1X7DA

Crystal structure analysis of ornithine cyclodeaminase complexed with nad and ornithine to 1.6 angstroms
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
340
Chain Sequence
b'TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ornithine cyclodeaminase
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
total genus 112
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1x7dA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x7dA02
4WOJA 1VM6A 1ONOA 5TRTA 3V2HA 5HM8A 4DLLA 1SOVA 3F1LA 3OJOA 1VLLA 4PCVA 5EPOA 5ILGA 2Z1MA 2DUUA 1LSSA 3RU9A 3GR6A 4M8SA 1E92A 1YE3A 4CM5A 3AOEC 4C7KA 5L9AA 3ZWPA 2BH9A 2WYVA 2DBVO 3DTTA 2NTNA 5HS6A 4BGUA 2HJRA 4DQXA 1P1FA 3G49A 2RIRA 4HWKA 5T67A 5B1YA 4M87A 3WNQA 5BQFA 1J5PA 1QKIA 4PG4A 2FPPA 1U7TA 3PRJA 3UUWA 1ZK1A 3OETA 1YOVB 1Y9EA 2I6TA 4U5QA 3QQPA 3ZWYA 1W6UA 5JFOA 1ML3A 3SX2A 5F5NA 1I3NA 3Q2IA 1Y6JA 5DF1A 2W8ZA 1E6UA 4NK5A 5DDIP 1PJ2A 2CZCA 2OOSA 4Z0TA 5LDGA 4E2ZA 2ZJ1A 3R3SA 2YHIA 4W4TA 3L9XA 4PZCA 3AU8A 4WLFA 3GZ4A 3C7AA 1LRLA 2GR9A 4DREA 1DHRA 4R9RA 4AJPA 1PZEA 4W9NA 4YAEA 3V1UA 1IB6A 3JYQA 2X86A 4IJKA 8LDHA 3H9GA 3PGJA 2O48X 1E3WA 3UHAA 4MO2A 3BIOA 5A02A 4RDHA 5THKA 4ALLA 5FEUA 4IDGA 4J49A 1C0LA 2JKVA 4G65A 4RVDA 2X58A 4ILKA 2O2SA 3JD3A 1VL6A 3V2GA 1HRDA 1DRWA 2VHWA 3BXXA 1CJCA 4Z9FA 3DC2A 2GPTA 4K6FA 5L7TA 4NBWA 4TRMA 1V3UA 3TRIA 1L7EA 3FN4A 1KY5A 1YBMA 3E8XA 2PZMA 5KCZA 5FF9A 1UXKA 3EDMA 1EEHA 4Q3AA 4D42A 3ADOA 1ISHA 4NFSA 5F1PA 3K2BA 4GKVA 5KWEA 3OJ0A 2GZ2A 4G5HA 4PLFA 4YJGA 3INRA 1JQBA 4XQ9A 5KTKA 1JWBB 4FS3A 5IF3A 4TKLA 4CM8A 3I4FA 4YT8A 3JD2A 1BHSA 2SCUA 3H9EO 5TIIA 1R12A 1TT7A 3K6JA 3M6IA 4MJLA 1TLTA 1I2BA 2ZYDA 3ROPA 1LC3A 3FRJA 5JY1A 4I1IA 1I10A 1WZEA 1HDGO 1LDYA 1DIHA 1JKFA 3ZZNA 3G3EA 1XSEA 2AA3A 1ENYA 2D1YA 3DOCA 4BQRA 4CR6A 5C5IA 5CDUA 7ADHA 4YPOA 4EEXA 3F9IA 3RUCA 3WBBA 2W2KB 2HRBA 4RVHA 1JAXA 3KVOA 3KO8A 3GEGA 3AW9A 3CZRA 1LTHR 3ZGYA 1G6KA 2JCXA 2EP5A 4R5HA 5IDYA 4FOOA 2Q45A 4UREA 4IDFA 2EHDA 3WGTA 3UVEA 4PLVA 4UULA 4DYDA 3RUIA 5ENDA 1XA0A 2Z95A 3INGA 1FXSA 4WECA 4CM4A 4FR5A 2BRUA 1ENZA 2X23A 2GGSA 2QG4A 4KDFA 4L0QA 4CPDA 2A4KA 4NU6A 1YBVA 3GVCA 4Y6SA 1K89A 5BNIA 3WYCA 2OMEA 4RPGA 3PYXA 4H7PA 2NM0A 4IXWA 3IS3A 1HYHA 4GX0A 1GL3A 4CMEC 4DLBA 2AMFA 4D0SA 1MC4A 4Y6PA 2B83A 4IDAA 3ZV5A 4EBFA 4YRBA 3M1LA 1ZKMA 3GC6A 1AHIA 3ZHYA 1H9AA 4HP8A 2TMDA 1N7HA 2IZ0A 2Y68A 1CF2O 1Q0HA 1QSGA 4J3FA 4BNVA 4BVAA 2X4GA 4H16A 1XCBA 2IXAA 1GDHA 4XJSA 3Q2KA 3ZV6A 2EW2A 1HE3A 4PLCA 2PR2A 3FCOA 3IP3A 4GI2A 3RCBA 2AEMA 3E5MA 3PWKA 1H9BA 4MVJG 4F6LA 1BW9A 1IOLA 1SNYA 4TVOA 2Y1FA 3GA0A 1WVGA 1ZK4A 1JU9A 3QWIA 3TZ6A 4ZICA 3PTZA 1JVBA 4IBOA 4BNFA 2RH8A 5G4KA 2BLLA 3TZKA 4CMGA 4Q3EA 3UICA 5CG2A 5BT9A 4YT2A 1I2CA 1PGNA 2Y1DA 3PLRA 1B2LA 1FDSA 3PVZA 3BA1A 4AJHA 5U1PA 1VE9A 2OXIA 3PYLA 3IAHA 2YV2A 4KZPA 1MP0A 4XGIA 1I3KA 2BI7A 4UAGA 4HADA 4E31A 2FOIA 3VPFA 3I83A 3H7AA 1EE9A 1QYVA 6LDHA 2ZCVA 4C7JA 4IDBA 2H6EA 1N1GA 1GFSA 3JD0A 1I3LA 3ZHXA 5DCUA 3DHEA 1X0VA 1LX6A 1E0DA 1HZJA 3ITDA 3LLSA 4ALNA 3PZBA 4II2A 3EHEA 4ZN6A 1I32A 5CFZA 5K6AC 1UDBA 5I9LA 4WLNA 4WUVA 5IDXA 5JDIA 3LC7O 5ICSA 2CVQA 1J49A 1Q7GA 2QHXA 5KJEA 2HKIA 4MIEA 4XR4A 3WGIA 1YQXA 2EKPA 3WFJA 3O03A 2PD4A 1V8BA 3U4HA 1EZ4A 3ASVA 3OH8A 1KERA 3FR8A 3JQCA 2WEKA 3QWFA 3WOHA 3H5RA 4O1MA 4R51A 4HV4A 1ZH8A 1R4MB 5F5LA 3AI1A 1F0YA 2NTVA 3DZHA 4J90A 4OM8A 9LDBA 5TJHA 2Z5LA 1VJ0A 5KIAA 1SEVA 5I7VA 4J6FA 4UUMA 3GAZA 3T7EA 1Q2XA 4FW8A 3U5TA 1B8VA 4IS3A 2AG5A 3W8DA 3ZWXA 4E5MA 5TQVA 4I8XA 2DTXA 1PJLA 3L9WA 4AICA 1Z7BA 4LVCA 3TFQA 2ZTLA 3GDOA 3RKRA 1F06A 3ZI0A 1PGPA 3F1KA 3A06A 3MCVA 1LDGA 1OOEA 4YT4A 1XGKA 1GYQA 2UYYA 4WE3A 1BVUA 3VTZA 4MVJE 4XKJA 3S55A 4AJJA 1UDCA 3EVTA 4GMFA 4RQTA 3WX0A 2BFMA 3GVXA 3NDJA 4MVJH 4E12A 2C82A 2Q2VA 5DBGA 2FSVA 3GZNB 3JQDA 5COQA 2I76A 1ZIDA 3KHUA 2HMWA 4Z3DA 5HTOA 3RBVA 4EUEA 1ISMA 1OZAA 2CNBA 2WE8A 