1X7DA

Crystal structure analysis of ornithine cyclodeaminase complexed with nad and ornithine to 1.6 angstroms
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
340
Chain Sequence
TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
molecule keywords ornithine cyclodeaminase
total genus 112
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1x7dA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x7dA02
3EW7A 1VKNA 4I9HA 1D8AA 4GWKA 4HFNA 2VCYA 5B4TA 1XQ6A 3F5QA 1T1RA 1B3RA 3JQ8A 3PZBA 3TL2A 3UGKA 3CEAA 3L4SO 3ZV4A 1GUFA 4AJ1A 3O8QB 1FDVA 1IZ0A 5KTKA 3CIFA 5T8KA 4E5KA 2GZ2A 1I10A 3H7AA 4E0BA 4CMGA 5HS4A 3IKTA 2UUOA 2A92A 1E3LA 4J9VA 2QRLA 1BG6A 4NJOA 1O9BA 3HNPA 3IOYA 3RUEA 4YTEA 1Q0QA 4AFNA 1Y8RB 3MOIA 4F3YA 3ZWYA 3PZRA 1WLYA 1MA0A 3GVIA 4YJGA 5IDWA 4CR6A 5F3RA 5DULA 4Z3DA 3TZHA 5GZ6A 4ZQBA 2C59A 2OORA 3ZWPA 1U5AA 1ADFA 1HSZA 5I7SA 1XEAA 3F47A 4RVUA 2H6EA 4TRRA 3WOHA 4LK3A 4XA8A 2RHRA 4IIUA 4ZU3A 2D59A 4E5MA 4LCEA 4D43A 3CE6A 2R2GA 1U3TA 1ZBQA 3B1FA 2NWQA 3DFZA 4FC6A 3GAFA 4C4OA 4OQYA 1N9GA 4CMHA 1PGJA 1Q7BA 3TSCA 1QSGA 1ISMA 4E32A 2LDXA 1PGNA 3CMMA 4IGEA 3RU9A 4Z9XA 3RWBA 3ZHZA 4DA9A 1T4BA 2A9FA 1GDHA 1ZUD1 2FRDA 2RIRA 2VUUA 1YXMA 2O50A 3DBVO 3AFNA 2FY8A 1Z7BA 2W2LA 3IUPA 4OOFA 1GYPA 4YJDA 4ZD6A 4CM8B 2AXQA 2I66A 5JC1A 3INGA 2DM6A 1BXZA 4PLVA 3GDOA 1EBUA 1E5LA 3OEYA 4J2OA 4BNZA 2D3TA 3WBBA 1RM5A 3KSDO 4OXNA 3S2FA 2ZTUA 1ZH8A 4DGSA 3TFOA 1WXDA 3PVZA 2PA3A 4WPGA 1NXQA 3KXDA 2DBRA 3L9XA 3KOUA 1JN0A 5ER6A 2J3IA 2AW5A 2Y1DA 2X0NA 4ALMA 1EQUA 1Y8QA 4AVYA 3OHSX 3RI3A 1H6BA 3LLSA 1I2BA 3AY7A 3W4JA 2ZB8A 4TKLA 3U4CA 3G49A 4Y9DA 5T5QA 3M2TA 1FK8A 1R16A 1BDMA 2JHFA 4BKUA 1NQ5A 4R3WA 3D5TA 4DYDA 5KIAA 4R54A 1K5HA 1T2FA 4J1QA 2HAEA 4HXYA 2BI7A 3W8FA 2BKAA 1NAHA 2XOXA 1DRVA 1W0CA 3WDSA 4CLEA 3MJCA 3FTNA 2B35A 3V1UA 3U9LA 1CF2O 4TMFA 2BFMA 5G0UA 1Y9EA 1WMBA 3LZ6A 4E6PA 5CEEA 2ZIZA 1PJ3A 2O3TA 1YVEI 2FP4A 4IJWA 5GY7A 3BHJA 5CDTA 3KHUA 2Q1WA 4GX2A 5IXYA 1XU9A 1C14A 1CEQA 3FI9A 5DOZA 4NK4A 4R4JA 2HSDA 2Y1FA 1BRMA 2PLAA 4JROA 4ZQEA 1WPQA 1MXHA 3NV9A 1NVTA 2JJYA 3VZQA 1WW8A 3FNFA 2B4TO 4YQZA 3NJ8A 5DP2A 3TZCA 4YT8A 3UFXA 3B1JA 1EE9A 2VYND 2Z1MA 4UVEA 3WLFA 5F21A 3H3FA 3JQ7B 4JNKA 4OGWA 1UDCA 4AG3A 4RF4A 3TJRA 5B12A 1PS8A 3LC1O 4YJHB 1I3LA 1V6AA 2YFHA 2VWGA 3WIDA 3DBRB 4E3ZA 4MIEA 2VRCA 4P4LA 5JLAA 1GR0A 1X7HA 3K92A 4X54A 1D3AA 4BNIA 2RCYA 4E5PA 1A9YA 5ILOA 4GX1A 1DIRA 4CLHA 5C7IO 3CUKA 1DB3A 5T67A 1NR7A 5G0TA 2ZB3A 2ZTMA 2SCUA 4EW6A 5AXBA 5H82A 3GVCA 4FC7A 4DIOA 1NQTA 4ND3A 4TKMA 1EFLA 1YB1A 3C8MA 4WE3A 5EMHA 5IFLA 1LQTA 3ANMA 3PWZA 1K6IA 3JSAA 2Y0EA 3GMDA 3HHPA 2GASA 3JQGB 1PJ4A 3FF4A 4KZPA 3JQCA 4IDGA 4II3A 3FCOA 3OMLA 4EEXA 5JMPA 2NU6A 3S2GA 3OJLA 5JBIA 1PR9A 4GGOA 4M8SA 3I4CA 4DQVA 3DZFA 4JXKA 4OH1A 3GY0A 3DBLA 2E49A 4Z0HO 1UP4A 1PJBA 2GN4A 3B6ZA 3GVPA 1GZ6A 2ZB4A 2WJPA 4GPD1 4R5HA 5ITWA 5COAA 2Y0DA 3KTDA 3WGQA 4IXWA 1ENYA 4FD3A 1KEWA 1G6KA 1P1KA 4EGFA 4NJMB 1SC6A 5CPFA 4NI5A 4WOJA 4Y8VA 3VTZA 4LN1A 3NRCA 4XRGA 4WEOA 2Y93A 1FMCA 1P1JA 4YR9A 1DIGA 4CM8A 3DOOA 1XWFA 1GQ2A 5JDIA 2RH4A 1KBZA 3CH6A 4FB5A 3ZZNA 1WDKA 4J90A 3D1LA 4D3SA 4URFA 3JQAD 1BXKA 4BGIA 1UP7A 2C7GA 2PD6A 1OC2A 3QIVA 3WLEA 3DFUA 1E3EA 5DP1A 3PYLA 4WNIA 2HJRA 2DTEA 4HNGA 4I5FA 3MWEB 3OQ1A 4ZQFA 4OO3A 3HADA 4EUEA 4K9DA 1Y5RA 3WYEA 1WVGA 1P31A 4NPCA 2EF1A 2ZTLA 4BQRA 5ICSA 3DDNA 1HDRA 4IZHA 2D0IA 4Y6PA 4MVJD 9LDTA 2X0JA 3PLNA 2VOEA 2HMWA 1NPYA 1M67A 1ZNQO 2J5QA 4MVJE 3WJ7A 3PHIA 3NUGA 1AHHA 1FDUA 4ROSA 4PRLA 3IJPA 3ZU4A 4FFPA 4BO5A 3AOEA 3Q11A 1DDOA 2PKQO 4JQCA 4CM7A 1JWAB 3D3WB 4J6FA 4XR4A 1CWUA 2A4KA 2BFOA 3I9MA 4Z9FA 3U49A 2P68A 2C2YA 4MVJG 3UN1A 1C3VA 4NG5A 4B4OA 3SEFA 4FW8A 3IDSA 4RQUA 4N5MA 4J0FA 1EUZA 5IDQA 2OO5A 3NDJA 1I01A 2C5EA 3GOHA 3ZWAA 4CLXA 2DFVA 1ONPA 3PYXA 2EKLA 4GLLA 4OHUA 1T2EA 2B83A 2UYYA 2VZ9A 4CV1A 5DNAA 4H16A 3T7EA 3RSHA 3UVEA 4MVJF 4IIVA 3RFTA 3D0OA 4WK6A 3VZRA 2Q1SA 1Y1PA 5KOIA 3F4LA 5KJEA 1MV8A 1UR5A 4XZ3A 4EJMA 3IMFA 1KVUA 3LQFA 3DXFA 1GEEA 1A5ZA 3N74A 4YRBA 1LJ8A 4WKGA 3KV3O 1QYDA 2X0RA 5JW6A 5F5NA 1EDOA 1GU7A 1WDMA 1ZXBA 3JCZA 4IXTA 1HKUA 3KYDB 2J3JA 4CM1A 5K6AC 3P2OA 1PJ2A 3OF2A 4TVOA 4PRKA 4W9NC 1HZZA 2VHVA 4IQ8A 4FOSA 3VPFA 3DAGA 1R15A 2P4HX 1PU2A 1IE3A 1HLDA 3HN2A 4RPLA 1X1TA 3K2BA 1NQOA 5JNLA 3GEGA 3UKOA 4D3FA 1W6UA 1BW9B 3PFWO 2VHYA 2DBVO 1PL8A 4WCFB 3FHLA 4RF2A 4GVLA 3W8DA 4XRRA 4XIYA 1Q0LA 3HG7A 5ADHA 4MP6A 4BB6A 1MLDA 4OMUA 3S2EA 2OZPA 1GQQA 5COQA 4IMRA 4Q3EA 5KVCA 4M49A 4ID9A 2Q4BA 4UUOA 2P9EA 4GMGA 1SPXA 4UVGA 4B4UA 3L77A 2WD8A 3VKUA 3WQSB 3QVSA 1A9ZA 1HE3A 3OQBA 3KYCA 3QJ5A 4CQLA 4B7CA 4UEKA 3UAGA 2Q1TA 1I24A 3GN2A 2TMGA 4KQWA 4O5OA 2ZJ0A 1ZK3A 1R12A 2CDBA 1I36A 5JAZA 3RBXA 2NACA 4GQAA 1DC6A 4Q3DA 4XX0A 3DMTA 4YJFA 1LSSA 4F6CA 4RDHA 2GZ3A 1V8BA 3RJ9A 1PSDA 1P9LA 4N7RA 4CM9A 1AE1A 4AJOA 4ONEA 3TOXA 4B4VA 3KLMX 2WDZA 5DBFA 4ZRNA 5A5FA 5I9LA 3D64A 5JDCC 3TZQA 3QHAA 1YBVA 3KB6A 1SZJG 4PVDA 5IN4A 4RO0A 5A9TA 3E5MA 1LXCA 3E9MA 5G0WA 2X58A 3P2YA 4BNLA 1EEHA 3Q9NA 4JBIA 4NBUA 5BSHA 3I9KA 2OGUA 2Q46A 4L73A 3K2EA 4OYRA 1T2AA 2B4QA 3C1OA 1JTVA 3I83A 3IUSA 2CVZA 4PLFA 1XLTA 2ZYAA 3INRA 1QP8A 3VH1A 4P4NA 1KC1A 5T8KC 2CD9A 4R01A 2O4UX 1I5RA 1OC4A 1Q7CA 2GNAA 4EUFA 1B3BA 4ND5A 4BGVA 4YAKA 1E3IA 4WNCA 5ICMA 1QRRA 5A03A 3PK0A 2NTJA 1N2SA 1CRWG 3QVTA 1PWZA 3QY9A 1C1DB 3PHGA 1ZMTA 1N1EA 1B0AA 1ZZEA 4HP8A 1GCUA 2NU7A 5L7TA 1H2HA 8LDHA 4CPDA 2DPHA 3L6DA 2YV3A 3LLVA 3OJ0A 3Q2IA 3MOGA 4RV9A 3PLRA 3WFIA 3D3EA 3GT0A 4YWJA 5DDIP 3KYCB 4CV0A 2PGLA 5C3MA 3DQPA 4KQXA 4L4SA 5JAQA 2JFGA 4D0SA 5DOVA 5K0ZA 1J0XO 2CY0A 1KVQA 3A28A 2EERA 4LMRA 3AUUA 3MJVA 1NHGA 2PK3A 4MKXA 1P3DA 3DHNA 1N7GA 2AE2A 2J3KA 1YDWA 3FBTA 1F12A 3ZV3A 3JQGA 4BO3A 3ROPA 3K8ZA 2QQ5A 3WXBA 3GK3A 1AN9A 4OJNA 4PIVA 1B7GO 1DRWA 5IN5A 4BNJA 3K73O 4JIGA 1MGOA 3VZPA 5BSFA 1ZMOA 1YE3A 1F14A 3ZHYA 3ZV5A 5A9SA 5JYDA 4K26A 2JFHA 4XDYA 2X1HA 1C0IA 3C3XA 3MZ0A 4ALIA 5I7FA 1ADBA 2ZATA 5FF9A 1PTJA 1F17A 3UCXA 7MDHA 4PLTA 4AJHA 2J8ZA 4MVJI 3UCEA 2G5CA 3FRJA 3QLJA 4CM9D 3ZW8A 2GF2A 3R3JA 1I32A 1Y6JA 1QYXA 2HUNA 1X7GA 4NHEA 1K6XA 1QR6A 3O4RA 3GUCA 4LVUA 1VL0A 3QWFA 3HQ4O 3OA2A 3DZGA 5DCYA 1ADCA 4XYMA 5HRUA 3ANNA 1J6UA 3PIIA 4IDEA 3VPSA 1D1TA 4PG7A 2PGDA 3TQHA 3PIDA 2B5WA 1BSVA 4LVCA 1YJQA 5EQDA 2GLXA 3ROQA 3KZVA 2VWQA 3CPSA 4BNGA 2VT2A 3COSA 2X9NA 4CMKA 4Z3KA 2GO1A 1GUYA 2E82A 3ETDA 4LW8A 2VOJA 5JAMA 3DONA 3EY4A 4Q3NA 3IIEA 3IJRA 4U0KA 4OAQA 3TZ6A 4NDNE 3PJDA 1PZFA 4FFOA 3H65A 4XQ9A 3BMNB 4XDZA 4RLHA 1SB9A 3WIEA 2CSUA 5HA5A 2QZZA 3UUWA 2D1YA 2AA3A 3T4XA 3S55A 6LDHA 3JD3A 3JTMA 4QFCA 1I2ZA 1ID1A 3TFQA 3CINA 4KDEA 1LTHR 3N58A 4BKPA 4BUCA 2Z95A 2CNBA 3RASA 3VDQA 4B3IA 4FSHA 1RPNA 2FR8A 2GZ1A 2I6TA 4BNHA 4XKJA 3DTYA 1ZK0A 1ZSVA 1QYVA 4GX5A 4I1IA 5C7OO 3WTBA 4QFDA 1EVIA 3U0BA 3DZHA 1TT7A 4CV3A 1E3SA 2Q45A 1YS4A 3PDUA 1LNQA 2FR1A 2JD2A 1B8PA 1UAYA 3EK2A 5MDHA 2O7SA 4BNUA 3LT1A 3GRPA 3OFSA 4DREA 1EVZA 2WD7A 1L7DA 1R37A 1XELA 3DZIA 5BR7A 1OAAA 4W82A 1PJCA 3GLQA 2QX7A 1XHLA 1M66A 1OOEA 1DFGA 1PJTA 2YV2A 4H7PA 4IBOA 4NQZA 3K5PA 4FIZA 2WWRA 2C5AA 3E5RA 4XQEA 5F1OA 1HRDA 4PG4A 3U4HA 4NNJA 5IF3A 4TRJA 3KEQA 2X6TA 4OKNA 1M76A 5CFZA 4FJ0A 1Y8QB 3VVCA 1YL6A 3JYOA 3BIOA 2E6UX 3BMOB 1IL0A 3Q3CA 4YRDA 1IHYA 3RBVA 4IDCA 1P1IA 1ZCJA 3AI2A 4PLPA 4YEDA 3OJEA 1HT0A 1CIVA 4DUPA 3H9UA 1V35A 2A35A 3I9NA 1X15A 1TB4A 4BQPA 1PJLA 4HUJA 3C7CB 2NVWA 4N18A 4CMEA 2H1SA 3QRWA 2Y1CA 4BS9A 4QQRA 4FFLA 1X14A 1PGPA 1N5DA 2ILTA 3AUSA 4IS3A 5IJZA 5FWNA 4OL9A 4B8WA 3L0DA 5JY1A 1PJSA 2EP7A 3FWZA 1VI2A 5EL0A 1ZSNA 3ZCXA 3S8MA 5IDXA 2GN8A 4IMPA 4OXKA 1PQPA 3K9QO 1X0VA 2HMVA 4K28A 4O0LA 4HWKA 5CDGA 1P45A 1C1XB 4DYVA 2BGKA 4CM5A 4IQ0A 4E2WA 1SCUA 5AVOA 1E7YA 1LBEA 3F46A 4YCAA 2W90A 3ZWOA 4J7UA 1OFGA 2BRUA 4GWGA 2AQIA 3JQ9A 3PQEA 5AYVA 4HV4A 1TT5A 3ZNNA 3ZU3A 1H0KA 5JFOA 4R68A 1E0DA 3L4BC 3LU1A 1HE2A 4XWYA 1Q1NA 2NVBA 1R6DA 2GD1O 4EBFA 3P7MA 4DXHA 1A4IA 1LQUA 2PH5A 2JFFA 2JKVA 2UVDA 2AE1A 3CZMA 4RPGA 4XCVA 4I8XA 4ALKA 2C7VA 1GCOA 1XU7A 3F9IA 3H5RA 4U7WA 1BWSA 2HK7A 3ASUA 5JY6A 2IZ1A 1J5PA 4OSPA 5G4KB 2RBEA 4MVJH 3AU9A 4JJGA 4FDAA 4NFSA 1HZJA 4NFHA 2YHIB 2X8LA 5EINA 5JDCA 4DQXA 4RVDA 1E6WA 3U62A 4AJLA 3RIHA 4NBWA 1CETA 1JVBA 2H63A 1GAEO 2O3QA 4BV8A 3I9OA 4P22A 2QIOA 1ZVMA 1LRJA 5TQVA 4PLCA 3NEPX 3H8VA 4XEHA 1MFPA 3U4IA 1HXHA 1YOVB 4DMLA 3JQAB 2FR0A 4YVFA 2O2YA 4WLFA 4CL8A 2JCXA 3AUAA 2VZ8A 1MP0A 1YH3A 5EIOA 3PQFA 3HE3A 2Q1UA 3Q2KA 5H81A 3ZWVA 1LUAA 5IZCA 1H5QA 2YV1A 1DSSG 1KOLA 1A7KA 1BTOA 4LSWA 1E77A 1JQBA 4K6FA 3NT5A 3LF2A 3H9GA 1VRWA 3UICA 4EJ6A 1U3VA 2OHXA 1KY4A 1TEHA 5ES3A 5JYEA 3TRIA 2Q99A 2VWPA 2VZ0A 3DC2A 1NPTO 4IDDA 1G0OA 4XJSA 4A03A 5HWSA 1E7RA 2XF8A 4D7AA 1YBAA 1OBFO 2P5UA 3O38A 1SNYA 2QW8A 1U4OA 3GMSA 2JD0A 2HMTA 3RUIA 5CDSA 1TXGA 3D4PA 1AXEA 1KS9A 3KM0A 3N7UA 3WGOA 1R66A 3DO5A 3PFFA 4Q3BA 4E2YA 3FN4A 1F0YA 2VT3A 4CMEC 3UOGA 1Y8RA 3KUXA 3W6UA 4DIBA 3ZU5A 4L75A 1GPJA 2YFQA 4OKIA 4E21A 3DOJA 1HYGA 1EQ2A 3HSKA 4UUPA 5F1KA 4DL9A 5KJCA 3CKYA 4J7CA 3A14A 3QQPA 4YJFB 2Y99A 4DMMA 1XSEA 4MVJP 1H9BA 1ZW1A 3F6YA 4M1QA 2UAGA 1NYTA 4A0SA 4UUMA 1KY5A 1JA9A 1LEHA 2E48A 4EITA 5KJ1A 4W7HA 3I9LA 3ZHBA 1CERA 4AJKA 1LSOA 1P0FA 1XCBA 4PLGA 4BKQA 4QO7A 3DHYA 3NTQA 5DZSA 2DFDA 4B7XA 2IE0A 4MDHA 4LSMA 1A72A 2PWZA 3WWYA 4BMVA 1KVRA 3NKLA 3PGXA 4XYGA 2HK9A 3ROKA 1TT5B 4PG5A 2BMAA 4KUEA 3VH3A 4K6CA 4N5NA 2HU2A 4Y6RA 3IQDB 4JCOA 5FEUA 3GAZA 3NDRA 1GZ3A 5IDYA 1YDEA 1BW9A 1QV7A 4GVXA 3WMXA 4CLRB 1AXGA 2HRZA 4TZKA 4ESOA 1HL3A 3UW3A 4YT2A 4E2ZA 3CTMA 2JAPA 3JV7A 3OP4A 1KC3A 3WSWA 1R4MB 1LLUA 2DTXA 3MJEA 3O8QA 3QWAA 1TI7A 4IPTA 4N5LA 4GI2A 4Q9NA 3U5TA 1L1FA 2NV6A 4E13A 1IOLA 4J1SA 5KVSA 4IQGA 1NM5A 1Q0HA 4HKTA 4FPXA 4J1TA 2EKQA 2IRWA 3JQ9C 3QE3A 2BLLA 2VNSA 2DQ4A 5IG2A 3DAPA 2G1UA 5FI5A 3TL3A 3VKVA 1RKXA 5THQA 1E92A 3TOZA 3H6KA 1NQAO 3STHA 1JU9A 1VL6A 5ER9A 4JJFA 3FTPA 3JD0A 4GLOA 4L9RA 3GGGA 1ZJYA 2CDAA 3QSGA 5TS3A 1NVGA 3ZU2A 4E2XA 2Z1NA 3GQVA 5L95A 5TIIA 5KWEA 3PDJA 1X0XA 3OICA 1GYQA 1XGKA 3D3WA 1VPDA 7ADHA 2W2KB 1NTOA 2TMDA 4MIYA 1YO6A 3C24A 3M6IA 4B3HA 3WSVA 2ZTVA 3WMWA 4JBGA 3AOGA 1P77A 4U0JA 4XR9A 1YOVA 1U5CA 5JMWA 2OUIA 3RVDA 1DFIA 1TVEA 4QXMA 3ZWCA 2D2IA 4RPHA 2FOIA 2PGJA 4JX8A 3EMKA 2IDZA 4G2NA 3I3OA 2B36A 2DUWA 2FZWA 1UZMA 1E7SA 2YZ7A 4C7JA 2F00A 2BFAA 1RYEA 2P4QA 1OMOA 1F8FA 1Q2XA 4KOAA 3W8EA 4MOWA 1E3JA 3TF5A 1R0LA 2I3GA 4UEOA 5I7EA 1VSVA 3GFBA 1SB8A 2IXAA 4L4XA 4EEZA 4EYEA 2R00A 3C7DB 1GQYA 1K2WA 1TLTA 2O3UA 2YHUA 2UDPA 4IM7A 2R00C 1QKIA 1UJMA 4J9UE 1AHIA 3GDGA 3ADOA 2C54A 1AUPA 2QHXA 3EYWA 4XB2A 4M86A 5BT9A 2YY7A 1V3UA 5KJFA 3CMCO 3PXXA 1DAPA 3FPLA 3FNGA 3VH4A 3U09A 2X5OA 2VYNA 1GY8A 5JPIA 3OEWA 4LRSB 1ULUA 3GFGA 3QWHA 1YJ8A 2D8AA 1ZEJA 1DHRA 2DBQA 5L45A 3R6DA 2W4QA 4ND2A 1YGYA 4FFNA 3NT4A 4W7IA 2C82A 2I76A 4BNKA 2IODA 1JKFA 1QORA 4WCFC 2RH8A 1U8XX 1C1DA 2CUKA 3WGZA 4KDFA 5A5EA 4F46A 4U5QA 4XIJA 3LC2O 2W2LD 5A1TA 4FOOA 1QLHA 5CP8A 3H5NA 3ZWBA 4NK5A 5BSEA 5L9AA 4O6VA 8ADHA 3LT0A 2FSVA 1W4ZA 1MFZA 3BTOA 3E9NA 3QV1A 3LC7O 3RCBA 4CLRA 1YB4A 1ISHA 4D46A 5JCXA 2CZCA 4DPKA 4BGEA 4ALLA 4L8VA 3PQDA 4J7XA 1NBOA 3DBRA 2X4GA 4II2A 1I3NA 2EGGA 3G1TA 1DEHA 1ZJZA 3H3JA 3DB2A 3I23A 1I2CA 4B8ZA 1DO8A 5TJHA 5AXDA 1DRUA 1DC3A 1V9LA 1UP6A 4LMPA 3RAJA 1LX6A 5TNXA 1Z75A 3PWKA 1N8KA 4DWVA 4YPOA 4R3NA 1EE2A 3DBHA 3PHHA 4A2CA 4KUHA 2OBYA 1LA2A 3PHJA 5L4NA 3E6AA 1R0SA 1ZK2A 3AU8A 4YJHA 4OSOA 1VLLA 2AQ8A 3GGOA 2YQ5A 3MJSA 4I5GA 4PN3A 1XKQA 4Y98A 3D4NA 3WGHA 5TX7A 4J2HA 1X7DA 4RPKA 4E4YA 1EK6A 1I8TA 2NLOA 4D79A 1YB5A 2F1KA 3JD2A 2QG4A 1E1MA 4S3MA 4Y6SA 3ON5A 3KVOA 3FNEA 1DJNA 4BO9A 5J23A 1MG5A 3WGTA 2ET6A 2AG5A 4JP3A 1XIVA 4RF5A 2GERA 3DBLB 3V2GA 3ZDFA 4EI2A 5A06A 2NM0A 3EHEA 3KETA 3JQEA 5A02A 4MPDA 3EGOA 3LDHA 4TSKA 2W2KA 4RL6A 4TRMA 1E5QA 1U3WA 3SC6A 4LRTB 4OM8A 3JQBC 3GNTA 4D45A 3Q0EA 4BGUA 1UXIA 4U6QA 1D4FA 2YYYA 3AY3A 2NTNA 2UV8A 3NT2A 4I5EA 2BFPA 1GL3A 3RJ5A 4R5MA 2YJZA 2HDHA 1I30A 4PG6A 2EP5A 3G79A 2O3RA 3VDRA 2QZ9A 2E37A 1O95A 2WD7B 4L76A 5T64A 4GKBA 5T57A 1LLCA 1EVJA 1MXFA 3GGPA 3V1TC 2EW2A 4ITUA 1GUZA 4PVCA 1LDEA 5L7YA 4N54A 4CM4B 4JBHA 1VKOA 4IGFA 3W4KA 4I9NA 4NJMA 2I99A 3C7AA 3V5NA 2NUAA 3BTUA 4M55A 4Q39A 5JSFA 4YBZA 4CMIB 2VYVA 1EUDA 5B37A 3UCFA 4RVFA 1HTBA 4WEQA 1HSOA 4D44A 4TRNA 2OMEA 2AEMA 4HFJA 4RZHA 4Z6KA 3WGIA 2HMSA 1TA4A 1HETA 2IXBA 3R0IA 4DC0A 1B8UA 4MVJA 2PZMA 3KYBA 1PWXA 1DHTA 1LSUA 4FGSA 5A4DA 2NQTA 1HDXA 1U8FO 3WR5A 3GNQA 4QSMA 4IY1A 1VM6A 1ONNA 2OP0A 3WB9A 2Y05A 3BHMA 4W99A 4XD2A 3VC7A 2ZYGA 2H9IA 1J4AA 2EEZA 5HM8A 2I67A 1Y7TA 2V6FA 4IDFA 3GR6A 5EPOA 3QVXA 3DR3A 2YUTA 1PJQA 1U28A 1E7WA 2XXJA 4R51A 2UUPA 4BHTA 1HYHA 3JQBA 3QW2A 3EDMA 4R1TA 5EN4A 4QEDA 4A26A 5KCZA 5CHEA 4ALJA 3RFVA 1IB6A 3ABIA 4YDRA 3AI1A 2GPTA 4ALNA 2Y68A 4HX5A 1ISIA 4NH4A 3S2IA 4PCVA 3UF0A 4WGGA 3GH3A 1E6UA 3DMTC 3MWDB 3GDFA 2O23A 3D5QA 1KIFA 3Q6IA 3NJ4A 2EG9A 1H6CA 4HADA 3QWBA 3IC5A 4EJ0A 2C20A 1KYQA 2G17A 1HDYA 1EFKA 2V7PA 2NADA 2VQ3A 3AOEC 4Y67A 3W1VA 2EHDA 2O4CA 4TQGA 4L0QA 3NDIA 3O03A 3E82A 4ZQHA 4YAJA 1A7AA 2I5PO 4BNNA 3IP1A 4FCCA 3ANLA 3EC7A 5I8ZA 1W8DA 3RQSA 4B79A 1L7EA 5G4KA 1I3KA 4LISA 4K1LA 2PH3A 5AOVA 3JYQA 1VSUA 2HMUA 4R1UA 3LF1A 1PL6A 1BXGA 2GRAA 3ITDA 1EDZA 4IS2A 4J16A 2Q2QA 1A71A 3DEYX 4AJ4A 3IL2A 4G65A 5I7VA 4R41A 3DZJA 1P1HA 1DBVO 5G4LA 2V6BA 9LDBA 1RYDA 1KEPA 1YRLA 1JVSA 4AJNA 3DMYA 4RQTA 3INTA 3I6IA 3AUTA 3ONFA 4PLWA 1B8VA 1E3WA 3M1AA 3B1KA 4J3FA 2VNAA 2DC1A 1K0UA 1RWBA 4QUKA 3WX0A 3T4EA 3OQ6A 2FWMX 4ZGWA 3GZ4A 1BVUA 1CQJA 3MCVA 4CM3A 3U3XA 5KKAA 1P33A 2BGLA 4YA6A 2RHCA 4DLBA 3K6JA 3SVTA 3F3SA 4INAA 1S7CA 5AXCA 4CMIA 4OXYA 2X0IA 3JQ7A 3MEQA 1B14A 1FDTA 2FPGA 2FZEA 1GFSA 2POQX 4CUZA 4NR0A 1IPEA 4RVHA 5TC4A 2PZJA 4OOEA 1SOVA 4CM4A 5LC1A 5JO9A 4M89A 1K3TA 1Y81A 1ZK4A 4YAEA 1PEDA 2VYVD 4QECA 1H2BA 1LC3A 1T25A 1UAGA 2WM3A 2ZB7A 4IJUA 5DN9A 3E18A 1EMDA 4I08A 4KTVE 4XB1A 4J4BA 3LVFO 3WBFA 4BMNA 3B70A 3HN7A 3HJAA 2FPIA 5B4VA 5JS6A 1K89A 3F5SA 1YONA 4UULA 3WFJA 3GF4A 3A9WA 1QYCA 1H93A 2AG8A 1U2DA 3VZSA 2ZYDA 4FGWA 1T4DA 4RDIA 2X9VA 3JYLA 4RVGA 5TT1A 2OL4A 3VPHA 2VTDA 1NX6A 2NVUB 1NASA 4CMAA 4FS3A 2CMDA 2I9PA 5DBIA 1VL8A 4KTTE 1DLIA 4CQMD 5CG2A 1B2LA 1QV6A 4H3VA 3AW9A 1X1EA 1SEVA 3ZWMA 5BQFA 3JQDA 2JCVA 3ICPA 4PLZA 4BO7A 3L6EA 5L4LA 4JLWA 3ZNPA 4GL4A 4FR5A 3FD8A 1U9JA 3GRKA 3P5SA 5LDGA 4YYZA 3HUDA 2C2XA 1NFFA 3ASVA 4ZVVA 2VHXA 4WLEA 1UUFA 3AWDA 1SMKA 4AICA 3JYPA 4CQLB 1P1FA 3L07A 2Y1EA 1BGVA 4QO8A 4BIIA 4YT5A 2O3JA 3PJFA 3GZNB 4IINA 2AHRA 5G2OA 4Q3CA 4CV2A 1PZHA 1FJHA 1ADGA 4UEJA 4AJIA 3I9JA 3W6ZA 2V6GA 5GZ3A 1GTMA 2X23A 3DHEA 4ZJUA 4RZIA 1BMDA 1KEUA 2VHWA 3V2UA 4HFMA 5A9SB 5JCJD 4QX6A 1PS9A 2AMFA 1T2DA 1XDWA 2DT5A 1IPFA 4LCJA 2G0TA 5DCUA 1ONOA 3GVXA 1VJ0A 4B3JA 1IHXA 1X13A 4CM6A 2YDXA 3LT2A 1PQWA 1DPGA 1JAYA 3BMOA 4U6SA 3VAZA 2PTGA 2Y66A 4W6ZA 1BHSA 4RF3A 1DXYA 2B4RO 2NU8A 2O2SA 1GPDG 1E3WB 2OP1A 1GV1A 3FPCA 3NAQA 3Q1LA 5CEFA 3E48A 4GAEA 2V65A 2NNLD 3AM3A 2A94A 2GN6A 3ENNA 3NGXA 1H6DA 4BVAA 5T6BA 1YKFA 4WASA 4BV9A 3X2FA 1H9AA 3L4BA 3GEDA 3BA1A 4YRAA 1C1XA 2AEFA 4ND4A 5G0VA 3GA0A 1F06A 5I9NA 1LDMA 2HO5A 3V1YA 2NSDA 3H4VA 1BVRA 4DRYA 3OH8A 3FR8A 1NR1A 1I0ZA 3BYZA 2ZCVA 5LDHA 1HDCA 4QTZA 1XG5A 3KRTA 3H9JA 1NFRA 3R1IA 1ZIDA 2DAPA 3L9WA 4JP2A 5ENDA 4PFJA 2WMDA 4RVSA 2EWMA 3R3SA 