The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
112
|
sequence length |
340
|
structure length |
340
|
Chain Sequence |
TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for
the u-Crystallin Family
pubmed doi rcsb |
molecule keywords |
ornithine cyclodeaminase
|
source organism |
Pseudomonas putida
|
molecule tags |
Lyase
|
total genus |
112
|
structure length |
340
|
sequence length |
340
|
chains with identical sequence |
B
|
ec nomenclature |
ec
4.3.1.12: Ornithine cyclodeaminase. |
pdb deposition date | 2004-08-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02423 | OCD_Mu_crystall | Ornithine cyclodeaminase/mu-crystallin family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | ornithine cyclodeaminase, domain 1 | ornithine cyclodeaminase, domain 1 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain |