1X7DA

Crystal structure analysis of ornithine cyclodeaminase complexed with nad and ornithine to 1.6 angstroms
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
340
Chain Sequence
TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ornithine cyclodeaminase
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
total genus 112
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1x7dA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x7dA02
3JD4A 4RVDA 4ZVVA 4CQMD 1MG5A 4BNWA 4PLTA 1EQ2A 3KLPX 1KY5A 1U8XX 4I9NA 4DQXA 1IULA 1Y81A 4NQZA 5TRTA 4BS9A 5MDHA 4DXHA 2Q45A 1TT5B 2UVDA 4OOFA 1UP7A 4WLEA 3SVTA 1AHIA 1PZGA 4XCVA 3DDNA 1NHWA 3WXBA 5EQDA 3MJEA 2CUKA 3ENKA 1AHHA 2VT2A 4PLYA 4OHUA 3V2HA 6ADHA 2QRJA 1LRKA 5COAA 4R01A 4JK3A 3S2FA 4RF5A 4GX1A 1E5QA 4IPTA 3SBOA 2GN4A 5L40A 1SCUA 1W73A 5JAMA 1K5HA 5JYDA 3S2GA 5EINA 2DTEA 4J1TA 4ALKA 3L9WA 3OQ6A 3TZCA 3F1LA 4BGEA 1P1FA 3IUSA 1ONPA 4CM9D 5I8ZA 2P9CA 3F4BA 4XYGA 3JD3A 4W9NA 3I3OA 3BYZA 1U9JA 4FFLA 1QYCA 4TRNA 3VZSA 2RIRA 4FDAA 4B4UA 4YA6A 3NDIA 3H2ZA 1YONA 1WDLA 2I67A 2H63A 3RUCA 4YRAA 1WZEA 3ZWMA 4NG5A 4HADA 4A0SA 4AJKA 1IPFA 1UDAA 2P2SA 3MWEB 3ICPA 5IG2A 3EAGA 4J1NA 5FWNA 3QWHA 3G49A 3GHYA 3ZI0A 1WAMA 3CIFA 1R4NA 1YDWA 3B1KA 1D4FA 1L7DA 2OBNA 2PH3A 3WOHA 2UAGA 1NTOA 3BHJA 3VOSA 4EUFA 4JJFA 4ZRMA 2GN9A 1F12A 4BNYA 2JAPA 3QVTA 2FPPA 3OIGA 4P8RA 3UH1A 3WGYA 1DLJA 3I6IA 1VL8A 3GG2A 4JP3A 1T24A 2GR9A 9LDBA 4E5KA 4AJHA 3FF4A 2EJWA 3DZBA 2AW5A 5GY7A 3RFTA 1E7MA 4E6PA 1N1EA 1P1JA 3HJAA 4CM4B 4JJIA 3LF2A 3GVIA 4NBTA 3BMQB 4PVDA 4B8ZA 2H5LA 3QSGA 4KMSA 1DHRA 2Q1SA 4IIUA 5F5NA 3OJOA 3VPFA 3DBRA 4ALIA 3G3EA 5A04A 4IDCA 1E6UA 4CM8A 4CMEA 4Z9FA 1YS4A 3UF0A 3PDUA 1PL6A 1JLLA 4GL4A 3RU9A 2HK8A 4F6LA 5DNAA 2GD1O 3GHHA 4OM8A 3KYDA 4GGPA 5FYDA 2IZ1A 1DIHA 4N18A 4IS2A 4IQGA 4IDGA 4PG8A 3PFFA 3SC6A 3INRA 2PD3A 4DBZA 3TF5A 1J6UA 1SB9A 1Y8RB 2IEBA 4WEOA 1KVSA 3IJPA 2WYWA 4R54A 3A4VA 4J91A 3E9MA 4GH5A 3G79A 4NHEA 1YRLA 4AJLA 4XQCA 1ZO8A 4TZTA 4R5HA 3B6ZA 4C7JA 2AQ8A 4WOKA 4DRYA 4TRRA 1DRWA 3CTMA 1GY8A 3VZPA 4IZHA 2Y1FA 1QXSA 4DIBA 4N7RA 4B3HA 3DOOA 2C07A 2O23A 1LUAA 1F8FA 4FOSA 1E3LA 2ZJ1A 4CMKA 1H6BA 2DBQA 4GSLA 4RDIA 4WLVA 4PLZA 4BNFA 4RJTA 1T4BA 2FSVA 4RLSA 1PJTA 2ZQZA 4F6CA 3PFWO 3RC9A 1P1KA 2HK9A 1IHYA 4QTZA 4BKQA 3KSUA 3ZWBA 5FI3A 1W0CA 2P5YA 5EJ2A 3WWYA 1B14A 4ZHSA 2J6IA 1ZNQO 5G2OA 4LSMA 4NFYA 3ZHZA 1E7WA 3RJ5A 4M54A 1SEVA 3JQ7A 4TRJA 3TNLA 4GMFA 5HS6A 3QWBA 3G0OA 4D44A 1D8AA 2NVUB 4BKPA 4WCDA 2AEJA 1ONOA 3GVHA 2FR8A 2R00A 3PVZA 1PTJA 3VAZA 4BNJA 3CMMA 3I83A 3CPSA 3HN7A 4XYLA 3K2EA 1PGJA 1GUYA 2VYND 3D3WA 4N5LA 1IUKA 4CM6A 3EGOA 5TGDA 1N8KA 1HLPA 1XWFA 3GFBA 5A9SA 2VYVA 4MVJF 3OQBA 1DO8A 3OJEA 3D4OA 1CF2O 3C7AA 5BT9A 5T67A 4CQLA 2V65A 4XD2A 3FR7A 4UVDA 5IAAA 5KOIA 2A35A 3HB4X 2AE2A 1LSSA 4W9NC 4A2CA 5DP1A 1XGKA 4CR7A 3K9QO 1PWXA 3K92A 4FSHA 2VWGA 1UP4A 4U6SA 1ZK2A 5L3ZA 1V0JA 1YJQA 3NT4A 3B1JA 2VTDA 1B16A 1SZJG 3E8XA 1GYRA 1IOLA 3ETDA 3LYLA 1GCUA 4E12A 3DBHB 1N9GB 1LQUA 4HY3A 5ENDA 1LDMA 3JQFC 1GQQA 4J6FA 1PS0A 4YT4A 1KOLA 3FRJA 1CRWG 4I08A 1LC0A 1BDMA 1U1IA 3WGTA 4CLXA 4NBVA 2C2XA 2IZZA 2X23A 4B4VA 4NJMB 2YFQA 3TZQA 3JD2A 3VH1A 4OH1A 3RSHA 3WGIA 1R66A 4IBOA 4RPKA 2VZ0A 3U9LA 4PZDA 4PCVA 3PHJA 5A5EA 4RF2A 1CIVA 4RZHA 2QYSA 5DULA 5EERA 5G0UA 3V5NA 3BHIA 1ZK0A 3OJFA 3TZHA 4DGSA 1C1DB 4O63O 2VOJA 3W4IA 1C0KA 3UICA 1Y8QB 3W8EA 3IDSA 4IDAA 1U3TA 3A1NA 4PLWA 3HN2A 4RORA 2GUGA 1HDYA 4E3ZA 3U49A 4FN4A 1ISHA 3WNQA 3L9XA 1B8UA 4FGWA 5AXCA 4J16A 1Q7BA 2YDXA 4LCJA 2JL1A 3GNTA 4RPHA 4IDBA 1NBOA 4KDFA 3X2EA 4YQZA 1MFZA 4J4BA 5L7WA 2JCYA 4CMEC 3RASA 3E6AA 4XB1A 1DEHA 4RO0A 1IHXA 1XA0A 1EDOA 2OUIA 3PTZA 3ZCXA 3S8MA 2WSBA 3EW7A 2IZ0A 2ZYDA 1EUZA 3K6JA 4NK4A 2PGJA 5CPBA 4K6CA 2DPGA 4UVHA 3WYEA 4XJTA 1E1LA 1KEVA 1YBVA 1K6JA 3KEOA 1E3JA 5HTOA 4DLBA 3S2EA 5KJFA 2YDYA 3PI7A 2UYYA 3PQDA 2WMDA 3NT5A 1E77A 3RCBA 3RI3A 2E6UX 1IYZA 3VTFA 5G4LA 4I5DA 2DM6A 1O95A 1X13A 3ZWOA 1SPXA 4BUCA 3F1KA 5TF4A 3TJRA 4O0LA 2X5KO 3D4NA 1XR3A 5KJCA 5CDSA 5KKAA 3ZU2A 3NDRA 3OF2A 3LT2A 3L4BA 2IXBA 1ZSYA 4R1TA 3GUCA 4BO2A 3KUXA 2Y93A 3D64A 1JU9A 2AXQA 4QFCA 3H5AA 1E6WA 3JQDA 3KSDO 2X1HA 3F3SA 4QT0A 3EVTA 4BNKA 4DBVO 1U4OA 2CFCA 3QW2A 3ABIA 3Q9NA 3I9LA 4PLCA 5EL0A 3RKUA 3NGLA 4GKBA 2BD0A 2VQ3A 3DXFA 3GDGA 3KRTA 4FPXA 4II2A 1ISMA 1VE9A 4MVJM 2EP5A 3EZLA 2IDZA 1I32A 4A7PA 5JCJD 1JVSA 4CUKA 3FCOA 4MPDA 1O89A 3PWSA 4OGWA 2H1SA 2DBRA 2I99A 3AUTA 4B79A 3H8VA 4EJMA 5EN4A 3QY9A 3OBBA 1XLTA 3F5SA 5L53A 2R00C 1U2DA 4R16A 1P77A 3OIFA 5I7VA 1D7OA 1FMCA 1FK8A 3MCVA 5T64A 3MTJA 4HUJA 2Q2WA 5GMOA 1ZMOA 4E2ZA 3PIDA 4C4OA 1VSUA 4BNMA 4CLRB 4OKIA 5CDTA 1PZEA 2OL4A 3DEYX 4R51A 3K5PA 1KIFA 5KNLA 1L7EA 1V3UA 3DZFA 4YRDA 2LDBA 1MA0A 3Q1LA 4BKOA 1IL0A 4BMVA 1GYPA 1K89A 2ZB8A 3K73O 1U2GA 2C7VA 3JQ9A 2NTNA 4MVJE 2BH9A 4CLDA 5JYEA 4XDZA 2GZ3A 3FNHA 3L6OO 2X0NA 1HE4A 3VPGA 4YT5A 3BMOA 3HG7A 1YB1A 1ISIA 2O7QA 1ZH8A 4OMUA 4XR4A 1DAOA 4Y67A 3FPLA 1E1MA 2DUWA 5G0SA 3HSKA 4YACA 3TL3A 3RKRA 4UREA 1H2BA 1HF3A 4U7WA 3R6DA 2DFDA 1UP6A 5DOVA 5T57A 3WGOA 4OQZA 