5A3JA 1R4NA 3OIDA 5C7LO 4G5HA 2BI8A 1WAMA 1LU9A 2DUUA 4TZTA 2D5AA 5IAAA 1PS0A 1O94A 1U4SA 3PWSA 4BKRA 5TLSA 3ICCA 5LCXA 2VN8A 4GH5A 3WG9A 1XYGA 3HDHA 2EJWA 3NTOA 3ENKA 4FBGA 5GZ1A 4LGVA 4A27A 4D41A 4P8RA 1YQDA 3CXRA 4CMJA 1QYWA 3AM5A 3FBGA 4R1SA 4MKRA 3SJ7A 1ISFA 1ARZA 1B15A 4J91A 3GG2A 4R9RA 1ZSYA 4BO0A 2DVMA 1ZK1A 1ZO8A 1MX3A 3A4VA 4IDAA 3RU7A 1YBMA 4MINA 2HKIA 3EZYA 4TROA 1C0LA 3MJTA 3O26A 4Z9YA 2BH9A 4WCDA 1KERA 3QWIA 1NPDA 2Q49A 1NVMB 4WOKA 4I9UA 3AM4A 1LRLA 5CPBA 1U2GA 4PG8A 1HWYA 3DZBA 4B7UA 2Z5LA 2HLPA 2E4AA 2YW9A 3P19A 5JCJA 4BNYA 1IUKA 4YT4A 4DBVO 5U9CA 4R69A 4AJ2A 5L3ZA 1QXSA 1JLLA 5HS6A 5DCWA 5I9MA 5FFFA 1UXHA 2DU8A 2EGHA 3ZNOA 3RC2A 4FN4A 3LSYA 1I33A 4NMHA 4WJZA 3K30A 4FFRA 1LC0A 4BO6A 2ZJ1A 1ENPA 3ZWNA 4ZN6A 4CQMB 2P9CA 3OSUA 1JKJA 4HFRA 2B69A 1IY8A 1ZXLA 5C5IA 1EUCA 1E1KA 4R16A 1NFQA 1NWHA 2GUGA 4J1NA 2J5KA 1ML3A 1G0NA 3WNVA 3GZNA 3HFSA 3KSZO 1YL7A 4J43A 5CAEA 4E31A 3I52A 2P9GA 2VRBA 3RUFA 1Z82A 2YDYA 1UXJA 4UVIA 4BNWA 5CEJA 1FDWA 5TJ9A 3RC9A 2ZCUA 1HDGO 1KVTA 1LDNA 1JDJA 2W98A 5DBGA 2FHSA 3LT4A 4DVJA 4RJTA 2PKRA 4JK3A 3TDKA 4CL3A 3GHHA 4WCFA 1V3TA 5CDYA 5COBA 3EVTA 4XQCA 2ZQYA 1N92A 3ST7A 1AGNA 4CLOB 2WYUA 4PLYA 1DAOA 2HCTA 2P91A 2DTDA 2Y1OA 3FNHA 3GUYA 4AJJA 2EIHA 3MTJA 3RROA 2ZKLA 3TZKA 1LLDA 1A27A 4WLUA 5U1PA 3DL2A 1O8CA 3G0OA 5L53A 3H9EO 1D7OA 3SLGA 1NAIA 1M6HA 2DKNA 2WSBA 3JYNA 2BELA 1P1RA 1PL7A 3PRJA 2CF6A 2FSSA 5DT9A 1EK5A 1WDLA 3WGGA 1XR3A 3E03A 3W4IA 3BXXA 1UZNA 5JAIA 2ZK7A 5HTOA 5CDUA 1HDZA 3UHAA 3H9QA 4BO2A 2HK8A 5EJ2A 4B4WA 3RD5A 2O3SA 1NP3A 1FF9A 2X22A 3PGJA 2X7HA 4XYEA 3WJAA 5TRTA 4F45A 4BNMA 1HDOA 4BNTA 2QYSA 2JHGA 3AI3A 4DLAA 2CFCA 2Y0CA 3QVOA 4M87A 4XYLA 1G1AA 1Y9AA 3IKVA 2NU9A 3GPIA 3ZWWA 2I65A 2HRBA 1B26A 2J6IA 3D4OA 4BNVA 4F6LA 3PTZA 5BSGA 4XGIA 1E1NA 2IYOA 3OECA 3LYLA 5L7WA 1UDBA 3DZKA 4A7PA 4PZCA 2Y1GA 5L40A 1C0PA 5TSDA 1LDBA 2V6MA 4RCVA 4BO1A 5L51A 2IYPA 3RBZA 3MJ4A 2J3HA 1JWBB 1SBYA 1VC2A 4NBVA 3JD1A 4IUYA 1O6ZA 1R0KA 3SXPA 3A1NA 1Z7EA 2NQ8A 2BD0A 3V8BA 4E33A 5U4QA 5KNLA 2DLDA 3M2PA 2J5RA 4D3DA 2VTEA 4WLOA 4BO4A 3H5AA 2QRKA 4KMSA 3DTTA 1U7HA 3RUCA 1PQUA 3KO8A 3E1KA 3H2SA 4ZQGA 1UXGA 1ZEMA 3UH1A 3I4FA 1EVYA 1UZLA 4HY3A 3ZGYA 1IYZA 4NBTA 2P5YA 5FYDA 2OOSA 3T7CA 2VWHA 1E7QA 3BMQB 5JC8A 3NTRA 5MGBA 4JN6B 1ENZA 4R9SA 4MVJM 1U7TA 2PR2A 4ZRMA 3VVBA 1C0KA 2VUTA 1GADO 2GR9A 4GSLA 3OETA 3QP9A 1VE9A 2WE8A 3JQFA 1BXGB 3C1TA 1DOHA 2FPPA 1DFHA 3D7LA 3OJOA 4O63O 4CQMA 3WICA 1HF3A 1MC4A 2EV9A 2EXXA 4MKZA 4ILKA 1UXKA 3M1LA 4GMFA 4RLSA 1U3UA 1DIAA 4P4GA 3DWFA 4NU6A 3X2EA 4ND1A 4TWRA 4WLNA 3ZW9A 1GYRA 1CQIA 2PY6A 3GNSA 4IJVA 4KWHA 4BOYA 4BB5A 2PKQP 5B1YA 4MP8A 1O0SA 1N7HA 5A04A 3VPGA 2HQ1A 3IAHA 2Q2VA 3A06A 3ZHXA 1LI4A 1Z6ZA 3L6OO 2GN9A 5BNIA 4FFMA 1FDSA 2EW8A 1K6JA 4HBGA 3PJEA 5FI3A 5K9ZA 3K96A 3ZWXA 2X5KO 1YQGA 2B5VA 3NX4A 2Q4EA 2NTVA 2RAFA 3BHIA 3EUWA 4WECA 4NFYA 2Y67A 3RC7A 1F8GA 1DIHA 1MUUA 1DC5A 1Z45A 1CDOA 2B37A 4L74A 3VH2A 1KETA 3LK7A 1LLQA 4YXFA 2WYWA 1I3MA 4JJIA 1PZEA 3ONDA 3KEOA 1Q7GA 2VUSA 2WYVA 1V3VA 4XGNA 1ULSA 2O7QA 3WYBA 4CR8A 1SAYA 4FJ2A 5TT0A 1U1IA 2G76A 1B16A 2R6JA 4XYBA 4J0EA 5KKCA 3JQ8B 4Z0PA 4EUHA 1HE4A 4NZ9A 1M75A 3OIGA 2OBNA 3DAFA 4GX0A 2PD3A 3NGLA 1WWKA 3KSUA 3OBBA 4W9NA 2C0CA 5IZ4A 5ENVA 1E1LA 4M54A 2CF5A 4H15A 2G82A 4CMCA 3AY6A 1H6AA 3K31A 3BZUA 4PLHA 4D0RA 2Q50A 3VOSA 4E12A 3H2ZA 4GSKA 1XA0A 1Z74A 1VJTA 1GV0A 4EZBA 4MJLA 1UDAA 1ZKMA 2BHLA 2IZ0A 3F1LA 4DLLA 5JO0A 1ZFNA 4IJKA 4UAGA 3HDJA 5KJ6A 1XQ1A 2VHZA 3BMNA 4D42A 3PJGA 3O9ZA 1SOWA 1DIBA 2JCYA 1PR3A 2XPCA 4A10A 1WMAA 2PNFA 3WWZA 4BL5A 4UVHA 6ADHA 3E9QA 5THKA 2H5LA 4BKOA 4C7KA 4KP7A 4KWIA 4XJTA 3E8XA 5BNTA 2WTBA 3FR7A 2C29D 5I8WA 3PP8A 4RORA 3PHLA 4PZEA 2C07A 3ZI0A 4AL4A 2LDBA 2JL1A 4MIOA 1SO8A 1W73A 1YWGO 3HZZA 5JE8A 3GHYA 3G17A 5EESA 4CODB 1HYEA 1E7MA 4J4TA 3RUHA 5ILGA 5CG1A 3EZLA 3I1JA 3SBOA 4BMSA 2FN7A 1M2WA 1R4MA 1Y5MA 4E5NA 5L4SA 2WEKA 2JAHA 2ZQZA 3G1UA 4L4RA 3ROMA 2GCGA 2W8ZA 1JAXA 3OA0A 2EKPA 1QG6A 3HWRA 5K6AA 1BDBA 3IS3A 4WLVA 4FJ1A 1KEVA 4CUJA 4PZDA 1SEPA 4AJPA 4R1NA 3ZH2A 1RM0A 1S6YA 2B0JA 4BO8A 1ISGA 1H94A 2GYYA 3ADPA 2CDCA 3JD4A 4GGPA 4Q3AA 3RC1A 3TN7A 2CVQA 1O89A 3UXYA 2EJVA 3DOCA 4QT0A 4U8GA 3U4DA 5TGDA 4CMBA 1KVSA 2PD4A 1VJ1A 4ZHSA 4KUGA 1RJWA 2CVOA 5IZCC 1MC5A 5AXAA 4YAIA 1JW9B 5A3VA 4P38A 1ORRA 3EVNA 2IEDA 5EERA 5F5LA 2GSDA 3KBOA 3IP3A 3BMCA 4BNFA 4E30A 5EQFA 1WZIA 4HNHA 3SX2A 1GEGA 5HBRA 3BAZA 3PYMA 1IULA 4JGBA 4O1MA 2BGMA 1J49A 3WQRA 5H83A 3DBHB 4DPLA 1YQXA 4DPMA 1OI7A 3NYWA 3WYCA 1HE5A 1NHWA 4XGKA 2GDZA 1YL5A 2PFGA 1PX0A 2Q2WA 2XAAA 4ZA2A 3VPXA 1P74A 4MP3A 2IZZA 2X5JO 4Z0TA 5A9RA 2YHIA 1P44A 3BMQA 3ORFA 3KLPX 1R4NB 4IZIA 3TWOA 1D1SA 4BNXA 3GC6A 3G3EA 5DF1A 1MB4A 2AQKA 3WQQA 1LRKA 1M6WA 2I3AA 1A4UA 2O48X 3AK4A 4YQYA 3VHRA 1HLPA 1ENOA 5BNFA 3BTVA 1T2CA 3RUDA 1ISJA 1HEUA 3OIFA 4DTIA 4YAGA 3RKUA 2XXBA 5F1PA 3HDQA 5C37A 4DBZA 4DQUA 2D5CA 3BTSA 2NVUA 1P0CA 3RUAA 1T24A 1QLJA 2D4AA 2BF7A 5A05A 4CUKA 3VTFA 2HJSA 2PV7A 4UUNA 4EDFA 3GPDG 1WZEA 2OFPA 4TVBA 3KYDA 4I5DA 3GVHA 2WE7A 3ZNQA 3C85A 2DBZA 