3ANNA 2C2YA 3DEYX 3Q11A 1GZ6A 1YO6A 3WYEA 5L53A 4R01A 4II3A 1GV0A 1D1TA 2CFCA 4XYLA 1KVRA 3W4KA 4ZD6A 4OGWA 1UP4A 3TF5A 3ON5A 3Q0EA 1GPJA 1R0SA 1T2CA 1NQAO 3LLVA 1X7DA 1LJ8A 4J2HA 4R1UA 4UVEA 1OC4A 3FF4A 2JD2A 3GUYA 4LISA 3OP4A 4RVSA 2A94A 2PZKA 4WKGA 4CV3A 2E82A 3GN2A 3O8QA 4UUOA 3I3OA 5GZ1A 1RM3A 5B4UA 1CYDA 3CPSA 3WGGA 4CV2A 5L40A 1EDOA 3OM9A 3VVBA 3WGOA 3JQ9A 2DLDA 5ES3A 1LDMA 3JD1A 4XGKA 1DLIA 4XIJA 1IY8A 1P0FA 4YCAA 1SAYA 3KYCB 5IXSA 3JQ8A 3B70A 5I7SA 4I5DA 4IZHA 5L3ZA 3RWBA 3FI9A 2OGUA 5COBA 4FFPA 4NU5A 3RC9A 3NJ8A 1N2SA 2OP1A 3OJEA 2VHXA 3QVWA 1A72A 3E6AA 2ET6A 4Y6RA 3OMLA 4O5OA 3IP1A 2XXJA 3VPSA 3I6QA 4PG6A 1J4AA 4K6CA 1T2DA 3ORFA 1LSOA 4BNMA 1NVGA 1E7WA 1KS9A 4KQXA 4XIYA 3S8MA 4DIOA 3ZNQA 3ROMA 1PQUA 3MWEB 3OBBA 2Y1OA 1C1XA 1LA2A 5AYVA 3L4SO 3U49A 1O9BA 4LMPA 2I67A 5TJ9A 4K1LA 5FWNA 3CXRA 3ZWWA 4GSKA 4BNZA 1PL8A 1MG0A 1MC5A 4MIYA 2GD1O 2VUSA 5BSFA 2PWZA 2C7GA 2Q1UA 3D4NA 2A92A 2VTEA 2J3IA 1S6YA 2O3SA 2X5JO 3F4LA 3GUCA 3W6UA 3LVFO 4ND5A 1KIFA 3IQDB 4P22A 4ZVVA 3V1TC 1MA0A 1TT5A 3WGQA 2BGMA 1HDRA 1ULUA 1SB8A 4Z3KA 1Y81A 5I9MA 2NU6A 2FWMX 1U7HA 1XQ1A 2AQKA 1M76A 2ZB8A 4OSPA 1GPDG 2JFGA 4XDZA 2C5EA 2OL4A 3U9LA 2OO5A 3CSDA 4I9NA 4JBIA 2C07A 2ZTMA 3ZWMA 4CMIA 2PKQP 4XYBA 3JQEA 4YAGA 4PLTA 2WD8A 4Z6KA 1R0LA 1KC1A 1AHHA 3GVIA 1PSDA 5A5EA 2VT2A 1BDBA 4GGOA 2YFQA 4EJ0A 1OC2A 3V8BA 5A04A 3GLQA 3KEQA 1HDXA 3PXXA 3R0IA 1V3VA 3JQAA 4YAIA 4PLZA 2JHGA 1GR0A 2ZYGA 2B4QA 4IQGA 2P9EA 3M2PA 3WYBA 3PIIA 1X1EA 5G0UA 4H3VA 2I5PO 4J9VA 4A7PA 4DMMA 3JQ7A 1GZ4A 3C1TA 2VZ8A 1DFGA 2VRCD 3AWDA 3VZRA 1ISIA 4RF4A 3D3WA 1XU7A 4HX5A 4DBZA 1YL7A 3GPDG 1HEUA 3IOYA 2G5CA 4L75A 4BV9A 3NKLA 1MUUA 4L9RA 1LNQA 2J3KA 1TI7A 4ND1A 2YHIB 4FB5A 1UUFA 4BQPA 2P68A 2H63A 3HB4X 4QXMA 4Y67A 1UXHA 3KUXA 4D46A 4JK3A 3PHGA 3UXYA 5HA5A 4FFRA 1W4ZA 4E30A 3DZBA 3DL2A 2DTDA 1RM5A 1E3WB 2E4AA 2PK3A 4NJMB 4ESOA 3TWOA 1U2GA 4Q3NA 2VQ3A 4NQZA 2EWMA 1NQOA 