4P4LA 4TQGA 4XYMA 2I65A 5TSDA 3VH3A 4BNXA 1PQPA 4FFOA 1GQ2A 1X1TA 1ZMTA 2EHDA 1F17A 2P9EA 2GCGA 4JIGA 4RF3A 4CQMA 4GMGA 1B8PA 4XIYA 3WIEA 5EQFA 2X86A 1R4MB 1TA4A 1ULUA 4M87A 4P22A 4Q3CA 3JQAD 3AK4A 2A4KA 3Q3CA 4Y8VA 5DCWA 2PZMA 2F1KA 3BHMA 2BF7A 1SO8A 1ENOA 2O4CA 1P0FA 3IQDB 1DHTA 1A4IA 1YBMA 5F21A 4AJEA 4YDRA 1WWKA 3CZMA 1RM0A 1LTHR 4R3WA 3ZNOA 1U5AA 5ILGA 4O6VA 1PEDA 1YL7A 1NFFA 3TZKA 1OZAA 3OEWA 4TSKA 4D41A 3RQSA 3VZRA 4HWKA 4J1SA 1R6DA 2C5EA 1E0DA 3DHNA 1LQTA 4IUYA 3UGKA 3KBOA 1DJQA 4JGBA 4A10A 3RUEA 5DF1A 4CJXA 4NBWA 5TX7A 1HXHA 1HYHA 1H2HA 1LSJA 5KWEA 3LC2O 1UH5A 1Z75A 3FI9A 2D4AA 3KB6A 3VKUA 2B4QA 3W6UA 2FSSA 5F5LA 1T26A 1T2DA 2HMVA 3JQGB 5DCYA 2DQ4A 2G1UA 2NV6A 1PX0A 4IS3A 4CV1A 1P1RA 4RQTA 3KYCB 2P68A 1S7CA 4WUVA 1ENPA 1PJSA 1PL8A 1Y5RA 4PG6A 4P4NA 4CMBA 1DFHA 5HS4A 3BXXA 2D3TA 2OP0A 1MP0A 2B5VA 3V2GA 1TI7A 4ND1A 1BSVA 4OL9A 4Y9DA 3A28A 3KM0A 2AG8A 4L4XA 5L4LA 4FJ2A 4YRBA 3UOGA 3GZNA 3UVEA 4J2OA 4ESOA 1BG6A 1PWZA 1JKJA 1ULSA 2ZYGA 3E1KA 3I52A 1NPYA 1DLIA 3ITKA 5JSFA 3L4BC 5JBIA 5ILOA 2HDHA 2QYTA 1PIWA 2D5AA 1VC2A 2CD9A 3BIOA 1I3MA 3OIDA 4NIMA 1DC6A 1MB4A 4XJSA 2OP1A 1KVUA 3E82A 4OQYA 3BA1A 4BGUA 1V3TA 1NYTA 3QRWA 1HDXA 1V6AA 4R3NA 2GASA 3ZHBA 1A27A 4PG4A 4J43A 1R0SA 2VZ9A 1I24A 1YDEA 3IAHA 5CDGA 1Q1NA 3HZZA 1GAEO 2RAFA 2DC1A 4NH4A 1YOVA 2C29D 3UW3A 2C20A 1VLLA 4KOAA 2Y66A 3LK7A 4TVOA 2YHUA 1KBZA 1BXGA 3KOUA 3E48A 3T4XA 4CMAA 4E2WA 3ORFA 5BSEA 4BNHA 3VVBA 4EYEA 2CDCA 3KXDA 3NT2A 3OJLA 2GLXA 2ZTMA 3PYMA 3PZBA 5K6AA 3LVFO 1R12A 3LT0A 1G6KA 3HFGA 4DWVA 2EP7A 2EW2A 1BHSA 1YWGO 1NAHA 5ENVA 4IDDA 4YQYA 2P91A 3WLFA 4ZGWA 3P19A 5HWSA 4MKXA 3CMCO 2VUTA 3EDMA 5COBA 3E5MA 3GC6A 5ICMA 2PK3A 4ZQEA 4BNVA 4M8SA 3ZWXA 4W99A 2BI8A 1IZ0A 3UHAA 1GYQA 3QP9A 1NVTA 3AUAA 4JQCA 3PJDA 4WCFB 4CUJA 3GK3A 3ON5A 1QLHA 4JROA 1GUZA 2X5OA 4L76A 4KQXA 5DN9A 4WK6A 3FWNA 2OMEA 1P0CA 3ZN2A 4ITUA 1AN9A 3ANMA 1I01A 5CHEA 2AEFA 2AQHA 3GNQA 3E9NA 1E1KA 2H6EA 1MXHA 2P4HX 2YZ7A 1H0KA 3U0BA 4DPLA 1VJ0A 1ZSVA 5GZ6A 3BTOA 4AJ2A 3IP3A 2VNSA 3OP4A 3WJAA 3EC7A 1QYVA 4TKLA 1HE2A 4LMPA 3TQHA 3IL2A 4L75A 5FI5A 1V9LA 3F47A 5CG1A 2JFHA 4BNUA 3KVOA 3ZGYA 3AI3A 4ZQHA 1JQBA 2NU6A 1I10A 3RUIA 5L7YA 3AI1A 4U0KA 1O8CA 3QHAA 1XELA 1ADCA 3QQPA 2Q1WA 1W4ZA 1QYWA 1T2AA 1PQUA 3ZZNA 4YAKA 3GEMA 4Q3NA 1YO6A 2RHRA 3KLMX 3ZWVA 1P45A 4XR9A 5TNXA 3NTOA 1H94A 1JWAB 4H16A 4FC7A 5G0VA 1YVEI 1VJ1A 2ZYAA 3ASUA 1HYEA 2YV2A 3SC4A 3BMQA 3FN4A 2OO5A 1PJLA 2QIOA 3UCEA 4CLOA 3B70A 3R0IA 2AQIA 5IZCA 3HFSA 3V1TC 2POQX 4E33A 1K0UA 2XPCA 1X15A 2P5UA 2D0IA 1DBVO 3H9UA 4IGFA 5K9ZA 5T5QA 4ALJA 4Y98A 4I9UA 4A73A 2D1YA 1C0LA 1H93A 4ZQBA 4S1VA 3QE3A 3GMSA 2B37A 2DVMA 5ER9A 2DBZA 2VT3A 1BDBA 1LEHA 1WZIA 5I7SA 1LI4A 1M67A 4Z9YA 2X0IA 3C7DB 5THKA 4IY1A 3PHHA 5HBRA 3GAFA 3DBLB 3IKVA 4PVCA 4UUNA 4NNJA 3AU8A 5CDYA 1HL3A 1SBYA 1UZNA 4AG3A 1J5PA 2BFOA 2X4GA 4HX5A 4AVYA 1RYDA 3DR3A 1OMOA 2BKAA 2EERA 1ISFA 2TMDA 4II3A 3UN1A 1WXDA 4B8WA 4D45A 3C1AA 3JQFA 3MWDB 4YJDA 2HMTA 1L1FA 1HYGA 2NU9A 3QWIA 2G17A 4HNHA 5LDHA 4F3YA 1U3UA 3AUUA 4MVJH 3F9IA 4JP2A 3PJFA 1Q7GA 4D0RA 2QZZA 3GN2A 3WBBA 2GYYA 5BQFA 1ADFA 1A71A 2ILTA 5GZ3A 4R69A 1CQJA 3K96A 4AJNA 2VN8A 1CWUA 2YW9A 2CF6A 3U4HA 3CINA 4NBUA 2V7PA 4RV9A 2Y1GA 4EITA 2YHIB 1KY4A 3DTTA 4EEXA 1FXSA 2F00A 1HEUA 5JDIC 1PGPA 4WNIA 4CM5A 1ML3A 1XKQA 5J23A 3RC7A 4R9SA 3F46A 3O26A 5KIAA 3FBGA 4UEOA 3EMKA 4MIOA 1LBEA 3VC7A 1K6IA 2CNBA 2UDPA 5IDQA 2Q3EA 3QWAA 4GGOA 5G4KB 2J8ZA 3LF1A 4W82A 1HWYA 4GQAA 1BGVA 3W6ZA 5H83A 2VRBA 3BMNB 4UEKA 5JW6A 3DHYA 2NVUA 1PGNA 4UUOA 4Z3DA 5K6AC 2Y1CA 2GRAA 1GD1O 1LDEA 4WLFA 3GDFA 2O3RA 1UXIA 3I4CA 4F45A 2X5JO 1XQ1A 2ET6A 1PJ4A 1GV0A 4RL6A 1LSUA 2E49A 1DAPA 4ND2A 1DFGA 5I9LA 4D79A 1NQ5A 4RVFA 1IY8A 4PLHA 5JCXA 2Q1UA 3NRCA 1EE9A 4FIZA 4IJUA 3KV3O 1JKIA 2C59A 1LRJA 1U8FO 2CSUA 1MXFA 1BMDA 3OETA 1P44A 2W90A 3FBTA 4ZA2A 4AICA 4BMSA 4J2HA 4D3DA 3D4PA 2VUSA 1DC4A 2VOEA 5B1YA 3IUPA 2NACA 3PLNA 5JY1A 5AYVA 4YAGA 1B2LA 5B4UA 3NDJA 1KC1A 3VHRA 1EFLA 1ZFNA 4AJJA 3K31A 1UZMA 4BOYA 1FJHA 1N9GA 4IMPA 5JCJA 1EVYA 1Z7EA 4JXKA 4B7CA 2W4QA 1XQ6A 4OXNA 3TOXA 1TB4A 3KHUA 1ZXBA 4KZPA 2NNLD 4I5GA 2DUUA 3D1LA 3DOJA 5CEJA 4UUPA 3RAJA 3JTMA 3U4DA 5C7LO 4KWHA 4CV2A 1N7GA 4YWJA 4E21A 4GVLA 5L95A 2RH8A 2VWPA 3TPCA 4CPDA 5AXDA 3ANLA 3ZH2A 1JVBA 3IP1A 3WYCA 5DP2A 1YB4A 3WMXA 5A9RA 4DQVA 1CQIA 4BO1A 1LXCA 1BVRA 1EZ4A 1ZCJA 1Y8QA 1FF9A 4D46A 2HQ1A 4RDHA 4L0QA 2OZPA 2VWQA 4YJGA 1NQOA 1DDOA 1G0OA 4Z0PA 4BVAA 1A4UA 3GGPA 3JYPA 2VCYA 3GR6A 1PS8A 5KVSA 4MKZA 4R9RA 4CV0A 2YQ5A 3PYLA 3WFIA 1GU7A 3ZU3A 2PTGA 3I9MA 2W2KA 2HAEA 3RVDA 1GUFA 1EMDA 4YBZA 1E7QA 1YGYA 1B0AA 4PLPA 5TS3A 5IZCC 3V8BA 3W8FA 5I7EA 1N5DA 4Z3KA 4IIVA 1LX6A 4K9DA 2DFVA 1E92A 3LU1A 4U6QA 1HSOA 4U8GA 2PR2A 2J3HA 2Z95A 3WQRA 2HMUA 2X58A 4K28A 4URFA 1O94A 1VRWA 1F8GA 1O6ZA 4LN1A 4E0BA 1EVIA 2Q1TA 4ROSA 2QHXA 1PJQA 1KVRA 4I1IA 2H9IA 2ZTVA 5KVQA 2GSDA 2ZK7A 5L51A 2BFAA 4CM8B 5A03A 3JQAA 2BELA 2XF8A 3ROMA 2Q46A 3SXPA 2B4TO 4Z6KA 4KTTE 3UCFA 1ZXLA 1DIGA 3MOGA 4OOEA 3WGGA 1VKNA 3WGQA 4DPMA 1LNQA 5TLSA 3DZHA 5FFFA 4EEZA 