5ITVA 4A5OA 5JDIC 3FWNA 5B4UA 3HDYA 3SJUA 1FXSA 1UH5A 4NIMA 3BMCB 3OM9A 4IDBA 3MTGA 1CJCA 2YQ4A 4OIMA 1N9GB 2P2SA 1PGOA 2X86A 3F4BA 1GD1O 3JQAA 4MO2A 4W4TA 3ETGA 4AJEA 4XQGA 4J4HA 5GMOA 3JQFC 1CYDA 1T1SA 3AJRA 1RM3A 4CLOA 1EBFA 3QA9A 3V2HA 1EZ4A 4CR7A 3HB5X 3WNQA 2X9GA 3AFMA 3F1KA 5KVQA 4UREA 4NU5A 4J49A 3WS7A 3TPCA 3Q9UA 4YACA 4RPJA 2PZKA 1OZAA 5G0SA 4O59O 3CSDA 3ITKA 3C1AA 1O5IA 3GEMA 4PGFA 2GGSA 1DC4A 3RFXA 4DIFA 1PGQA 1MG0A 1LSJA 4NBRA 3FSRA 3EAGA 1QMGA 4YJGB 2FMUA 1JKIA 1LDGA 3I6QA 1RM4A 3ONEA 1NNUA 1WP4A 1Z73A 3PEFA 3TNLA 2IEBA 2JD1A 3I5MA 2AEJA 4G81A 3RKRA 4CLDA 4RGBA 3GN1A 2AQHA 3PPIA 1V0JA 4OQZA 5AQ1A 3CZRA 4E5YA 3PI7A 4GKVA 1PZGA 3GG9A 1DLJA 4A73A 4UVDA 2Q3EA 1NWCA 3OJFA 2QYTA 3QVWA 1GZ4A 4GBJA 3WTCA 2DPGA 1LDYA 3ETEA 3B20A 1IZ9A 1E6EA 2QRJA 3ZV6A 2VRCD 4WUVA 5IXSA 3ZN2A 1DJQA 4S1VA 1T26A 5KVVA 4DC1A 3S1LA 3SC4A 3WGYA 4CJXA 1N1GA 1PIWA 3HFGA 3ULKA 4ZICA 4FQ8A 1WNTA 3HB4X 3SLKA 4YB8A 5TF4A 5JXWA 3JQ6A 2OXIA 2PZLA
chains in the Genus database with same CATH superfamily
4N49A 4UJ3A 2PMEA 3EW7A 2OUKA 1TW3A 2WAXA 3HR7A 4MQMA 1UZUA 1JR3A 1YVUA 3CRQA 1EPUA 3FTDA 3GI1A 3NIFB 2CBGA 2YYSA 4FR2A 4GEKA 1BA3A 1OZ0A 2EFGA 2ID4A 3KR1A 2VF4X 2H92A 3QXCA 2BTOA 3EOAI 5D87A 1QAQA 3H4IA 4ZCIA 4TMVA 1B3RA 3PZBA 2H1CA 1KFEB 2J7KA 4TT3D 3CEAA 4UXHA 5ALFA 4HJRA 1GUFA 4UKDA 2PFKA 1B0PA 1KI9A 1BXRA 1KMQA 4P7JA 5HDBB 2JNWA 1F8XA 1R8YA 4A92A 4YY3B 5CLFA 2PJRA 5F9HA 2YJ6A 3OFND 1KYTA 1EDEA 5HS4A 3LOPA 2A5LA 2UUOA 3CJRA 2A92A 3CKLA 4IXMA 3IKTA 1HA3A 1EU1A 2EKBA 1OBCA 3UAXA 4J0JA 2QAGC 1K86A 3H6HA 1WMEA 1GL6A 1K7SN 1O9BA 1EH5A 2I8AA 3IOYA 4HGRA 1Q0QA 2ZAOA 1Y8RB 1CUFA 4F06A 5C0OE 2QW1A 8ATCA 1C9JA 1D1QA 4Y6QA 5B3JA 3PZRA 6ABPA 4GKJB 3OD5A 3A11A 3GVIA 3SAJA 3TLEA 4GXQA 4YJGA 1UOEA 2RGRA 3LGSA 1D2RA 1G4HA 5DULA 2OG2A 2BEVA 4ZQBA 3VNAA 1E5DA 1X80A 5G40A 3TLKA 1LTQA 1QZZA 2P4SA 1V1MB 1TKBA 4WACA 3SJBA 3O93A 3TJZA 1NMXA 1XEAA 1TM2A 2N75A 1OLSB 2JC3A 5EZYA 4EHNA 2H6EA 3WOHA 2PZ8A 3QE4A 3FNIA 2M6KA 4INPA 1FFDA 3J81A 1XLWA 1EFRA 1JL3A 4X91A 5F64A 5HW0A 2X9LA 3CE6A 3O2JA 2Z30A 1KO8A 1TQ8A 5KSWB 3B1FA 2AFVA 3DF9A 4I6EA 2IF2A 5HK9A 4LV5B 4NX2A 1TZJA 2QN3A 4RXUA 5IASA 1CULC 4RE6A 1H8ED 2HT6A 2NOAA 3BN3A 3LCRA 4O2AA 1U9IC 2VDMB 3UT0A 4JASB 1Z83A 4CMHA 4FFWA 3T5MA 1E2KA 2LDXA 5GZ3A 3JYHA 2ECOA 2A5GA 3KXIA 1T4BA 1RDFA 4YCDA 5ALQA 1ZUD1 5KNCA 2QN8A 2QUIA 1P91A 2XQKA 2Z9DA 3FPSA 4ZVKA 4RENA 3OX2A 2O8FA 2BKUA 1Z7BA 2W2LA 1VDZA 3IUPA 1GYPA 4YJDA 5AJUA 4ZD6A 4TV8B 4FOTA 5ARDA 2HJHA 4WFJA 4TKUA 3UWKA 3COWA 2XMZA 3FE2A 5KNDD 3L82B 3WLAA 1SCDA 1V4VA 3MAJA 2JFYA 1MRNA 3QK7A 1EFTA 2H08A 1FPMA 5IC4A 3TFOA 4EL5A 5DBEX 3RF6A 4WPGA 1UMDB 4PM4A 4A6DA 2ANBA 3C7TA 5AOBA 3SBXA 1Q21A 2C9DA 3SOPA 1ZLYA 4OXRA 4D8UA 3KXPA 3O8BA 4KFCA 5BN3A 4GMKA 3C1UA 3IMGA 4MW4A 3PCRB 4V0LA 3X1ZA 1US8B 3G23A 5HYVA 1Y8QA 1YTUA 3EPRA 3VFDA 3LLSA 4R7ZA 3W6OA 1V8OA 3AY7A 3SKVA 1H0SA 1NT2A 3TCXB 1DOAA 4N76A 2H57A 3E9YA 5ALRA 5KAPA 4C7OA 3M2TA 2JHFA 2VG8A 3PPYA 2YMLA 3DD1A 1A98A 3F5MA 3FLBA 3D5TA 1K8XB 2ZSAA 4R3WA 5KTRA 4L5IA 5KIAA 1AUQA 4LZNA 3LNCA 4OATA 2V7GA 4BVJA 2HXYA 2IYWA 2X42A 4I8IA 4K3VA 1YQ9A 4RPIA 3W8FA 3DZDA 3UUFA 1K3FA 2ZP1A 3ZI7A 1QZUA 1Z16A 2XOXA 1EWQA 3WDSA 3CGWA 1E9RA 2PL5A 2Y4NA 1JU4A 4L85A 4RZQA 4MO9A 4JGIA 1IY9A 5J2UB 3T35A 1ORVA 3U9LA 2BFMA 3H19A 2TRSB 1HI9A 2H4JA 3BHNA 2ZW9A 1HFEL 3KJGA 3LZ6A 4HWRA 4RJ2A 2XV1A 4D9EA 3L0PA 1XOIA 1E96A 4MRMA 5KQPA 1C4XA 3QMPA 1J5EB 1CHNA 1SUCA 3I42A 4WKCA 4FCTA 5D2CA 5GY7A 5BQPA 1WV1A 4IWNA 5CDTA 1FMFA 3TE6A 2H17A 1RFGE 3WC4A 4YHHB 2R62A 3FI9A 3HPRA 4R4JA 1F7VA 3GCWA 1SG6A 2HSDA 4YROA 3V00A 1FZTA 1MHTA 3N0TA 2PLAA 4KXMA 1NNI1 4ZHQF 3M6AA 1NVTA 2JJYA 2VAVA 4N3BA 3VZQA 3D8HA 3NJ8A 3R5SA 5C1IA 3B1JA 1ZIXA 3ZDEA 3WLFA 2Z1MA 5JCOC 4OGWA 4JNKA 1VB5A 4AG3A 4HJXA 2A0XA 5ALLA 1X74A 3AONB 3DDHA 1ODTC 2QZJA 3R44A 1PS8A 5EPUA 4FZ5A 3TTVA 3LC1O 1OI2A 4PXYA 1KMHB 4YRNA 1GZ5A 4ZDWA 5BWBA 3WIDA 1T29A 4MIEA 4JYBA 1FXUA 4GMDA 2GJKA 2R7LA 3WGNA 5JLAA 3WL8A 2EKDA 4QPNA 3EASA 2OQIA 2UKDA 4MQEB 5LUBA 4MRAA 1TU4A 3J80A 2NN3C 2B0CA 4N4AA 5EC8A 4A6EA 1EIWA 3NB0A 5C7IO 1DDIA 3QLEA 5CGQB 3CVYA 2IP2A 1EINA 4LF4B 1EGAA 1S01A 3NVAA 2H29A 1ISSA 3O4GA 5CT6A 3WWEA 4EW6A 1XCOA 3A3OA 4PSKA 1NQTA 2GS9A 2RMKA 3DXXA 2ZREA 1JEQA 1QUFA 2YXBA 3QKSB 2R6AA 5IFLA 2ADOA 2RONA 2ZRDA 3ANMA 3LQKA 2Q6LA 3QLUA 4MUAA 5E2AA 1RJ9B 5LL6P 4P1ZA 3HHPA 3AXTA 4N3NA 2J30A 3GA7A 3HCOA 1UM8A 2Z2YA 4HBZA 3JAKA 4FYKA 3UJ6A 4YO8A 2NU6A 4Q6WA 4RZ2A 4DJEC 4F97A 3EF0A 2Z5GA 1VIAA 2OD9A 3I4CA 4EA8A 1CKEA 4WK2B 1UKEA 3DZFA 2C4WA 4DQVA 5JH7F 2KHZA 5THXA 3N1UA 2E49A 1TQ4A 4YRQA 4ES6A 2AOWA 3BCHA 1USWA 2DLNA 4XSGA 2PMWB 2ZIFA 5DYYA 3V48A 2Z4RA 2XOKA 1GZ6A 3R7DA 4YAFA 4AROA 2WJPA 4GPD1 5I7OA 3SZMA 2W6ID 2HF2A 3LX8A 3N5CA 1WXGA 2TECE 3WGQA 3C4VA 1KEWA 1P1KA 3D0KA 1Y7LA 3LDGA 4UTOA 1CDDA 2P2ZA 3BAFA 3N8GA 4NI5A 1ZD4A 3OD1A 1MO2A 4P3KA 4YCLA 1USKA 4LSGA 5D00A 2IHVA 1GNLA 5JJCA 3NRCA 1OJ7A 2II6A 2Y93A 3I39X 1DV1A 4ZO4A 3HJTA 3WWDA 5DSXA 2JJ1D 4C0AC 4GHWA 2FKAA 1UBSB 2XZTA 1F8YA 3DLHA 3ZZNA 1PLKA 2HJGA 1QVVA 