4LGVA 5DBIA 4DIFA 1U8FO 3CUKA 4GGPA 3PQFA 3K73O 4DQUA 1UXGA 1YBAA 4GKBA 2ZTUA 1PS8A 1XELA 1SBYA 2R6JA 3NT4A 3F47A 1ONPA 3VZPA 4TKMA 4DC0A 3KSZO 3ABIA 1CIVA 3BTUA 3R3JA 5HWSA 3JYOA 4JNKA 2I3AA 4RCVA 4AJ4A 1S7CA 4E2WA 5H82A 3D7LA 3I5MA 4RO0A 4E2YA 3Q1LA 3HG7A 5KKAA 4A03A 3AY7A 4XEHA 1NFQA 2TMGA 1ZO8A 3C7CB 3V2UA 2HMSA 3QVXA 4R4JA 4YJGB 1NYTA 2PD3A 2PKQO 4NDNE 5H83A 3STHA 5CPBA 1MFZA 1ZSVA 3OF2A 4CM8B 1K0UA 4WLVA 2HRZA 5U4QA 3PFWO 4J0EA 3RQSA 2WE7A 3PIDA 1QMGA 4MVJI 3FBTA 3AJRA 2QRJA 1NQ5A 3F4BA 4RLHA 4WGGA 3KEOA 4MPDA 4LRSB 3GRKA 4QO8A 1P44A 4RQUA 1H94A 4IIUA 4CLDA 5A03A 1I2ZA 1NHGA 3B1FA 3RUDA 1B7GO 2FZWA 2BELA 1PX0A 4YWJA 1N7GA 1B16A 1ONNA 1RWBA 1VL0A 1ZZEA 3DQPA 2O2YA 1Z74A 5T8KC 1KETA 4R9SA 2ZB3A 2P5YA 1ZMOA 1GZ3A 4BMSA 1PEDA 4CQMA 2PTGA 5IXYA 1Y8QA 3W8FA 1L1FA 3AUAA 3HUDA 3ZV4A 4CM4B 1QV6A 3PLNA 5IJZA 3I9KA 3E9MA 3SXPA 1SMKA 1Z82A 1QRRA 3ZNOA 2JCVA 1R66A 1WW8A 2BF7A 2V7PA 4CMCA 1E7RA 1FMCA 4OOFA 4ZQGA 4GLOA 5LDHA 1MX3A 4IDEA 3AFNA 1C0PA 3DFUA 4Z9XA 4DMLA 1DIGA 2IZZA 1YB5A 3QE3A 4BV8A 3RC7A 4IY1A 5EJ2A 2GDZA 1U8XX 1G1AA 3JQAD 4W9NC 3CKYA 3PEFA 2PA3A 3QVTA 1GTMA 5TF4A 4XWYA 2YDXA 2NQTA 3D3EA 4JP2A 3OEWA 4BHTA 5BSGA 1P9LA 1XQ6A 4HFRA 3H2SA 3A1NA 2FPIA 4GWGA 5JLAA 1BW9B 4FIZA 3BMNA 3NDRA 4WEQA 4KMSA 2GN6A 4N5LA 2VUTA 4MVJF 5CP8A 1UXIA 2C5AA 2OBYA 2EIHA 2JL1A 5G4KB 4YYZA 5L45A 3DTYA 5L4LA 4FN4A 3EGOA 2Y67A 3GN1A 4P38A 1FDUA 2P9CA 4DYVA 1KVSA 3O26A 4UVDA 3ULKA 2NUAA 4FFOA 3GEDA 1JAYA 1YKFA 2PZLA 3ANLA 1ZSNA 4CL3A 3I52A 2X0IA 2Y0EA 3QVSA 2GRAA 3LSYA 1AXEA 5EQDA 2VWQA 1T4BA 3W4JA 1LQUA 1ZCJA 3HZZA 4CQLA 4YDRA 1N92A 2QQ5A 1H93A 4HFMA 3OQBA 1V0JA 2NACA 2IYOA 4P4GA 5A5FA 1DO8A 1ZSYA 3KTDA 3E48A 4MVJA 4QX6A 1IHYA 3KRTA 3GGOA 4NFYA 1NP3A 4INAA 5AXDA 2ZB7A 4UEJA 3F3SA 3RFVA 2C0CA 3GMDA 3SJUA 1I24A 4EEZA 1M6WA 4FQ8A 1E3JA 1ISFA 1ZK0A 2PGLA 4EI2A 2V65A 1DC6A 1PJCA 1BXKA 3EVNA 4UEOA 3TJRA 4OIMA 4KTTE 1DIAA 1LDBA 3U62A 