1BXKA 1WMBA 1LDBA 4BNGA 1WPQA 4MVJD 4E13A 2QQ5A 1EBUA 2Y0EA 1HRDA 4YJFB 2JD1A 4CODB 3DBVO 3V1UA 4CM1A 4CM3A 1X7GA 3HB5X 1NQTA 3WYBA 1HLDA 5C7IO 4FOOA 3D5TA 5LDGA 4LVUA 5IZ4A 4XX0A 1T2FA 2IODA 3VPSA 4O59O 2WD7B 1OC4A 1O0SA 2I5PO 1MFPA 1WNTA 4LGVA 2VTEA 3A06A 5DT9A 2BMAA 3AWDA 2A94A 4WECA 3DZJA 4JX8A 1UXGA 2PNFA 2YYYA 5I9NA 2FR0A 1W6UA 1TT7A 4KDEA 4O1MA 1NP3A 4B4OA 1GCOA 1ZK1A 5IN4A 3W4JA 4E4YA 3I4FA 2QRLA 5CDUA 4FJ1A 1HE5A 1UUFA 5CG2A 3AW9A 2RH4A 3H9JA 5LCXA 4QFDA 3K8ZA 1RM3A 3DAPA 1ADBA 3E9QA 1NQAO 3T7EA 4CLRA 1NFRA 4GWGA 3OEYA 5ER6A 1R0LA 1PJCA 2AQKA 4RZIA 3QWFA 3SJ7A 4HP8A 3PXXA 5C37A 2WYVA 4D7AA 7ADHA 4O5OA 1AUPA 4KUEA 4CMIA 3GVCA 4PZCA 2O2YA 3TOZA 1ZJYA 3BZUA 3GNSA 3JYNA 2XXJA 2VZ8A 4WASA 4BKRA 2G0TA 5C7OO 2FMUA 1WP4A 5TQVA 4ZJUA 1UAGA 3ASVA 3TFQA 4JJGA 3LC1O 2EWMA 4EW6A 5A9SB 1I36A 2O48X 4DREA 1V3VA 4CR8A 2NU8A 4CL8A 3N74A 3H3JA 1ZKMA 5HA5A 4FBGA 5IDYA 3NEPX 3BAZA 4M49A 3UCXA 3ZWNA 4OXYA 2IEDA 4RLHA 4KQWA 2J5QA 3HADA 5KVCA 4IINA 3S1LA 1OI7A 1R4MA 2C5AA 2HJSA 3Q6IA 4D0SA 3DZKA 4YXFA 2FOIA 2PD4A 2JHGA 3QV1A 2JFFA 4I8XA 3ZHXA 1P3DA 2O4UX 4RVSA 2IRWA 5ITWA 4KWIA 2J5RA 3JQEA 4J0FA 1SAYA 2OGUA 3R3SA 2JAHA 1PZHA 3MJCA 4DIOA 3WTBA 4GLOA 4GWKA 3GDOA 1VPDA 2V6FA 5F3RA 1PR3A 1I2BA 5KVVA 3F5QA 1T1SA 1S6YA 2DKNA 4WLUA 4B3JA 5L4SA 1IPEA 4TWRA 3E03A 3CEAA 1C14A 5CFZA 3VH2A 1IZ9A 1ZSNA 3AUSA 3JQGA 3QIVA 4OAQA 1X0XA 2ZCVA 1J49A 4FCCA 3H9QA 4IXTA 3DQPA 3RROA 4EDFA 2XXBA 2DT5A 2B0JA 3WQQA 4GX2A 4OO3A 4RPLA 3KYCA 1NAIA 3OICA 3MOIA 4R41A 4D3SA 2BFMA 1I3KA 1WLYA 2EEZA 4LVCA 1EVZA 4YT2A 1U7HA 1B7GO 3LC7O 4XGNA 5A9TA 1V35A 3V2UA 1EUCA 2Z5LA 4JN6B 4FB5A 3WSVA 1KEPA 1GDHA 2PLAA 4GKVA 4FFPA 4XZ3A 4BO0A 4DYDA 1XCBA 3R1IA 4B7UA 5JO0A 3QVXA 4H7PA 1NXQA 4J90A 1HDOA 4ID9A 2JFGA 2E48A 2VNAA 1DIAA 5TT0A 4OSPA 4LRTB 5IDWA 2X9GA 3DL2A 5KKCA 4Q3BA 4BB6A 2ZCUA 5CEFA 2PKRA 2IYPA 2WM3A 1IB6A 5DZSA 1EK6A 4YT8A 2WEKA 4A03A 1U28A 4EBFA 3PWZA 3INTA 3I23A 1JAYA 1MV8A 1RM5A 1QRRA 3AOGA 4BO3A 2ZTLA 3PP8A 4OKNA 4YR9A 1EE2A 2ZB4A 3QA9A 2Y99A 1GZ4A 5TC4A 5KJ1A 2B4RO 1NWCA 1GTMA 3NX4A 4ZU3A 3H5NA 3CUKA 3JSAA 1X0VA 2Y1OA 2VUUA 2PY6A 3JQBC 2Y1EA 4AJ1A 2UUPA 4BO8A 3FWZA 2I66A 4MP6A 1JW9B 2NQ8A 3FTPA 1P33A 4XWYA 3WIDA 2DBVO 1N92A 1EBFA 1ZEJA 4MO2A 1D3AA 1Q2XA 1ZEMA 2G76A 2V6MA 1VSVA 1SOVA 4J4HA 5JDCC 4RQUA 3K2BA 5JLAA 2X8LA 1LRLA 3WBFA 4FFNA 3BTUA 5COQA 4EI2A 3ONDA 4UUMA 1E5LA 3TN7A 1AXEA 2GN6A 1IE3A 4YYZA 6LDHA 3UUWA 8ADHA 3MEQA 3DHEA 3LT4A 3WGZA 4FS3A 3LZ6A 2Y0CA 3UKOA 3INGA 1KVQA 4LRSB 3RU7A 5BNFA 5H82A 5T6BA 1KVTA 4J3FA 3VDQA 4H15A 3PHGA 5B12A 4WCFA 1HDCA 2G5CA 4BGVA 2TMGA 3JCZA 4BO6A 1DFIA 1K3TA 5AQ1A 4GX5A 3NYWA 2HMWA 2X7HA 1HTBA 4ILKA 1VJTA 1C1XB 1UZLA 2WDZA 1XHLA 4CLHA 1QMGA 4J7CA 3Q2KA 4K1LA 1VKOA 1RKXA 3GRKA 4ONEA 3DWFA 3AY7A 3ENNA 2X6TA 3ETGA 1MGOA 3H9GA 2BI7A 4ZICA 4NI5A 5JO9A 2GO1A 4FGSA 2W2LD 3F6YA 2OORA 5JXWA 2JD0A 1XG5A 1P1IA 1OOEA 1E3WB 4ND4A 3OA2A 3H7AA 5JDIA 2CVQA 3KEQA 1LJ8A 1X7HA 4J4TA 4NK5A 4CUZA 3OH8A 5AOVA 4GBJA 3DAGA 3AFNA 3R3JA 4DTIA 2VHWA 5CAEA 2YV3A 1ISJA 5ICSA 4FW8A 3QVWA 4WPGA 4CQMB 5IF3A 5A3VA 4FR5A 1PZFA 4LMRA 4NFSA 1QV7A 4ZQGA 5FF9A 1YE3A 3FR8A 1FDSA 1NNUA 3WMWA 1DRUA 2JD2A 3RUDA 1CJCA 1PR9A 1TT5A 1K6XA 1HZZA 3Q0EA 3IC5A 2YJZA 3OSUA 3DZIA 1NR7A 4PG5A 5B4TA 4F46A 1MC5A 2XAAA 4E2XA 4XEHA 5IXSA 1EEHA 3P2YA 4IXWA 3EHEA 1MUUA 4MDHA 4BIIA 2HK7A 4GX0A 2ZJ0A 3DAFA 4WE3A 2RCYA 1AGNA 1E7YA 3FTNA 3NJ8A 2GZ1A 4CLEA 1UDBA 3VDRA 1EQUA 3OMLA 4L4RA 4R5MA 1ENZA 1LLQA 2BLLA 3UAGA 4U0JA 4YTEA 3DBLA 5MGBA 2IE0A 3O8QB 2V6GA 3CH6A 5A02A 1LU9A 1RM4A 3H4VA 5HRUA 4YJHB 4IQ0A 4UULA 4D3FA 4A26A 2B69A 2O3QA 3L07A 1KERA 3KYBA 1LSOA 3W8DA 3U3XA 4HKTA 3GGOA 3LQFA 1I2ZA 3TSCA 2C82A 2V6BA 2YQ4A 1YQXA 4BMNA 3QJ5A 4A27A 2JCVA 1QSGA 2WTBA 3O38A 4XGKA 4TROA 2FPGA 1GFSA 3ZDFA 1Y7TA 4KUGA 4MVJI 2HU2A 4Z0HO 2AMFA 3DTYA 4G5HA 4B4WA 2LDXA 4AL4A 1I3NA 4U5QA 3VPXA 3VH4A 1YB5A 1E3SA 4XKJA 1N1GA 3ZV6A 1DSSG 4FC6A 1GADO 3FD8A 1FDVA 3WWZA 3ANNA 1YQDA 3C24A 4NFHA 4R1NA 3D7LA 4IDFA 1I2CA 1NR1A 3WSWA 2WD8A 1VM6A 3OM9A 2PZKA 1E7SA 3VZQA 4AJOA 4XB2A 5G4KA 1QYXA 5G0TA 1VI2A 4YVFA 3MJ4A 3PHLA 2EF1A 3H65A 4NBRA 2CDBA 3BMNA 2CVOA 1P9LA 4Q3EA 5TJ9A 4TKMA 4XYBA 3GEGA 1W8DA 3RUHA 3VTZA 1MLDA 4CM4A 3CZRA 2O2SA 5U4QA 3ITDA 1H9BA 4K6FA 4CMGA 1E3IA 4E5YA 4ND3A 7MDHA 4DC1A 3I9OA 3RFXA 1M75A 4UVGA 1X7DA 3TRIA 4BNNA 3GPDG 3HDHA 2D2IA 1H5QA 2EG9A 5TT1A 4BO9A 1BXGB 3AJRA 3NTQA 1NHGA 5IXYA 1Q0LA 1ISGA 4LSWA 3N58A 1QORA 3WJ7A 2J3JA 4TVBA 2O7SA 3QLJA 5JC1A 3LSYA 1H6AA 5B4VA 4WOJA 3COSA 1OC2A 5A4DA 4XQ9A 1ZK3A 4MVJA 3EUWA 1LA2A 3DFUA 1ORRA 4ZQFA 4FJ0A 2NWQA 2PGDA 4HFRA 4YAJA 3IS3A 4WCFC 1Y8RA 5DOZA 1Y6JA 2SCUA 4K26A 1I30A 1NPDA 4JBGA 3HWRA 4OYRA 3HDQA 1LLDA 1T4DA 3TL2A 3PK0A 1Z45A 4RVHA 3M1LA 2PV7A 3H2SA 5DBFA 4MIYA 3JQ8B 1NVMB 2Y67A 1MX3A 3BMCB 4UVIA 5FEUA 1CDOA 3V1YA 1DJNA 4RCVA 3MTGA 3S55A 4J9UE 4QO7A 1PSDA 1R37A 3DO5A 2NQTA 3OFSA 5BR7A 1ZZEA 4RF4A 4DIFA 4BGIA 5IFLA 1WVGA 1CYDA 3VVCA 3W4KA 2CVZA 4TMFA 1UR5A 5JAIA 1M66A 2X0RA 1ZBQA 4JCOA 1QKIA 1G0NA 4GLLA 4Y6PA 2O50A 3CXRA 2HJRA 3F4LA 4JLWA 3GZ4A 