2ZJ6A 1IBSA 3EVFA 2RCNA 4A91A 3RF7A 1BXKA 4FGLA 2C7GA 2QRVB 3TTSA 5KNBD 3QSYA 1XMOB 2EZUA 3C6KA 1XD8A 3PD7A 3IVMA 1WBDA 3PYLA 1HEIA 1CY7A 5AVSA 2HJRA 2N1BA 5DMHA 3ZJ4A 1B6SA 4QRDA 2QUZA 1F2UB 5CB8A 3HADA 4A2PA 3IE0A 3HYTA 3QMMA 1ZR4A 3RSLA 5IJAA 1L7MA 1OCEA 3URKA 1WY7A 3LPNA 5ICSA 4IZHA 4QNMA 4Y6PA 1W1UA 3QFSA 3DMFA 4G5OA 3VUEA 1C1YA 1E0JA 2J5QA 2DRIA 2R1UA 4MVJE 3PHIA 3NUGA 1ELOA 2CN1A 2W9XA 4AT1A 3U4QB 5FIUA 1FVHA 2QXTA 2AMLA 1T2NA 1BWQA 1GIAA 2IXEA 3KQWA 4GL2A 2F1JA 4FFPA 2OD7A 2FW7A 1JJ7A 1Z62A 2VPWA 3QUBA 1E5XA 1RLMA 3PXDA 5JS2A 4XWWA 2CLKB 4FFDA 2PKQO 2R6DA 1LW6E 4BMOB 1S2DA 4IYRA 1E79D 3IP9A 3MPUA 4J0KA 4GXRA 1PWHA 3IILA 4KO2S 3ZXSA 5MGNA 1AM4D 4J6FA 4XR4A 1D04A 2BFFB 4DMHA 3SQWA 4C2UA 5AWFC 4U9HS 5LOVB 1E58A 2AXNA 3CR3C 5KOJA 1UK6A 1TZ2A 2ZYIA 1YJ5A 3SR0A 4J0FA 2LWIA 2XNKA 1OLXA 2IZ5A 2HLDD 4BNTA 1XMPA 5IDQA 3NDJA 4CLXA 2JIDA 1GQOA 3I2JA 2H1VA 4F8YA 4BP3A 4HH1A 3COZA 3FPAA 1H4TA 4Q18A 1LNZA 2HHJA 2QLTA 4R8KA 2QD2A 1JQDA 4E1VA 2UYYA 1ZPDA 3CTPA 5DM4A 1BA2A 3RSHA 2AS0A 1GN9A 3CLTC 2CLIB 4QDKA 4F5ZA 2HA6A 3DO6A 3LUHA 3LWBA 3TLZA 1MV8A 4AF7A 1UR5A 1QRSA 1NVVQ 3BH0A 3IMFA 5KB3A 3W79A 1E32A 1BVYF 2IZOA 4CTJA 3BM5A 4BLSA 1WEKA 1CK4A 1T15A 1T9KA 2G08A 2QQ0A 3K9GA 2HHHB 4ZPJA 1TUBA 3LQFA 4QU5A 3E61A 4JUAA 2PAFA 1LJ8A 3WKCA 3MB5A 3KV3O 4U2KA 2EQAA 1N5KA 2X0RA 3WE7A 5HZHA 5JW6A 1GU7A 1WDMA 2I1WA 4IXTA 4MUXA 2XKBA 3RTCA 4BQSA 3VA7A 5DVZA 3DVQX 1KI3A 2PEYA 4CM1A 5K6AC 3P2OA 4F85A 5K0EA 2I6XA 1PJ2A 1HOTA 4PC3A 4MRPA 2XTJA 2VHVA 2WF6A 1JMYA 1JZTA 2D0OB 2Y6VA 3EZ2A 5KCMA 3MT8A 4QJIA 3PE6A 2C7OA 1VE5A 1M5UA 4L0DA 4U02A 3WO0A 1HLDA 1S2NA 1CP3A 3EEBA 3H5WA 4G4SP 4NOJA 4DA7A 3ICVA 2BGUA 2MINB 3UKOA 1G3RA 3Q5EA 1W6UA 3TXYA 2CD7A 3PFWO 2DBVO 1PL8A 4WCFB 2X8JB 3M83A 2UUAB 4LI0A 4DCPA 4GVLA 1TCCA 2EQBA 5EXSA 1Z2AA 3UEOA 3CNNA 5C5DA 3KJNA 1FSSA 1QVWA 5C3UA 3E3OA 3W5UA 2HMAA 2ZRFA 4M49A 1PG0A 2H1LA 4ID9A 3A3PA 4F1KA 2FN8A 2P9EA 1UWKA 1FVOA 2F43B 2AMJA 3BQ9A 2BEUB 2F9FA 3X1JA 3ZBQA 4B4UA 3KL4A 3KIPA 2WHXA 3L8GA 4F5DA 1L4MA 3TPZA 1A9ZA 2DUMA 2PS9A 4B3XA 1XNGA 1JHZA 1LKZA 3H8JA 1ZWLA 1TM5E 2VJMA 2ZSFA 3R3ZA 4FHCA 3DVAA 2YJ4A 2VDPB 4X97A 3SIXA 3S5UA 2CXPA 2AT1A 2DETA 1R12A 5EKXA 1PK9A 1R64A 2IDKA 3ZBPA 4EX7A 2CDBA 5TDHA 5BPHA 1GM5A 5FA8A 2NACA 3HYLA 2R47A 4I1UA 1XVUA 4KGZA 1LSSA 4RIIA 4ND8B 5DTQA 2GBFA 3PFNA 3VU9B 4AP6A 4BLOA 2X3FA 2XAUA 4NYMR 5KNCD 1RLTA 4P0PB 1P4GA 2JH3A 3C6ZA 4DLUA 4B4VA 2H2HA 4HL6A 4ISCA 3UQZA 4ED9A 3KLMX 5A5FA 2EWWA 1RI1A 4ZVOA 1OWMA 3LKDA 3ONVA 2C31A 1YBVA 4ZEXA 1SZJG 1CNMA 3HB7A 1KTIA 2AN4A 3D2LA 5G0WA 5A9TA 3U48A 1V3QE 2P3SA 2XA2A 2PU7A 1XXHE 4F6RA 5KNDH 3T7SA 3AEKB 4FINA 4NCHA 2Q46A 2QTMA 2A1TR 3AB7A 4A6PA 4DSOA 3C1OA 3SZUA 4FHZA 3NBFA 1JTVA 3OT1A 4GDMA 3U3ZA 1NBHA 4A3SA 1XTSA 1A5AB 2X2OA 2R4QA 4PLFA 3RSQA 1XLTA 1QONA 4P4NA 4H0NA 1YMUA 1AZLA 3TG8A 1MW8X 2O4UX 4UOQA 4AZWA 1KJYA 3PL1A 1VBMA 1E3IA 2GBPA 1PTKA 5A03A 2PGIA 2KB0A 3SF8B 2W6MA 3EVZA 1XWWA 4IH1A 1C3LA 1XN1A 3ZC3A 2NO5A 1N1EA 2VATA 1P60A 3S1SA 2P2LA 1GCUA 2WFLB 4FEEA 4RA6B 4CPDA 3L6DA 2YV3A 4Q02A 2X4LA 4ZT6A 3K5WA 3Q2IA 2XE8A 1JRLA 3TDMA 3PSAA 4RV9A 1ZGZA 1ST3A 2BFCA 4NJEA 1XEXA 2JJ2D 4Y9UA 5EZSA 4CV0A 1GKIA 4JCCA 4Q7QA 1XEFA 1Y1QA 1Z4QA 2ASEA 2JFGA 1RACA 2BFBB 1E6CA 1A8QA 1ZJ5A 4FYXA 5AKZA 5BN4B 4DBLE 5AI5A 4PX3A 2AZ4A 3HFJA 1YD7A 1ZLXA 1P29A 3RVPA 1BD3A 1LY1A 1W5TA 3BGDA 3GD7A 3AF5A 3KUUA 2EERA 2ODTX 4UBKA 1NHGA 3OT4A 4G26A 3QVJA 4QREA 4RMNA 1N7GA 1YDWA 5FWAA 3JZIA 3SMVA 2CL5A 4NCIA 3FBTA 2BJVA 3MNFA 1UJ2A 3DMHA 2IU6A 3JQGA 3EXAA 5H1YA 1JEJA 1W4CA 3K8ZA 1JMKC 2QQ5A 1JG1A 3P9SA 4JT2A 3YASA 3IAEA 4E7PA 4EF5A 1AHPA 3K73O 1V2HE 4HAYA 4PAOA 1MNAA 3BJEA 4NPAA 4JIGA 1W96A 3KZCA 4LRXA 1P7PA 1U2QA 2BFWA 4QXOA 5A9SA 1J9GA 1IJFA 2IUYA 2A86A 3N7TA 4EUNA 2A8YA 2WZDA 3GJ6A 5CXUA 1GQFA 1NBIA 2X1HA 1C0IA 4XDYA 3VNVA 4ZAWA 4X7PA 1ADBA 1D4OA 3L7DA 5FF9A 3SM9A 3V55A 1QRDA 3NBUA 1RAIA 3A6FA 3PNOA 2O6LA 3RO7A 3ZUGA 5GIOE 1E99A 4AJHA 4WDQA 1OH8A 4DDKA 4DFDA 4YRGA 3MHTA 3ED5A 5GV8A 4CM9D 2R2AA 1CF9A 4DANA 2GF2A 4KYTA 1QYXA 3V32A 1X7GA 1BS2A 4WZAB 1K6XA 3T06B 2HF9A 4B0OA 3WA7A 3O4RA 4LVUA 4MUEA 3RSSA 2VLBA 3QWFA 1PR2A 4G3XA 5M2QA 4B47A 5DCYA 4IHKA 3E7WA 2E4WA 3KR0A 1G5RA 1J6UA 2YXEA 3B2NA 3M4JA 3PIIA 4IDEA 3I30X 4GPBA 2X0FA 4YRIA 5CLLA 5G3YA 3G0BA 3D8TA 3B6MA 3ICWA 4U7JA 3TQHA 1X3LA 2Y1WA 3PIDA 1HQDA 1QS0B 2I2XB 4LVCA 5E8RA 1YJQA 5EQDA 4EJ2A 3R7LA 5CLJA 2VWQA 4YS6A 5C4MA 2R1VB 1JIXA 3CPSA 3BZWA 1RE0A 3DFKA 2IT1A 2X9NA 3NHFA 1WKBA 2WSLA 4LYJA 4CMKA 3QYPA 5JD4A 4MRSA 4Z1MD 2VBCA 2ZR8A 1OFUA 3AR3A 4FILA 3QBJA 1IAVA 4EHBA 5D85A 1VGQA 1GPUA 1HK7A 3EXG2 4OAQA 4NDNE 5TS3A 3RBAA 1PZFA 4HQKA 2JLAA 5IYZA 5DKFA 5LMZA 4XDZA 1CIPA 1RXEA 1LQ2A 2FPPB 3QVLA 1W0KD 3KVYA 2CSUA 3F7MA 1WXIA 5HA5A 3EZ7A 1CEXA 1F5SA 1JQ3A 1Y3IA 3T34A 1ZMBA 1IATA 1O54A 1L7XA 4R2WA 2WKRA 3T4XA 3S55A 4BECA 1GNSA 1ZWKA 4MUFA 1A8SA 4ND8A 2GPSA 3TFQA 1KYXA 4Y2YA 3CINA 5FAKA 2NYVA 2OHIA 2R8XA 4BKPA 1BOFA 1IEVA 1QGUA 2PG3A 1GPAA 2Z0MA 5EIBC 3TSWA 3TI7A 3VDQA 3ZZTA 1M0TA 1QH0A 1GAQA 1RPNA 2GZ1A 2I6TA 4FSHA 3RVLA 4AO7A 