4BO3A 2W2LD 3L07A 1SPXA 1MFPA 3S2EA 1V35A 4D44A 5AXBA 2OUIA 3CMMA 2P5UA 3RC2A 3UN1A 1LXCA 1M6HA 2X9VA 1AXGA 2DQ4A 3EW7A 1U3TA 4IINA 4D0RA 4LCEA 4E2XA 3AU9A 5DZSA 5DCWA 3RC1A 2QX7A 2Q2WA 2VZ0A 3QIVA 3GEMA 3WICA 1MXHA 2DBZA 4WCDA 1M66A 1WAMA 3HFGA 3QHAA 3DMTC 1GV1A 5C3MA 5A4DA 3ONFA 1GQ2A 2WSBA 4CV0A 2J3HA 2ZK7A 1OBFO 3TPCA 3EAGA 3SEFA 3ENNA 1VJ1A 3LT2A 4R69A 5GMOA 5TS3A 3H8VA 3DMYA 4XGNA 5COAA 2HO5A 4DRYA 5JCJD 4OHUA 3KETA 4A0SA 4E5KA 4D7AA 1FK8A 1Y9AA 4M54A 2GO1A 1A7KA 3A14A 1EVZA 1GYPA 1YB1A 3EK2A 1YVEI 4U6SA 1UAYA 4PVCA 2FPGA 2EKQA 1ISJA 1E77A 4KQWA 1E7MA 2YW9A 4RVFA 5ENVA 2NU8A 1D1SA 5BNTA 4BNXA 1KYQA 4HNGA 3WMWA 2E37A 2P2SA 4TROA 3O8QB 3O4RA 3DBLA 1E6WA 1B3RA 4CLXA 1ZK3A 3B1JA 4NFHA 5I8WA 5JXWA 4OXNA 1BMDA 3K31A 5TT0A 2ZQZA 3NGXA 4QT0A 4R1TA 3RUFA 1I5RA 1PJQA 1NVTA 3MJSA 1MV8A 1NBOA 4NR0A 1HSOA 2P4QA 2HJSA 2O3UA 2VWGA 1XLTA 4BNIA 1T2FA 3BZUA 4GPD1 3JQ8B 1IPFA 2HSDA 5JDIC 4PRKA 4NMHA 5EESA 4CMHA 4DL9A 2DAPA 4LSMA 3WTCA 3WFIA 3WR5A 3ONEA 3SC6A 3O9ZA 3ZWOA 3JV7A 3QV1A 4J4BA 3WB9A 1GQQA 1TEHA 3AI3A 1DAPA 1NAHA 5KVSA 5BSEA 3SVTA 2Q1TA 2I99A 5T57A 2IRWA 2PGJA 3SJ7A 3HQ4O 3H4VA 3IJRA 4PG5A 4TRJA 4DUPA 3BTVA 4GL4A 3FSRA 1W8DA 1XR3A 4QQRA 1PS9A 2AEFA 5DN9A 1C1XB 1NASA 4RLSA 5JS6A 2E6UX 3TNLA 3Q9UA 2VYNA 3ROQA 1W73A 2GN8A 4RJTA 1LLDA 4RF2A 1E1KA 2B5VA 3H3FA 3ZCXA 5K9ZA 3SBOA 4ID9A 2ZATA 2E49A 1P1JA 1RKXA 3RIHA 4Q9NA 3E9NA 2XOXA 1CDOA 3WSVA 3CE6A 3LT0A 3QVOA 5JMPA 1TT5B 2UV8A 4CLOA 1PL6A 4BNKA 1WDMA 3S1LA 3I9NA 3O38A 4N7RA 4WASA 3GF4A 3NTQA 3RI3A 4BO1A 5F21A 4F3YA 4ALJA 1X1TA 2DC1A 4OXKA 3ICCA 4XA8A 6ADHA 2IODA 4KUGA 4A26A 1DLJA 2VHVA 4GVLA 5IZCC 1X13A 1KEPA 1ZK2A 1CQIA 1BWSA 4J1TA 2Q46A 4CMIB 1EVJA 4PLWA 5TX7A 1Z75A 2J8ZA 5T64A 4DPKA 2B0JA 4I5FA 4GMGA 3HJAA 2EW8A 2Q3EA 4LN1A 4RVGA 1NPDA 5EMHA 4CMKA 4BMNA 1F8FA 3JQAB 3ZHBA 4CM9A 4D41A 1E6EA 1UP7A 2PKRA 7MDHA 1O94A 4D3FA 4XQCA 5JAIA 5CEFA 5IZ4A 2D59A 2GCGA 2JD1A 