8LDHA 1N7HA 3C7CB 3IJRA 4WJZA 4N5MA 1HETA 3EK2A 1KS9A 3M2TA 2OHXA 1CEQA 2DAPA 1PGOA 3U62A 4CM7A 5JNLA 3AI2A 3HE3A 1UDCA 1DB3A 4OIMA 1O5IA 1QR6A 4IJWA 2EW8A 1SNYA 5T8KA 1I0ZA 2ZB3A 2EGHA 3S2IA 1RJWA 2J5KA 3IIEA 3WQSB 1GL3A 2CY0A 1P74A 1HT0A 3PWKA 5F1KA 4BO4A 1DIRA 4N54A 1ID1A 3E5RA 2HMSA 3G1UA 3PIIA 5L4NA 1DIBA 3CKYA 5AVOA 4Q3DA 4NMHA 3DFZA 4AJPA 3D3EA 1BW9B 3H3FA 3ZHYA 1I8TA 1XSEA 5HM8A 3NKLA 3OJ0A 1QV6A 4PLGA 2W98A 3M2PA 3ICCA 1N2SA 3UXYA 3RD5A 1LDYA 2O3TA 1PQWA 1T2EA 1YH3A 4R1UA 1OAAA 4EJ6A 3ZNNA 2HCTA 4CLOB 4GSKA 4MOWA 4MP8A 3RWBA 1EDZA 3GY0A 3ONEA 3L77A 3T7CA 5TIIA 3MJSA 1PJ2A 4WGGA 2BGLA 1B26A 2J3IA 4WLNA 2PZLA 4Z0TA 2BGMA 2GGSA 2E4AA 1YL6A 4M55A 4CR6A 5CEEA 2OOSA 2O3SA 1A9ZA 4D43A 4XA8A 4UEJA 3OA0A 2JHFA 1DC3A 5KCZA 4AJ4A 3DBHA 4HFMA 4Q9NA 3P7MA 2UUOA 1DXYA 4IQ8A 5TJHA 9LDTA 5L7TA 4DLLA 4W7IA 2ZIZA 3QVOA 4RPJA 2Y0DA 3O9ZA 4NJMA 4YJFA 4QO8A 4EUHA 3LDHA 1BVUA 4I5EA 3ZV3A 3O03A 2YY7A 2B5WA 4H3VA 3AFMA 2P4QA 1AXGA 3WLEA 1QLJA 1XU7A 2PWZA 4DUPA 1ARZA 4J1QA 2VRCA 2WD7A 3NAQA 4KP7A 3ULKA 3WS7A 3GRPA 3I9NA 3X2FA 1RPNA 4DA9A 1C1DA 3C8MA 3GLQA 1QP8A 2Z1NA 2FPIA 3JD0A 3ZWYA 4OXKA 1SB8A 4J49A 4UAGA 4LISA 3AM3A 5U1PA 1M6WA 2FRDA 1EK5A 5JAQA 1JA9A 3ROKA 3MZ0A 5BNIA 1UAYA 2OXIA 1PGQA 3P2OA 4EZBA 5THQA 1R4NB 3FSRA 1Q0QA 1ZVMA 2I3GA 1CERA 3STHA 1M6HA 3ROPA 3MJTA 2Y1DA 3GOHA 1GR0A 2A92A 1A5ZA 2NM0A 1B3BA 5H81A 5BNTA 4RPGA 3PLRA 3NTRA 3WGHA 5A1TA 2FZEA 4GVXA 1ZW1A 3PPIA 2QX7A 2NTVA 1T2CA 3KZVA 4E32A 4HNGA 4BV8A 4XQGA 1YQGA 3DB2A 4AFNA 2Q2QA 5LC1A 5I7FA 1HDRA 2WE8A 5CP8A 2FN7A 3SLGA 1HSZA 1TVEA 2NLOA 3D0OA 3SEFA 3DBRB 2IYOA 3PJGA 2GERA 2Y05A 3N7UA 1U5CA 3RBZA 1KEWA 1JN0A 3H9EO 3GUYA 3AU9A 3KSZO 2HKIA 1A7KA 2WYUA 3KYDB 4BKUA 1X1EA 3ONFA 1LDGA 5B37A 2WWRA 3KTDA 1NPTO 2WE7A 5A05A 3RBXA 4CMCA 3WTCA 2AE1A 1RYEA 2BHLA 3NGXA 4ALMA 1DC5A 2PH5A 2VHZA 1B15A 4NZ9A 1X14A 2NSDA 4PGFA 4GAEA 1E1NA 1GPDG 2HO5A 2PFGA 3GF4A 2BRUA 4G65A 2C54A 4R68A 4LK3A 2VHXA 3A9WA 4XYEA 1NX6A 4ALNA 4B7XA 4DLAA 3P5SA 5I9MA 3JD1A 3SJUA 1D1SA 1CETA 1MG0A 4E5PA 5JS6A 3JQBA 5EPOA 3RIHA 3D5QA 5T8KC 4HFNA 2FP4A 2QW8A 2W8ZA 4FFRA 2PD6A 4PG7A 1PL7A 5JE8A 4NJOA 1UXJA 4IGEA 4PZEA 5JDCA 3ZU4A 1U4SA 4MIEA 3FNGA 2Q2VA 3ZWPA 2Q50A 2BGKA 1PJBA 4IJKA 3WNVA 1NFQA 4YJGB 1DPGA 5IJZA 4QXMA 4C7KA 3C85A 2E82A 3JQ7B 4E5MA 2ZATA 3U4IA 1RWBA 4TRMA 3PZRA 3FNFA 4E5NA 3HDJA 1SOWA 2W2KB 2C0CA 1HKUA 1B3RA 1T1RA 1H6DA 2JKVA 3G1TA 3U4CA 3JQ6A 5EIOA 1H6CA 3ETEA 3GVXA 4IZIA 1WDMA 2W2LA 5EMHA 4M86A 3D3WB 4YEDA 3ZW9A 5JMPA 2Q49A 1Q7CA 3GAZA 4PIVA 2AHRA 5IDXA 1Y9AA 2AG5A 1XEAA 3GVPA 4WEQA 5C3MA 3JQCA 2HUNA 4E31A 4HBGA 1YKFA 4CQLB 1MC4A 1V8BA 3TZ6A 1UXKA 3PGJA 1VL0A 4HXYA 3C3XA 4XRRA 2HRZA 5JC8A 1C0IA 5K0ZA 3WX0A 4W4TA 2D8AA 2GF2A 4DC0A 1XIVA 4QX6A 4NR0A 4E30A 3JQAB 3RUAA 4YAIA 2C2YA 4QECA 3SX2A 2UV8A 1TXGA 3TDKA 2J3KA 4NU5A 4XGIA 3L6EA 2YUTA 2JCXA 4IDEA 2FY8A 4PRLA 5C5IA 3H5RA 4ZD6A 5JFOA 3C1OA 3ZNQA 2X9VA 2FWMX 4MVJG 3ST7A 3SLKA 3ZU5A 2A9FA 5EESA 3ZWCA 2EXXA 4XQEA 2D59A 4N5NA 4ZN6A 4D42A 1JKFA 1Y5MA 5AXBA 2DLDA 1ZK4A 2B83A 2ZB7A 3HDYA 3QVSA 2DPHA 5A06A 4WLOA 5BSGA 4E2YA 1P1HA 4DPKA 3I9JA 1J4AA 1GPJA 3KETA 4BO7A 1UXHA 1R15A 4FFMA 1F14A 2VRCD 3IOYA 4LW8A 4ALLA 3GH3A 2YV1A 2EJVA 3GFGA 4GPD1 3FHLA 3NJ4A 4DVJA 1K2WA 3DC2A 4JBHA 3EZYA 2RBEA 2XOXA 3BTVA 2R2GA 3GA0A 1U3WA 4EUEA 2NUAA 5JAZA 1PU2A 3DMTA 2PZJA 3AOEA 4I5FA 4ND5A 3PJEA 2ZQYA 3JYQA 2CMDA 5U9CA 4ZRNA 4L74A 3OQ1A 1XDWA 3PQEA 4Y6SA 4YAEA 3GEDA 4QQRA 4WKGA 1EVJA 3RUFA 3L4SO 3T4EA 3IKTA 4XDYA 1SEPA 1SC6A 5BSFA 1ENYA 3JYLA 1DOHA 1GZ3A 1GEGA 1NWHA 3GQVA 5BSHA 4FQ8A 1T25A 5JY6A 3FNEA 1TEHA 3DONA 3KO8A 4FD3A 4M1QA 1C1XA 2B36A 1EFKA 1FDTA 2EKLA 1U7TA 2X22A 4BV9A 3LT1A 4J7UA 3NUGA 4NU6A 1ZUD1 2Q99A 1M76A 1F0YA 3I6QA 1WW8A 3I9KA 3JV7A 4IM7A 5I8WA 3EVNA 1VL6A 4CMIB 5AXAA 1OBFO 2GZ2A 4X54A 3HHPA 3GMDA 1UJMA 1Y1PA 3C1TA 3K30A 4JNKA 1DRVA 3PGXA 4BHTA 1U3VA 4L4SA 1I33A 1B8VA 2NVBA 4QEDA 3Q9UA 4KTVE 4PFJA 3L0DA 1E3WA 2JJYA 3AM4A 2CDAA 2PGLA 3DZGA 5DCUA 2FHSA 4G2NA 1D1TA 1G1AA 2VYVD 4DMLA 1HDZA 5GZ1A 4QSMA 1XYGA 1JTVA 1I5RA 3O4RA 2GNAA 4HV4A 3OHSX 3TFOA 3MJVA 2PKQO 2OBYA 3U09A 2PA3A 2VWHA 1FDWA 1BXZA 5DBIA 3HUDA 2QZ9A 5ADHA 1YBAA 2EKPA 1LLUA 5JPIA 3VKVA 4DL9A 1JAXA 2PKQP 5F1PA 4B3IA 4HFJA 1Z73A 1HE3A 4MKRA 1WMAA 4L8VA 1J0XO 1GZ6A 1JWBB 2I76A 4PLVA 4A5OA 3ZV5A 4DQUA 3EY4A 3GT0A 1E3EA 3CE6A 2X0JA 3LLVA 3ZNPA 4KUHA 4BNZA 3RBVA 4YPOA 4RGBA 5KTKA 4CM9A 4W6ZA 2EGGA 2OFPA 5JMWA 2Q4EA 1KEUA 4PLFA 4BQRA 1YL5A 4BO5A 3O8QA 4R1SA 1ZJZA 3WR5A 2O3UA 1SMKA 2AA3A 1NVGA 4Q3AA 4CL3A 1Z82A 2EV9A 1Q0HA 2CZCA 2IXAA 4YJHA 1I3LA 3PYXA 4G81A 4NPCA 5IN5A 3GG9A 2I9PA 5DDIP 3M6IA 3B1FA 4MJLA 1LC3A 1BWSA 4I9HA 2GN8A 2FR1A 3BMOB 3FPCA 2D5CA 4EGFA 2DU8A 3A14A 1E6EA 4OJNA 1R0KA 3IMFA 2E37A 2C7GA 4WNCA 4EJ0A 4GI2A 1Z74A 3AM5A 3ZWAA 4YB8A 3ZWWA 1AE1A 3I1JA 4J0EA 2QG4A 2EIHA 4R4JA 4PN3A 1Y9EA 2EKQA 1NASA 1EUDA 1LLCA 2QRKA 4MINA 4MVJP 2CF5A 2GDZA 4CMJA 4DYVA 3WG9A 4MP3A 2Y68A 1A9YA 4IMRA 4INAA 4CV3A 3PRJA 2HLPA 3NV9A 5ITVA 1GV1A 2GPTA 2VHYA 5L45A 3HQ4O 4P4GA 5L9AA 4AJIA 3RFVA 4M89A 3OECA 3WDSA 