3STXA 3DTYA 1ZK0A 3KQPA 3NU1A 5GM1A 2BLNA 4ETNA 4F72A 2EFYA 2PRKA 5KDOA 1LX7A 4QFDA 3QW4B 2ZFUA 1FFAA 2CLMB 4YRJA 4M1WA 2Q45A 2O8EB 3B78A 1NL3A 2JI9A 5KTYA 1BFDA 2FR1A 4P7BA 4TT3A 2I7CA 1WXFA 4B3MB 2JD2A 2WDPA 4JH0A 4A4DA 3UFBA 5MDHA 2O7SA 2A9RA 2R8EA 3KQLA 3LT1A 1CCWA 3GRPA 4WZAE 1NP6A 2RHBA 3MHPA 2FPWA 1I13A 1EVZA 2BFDA 4TV8F 1L7DA 2OCDA 1KE2A 5CD9A 1BCSB 5E9QA 4FEYA 2XUAA 5IX8A 3NNDA 4MHOA 3MTQA 4PHFA 1L3BA 2MYUA 2QUAA 3P9PA 3FKQA 3RREA 3ZG6A 4AY2A 3OT5A 3LGXA 1SVNA 1CY0A 2WWRA 2YV4A 4YP0A 4MGZR 4PG4A 5FO0A 3KAKA 1ECBA 2GD6A 4NNJA 4TRJA 3M3PA 2J07A 3KEQA 3O3MB 4QOEA 3NBQA 4BMZA 1U80A 1WZNA 2YY5A 3AVVA 4ETWA 1T4CA 3JYOA 1M0WA 4DIMA 1VPWA 2X1VA 1XVTA 1RD4A 1OTHA 1SR8A 1JA0A 3FTQA 5FULA 1CS0B 1Y63A 4IF6A 4YRDA 4CDGA 3AI2A 3W2TA 3HCWA 3GP8A 3V4ZA 2ACWA 3OJEA 4R8VA 4CT5A 3FI0A 1KMNA 1V35A 3E3MA 2NUTA 1QIIA 2WINI 1WPGA 3IVRA 4IUBS 2G28A 1CRZA 4J0HA 3EPJA 4K9OA 1BS9A 2K7ZA 4B6FA 3QRWA 1QK5A 2Y1CA 3WL4A 4BS9A 3QY0A 1RABA 1X14A 3EXIB 2BC9A 4OL9A 1DWOA 1PJSA 3H9CA 1H2AS 4A0HA 2B1QA 3L1KA 4OB6A 2DSTA 4QULA 3T4UA 4OHVA 2AK2A 2V54A 1PQPA 4GBED 4O0LA 2C4NA 3G7NA 4HWKA 4ZI7B 3PUWA 1C1XB 4NOMA 3NS7A 2HSZA 3A6GA 2Y1KA 5CFOA 2GXUA 5AVOA 1E7YA 2PKEA 1Z38A 3F46A 2Q29A 2GVZC 3RG2A 3ZWOA 4OHFA 3LUDA 5E2IA 2BRUA 2WQ6A 5SYAA 4H6PA 2E5FA 3IEKA 4OAOA 1Q1QA 1UMCB 1CP2A 2A59A 3JQ9A 1KA9H 3PQEA 3QXHA 3VC2A 2Y8EA 2I2WA 4HV4A 5JFOA 4DJFC 5JIBA 1JEYB 1E0DA 5AMXA 1J0EA 2C3MA 5FQNA 3RHZA 1KYWA 2RK6A 1Q1NA 3IYLW 1L5OA 2V6JA 3KTAA 4D3YA 4EBFA 2GLUA 1OXKB 4LVNA 4DXHA 1K6EA 2QTBA 3D6JA 1LQUA 2XW6A 2GAJA 1KRHA 4FDVA 4NC9A 4JFRA 1ND6A 2PR7A 4I8XA 1PJAA 3H5RA 1XMIA 4V2UA 1V47A 3SQLA 3KPVA 2KWIA 2IZ1A 2VQ6A 3NTLA 3BE8A 1GGMA 3PC8A 2IYRA 2RBEA 5JCOA 2R48A 4JJGA 2Z3VA 2ZUUA 3IAS1 5JDCA 2OZKA 4HN9A 4PO9A 3TBHA 3TI9A 4ZTBA 2G9UA 5IARA 4H9GA 1E6WA 3HUUA 4P36A 3Q5GA 3AR5A 5BYJA 3ZGNA 2XQVA 3HWWA 3G6WA 2CLFB 2JZCA 4EA7A 4ENUA 3HCFA 2GN2A 2XIJA 1P0IA 2HZBA 4GPEA 1CETA 1JVBA 2H63A 5AO9A 4CU2A 2PVSA 4P22A 4R8SA 3PA8A 1G8YA 4ZO6A 2NZVG 4MW1A 2IH5A 3AF1A 1ZVMA 2QV0A 1TYEB 1ULZA 2MMGA 1SN7A 2OB1A 4ZCRA 3UB3A 4L27A 1ZITA 5TVKA 2IY8A 2O9JA 1L4LA 2CMGA 2HLDA 3U4IA 2CCKA 3R6LA 1YOVB 3UHOA 1LK0A 1DV2A 4X1KA 2DP4E 4CL8A 3OKPA 5DNDA 1D2HA 2JCXA 3IUQA 5DXAA 3HVRA 3PQFA 2ZT8A 2P2DA 5H81A 4S1PA 1YV9A 1CD5A 2EL9A 1U2TA 1O2DA 3M5DA 3H3XA 1KP9A 4G1BA 4YMTA 1A7KA 2CUTA 1E79A 4BRSA 4ERNA 2H59A 3NT5A 3JS5A 4BMYA 1JPUA 5AJYA 3LF2A 4Q7JB 3H9GA 1WR8A 4WZAA 4DOMA 3AG5A 4M0KA 3OE1A 3ADKA 4EJ6A 4ZT4A 2OBFA 3R8XA 2DHQA 1TEHA 4LXTA 3HKCB 4EHAA 1ZH4A 2Q99A 1FZQA 4MR9A 3JASA 1L5RA 1TF2A 2VZ0A 1A82A 4DLWA 1IWPB 1YCGA 3DC2A 4PYLA 3AESA 4NCJA 1Z3IX 5MN6A 2XF8A 1KO7A 3UV6A 4Z8YA 2BCEA 4QJBA 4UHBA 4DDTA 5JAPA 1U4OA 1FU7A 2JD0A 3T9BA 1T6XA 1M1YE 3TMYA 1XKTA 4EKIA 2GCOB 2A9VA 2PKCA 3ZHOA 3CVVA 3D4PA 1CQXA 1CZKA 3UMRA 1AXEA 4RTJA 2AFHA 3KM0A 1YACA 1DCTA 2YIMA 2OSVA 3ZXYA 3MMPA 3WGOA 1R66A 1XPJA 4RSRA 3O8CA 4DCOA 4NZZA 2RGYA 4E2YA 3N0VA 1B1CA 4WJKB 5ALSA 1JALA 2VPPA 3L0ZA 3T6KA 4L75A 4RJJA 1QJCA 2JEOA 2YRWA 3C0KA 3RSGA 5CCEA 5D5PA 4E21A 3RE1A 2O1SA 1EQ2A 2YZ2A 3B5EA 4S1OA 3ROEA 4AMYA 4F38A 1YS2X 3GRCA 1RHMA 4YMHA 2Y99A 4K7JA 4YRFA 4NAHA 3OMXA 1KOFA 1IPHA 1V43A 2IYEA 2Z57A 3GRZA 1AQLA 3LPCA 3IQGX 4F4DA 3ML1A 5SZIA 3L8YA 3EFOB 4M1QA 1NW8A 3NXSA 3A10A 4I8DA 3JALB 3SC2B 5HJ5A 3DL4A 2WUDA 1OHHD 1KY5A 2N0SA 2XRYA 2DFKB 4HN2A 5BT8A 3UGJA 3T8YA 3ZQJA 3Q8KA 4RD3A 5M5BA 3IFSA 3QEAZ 2V4UA 3R0ZA 4EITA 4W7HA 3I9LA 3ZHBA 1IEQA 1T3SA 1W5AA 2C4VA 1GL7A 2GKOA 5HG0A 1P0FA 1O87A 3DJYA 4LQCA 5P8WA 3QYJA 3DHYA 4G4GA 1E2UA 1USGA 1U2SA 2R6FA 5DI3B 2DFDA 3K0FB 2OAP1 1SCJA 3LLCA 4LSMA 4XWGA 2JI4A 4BMVA 1U0EA 1X1BA 1KVRA 1RYZA 2XVMA 1CRLA 3NKLA 4OBXA 2HOQA 2C2WA 4MHSA 4PG5A 2BGTA 3OPXA 5J5AA 1Z2CA 4KUEA 3LTEA 3HO8A 4A8HA 1K92A 4JCOA 3N2NA 2RHMA 3NDRA 1VE6A 3F9RA 4WW0A 3T5GA 3UG7A 1Y6GA 3B89A 1QV7A 4AY3A 3WMXA 1AXGA 1EWTA 2B61A 2HRZA 2CXQA 3C3MA 1LTKA 4BE9A 3PQ8A 1L4KA 1U6KA 1X1AA 3RVMA 4RMJA 3JV7A 5CA1B 2PSSA 1KC3A 5J5VA 1R4MB 1YR8A 4LOAA 5F5XA 1HT3A 3MWDA 2WJJA 1UBEA 5IUJC 1Z4JA 1YZNA 3CUSA 5KHLB 1M2JA 3C3JA 1ACLA 3HEBA 4PINA 4W9MC 4N5LA 4JBYA 1I7DA 4AW9A 4GW3A 1GTL1 5C7YA 4RGYA 3U5TA 4JP5A 5D01A 3PUXA 2ILVA 5K8TA 2Z5FA 2WHYA 1K7XB 3WLKX 4DV5B 3IB6A 3ABSB 5KI6A 4DHEA 4U9IS 3ERCA 2H0QA 3JQ9C 3QE3A 3HSSA 3NHZA 2ZIEA 3SX4A 5FL7A 3VKVA 4WGFA 1GSOA 1RXIA 3NFYA 1E92A 3IUMA 1XMQB 3TOZA 3H6KA 1NQAO 3STHA 4JJFA 2CEKA 4DF3A 1W34A 4F5YA 4L9RA 1P8JA 4EX6A 3GGGA 1YI1A 1ZJYA 3QSGA 4JS0A 4BE7B 2ANCA 5GP1A 1NVGA 2Z04A 1MVOA 2IXTA 1U2EA 1W94A 1L5FA 4G9EA 4KXNA 4L8GA 1LJUA 1OA1A 1W88B 3DV0B 3F90A 2ZG6A 4P3YA 5KWEA 2VT7A 3L0IB 5B64A 2OBBA 1M8PA 1N8TA 2C97A 3EZ6A 1XGKA 2H7VA 2J59A 1VPDA 3D3WA 5MFPA 4RANA 4K8OA 2VK2A 4F2DA 1NTOA 1THMA 3DVSX 5G1NA 2HRDA 3KFVA 3M6IA 2ZRCA 3WADA 1OX6A 3WSVA 1C9NA 3QU7A 2Z98A 4JBGA 1TFUA 1XDBA 2IQ5A 1YOVA 1Z6XA 2GBLA 4XR9A 5CT4A 4DJJA 5FUMA 2GA8A 1VBKA 3HJNA 2E9SA 1DFIA 3GEBA 3H7IA 5JBNA 2V9ZA 1JKXA 3QPAA 3ZWCA 2JVIA 3U5ZB 1VGVA 5FJIA 4HEJA 4LF7B 1KI2A 2ODEA 3TAXA 2DUWA 1GKLA 2YZ7A 5AJHA 4QJ4A 2Q9UA 3KP1A 