL4A 3RUIA 3EE6A 4M76B 3EZ7A 3Q87B 3ZPXA 1GD1O 3GDFA 1D4ZA 3HXQA 2VHQA 4MPDA 1HWYA 2GZRA 4FYPA 4YH1A 5AVYA 3C6MA 1YMUA 3TTYA 1UADA 3PVSA 4XEUA 1Q7GA 2WDZA 1ML3A 2XKKA 3CEPB 1WP9A 2IS4A 5CT6A 5D01A 4CLDA 4Q4LA 5T57A 1G60A 1PGQA 2MU1A 4HAXA 1JAYA 8LDHA 2GZDA 1H2YA 3GAZA 4QGAA 1A2BA 3R7WB 1MHTA 4A8TA 2FZLA 1BEZA 3NYIA 4FXPA 4RV5A 3C45A 3LBFA 2ZIZA 2XYGA 3BMNB 4WKNA 1W5EA 2A0WA 2ACWA 5KJFA