2HSDA 2I3AA 1YJ8A 3EYWA 3AY6A 3BTSA 3W1VA 2RHCA 3GGGA 3DMYA 5KJ6A 3DMTC 3AOEC 4BNIA 2I6TA 1R16A 4BL5A 3RC2A 4TZKA 1H9AA 1OFGA 3M1AA 4BNLA 2NU7A 2O3JA 4JBIA 1HDGO 4YCAA 4P38A 3RJ9A 3WB9A 2WJPA 4BB5A 3UFXA 1GQYA 4LCEA 2Z1MA 1LDNA 4RVGA 2ZTUA 2NVWA 4Q39A 3ADOA 2NTJA 3AY3A 1NM5A 2BFPA 2YFHA 3DOCA 4NDNE 4UVEA 1ONNA 3JQ8A 4OSOA 1KC3A 3BMCA 5DBGA 5CPFA 4CMHA 2VHVA 4L9RA 1ADGA 1KYQA 3RC1A 1PS9A 2HRBA 1Z7BA 4QUKA 3H6KA 3JQ9C 4XIJA 5A3JA 1A72A 4W7HA 1M2WA 2G82A 2B35A 4XRGA 1GEEA 2ZKLA 3Q2IA 3Q11A 1F06A 1QG6A 5A5FA 4BNTA 4Z9XA 3ZV4A 4S3MA 3GPIA 3GZNB 3PDJA 2YHIA 4DMMA 2DTDA 1BTOA 5KJEA 4J9VA 3WFJA 3L6DA 3HNPA 3B20A 3PHIA 4IJVA 4L73A 1YXMA 1ZIDA 1XU9A 3VPHA 2NADA 1FDUA 4RVUA 5G0WA 1A7AA 3ADPA 1C0PA 1O9BA 3LLSA 1C3VA 1HZJA 1P31A 5ES3A 2Q4BA 2R6JA 1PJ3A 2AEMA 2X9NA 3ROQA 3CSDA 2FZWA 1JDJA 3I5MA 2DTXA 3PEFA 3E18A 4BQPA 3TWOA 3JYOA 3GN1A 3ZW8A 4PRKA 4Y6RA 3U5TA 1YOVB 1WDKA 5F1OA 1TLTA 3G17A 1BW9A 2VYNA 1BRMA 1Z6ZA 2P9GA 4J7XA 1QYDA 3PQFA 3WICA 1E7RA 1KETA
chains in the Genus database with same CATH superfamily
3STWA 1DBRA 2OHOA 3U7IA 1EVQA 3U48A 4DLXA 4BNWA 2B6HA 1OB2A 4LY3A 3AHCA 1EQ2A 1D0SA 3KLPX 2CFOA 2XYPA 2FETA 4M60A 4DQXA 4PYJA 5C53B 4TKUA 1IULA 1Y81A 3VNQA 2J4DA 3NWEA 4DXHA 1IHUA 1TT5B 2ZT6A 4WLEA 1UP7A 1L8OA 1UMKA 4QG3A 3SVTA 1M7BA 2FQQA 1G4UR 3QU7A 2GAJA 5E1MA 4OCZA 3LXRA 3QOYA 3ZCPA 3ENKA 1TA9A 5C51B 3OOJA 1DS6A 1KEZA 1N0IA 4GOXA 2C8KA 5TMDA 2HHCA 1LPOA 3EFEA 2VAWA 4YHBA 3GLFA 1N2XA 1I7DA 3L0SA 1QVWA 2FVYA 2B2NA 3A25A 3HJRA 1OB5A 5GJBA 4UNNA 4X8OA 4JK3A 4C04A 5AIBA 5KB3A 3AXSA 3KAQA 4MRVA 2MSDB 3PC6A 4Q18A 4ANFA 4TS4A 4IPTA 1EP3B 3SD7A 3VU8A 4KO1S 1E3DA 5JAMA 1XE3A 3S2GA 2C1XA 1AKNA 5B3AA 4QTTB 1GAWA 4ALKA 2HPVA 3D2CA 1TCUA 2VNIA 1OV6A 2XUDA 5DWDA 3KR0A 3HKEB 3TZCA 2E1RA 3TOVA 3IUSA 1Z7WA 2K2WA 3ASYA 3NXKA 3OOWA 3DUFA 1RADA 1SWVA 4XYGA 1DWUA 3RSOA 3I9V6 3SQDA 4W9NA 2WBLC 2VDUE 1JFFB 1X70A 4IH4A 4Y1FA 5ECYA 2INGX 4EF4A 5AESA 3UJNA 3BWMA 4OLBA 4MR8A 2RIRA 4P81A 5FWYB 2O0MA 4E1BA 3ZDAA 4E70A 3NDIA 2MOKA 3QPBA 1IPHA 3KZ1E 1X7WB 4KJZA 1KI9A 4U02A 4UM8B 4YRAA 1RI4A 1N9KA 1A9RA 2VPTA 5HYVA 5IC5A 3ZGVA 2H51A 3HV0A 1FVFA 2FMHA 4FZJA 4GQIA 1V7QA 1JHDA 1UDAA 1QUFA 1JDZA 2VDQB 3AEQB 3MINB 5ADUS 1JR3A 3BHNA 3M4ZA 2G9QA 4M2LA 4M3NA 5HRCA 3WWOA 4Q9JA 5ERXA 4U3JB 2QAGC 1QCZA 1NRXA 1TTQB 2FE1A 3B8HA 2ZIFA 3G49A 3L04A 4X1YA 3ZI0A 1R4NA 5JROA 2BSQA 4W1QA 1X8XA 2NU6B 4YXFA 1KSFX 1C2TA 1UFVA 4ZGGA 4NDZA 3Q7QA 3IE2A 2VJBA 1F12A 3H2HA 3QVTA 2FPPA 3THRA 4XIGS 3OIGA 1HYQA 2XYGA 1BXRB 5LQSA 4FZRA 1N78A 3CFYA 5HZKA 2GM5A 4JU8A 1NJGA 3C3EA 4QA9A 3RRNA 4K9RA 2BEWA 4F8JA 5GY7A 1LB1B 1P1JA 4ARVA 4ZJYA 3HK2A 5E6SA 5BWBA 4QOGA 1OYVA 3GVIA 3BMQB 4B8ZA 1B0ZA 1GCAA 4M83A 2CMGA 4KQ9A 4IIUA 1CUDA 3CBGA 3DEFA 5F5NA 5GZ3A 4LZWA 2IYRA 1NDQA 3KV1A 4IDCA 5A3SA 3EGCA 4HDSB 1MU0A 2HT6A 3NYQA 5A04A 2PUWA 3EIOA 3HXPA 3P2JA 3UF0A 3MIIA 4F6RA 5IAJA 4MAFA 5CT5A 4TV8B 5SY9A 3IOBA 2FX3A 4ZFNA 1CD5A 4JODA 4F6LA 1J20A 5ULLA 1X42A 3UWDA 2GD1O 4EW1A 3HJTA 3VYRB 1KYYA 3G0IA 2JGNA 3ABSB 4MULA 3OG9A 1X1SA 3TQRA 3ZCVA 1XTQA 4DEVA 4IS2A 3GJ8A 4IDGA 4YROA 3BSWA 4E5VA 2PD3A 4RHCA 1J6UA 3RF6A 3FOBA 5DNDA 4UCQA 2Y8EA 4UM9B 3A4VA 1MEEA 3JQRA 4J91A 1YI0A 3SMVA 1SR8A 4MO9A 3BJIC 2ID7A 3AETA 4Y18A 2WF5A 3B6ZA 4WOKA 4TRRA 3T1TA 1GZVA 4FDTA 1TTTA 3IEUA 5H9WA 3MBKA 3ND9A 4ES6A 1S7GA 5IW8A 4DJJA 4UDYX 3R7AA 1GILA 2ODNA 4B3HA 1LPPA 4HGQA 2AJBA 4FMDB 5DRYA 1G4HA 4Y1RA 2VJKA 3T52A 4CMKA 2ZJ1A 1K8ZB 4YS6A 4X1IB 1L7VC 1DT3A 3GD7A 4RDIA 4WLVA 4RJTA 1HG0A 4M22A 4TLCA 1T4BA 2CLEB 2GZDA 2FSVA 1RWQA 4RLSA 2ZM6B 1PJTA 1T3ZA 3X1YA 16PKA 1X87A 1T35A 3R41A 4OREX 1C4OA 1RQNA 2ZQZA 5AVZA 4RGYA 3SZUA 1OFTA 1P1KA 1P4GA 4MV5A 4A4DA 3QXHA 1IOWA 4QTZA 2C2BA 2B1GA 2Q5QA 3F49S 3TBHA 4L51A 1SXQA 2Z4TA 4BKMA 1B4DA 5EJ6A 1DDGA 3VR1A 4ZHSA 4UBLA 4FGKA 1MDBA 2Q27A 1J97A 2CL6X 2YC2C 5G2OA 3GLRA 3TW4A 4F2HA 4D4MA 4NFYA 4RH0A 2XTNA 4ZPJA 1OIXA 4M54A 1Z13A 1PK9A 4REQB 4QQNA 1DTWB 3TNLA 1NVDA 4OGLA 3S2UA 3WGLA 1P2FA 4C43A 1GXSB 1SU6A 2RGAA 4JI6B 3TX6A 1D8AA 4HAOA 4BKPA 1IVNA 3NEYA 4G4JA 4IO0A 3DLCA 5A4IS 3CG4A 1Y33E 1NW9B 2KX7A 3GVHA 2OZLB 5B7GA 2O59A 2VATA 4NESA 3VAZA 3K70B 3HO1A 5BYBA 1NVAA 3HN7A 4TV8F 3R75A 4N5LA 1RBYA 1IUKA 1VMAA 4LHXA 1JXMA 4F12A 3E1GA 5CA1A 2R96A 5A9SA 5TQ0A 1YQEA 1CHNA 2WTUA 3QE2A 2HPZA 3HCAA 1CS0B 1DO8A 2RG1A 3E61A 2QNBA 2O06A 3N0WA 4LDRA 3MLAA 5ITZB 4XD2A 4AN4A 4BFVA 1A8UA 4YDQA 3FR7A 2I7DA 5IAAA 1SXHA 2PN1A 1K75A 4E14A 3HB4X 2VS1A 3D7KA 2AJCA 3LP6A 4A6XA 2IHNA 2VWGA 1BQ4A 1UP4A 4TQAA 5JWHA 3ESRA 1WHTB 3RNOA 1IN1A 5EQJB 4AZVA 4FBMA 3NT4A 2YIJA 3BWXA 3P9QA 3ZZ1A 1T91A 5CM8B 1I14A 3B2NA 3LYLA 1GYRA 2YWJA 3W2TA 3N6VA 4XVCA 4UE3S 2JLWA 4TZ6A 1PF7E 3TTWA 4HY3A 2ODPA 1E5TA 3JQFC 3V32A 1N2OA 5J1SB 3PEUA 3FZEA 1L7RA 1LC0A 4K2AA 4BC1A 1BDMA 1DJPA 4CLXA 1M1YA 1XK6A 5K0CA 1JJAA 2X23A 4MWDA 4NJMB 2YFQA 1QH9A 2SHKA 4LOLA 1QFXA 2WF7A 3K9CA 1AG9A 4OH1A 3RSHA 1Z4OA 3WL4A 5HILA 5EJGA 3R7DA 4B82A 1Q12A 3DVQX 4FEYA 3D2AA 1OTHA 2Q3MA 3ZZTA 2B94A 1MN6A 1JLKA 2QYSA 1TVKA 4JSTA 2UZIR 1CLUA 4QDZA 4V38A 1AKTA 3J7TA 3DD1A 