1OUMA 2BM0A 3QMWA 1DX4A 1RYEA 2DPMA 3GV0A 4UASA 1F8FA 1BD4A 5K8LA 1E3JA 3TF5A 1R0LA 2I3GA 1SM4A 3BXHA 3OCYA 2FLWA 1RNLA 4UEOA 4URWR 4JI3B 1VSVA 1A8PA 4O4IB 2WG1A 4FDUA 4L4XA 3IEPA 1I1OA 4I2VA 3LXUX 4M7WA 4EYEA 2JCBA 1K2WA 2PSJA 1DX6A 1NBAA 2I3DA 2UDPA 2YHUA 4HGNA 4ZZ1A 1J56A 3AGQA 1RI4A 2FJ0A 1RQ7A 4G1VA 1AUPA 4O4HB 1FXWA 1G8AA 2IEAA 2QJFA 4JT9A 2W83A 5ALJA 1SUSA 3MD9A 4XB2A 2IUUA 5A5VA 1U04A 2F1OA 3D6MA 1U0JA 5HF6A 3T52A 1S3IA 4B44A 1T5SA 1ADJA 1AZWA 3U0VA 4WNAB 2X5OA 2XYPA 1LVGA 4NMLA 3NRBA 1T1EA 1GY8A 4J7AA 1O94C 2E4XA 3EOZA 2QL9A 4M8NE 4UHFA 3UENA 1U3GA 4UBNA 4Z5XA 4LJ9A 1L5YA 3AP1A 4K40A 1ZEJA 5TE9A 4P4UA 5TY0A 1PFWA 4X64B 2NPOA 1ZVQA 1YGYA 2WWIA 4G07A 4MQLA 4PR0A 5L8VA 1VECA 2XQGA 4GM1A 1PI3A 2RD2A 5F4BA 1K88A 2A0UA 4E5UA 1JKFA 4B84A 3ZD8A 1JAZA 1LLFA 1U8XX 5K3FB 1ZUIA 5AHWA 1C1HA 2H0RA 3SJCA 1XCJA 4BFXA 5A5EA 3LC2O 1FXWF 5FPSA 2W2LD 4Z2AA 4KR2A 3BXZA 3QTLA 5EVCA 2DERA 3KU4A 1GGFA 1UPCA 1QLHA 1QIEA 4FOOA 1BJTA 4R31A 5CP8A 3S2SA 4KE8A 5E3IA 4G0ZA 2ORVA 3UOWA 1JJAA 3LT0A 1MFZA 3BTOA 5I01A 1HNWB 1AK2A 3QV1A 4MARA 4MW5A 1X7XA 2C5LA 1MJFA 3EZXA 4D46A 1G3QA 2Q62A 3PVSA 3FOWA 1G7RA 1KS2A 2YOFA 3CVXA 4L8VA 4CCAA 3G2NA 3R23A 3NHLA 5CA0F 5LU9A 3M33A 4QUDA 1ZJZA 1FNDA 2VTVA 4MWTA 4N12A 2G04A 3KOYA 4I1OA 5A5DA 3I23A 4IUDS 1I2CA 4B8ZA 1DO8A 5AXDA 4B73A 5LOVA 1V9LA 1XA4A 5CW2A 3IOEA 3PCTA 1LX6A 4P6VF 3RAJA 5AIBA 1N8KA 1Y3HA 3LAWA 3QFRA 5DJ5A 3WLTA 3SQXA 1GRRA 1QC5B 4XFKA 3GJYA 3PHHA 4RM3A 4LX0A 2O2EA 1LA2A 1CB0A 4JD5A 1KYYA 3R7WA 5L4NA 1KI7A 1EWKA 2WIGA 5ALVA 3GGOA 2AI1A 2WD9A 1P2BA 4PPNA 3MJSA 2JIMA 1SVSA 4ZOBA 3HM9A 3HWSA 3GUHA 1JHQA 2BGJA 1CHDA 1X7DA 4RPKA 2XR1A 4RKFA 4LBVA 1G59A 2Q21A 1L4NA 2NO0A 1HC7A 4DMCA 3ER8A 1XRPA 4M1TA 3JD2A 1U0HC 4EPXA 4HZIA 2QG4A 2WJYA 3SR4A 5AKKA 2XWJI 4HSEA 1P39A 3L6BA 2HEGA 4O1IA 4L07A 2ET6A 3G02A 3I6YA 4BQEA 4RF5A 4EP1A 3V2GA 5A06A 5F73A 1KXZA 1NLFA 3N39C 1H2ZA 4MZDA 3IJEB 5A02A 3W5DA 4DR2B 4XE5A 3EA4A 3LDHA 4TSKA 2W2KA 4BIMA 4L9SA 4RDXA 4BTEA 3Q88A 2HGSA 3CWCA 2PUTA 3FDXA 3SC6A 4CI9A 5AM3A 3FCAA 4Q4JB 1ZU4A 4QYSA 1MC8A 1OV6A 3VJKA 4U6QA 4B09A 4E3WA 3O1IC 1DQSA 4TL9A 3AY3A 3CW2A 4J75A 3O7WA 1XFDA 3WKAA 3NT2A 1K75A 3HHEA 4I5EA 3WBJA 3RJ5A 2Q4RA 2G09A 4HTFB 1G8MA 3CSUA 1O95C 3G79A 3VDRA 3MWFA 4KJZA 2XADA 1O95A 1WHTB 1ZD1A 1ONSA 4I36A 5T64A 4BB9A 1LLCA 3CJQA 1AV7A 1E1CA 1MXFA 1X1CA 1Z5UA 3M81A 1YC2A 4RXTA 5EE0A 3REOA 1MAWA 4U4AA 3OZRA 4AUKA 4JBHA 3WHLA 4IGFA 4JI7B 4I6JA 5B7QA 2O8DB 4ZOLF 2EQ5A 4YV0A 2NUAA 2XCLA 4RMHA 5JXGA 2FWIA 3ETLA 4HTAA 1Z33A 4BJ6A 2VYVA 1B43A 1KMHA 3B2EA 4XLTA 3UJNA 1J25A 4RVFA 4WEQA 3UZUA 2R8BA 3A58B 4CQNA 1M3SA 3OLYA 3WGIA 1TA4A 1H3FA 1HETA 1UDWA 2CJPA 2IXBA 3DHVA 1X1RA 2WTNA 3EA5A 3R0IA 4LHYA 1EX9A 4MVJA 2WY2D 3UWDA 3VZCA 1P62B 4DC0A 4HB4A 1FSFA 4E15A 1EP1B 2BIFA 4Y2HA 1HZZC 2O8CA 4JT8A 3ELBA 3I1FA 2P9ZA 3N5KA 4OPMA 3RB8A 1YI8A 2V8BA 1EP3B 3OZTA 4N82A 5E4YA 4IY1A 4XSVA 2A2ZA 2DEUA 2KYRA 1VM6A 1ONNA 1Z4NA 2B8WA 2OP0A 2EL7A 3BHMA 2C3UA 2G7ZA 2ZYGA 5KTNA 1KKUA 3T5BA 2MSWA 1RPZA 4TKZA 3QKSA 5EHIA 2I4RA 1VJDA 2P6UA 2QPLA 3E22B 1NN0A 2ATXA 2V6FA 2XEDA 3DOIA 2APJA 3QVXA 1OTXA 4H27A 4G0NA 4IDFA 4XB6B 4E1BA 4IEIA 1U28A 1E7WA 3E15A 2YVLA 3IESA 3EIHA 2JLVA 2V3CC 3QU2A 2XT9A 1QIJA 4FT4A 4BFVA 2FA9A 2UUPA 2WF7A 1EG7A 1GTG1 4JR1A 4Z1MA 4XAQA 3NANA 1W85B 3CNOA 4IEEA 1SVMA 4A0QA 3LQRA 1TVKA 4TMKA 3VU0A 3FYUA 3L6RA 2D1QA 4WRRA 1HFJA 1OBOA 1PWEA 2JI7A 2P6MA 1BEUB 1IB6A 3B3FA 3ABIA 1P5ZB 4URZR 4YDRA 4D8YA 4C20A 3LCCA 1MQAA 3TOCA 2Y68A 4Y7DA 5DYTA 5C51B 1ISIA 3A6PC 3S2IA 4O2BF 2IIPA 1JDNA 2L42A 3D6FA 2ZR9A 3V34A 1R0CA 2O23A 4Z9BA 3SSNA 1A9QA 4MRVA 1A3CA 4M36A 4EJSA 3Q6IA 4C3ZA 3OX3A 3ILVA 4N01A 1H6CA 4HADA 4RUKA 4ESEA 3QWBA 3FWKA 3ZJUA 4EPYA 1RBZA 5IH7A 2G17A 3NZEA 1Z0KA 2ZAGA 3EMVA 2V7PA 3AOEC 2NADA 3QFHA 3I12A 4LXYA 5TF0A 4BASA 5ECYA 1FS4A 4HWTA 3QYFA 2HIGA 4TQGA 4ZVNA 5TARA 3JZDA 3NDIA 2YX1A 3QPWA 4QJ3A 1B8NA 4YAJA 2QE7D 3FFWA 4B1FA 3L1IA 3COYA 1LF5A 3IP1A 1Q0UA 4INZA 5ELXA 3CUEF 2ZJ2A 1SBQA 1L7EA 1REQB 4JJKA 1XTRA 3WLIA 5JS8A 4G0WA 2YW2A 2AXPA 1JS1X 3R5HA 2YXLA 3R7FA 2NV0A 3H5TA 4IDPA 4KRGA 4QYIB 1BXGA 1GUAA 2H5IA 3AF6A 1XDGA 4NV0A 1WB6A 4FYIA 3TRDA 4MV8A 4IS2A 2JGFA 3JW8A 2Q2QA 3OCVA 3KQMA 4EI9A 1P19A 1QBGA 3DEYX 4X44A 4EVQA 1K06A 5FRDA 4AJ4A 9ATCA 1PJZA 1Y8AA 4R41A 3NP7A 3RVBA 3N2EA 1RXCA 1P1HA 3KV1A 2C83A 5SY9A 9LDBA 3ZQ4A 3VAYA 1KEPA 5DM60 2Q5FA 3H13A 2MMCA 1PO7A 1YMVA 4GP6A 3R7NA 3T3GA 3WLHA 2XUIA 1IZ8A 3RJTA 3INTA 4PLWA 3AUTA 3ONFA 4JOSA 1MA3A 2BEWB 3EVCA 4IZ6A 4NDAA 1NV8A 2ID8A 2Z3ZA 3AO0B 3Q7QA 5KWIA 2Y76A 2FEWB 3CZ4A 1Q91A 1K0UA 2RHJA 4QUKA 5EWJA 3GAAA 1C9EA 3ZGVA 3WX0A 5JTUA 3LUPA 1K3UB 1VHWA 3R24A 4Q6BA 2PMBA 5J43A 3QJGA 3MCUA 1CQJA 1T6NA 3H1FA 5AKHA 3VU8A 1SHKA 4W8OA 2FSUA 1O0BA 4RFLA 5FADA 4DA8A 2BGLA 2P6RA 1RCUA 1D2GA 1O3YA 1P2UA 3H2IA 1LZKA 3PR2B 3P0RA 4INAA 5C4IA 2AD5A 3EXEA 4JUIA 4GP7A 3I2GA 3IIKA 3K1AA 1S7CA 4CMIA 1ZH2A 4CTOA 1RPTA 2V0NA 1Z18A 4R2KA 4BC0A 2FFAA 1M34B 3VO9A 1WCYA 5DN6A 2FZEA 3ET4A 4EF6A 2JGNA 2WV7A 2V97A 3AVQA 2C9YA 1RI2A 4LQ4A 4V38A 3A1TA 1JIJA