3MTGA 3R6DA 3JQ7B 2JAPA 3VPXA 4K9DA 3MZ0A 2PV7A 2I66A 4Q3DA 1K3TA 3HDQA 3D3WB 5B4TA 2JJYA 2CMDA 4NI5A 4Z0HO 3WMXA 3JQ9C 4CUZA 2IYPA 2QZ9A 1B8UA 1DAOA 3DO5A 1Y5RA 1KOLA 4JJGA 1UZLA 2Y99A 4YEDA 4W7IA 5L4SA 3QLJA 5JDCA 1WLYA 3UFXA 5KJ6A 2JCYA 2Q2QA 2O7SA 2D2IA 1HZZA 4ND3A 3HDJA 3GDFA 3JQFC 5A9RA 2NNLD 1QLHA 3BYZA 3QJ5A 2UUPA 2J5RA 1O6ZA 3HB5X 4D3DA 4PN3A 3OJFA 5F1KA 4CM1A 5C7OO 1HLDA 2BGKA 3AUSA 3RD5A 1GU7A 2HK9A 3VDQA 1E7SA 1NX6A 4BKUA 1B14A 4CM3A 4YRDA 2FHSA 3H6KA 4E13A 1ADFA 2I9PA 3ZW8A 4Y98A 4EGFA 1HDCA 1I3MA 2HMTA 4FPXA 3PHLA 1VC2A 4AJKA 4FSHA 2IE0A 3JTMA 1OAAA 1E3EA 1PGOA 1HE2A 4ZU3A 1N9GA 1P31A 5ER6A 3GPIA 3TDKA 4F6CA 3OHSX 1VRWA 3FTPA 3K5PA 4G2NA 1P1KA 3GFBA 4JCOA 3WLEA 3HWRA 4NPCA 5ICMA 1C0KA 3VPGA 5JSFA 2OFPA 4R1NA 3UKOA 2J5KA 1NTOA 3GNSA 2WYWA 5KJFA 1HYEA 3RROA 3BTOA 2G76A 5FI3A 5JBIA 3E9QA 1R0KA 3DB2A 1P33A 4GH5A 1P0CA 3ASUA 2CUKA 3LQFA 2B4TO 3AM5A 4FBGA 2ZYAA 3BMOA 4XYMA 1IL0A 4YA6A 1ADBA 2XF8A 5H81A 4CMAA 4J4HA 1X14A 2BI8A 4DTIA 1ZW1A 2VYND 5HS4A 1YWGO 3LYLA 5KJ1A 1SOWA 1RYEA 3PJEA 3IDSA 4L4SA 1BG6A 5TNXA 1Z7EA 1VI2A 3DZJA 2GN4A 4BKOA 2VNAA 4JJFA 1HDOA 4YRAA 4E3ZA 2OBNA 2GASA 3F5QA 1TXGA 1KC3A 2B4RO 2PH3A 1NHWA 3GGGA 1HDYA 3C8MA 3FHLA 3I1JA 4HXYA 4B3IA 5EINA 3PI7A 3RASA 4BNGA 2CDCA 5A9SA 2Q1WA 1ZXBA 2JFHA 5A05A 3ZU2A 2R00A 1LRJA 4RF5A 1HT0A 1NWCA 4CQMB 1Y8QB 3D1LA 3WBFA 4CR7A 2BFPA 4BO4A 3WWYA 2XXBA 1HTBA 4BNUA 3I9JA 4JJIA 3ZWNA 1O0SA 1GADO 3VKVA 1QYDA 3AUTA 4OKNA 2AE1A 3PJFA 2W4QA 4PRLA 1ZVMA 4YJDA 2VYVA 1GAEO 4A2CA 4DPMA 5G4LA 1JDJA 2A9FA 4JLWA 3G0OA 3ZWVA 3MJCA 3S2IA 3AOGA 3P7MA 4IPTA 5AVOA 1QG6A 4CM9D 3VKUA 3ZU5A 3FNFA 2D5AA 3DHNA 4WK6A 1R4NA 3MWDB 1M67A 4NK4A 1UXJA 5I8ZA 4B79A 3RBZA 4FFMA 1BTOA 1EBFA 5L7WA 3ZV3A 1LBEA 1SO8A 1YB4A 2B5WA 4PZEA 4L4XA 3FTNA 3HN2A 5KVCA 4FCCA 4YJFA 3BMNB 1N8KA 4WLOA 5B4VA 2HK7A 4TWRA 4OSOA 2O23A 4RGBA 5GZ3A 3C24A 4AJEA 3KLPX 4ZJUA 2X5OA 3RVDA 2BFOA 4IDCA 3KB6A 