1C1DB 3HJGA 2VOJA 1GTVA 3ZXUB 4NS4A 1FY2A 4HAXA 2CYBA 2FPIB 4BQIA 4I8DA 4RORA 1A9QA 3H5IA 1M7GA 3KDAA 2A0KA 4DAOA 1HDYA 4ETWA 4F92B 2D54A 4Z8XA 1U7ZA 3WNQA 2PIDA 4R2HA 2QQFA 1VDMA 2R62A 2ZWIA 1M33A 4PSCA 4FGWA 5D2CA 4J16A 3TS1A 2JL1A 3D4IA 4UU1A 5DX1A 1VKHA 5KUTA 2Q3DA 5A0FA 1H9CA 4IDBA 3PQ5A 1KY3A 3U3RA 1NBOA 2AUMA 2C7RA 3EMDA 5KTOA 1B73A 1U0SY 2B92A 5L7WA 2JCYA 2PWYA 2C7OA 3DLTA 3RASA 2BKVA 2GFIA 5CM2Z 5FPPA 2RARA 2RHOA 1CIPA 3VI3B 2QDXA 1IHXA 1XA0A 2OUIA 3ZCXA 2PO5A 4NEQA 3TCXB 3WMFA 2XJ9A 1C0EA 4UHDA 3S8MA 2CHFA 3K6JA 4P7FA 3AX6A 1XAJA 1EUZA 2R1UA 2ZYDA 4NK4A 3UJ9A 1ZM7A 1TKCA 5K8TA 4URZR 2FPXA 5CIYA 2MSLA 2J7KA 4RK7A 3QEOA 2DPGA 1D1PA 4RSGA 4X8HA 3LM8A 3UMGA 1KEVA 5JZMA 2Z08A 3AC0A 3SJCA 4BY9E 4Z49A 1E3JA 5GJVC 1ZD2P 3SS7X 4DLBA 2IKQA 2F59A 2I4TA 2WI8A 2YDYA 2IITA 5INTA 3PI7A 2BKLA 1EDEA 3QY0A 1GZUA 2ZYIA 1QAMA 2AOTA 3HMKA 3CLHA 3FXAA 3G7NA 5M7EA 1W29A 2Q9AA 1CZHA 3QFCA 3R8XA 4I5DA 1AS0A 2YWRA 3C45A 4HQ6A 1B76A 2XVXA 1U90A 1SPXA 1T9DA 3E4CA 2NXEA 2XV1A 3MMZA 5DI3B 5FO0A 3TQIA 3WKAA 3F1KA 4J29A 4C88A 1C4WA 3IJ5A 2X5KO 1OFUX 5CDSA 5KKAA 3NDRA 4ZTZB 2F3RA 2B21A 3CS3A 2W2TA 3L4BA 3A1FA 4BO2A 2VPIA 5I7WA 2IQIA 3LQKA 1IBLB 3W3AD 2P67A 5EEGA 3ENVA 3D64A 5A5VA 1JU9A 3OZSA 1U6JA 2VF2A 3IEKA 4LMAA 3JQDA 1NMZA 3RYHA 2MSEB 4ZMRA 3RQIA 2GK3A 4CDMA 3B1XA 4QT0A 3T12A 3EVTA 1UPXA 3G0BA 2ZS8A 1RHUA 1BIFA 1JUDA 1Z0IA 2ZPUA 4HYQA 2HJGA 2G06A 2E5LB 3Q9NA 2OCXA 4MQBA 5G41A 2GYVA 2VVTA 2W7TA 3C8HA 2CJYA 4G1BA 2VQ3A 4QJ5A 3GDGA 2HEIA 2QVLA 1Q0RA 4II2A 1ISMA 4QLOA 5G40A 4HVLA 1WSBA 1FBNA 1I32A 2REQB 4A7PA 3VYUB 2GJSA 1BEZA 1UK8A 4CKYA 1O89A 1NIJA 3PFNA 4O29A 4XAQA 1J0AA 5EPEA 3WVNA 3LZCA 3TNYA 1NBME 5KPDA 4D82A 1G8SA 1JDTA 2KE5A 3T54A 2JGDB 2I99A 3VC3A 3H8JA 2WHPB 1CJSA 4K9SA 3OTOB 1NVWQ 3D3QA 2UYQA 4K3UA 3U56A 4EJMA 1N2ZA 3U7HB 1E3TA 1NVXQ 5EN4A 1KDPA 2QRNA 3VHXA 2PT7A 3H5WA 5LQMA 1XLTA 1ZR2A 1VZ3A 3BC1A 3F5SA 5L53A 2FR8C 5CW1A 3SSAA 4B3GA 1G2IA 2HZBA 1Z5OA 2XQKA 3BD7A 3HFJA 1FMCA 1FK8A 3FRIA 2WSSA 3QLUA 3MTJA 3UV7A 1L5SA 2Q2WA 5KYKA 1XLVA 1ZMOA 1FB5A 3PIDA 1GT6A 1FQKA 3DEIA 3VO9A 4N12A 2E6KA 1GG5A 4TTVA 2NZXA 1JLSA 2JS7A 3DZ8A 4LJ9A 1KIFA 5KNLA 4LBVA 2BP7B 1L7EA 2YMQA 3DZFA 3G23A 4YRDA 1IL0A 1P60A 4PRYA 4FB5A 5G3ZA 4MVJE 3JQ9A 5EQTA 2BH9A 2FW8A 4G97A 1IJEA 3QVGB 4KGDA 1ZW6A 1GRVA 3FNHA 3I9FA 1IAQA 3L6OO 1HE4A 2ZAGA 4YT5A 1TZ2A 1XRSB 3BMOA 4GOLD 1QNLA 1LK7A 1NT2A 3CNLA 3EDYA 3I04M 4N8SA 4QHSA 3UMVA 3PNVA 5MFPA 3KJIA 4Q4AA 5ECGC 5BYKA 3ZD9A 2KQUA 2XA1A 4GU5A 4XWKA 1HNWB 1VYUA 2YNMC 5FP0A 5B1SA 4C0LA 4H31A 1JFSA 3JAWA 3QX8A 4FFSA 1E1MA 3EAQA 1PUXA 2DUWA 5E1DA 5A0TA 2JFXA 2C3UA 1XDGA 2J09A 2HXSA 3ILXA 1FZTA 1H2BA 3DOHA 4FCVA 4DSAA 1OX6A 3QU4A 3F9RA 4U7WA 2DFDA 1UP6A 4S04A 1JPNA 5T57A 1Z3CA 4P4LA 3VH3A 2I65A 3DVSX 5JXIA 1V4VA 4JIGA 2EHDA 4CQMA 1F17A 1PR2A 1OJ7A 2BBOA 2H5JA 2MINB 2WZCA 3A27A 5IVDA 1L4EA 1R0CA 1U0GA 2X86A 5EQFA 5SYNA 1ULUA 2WU4A 5K3FB 4BZPA 2A4KA 1M54A 1TYCA 3D8HA 4KZKA 1F4PA 5YASA 5TPWB 1VFPA 3IFSA 1UT8A 2BF7A 3I3SR 3JSXA 1ENOA 2O4CA 3IQDB 4LF7B 1DHTA 4HWTA 3DBIA 3LYHA 5REQA 4JYZA 3A10A 5HJ5A 5IABA 2CJWA 3IURA 3MWGA 1F3LA 1PEDA 1RYNA 4IIXA 4O25A 3CRNA 4X1OA 1OZAA 3ISJA 4OHWA 5WRFA 2NOAA 3UWOA 3FGOA 3RQSA 3EH2A 4J1SA 3WGNA 4B3XA 1Z0UA 2Q1YA 4G5OA 4C0HA 1E0DA 4HF7A 4UTPA 5CK5A 5A5DA 2ONCA 2QV7A 3ADCA 3TEFA 4JFAA 4DLSA 3HYCA 4U2BA 5KX5F 2CT8A 2BH2A 5EIBC 1EGAA 1SHJA 1ZDMA 4TTTS 2GCPA 2HHHB 4RZXA 5CLIA 3SKYA 1H2HA 1LSJA 4DIKA 4N48A 1M7HA 2FAXA 2FFQA 2GQ0A 3H7IA 2FG7C 1E2QA 2HCJB 2WOOA 3PR1A 1MEJA 2C9BA 3AILA 3LY8A 4JP5A 3W6UA 2HMVA 2IUFA 1CUCA 2VHCA 3GEHA 3JQGB 1KAEA 3GT3A 3NO4A 4JQOA 3M7IA 3RE1A 1C50A 1NW8A 3CX7A 3RG8A 1OYOA 5B3LA 4JI7B 4I1RA 4X44A 4EZEA 3DF7A 4I50A 4ARZA 4ZOAA 2DFLA 4MV0A 4WUVA 4P93A 1ENPA 3K72B 1A50B 1IZ8A 2CWWA 1KTIA 3P94A 5EIBD 2O8CB 5DM70 4P4NA 3NVAA 4GP7A 3PE6A 3OOHA 2NUBA 3C74A 2JFZA 3LCRA 4WXRA 3NBMA 1MP0A 2I6GA 2NUTB 1BKDR 2X41A 4ZKEA 5K0LA 4AYTA 3KKQA 3R76A 2ZG6A 3A28A 3SQWA 2I33A 3SIRA 4XOIA 4YRBA 4RIGA 3EFOA 2I55A 2D4HA 3GFRA 1GLGA 2HD4A 5AHKA 4J2OA 1GTJ1 3RTBA 4DNPA 2VZEA 1S3SA 2OO7A 1XMPA 2O8FB 1K3FA 1VE1A 3A37A 4PWZA 2ZYGA 3E1KA 1SUDA 5ALDA 3I52A 3A4YA 2XD4A 3RARA 1KOFA 3WNDA 1R0BA 3ITKA 2GD0A 3KKPA 3O5AA 1LWNA 2HDHA 2QYTA 3DM9B 4NU8X 3O73A 1VC2A 1TTHA 1R10A 1VJDA 3BFXA 4KGZA 2OFWA 1D2CA 1DC6A 4IG4A 4ZCLA 4KWEA 4GUAA 3QEMA 3SHFA 3EVEA 4YMGA 3TLGA 1HDXA 5SZJA 1C3XA 1V6AA 2I3BA 3FOCA 2VNKA 2YVUA 1CUGA 4ARUA 4PG4A 4J43A 4ZT6A 4KI7A 1Y63A 3O94A 3IAHA 3OCJA 1RLTA 3Q9LA 5CDGA 1GAEO 2ZYVX 2P9QA 2RAFA 2Q3BA 4BLQA 5LYYA 5I7OA 4P7BA 4O3MA 3ICOA 2JDID 5DGDA 5JQWA 1G5HA 2C8VA 3BRCA 3LK7A 1TF2A 4I55B 4L3VA 2YHUA 2AFHA 1KBZA 2ZLBA 1FXWF 4E2WA 1REQA 5BSEA 1G7TA 3L7JA 3ORHA 4NAUA 4RZUA 3EF3A 2CDCA 4YMIA 2QTBA 5AKKA 3VVBA 1GRRA 2RHTA 1W87A 3NT2A 3QHQA 1N4DA 4Z2YA 3DPUA 1GDDA 1F2TA 2A1TS 3PC2A 2FW0A 5FT9A 5K6AA 1H5NA 1V39A 1SBIA 2MSWA 3ZYCA 1APBA 1L4GA 1VLQA 1G6KA 5DASA 1D6JA 4I7EA 1J39A 5D8DA 3PFCA 5KYVA 2QJOA 4ZO4A 2HXGA 1IM5A 3MCTA 4YQYA 4DF3A 1TF7A 3WLFA 1T5TA 3M6FA 2XW6A 3JALB 4ZGWA 3IALA 4WXYB 4M0KA 3GPCA 3KQPA 4FP9A 2RKOA 4IIJB 3T5AA 1BHJA 4DG9A 1IFXA 4ZQEA 2Q5CA 3ZXSA 1E5XA 3AFGA 5H3HA 2GFQA 2HU5A 3QIAA 1DQYA 3T99A 3C16C 1DQZA 3UHAA 2BI8A 3CH4B 1GYQA 3M3DA 3BGOS 4BLPA 1NX9A 2FPLA 3W6NA 3NHLA 4BBAA 2VF7A 4GHWA 4WCFB 2I6XA 3ON5A 4BMDA 4CUJA 1OPXA 3IKLA 1S3GA 3CEHA 4PZLA 3QK7A 1E58A 4FSDA 1SJ9A 3OZTA 1U80A 4JEHA 2PU7A 4L15A 4KQXA 5DN9A 5EIXA 4OJYA 3A3OA 2Z3WA 1MRSA 3FWNA 5FWYA 3ZN2A 3ZLVA 2PE5A 5CB8A 3DAHA 1KU0A 1F8UA 4A0GA 2AQHA 3BG5A 3WDKA 1OFUA 3E9NA 4QGFA 2QTRA 5DXJA 2JJ1A 3GUZA 1A4RA 5JJ5A 4QM7A 2YZ7A 1SQFA 1WMDA 1ULTA 2PGXA 3QFTA 5K0SA 1KP3A 4PYKA 3TD2A 4KG7A 4DPLA 2CXPA 2P69A 3CH5A 1ZSVA 5JZ9A 2OG2A 4DCUA 5LJLA 3MINA 5EMNA 2A86A 3BTOA 4FUQA 2WJGA 2F1IA 2H1LA 3IP3A 3OP4A 4MUEA 1R5NA 1QYVA 2ZDHA 3EC7A 3RK0A 5CDFE 3TQHA 3LIIA 3IL2A 3UMSA 3QSYA 2YZGA 1R4AA 5FI5A 5CG1A 2BW0A 1RI1A 1T36B 1P7VA 1UJ2A 4NULA 3ZGYA 5DRTA 2MDTA 3M34A 2ZYSA 2NU6A 4H1HA 1FU7A 1I10A 4W5JA 5CJJA 5F64A 5GGXA 3T06B 3AI1A 1O8CA 3KJQA 3L41A 1NSFA 1XELA 4I55F 1ADCA 1SZPA 3CZCA 3OKFA 3QQPA 5CJPA 2CJXA 4HNUA 3LFUA 4JASB 1Q92A 4M1KA 3WL3A 5IZCC 1PQUA 4L3OA 1EUDB 1AIPA 2BE7A 4Q1AA 4UE2A 1K5GA 1BXRA 4Q3NA 1ZRNA 2BR3A 3K4QA 1F51E 1HEIA 3HDTA 3KLMX 3ZWVA 1TPZA 4C7VA 2BFFA 4XR9A 5AR1A 2H16A 1G17A 1JWAB 5AK5A 1H8HD 4FC7A 2DQSA 4TT3A 2IIPA 4GRAA 5JXJA 3BMQA 4OHRA 3FN4A 2OO5A 3WV4A 4WFKA 4BU0A 5B55A 2B7BA 1TEVA 3ZE8A 2P4SA 4HDSA 5FOSA 4IIJF 1X15A 3L1JA 1EFPB 4QU9A 3H9UA 4Q1FA 2H8GA 5T5QA 1IK4A 4ALJA 1KR5A 2EJCA 1CY0A 2D1YA 1H93A 4ZQBA 4ZK2A 4TV8A 2AR0A 4S1VA 4FGLA 3K9WA 4HPJB 3VZDA 1EX1A 1X39A 2NVOA 3LE8A 1C7FA 1YJCA 4IWXA 2COKA 3DPIA 4WVFA 2X8BA 2IY8A 1WZIA 2RKWA 4NCNA 1CVIA 1T4MA 1LI4A 2P9BA 4MA0A 1AZLA 1QHNA 1QX4A 2HXYA 2Q0QA 3STXA 4CBVA 1ZITA 2WNIA 3CJQA 4IY1A 3VU0A 3LNCA 4PQGA 2EFYA 1YJXA 3GAFA 1OZGA 3JARA 3E7FA 4UUNA 1JDUA 2H85A 3VISA 3LXXA 1UZNA 2EFDB 1Z47A 4KXLA 2PAFA 2B1IA 4TYPA 4DA0A 4ZYZA 1C9EA 1UM8A 3PGVA 3A8TA 5DYGA 2MMGA 3ZLBA 2X4GA 5JNVA 2J9XB 3A1DA 3FFXA 3OJXA 1UC4B 3PA6A 4AVYA 5MGNA 1KOGA 4AKHA 5GIOE 4C30A 1QFYA 2EERA 1WXDA 2BMFA 4B8WA 4WAUA 4DDMA 5LOVB 3FGNA 1Y5LA 4YP5A 1KYXA 3QWIA 5LDHA 3H13A 3K1AB 3AUUA 1SWWA 4X1IA 1NC3A 1SIOA 2O8EB 3WBBA 2GYYA 3PC8A 3ZDXB 5BQFA 1ADFA 1A71A 4LWQA 721PA 4R69A 5AM5A 2Q9CA 3OZXA 4B75A 1CWUA 4WKPA 2YW9A 2X0FA 3L6CA 3ZHVA 3RSFA 1RRFA 3D7RA 5JAOA 2Y0PA 4U6NA 4EITA 5FAKA 3DTTA 4EEXA 2XEDA 1FXSA 2PYDA 3IUMA 2K7ZA 5JDIC 4EG3A 4PY2A 3TLMA 3JPYA 2C2OA 2PMWB 3F6PA 4R9SA 1YS6A 3O26A 4QG7A 5KIAA 3Q6MA 3FBGA 4UEOA 4BE4A 3FGPA 1A5SB 2HA0A 1JQAA 3C3BA 1G3RA 3IBGA 2Q3EA 1MABB 3KDSE 4NP6A 4Q3KA 3LF1A 5IDQA 4GW3A 3W5CA 2DT8A 4Z4GA 1P2SA 2IUYA 3I8SA 2VRBA 1JG4A 1WZNA 4RZ3A 1DTWA 3T3MB 1CZUA 1GXSA 1C4KA 4UOZA 4TMWA 1CJUC 1PGNA 4ZIRA 4ABTA 1XDDA 2OPHA 5HUQA 5B3JA 1Z6XA 2YCBA 2D13A 2Q0HA 3GDFA 1Y6ZA 5B2ZA 2X15A 4AN1A 4E09A 1Z34A 3BFPA 1OR8A 3EDOA 4AROA 4F45A 2X5JO 5C4IA 5A1JA 3MG9A 5B7QA 4RL6A 1DAIA 3AYZB 5F9FA 4PQFA 1BFKA 1O03A 3AV3A 5F7JA 1OZHA 2H2HA 3CX6A 5KSYA 1G42A 1NQ5A 1S2NA 1K4YA 4H3HB 4ZAVA 3TLCA 4GBMA 3PUZA 4CIYA 2P6PA 1NBHA 3DOEA 4L57A 4CTOA 4F97A 2CEAA 5JCXA 2Q1UA 4F86A 3AO0B 3CNBA 1FUYB 3OPQA 2RBGA 5A7FA 5BUQA 2GAIA 3FAKA 3B52X 1THZA 4BJ6A 5C5EA 1W36B 5CVVA 1MXFA 4C78A 3IDQA 1P44A 3K3PA 2W90A 2NSYA 2WTMA 4OY3A 5KNCD 5DGCA 4EELA 4PBTA 2V0GA 1GTZA 4AICA 1DCKA 4AZWA 13PKA 2VUSA 1DC4A 1KDVA 5B1YA 4ZDJA 1K86A 1BU5A 3B3GA 2WMNB 3PKIA 3UNXA 3IUPA 1ODIA 4WKCA 2NACA 3PUXA 1XDZA 1WHTA 3EC1A 3QYJA 5AKIA 2MYNA 4B71A 4R2IA 5H16A 3UAWA 1GL9B 5JY1A 2NGRA 1O54A 2R8OA 3TSWA 4BAZA 4C0BA 5LOVF 4G5QA 1OFHA 3QEKA 4PZ0A 1FJHA 5JCJA 4H18A 1W5EA 1EVYA 1AGYA 1Q7RA 2CLCX 5GADl 3UHOA 1UDWA 3Q7TA 2OGZA 1VKRA 4BN4A 5DNCA 4B7CA 2Z6QA 5SY4A 1XQ6A 4W5RA 3LCUA 1FYWA 2HJVA 2GPAA 1ZXBA 2C2ZA 3G88A 4I3FA 2QL6A 4KZPA 5HCNA 5JQGA 4L6AA 3D1LA 5AW4A 1AS2A 5CEJA 1EWYA 2IYQA 2FFAA 3JTMA 2ZZNA 1ONSA 1TMYA 1Y4DE 1VPTA 3IP9A 4TPKA 3G2MA 4WXEA 4YWJA 2OQVA 3TPCA 3ZD8A 4CPDA 5B1EA 3OC6A 3AF0A 1JVBA 4H0NA 4R71A 4AMZA 5C4MA 4MVXA 2B4YA 1GTSA 4ZGBA 5DP2A 3R2JA 4WZBA 1Y3BE 4QNMA 2UZ1B 1RPJA 1XCGB 1LXCA 1SM4A 5FR1A 1ZCJA 1EZ4A 2BVNA 1GN8A 2A6PA 2ZRDA 3L49A 1LPNA 4D46A 4GL2A 2QRMA 4RTPA 2VWQA 4YJGA 3WDMA 1SKMA 1KAGA 1T8UA 1YMUA 2R8YA 3KEGA 4JBXA 5HDQA 4BMOB 1XCOA 2V96A 2XZPA 3GGPA 3QKIA 4MQUA 3UBTA 1QKJA 2VCYA 1PS8A 3VU9B 3OPMA 3PHBE 4IUDS 3PYLA 3C6MA 4HB2A 1KBQA 2GN2A 3FGZA 2LKCA 2VO1A 3QLVC 1X92A 4IXDA 1Z37A 3AONB 3D6HA 4N1AA 1BE6A 4DLLA 1EMDA 1GAQA 2CXTA 1L5MA 2YFYA 3OT1B 4X3CA 4EHFA 1PTKA 5BUSA 4PLPA 2JLUA 5TS3A 1OU0A 1W94A 1XMOB 1YJ5A 2NYVA 2J4FA 4Z3KA 4K9DA 3HRIA 4MSUA 4Y9RA 1KSGA 4M8NE 4ITVA 4MR9B 1HSOA 3GRVA 1KORA 3NAZA 4DCGA 2J3HA 5BQOA 2Z95A 3U4MA 1LI5A 2X58A 2ZAIA 4K28A 4E22A 2BFNA 1YJAA 3AUXA 1O94A 2HWWA 4Y2VA 1VRWA 2C04A 1EVIA 1SELA 5FX2A 5KHOC 2FG6C 2XB4A 1QYRA 4Q4DA 5J5AA 2H52A 2XZDA 2ZTVA 2GSDA 2XBLA 2ZI4A 5L51A 5CT6A 2BFAA 5EWLB 1U9ZA 1FRQA 2GO7A 1Q17A 5LKAA 2XF8A 2PMBA 2IHVA 5T4FA 1E6KA 2Z8YM 5E1BA 3B13B 2JJ2D 4P0PB 4DE5A 1GQFA 1W96A 4OMCA 4EW3A 3CZPA 5DI3A 1DIGA 2G6TA 2G4CA 1I80A 3DT8A 2VH1A 4OOEA 5EP4A 3WGGA 1VKNA 3P9PA 5TLSA 1FU4A 1TCAA 1Z2NX 