3BMCA 3KYBA 3A4VA 1GQYA 1YS4A 1I36A 2IZ1A 2VWPA 1LDEA 4YJHB 3ZHZA 3VH1A 2BGLA 4IDDA 1IYZA 2WDZA 2O3TA 3G1UA 3JCZA 3PHIA 4BL5A 2I65A 3MJ4A 3JYLA 5KOIA 4PVDA 4X54A 3SC4A 2VTDA 3PHJA 4KOAA 1X0XA 3H9JA 1U1IA 5TLSA 1PGQA 1I01A 3MJTA 4BOYA 3EC7A 4AJLA 5G0VA 4JQCA 3I9OA 1KBZA 2EG9A 3E03A 2R2GA 3N7UA 1ZXLA 5KJCA 1I0ZA 3EZLA 3KYDA 4M55A 4B3HA 1EUCA 3PJGA 5CDTA 1O95A 1MXFA 4J43A 4FD3A 3VZQA 1K6IA 4WCFA 3KM0A 4OJNA 4CQLB 3U09A 1JKJA 1CERA 1PJ4A 3CEAA 3IUPA 4XDYA 3NDIA 1XHLA 3QP9A 3RUHA 3JYPA 1H2HA 2C7VA 2CY0A 1H6AA 4S3MA 4ND2A 5L7YA 4C4OA 3QWHA 2OHXA 3R1IA 1XWFA 4EUFA 1F8GA 2QZZA 2Y66A 3PWSA 4IS2A 5L95A 4GSLA 3Q6IA 2PLAA 4GBJA 3A28A 3FPCA 3IJPA 3U4IA 1BRMA 1LC0A 3PWZA 1EQUA 4OO3A 4ROSA 4I5EA 3OIDA 4XB1A 4E6PA 3KSUA 1T1RA 5FYDA 4DWVA 3L4BC 1ULSA 4YTEA 2F1KA 4XB2A 4TRRA 1QYCA 4QUKA 3UCEA 4NJOA 1N1EA 4R1SA 5AQ1A 4I08A 3LK7A 4AFNA 4E4YA 1GY8A 5EERA 1NR1A 1H6CA 1JN0A 3BHJA 2NU7A 1Z6ZA 4NIMA 1PIWA 4QSMA 2A35A 4PGFA 5C37A 1UP6A 4QFDA 3C1AA 1AN9A 2O3QA 4O6VA 3T7CA 2NVUA 4IMRA 3GVPA 1DPGA 1UR5A 4DLAA 1DFIA 4FC6A 4YXFA 2HDHA 4YACA 2DPHA 3INTA 3FWZA 3PDUA 1FF9A 2X1HA 3I9LA 1B8PA 3QWAA 4N5NA 4WLEA 4IJVA 3C3XA 3PQDA 2EEZA 1XKQA 1Q7CA 3K2EA 5CEJA 3I9MA 3NX4A 5JYDA 5DBFA 3FNEA 4M1QA 1JWAB 4W99A 3WIEA 3LT4A 3QY9A 4FFNA 4ZHSA 4R3WA 4KDEA 3GDGA 5G0SA 4P4NA 2Y1GA 2WD7A 3I4CA 3T4EA 4BGVA 3P2OA 4CLEA 3ZDFA 1AE1A 4AJIA 3ZWBA 4CR8A 4E32A 1HKUA 3DBLB 2NLOA 2W98A 4R3NA 1HDZA 4B3JA 1GD1O 1E7QA 4EW6A 1OI7A 1ZBQA 1WZIA 3GAFA 1DEHA 4GQAA 1U4OA 4XYGA 5CEEA 3ZWAA 5JAZA 4JP3A 1XYGA 4D43A 1U2DA 4CMBA 1LDNA 3S2GA 3IL2A 3DONA 2NV6A 3B1KA 4CM6A 1Q7BA 3IKVA 3GRPA 3DHYA 4ND4A 4WLUA 2V6BA 5CHEA 5I7EA 1KEUA 3HHPA 2BD0A 3DBHA 4EITA 2PY6A 1HE4A 4RVUA 4J4TA 5DNAA 5K0ZA 2C20A 2JD0A 3U0BA 3OA0A 2D4AA 5JW6A 1E5LA 1N5DA 2YJZA 1DDOA 3OIGA 3LC1O 4HFNA 4DQVA 2AQ8A 2X6TA 1PS0A 3PK0A 1ZUD1 1PR3A 1CQJA 1PQPA 1ZNQO 1QV7A 3U3XA 2UAGA 3DBRA 5CDGA 1L7DA 2RHRA 1KY4A 4CUKA 3DDNA 