5FFFA 4YHHB 2KPOA 3QW4B 1BXKA 1WMBA 4YK7A 1J09A 1XZKA 4V0ME 1WPQA 3ZJTA 2IBMA 1E1CB 4WH0A 1QWOA 1F8YA 2JD1A 4N49A 1WLSA 5SV2A 3BGDA 2IOQA 2OYCA 3ZD7A 3V1UA 4LXUA 1Y1TA 3WYBA 1HLDA 2IP1A 3NKFA 3PUHA 3Q0TA 4GEGA 3ZIAD 1NJ8A 4YUXA 4U7DA 2CXRA 5A4MS 2NP7A 3T95A 3ZGNA 4EGQA 4JJZA 1A9OA 2WD7B 3OTQA 4L7VA 3BPSA 3G8YA 2ZRJA 1TW2A 5KWVA 3W5DA 5BSMA 3WWEA 4KREA 5H7XA 2REQA 1A8IA 1R18A 1MX5A 5K09A 3ZWDA 2A94A 1PHPA 2ICAA 3CUTA 4WECA 4F4UA 4URYR 1BS9A 4ZT7A 4MQ5A 4EO7A 1CQZA 2DOKA 1LPSA 3GUHA 2BM1A 4ZP1A 5I9NA 2VYFA 3EZXA 1JHRA 4YJ2F 3EJ6A 4F1JA 4UTNA 5JV5A 1SFRA 3FOWA 2EZUA 1UC5B 4LGYA 2UXDB 4B4OA 1GCOA 4MAAA 1ZK1A 1AKMA 4MITA 1VI5A 1JPJA 1QQAA 2DHQA 3AH8A 3UYLA 2YHBA 3GRZA 1J1ZA 4KO2S 3E15A 4AMBA 2OLJA 1A2OA 1PT5A 3AW9A 5DISB 1TAUA 3NOXA 4ZCSA 4DCOA 2HT1A 3Q10A 3K8ZA 4HGYA 1YC2A 3WGJA 4JYBA 1NKTA 3EEIA 2CLFB 1FW8A 2FWRA 2ZIWB 2F1OA 1NFRA 2QM0A 3LJKA 3ZCSA 1P19A 3MLBA 3NHFA 3OURA 1YACA 1SA0B 4FOTA 4UASA 2AQKA 2W2PA 3B6EA 3T7RA 2BP7A 4Q0MA 2Q8QA 3Q5DA 4M1OA 3PXXA 3M5CA 5C37A 4IHAA 7ADHA 3K0FB 3QXGA 4KUEA 4Q48A 1E4YA 3I01M 1XZDA 4Q1CA 4PZCA 2PT9A 3QVGA 2PH1A 1DDIA 3W1WA 5EI5A 4DCSA 4LQCA 2O14A 1KI2A 3B5JA 3WMRA 2FMUA 4FLFA 2FK7A 5TQVA 4ZJUA 2NV2B 5JRJA 1IB0A 2P62A 2WTAA 5BV8A 2TRSB 3CWQA 3HR7A 3LC1O 4N01A 4OFBA 3DT6A 2WUVA 2EHJA 2Z83A 4EW6A 1TF5A 2GPWA 3NWOA 4IIYA 2OCDA 3H3JA 1BAPA 3GUVA 4U9HS 5JSYA 1M2EA 3BAZA 1EHCA 3E0XA 3ZWNA 2O0HA 4OXYA 2PT6A 2IEDA 4EF6A 4RLHA 3Q8MA 3P0FA 1DVRA 1JVNA 1LD3A 1IWPB 1FMFA 4PTZA 4WGFA 4HQOA 2PJZA 5K3FA 1GPYA 2AI2A 3NDPA 3TMKA 4D80A 1JL3A 3E1SA 5TPWA 3HJCA 4DW8A 2RGRA 5HEKA 3HU1A 3O8LA 2EW1A 4BLRA 4PS1A 2FOIA 1YRQA 2PD4A 3P0EA 2VDLB 4UNSA 3RHZA 4I8XA 2VF8A 4TLBA 2X2FA 1FFDA 4KWIA 3JQEA 1NOIA 1EYZA 4LXHA 4BFWA 1P7WA 5CVUA 2WTNA 3SM9A 4XUCA 1RHKA 3DOFA 4NMLA 3WTBA 5I4KA 5KSOA 5LM3A 2WSIA 1KK1A 1ZR4A 3EUAA 4TN1A 5A4AA 2QRHA 3AGQA 2R87A 1I2BA 2VAVA 4HN9A 5F3RA 2H4XA 2AFIE 2GCEA 1ZCAA 2K4MA 4Q37A 1JIUA 4ZO8A 1TZBA 3FFWA 1GGEA 3UWMA 4TM7A 2OHJA 4WLUA 3RSSA 3TVTA 4LZOA 1IPEA 1S8NA 4ID3A 4PU0A 3E03A 3RS3A 3CEAA 1C14A 4EA7A 2XUPA 4DAEA 1DZIA 1UBEA 3VH2A 3JX9A 5LMZA 3AUSA 2DR3A 1KFEB 3JQGA 4PO1A 3TD9A 1X0XA 2ZCVA 4PC1A 1JJBA 4OQDA 4JI0B 4MQ4A 4IXTA 2ZBEA 3DQPA 3RROA 2IS6A 2PXHA 4P3NA 2GJ8A 1DELA 4GX2A 4OO3A 4RPLA 1JHAA 2FLKA 2JIZA 2XUFA 3MOIA 2N3ZA 1NN0A 2IK8A 2BFMA 1I3KA 1R9NA 2J48A 2KMLA 3A6LA 4KPGA 3TKYA 1Q84A 4RD0A 2YWFA 1EVZA 4YT2A 5A9TA 2IW3A 4WZAB 2O8CA 4PONA 1RXVA 3F3KA 1TZJA 2XQGA 3CGWA 1QM5A 2Z5LA 4UOEA 3EX7C 2A5FA 2IHTA 3A1VA 1ZL2A 4JN6B 4KXNA 2VJMA 2NUTA 4CU5A 2Q9UA 4PPGA 1P2DA 2FZKA 2O52A 1OVGA 3VUFA 3MGAA 2F43B 4D25A 3CE9A 2F4VB 5FPSA 5EJ8A 1HDOA 1PCXA 2BC9A 3QYPA 4ID9A 1RAHA 2Y2UA 2ZBRA 5TT0A 4NPAA 3V4VB 5HHTA 4WRRA 1ICEA 2GBIA 2QTTA 1EJBA 2PKRA 3B48A 2Q2NA 4YRCA 5L3SA 2H29A 4ZPXA 1OILA 4O4JB 1FJXA 1EK6A 2J1LA 4XOUA 3PWZA 1ZMRA 1RKBA 4ZDWA 1RM5A 1YOBA 1B93A 1S0UA 4AXXA 1OH8A 3JVVA 5LR6A 2WIKA 2I4LA 4KLAA 2LD4A 2Z3ZA 1YAHA 2GHQA 1PW5A 4MB2A 2XE8A 1KJNA 3E7PA 2AVNA 1P3Y1 3PVSA 4CGZA 3QOFA 5TC4A 2QWXA 4P36A 4U2GA 2XZTA 1EWQA 3T7KA 1BGWA 3R0VA 4YFYA 2ZU0C 3WC4A 1JEQB 2ZAYA 1KKLA 1ZGBA 4I55A 3JSAA 5F7XA 1FVHA 2RE8A 2GDJA 5JNTA 1UWVA 1CIJA 2X2EA 3P20A 5HKLA 1JHUA 2WF8A 2Y1EA 3WLRA 4Y30A 3MWLA 1DEAA 1JB9A 4MP6A 2I66A 4LX0A 3FTPA 1P33A 1GTL1 4MWCA 4OVKA 5AKLA 3V8VA 2DBVO 3WIDA 3E2PA 1ZEJA 4AZSA 1D3AA 1Q2XA 2G76A 3FVQA 4CKCA 5JDCC 2RB5A 4UNRA 2FW7A 1AD2A 1LRLA 3RANA 3WBFA 5F3WB 4FFNA 1UC9A 3ONNA 5BVGA 4N03A 1QS0B 3JALA 4UUMA 4F8YA 3TN7A 1AXEA 5FPHA 1IE3A 3DEJA 4C1NA 6LDHA 1QE5A 1JHMA 4KSBA 4IIJA 4X6LA 3R7WB 4C0XA 8ADHA 3LT4A 1P6XA 1NNEA 2QN3A 1KDTA 3DEAA 4FS3A 4KCGA 2G7ZA 1PWHA 2Y0CA 4I99A 4WTOA 3UKOA 1TM7E 3C3YA 1DOZA 1SOMA 3TZEA 3N8NA 5T6BA 5TY0A 3VR4H 1AMOA 3L5OA 2GHTA 4H15A 3UOAB 4A2PA 1YQWA 5BQXA 2EFGA 4WCFA 3T7TA 1ZRHA 2P3SA 3M49A 3MWYW 3BWEA 5B30A 1SCKA 1HQCA 3K09C 3QOXA 1CPYA 2TMGA 3JCZA 3NOOA 1R6TA 4JS0A 5DTIA 4BGVA 4GX5A 5AQ1A 4N8DA 1C7IA 1UFRA 3U17A 3LCJA 1Q83A 3OX2A 1UOQA 3NPAA 1H0HA 1R5BA 1T0UA 3OKAA 3VR5A 4NENB 1Z6YA 2ZBDA 4CLHA 1N6LA 2ID4A 2OENG 1QMGA 4GEKA 4O4JF 3TIFA 3E7DA 5GOTA 4OLJA 4O4IA 1IHPA 3RDPA 3ENWA 4NZZA 2RIPA 4RX1A 3ENNA 4GOKA 4ZCMA 5I4CA 2RI0A 1OKKA 3Q7EA 1QQ7A 3ZV6A 3KOZA 1UBHS 5ALPA 1CZKA 2OXFA 5KWSA 1ZI8A 3MNFA 4P3PA 1XCMA 2OORA 4Z7OB 2PMKA 1KZYC 5KQPA 1T36A 4BP8A 4MI1A 3KR2A 4ND4A 2DYKA 1V5GA 1AHNA 4UHCA 3UBMA 3RAFC 2RGWA 2XR1A 2PUTA 3H7AA 3NIWA 4P08A 2CVQA 1S02A 4F8EA 4HGZA 1RLIA 5LLTA 1PWYE 4ME6A 2O0JA 3R3JA 2VHWA 1BN7A 1Y8ZA 4ZO9A 1ZM4A 3E3AA 3FPJA 4LDAA 1ES9A 3COWA 4P1ZA 2DUMA 4A0HA 4H7EA 4XM1A 3DO6A 3L43A 4ZQGA 1CZOA 3LHKA 2XYRA 5BP7A 4NKRA 3WDLA 2PEYA 3D3NA 2XGMA 3D8NA 3FR8A 4JY7A 4F1WA 2G9VA 3AIKA 1GSOA 2JD2A 3QMMA 4M9ZA 1V4BA 2B0CA 1CJCA 2WTEA 3CCFA 4KHZA 4QOIA 3DE2X 1PR9A 3KX2A 3Q0EA 3IXQA 3N8KA 1WABA 5MN5A 3WK5A 1L5ZA 3PQCA 2XAAA 2IOYA 4XUDA 3G2QA 5J2TB 2X8AA 3D4BA 1FQJA 1MRZA 4KPUB 2GFHA 3VSBA 2V1UA 1D2EA 3DEZA 2AN9A 4ZYVA 2C0QA 4ZARA 3VSAA 2P4UA 2R7NA 3EHEA 1OI4A 2XGGA 4LNUB 2WVHA 3RYFB 2YN4A 3DAFA 4I36A 2W4MA 2P2LA 2JIRA 1UDBA 2VP4A 1RHRA 1ILEA 3I2IA