1Z45A 3K96A 2F00A 1DFHA 4LMRA 1E1LA 1HL3A 2D5CA 5J23A 1PTJA 3H9UA 4BB6A 3DAFA 3ETDA 4GAEA 1Y8RA 1V9LA 4BO5A 4G81A 2VOEA 1F14A 2YY7A 4E0BA 4GWKA 1JKIA 1ZMTA 3QRWA 4UUNA 1DC5A 3ROKA 3P19A 3OECA 4O0LA 2X0RA 4CLOB 1IPEA 1LEHA 3WLFA 2VT3A 1R16A 4WEOA 1A4UA 2YYYA 3GH3A 2H5LA 1QP8A 3WJ7A 3JQBA 3QWBA 3P5SA 2VWHA 1J6UA 4D45A 1DJQA 2FZEA 5JO9A 1C1DA 1T24A 1FDTA 4LSWA 3H9QA 4ITUA 4TMFA 4BUCA 2XPCA 1EDZA 1EK6A 2UUOA 4XX0A 4YQZA 3TL3A 2B35A 2NVWA 2AG8A 4ZQHA 4FJ1A 4CLRA 3BHMA 4F45A 5JAQA 3AFMA 4FGWA 3WQQA 3WGYA 2EERA 1YGYA 3GVHA 3L6OO 2O4CA 1BXGA 4LRTB 1P45A 1YL5A 4IM7A 3FWNA 1ZFNA 3JD4A 4P8RA 2DPGA 3WQRA 2BFAA 1F12A 5KVQA 3DR3A 2JFFA 1IE3A 3VZSA 3AK4A 1FDWA 2JAHA 2BKAA 1NPYA 3NRCA 3OA2A 1GCUA 3QSGA 5JYEA 2JHFA 2GNAA 5DP2A 4YAJA 4EZBA 5HRUA 5KKCA 2DUWA 2CDAA 1IULA 4BO2A 2FMUA 1LRKA 3QA9A 4TRNA 4B4OA 4IJWA 4N54A 1OMOA 4KUHA 4E5PA 1TVEA 3ZW9A 5CG1A 2VHYA 2NQ8A 1WDLA 3HN7A 4MKXA 2ZB4A 4IIVA 4PG7A 4BGEA 3L6EA 4RORA 5T6BA 3WXBA 3PDJA 5A3JA 2POQX 1Y1PA 1JW9B 1PJSA 2Y1EA 4M89A 3TQHA 1X7HA 1AUPA 4LK3A 4WNIA 5BNFA 1LLCA 2X5KO 3ZU4A 4NBVA 5T5QA 4R16A 5CPFA 2IXBA 4GX2A 2RH4A 4GX5A 5EL0A 3EUWA 4AJOA 4PLPA 4Z9YA 3TOXA 1DHTA 2QRLA 4QFCA 3IKTA 5JCXA 1T2EA 1U5CA 1V3TA 2Y0DA 4KWHA 4UVIA 5AXAA 2RBEA 3UH1A 4BNLA 3GOHA 1CEQA 3QW2A 3HDHA 1ID1A 4ZRMA 1KEVA 1N9GB 1VKNA 2FR8A 2DBQA 3Q9NA 4XRGA 3EYWA 2CSUA 4AL4A 3COSA 3D0OA 3LC2O 3FNGA 5ITWA 3RU7A 2VHZA 4KWIA 1M75A 1P74A 2X7HA 2VNSA 3PFFA 4ZQFA 4MP3A 2WWRA 4IMPA 5T8KA 2CDBA 3DAGA 5IDQA 3SLKA 2ZIZA 4WPGA 5GZ6A 4BO7A 3C1OA 1T25A 3GK3A 2PFGA 4CQMD 3AUUA 4J1NA 2VCYA 4K28A 1LUAA 4BB5A 1VSVA 3BMOB 4OKIA 2NU9A 4BO6A 2ZTVA 2I3GA 1LI4A 3C7DB 4B8WA 2HMUA 4KUEA 1O5IA 4NBRA 4MINA 4L76A 3NJ4A 1K6XA 3GG2A 1GEEA 3WSWA 3G17A 1PGJA 2GLXA 2B36A 1DXYA 2VUUA 3E5RA 3DZGA 1PJ3A 4MVJP 5JAMA 1ZEJA 1NPTO 4HUJA 4TSKA 3OQ6A 4YR9A 3PZRA 4FFLA 2OP0A 1YONA 2FRDA 4BO0A 1SEPA 3DZKA 5A9SB 5JMWA 4NJMA 4D3SA 1B15A 5TSDA 5F3RA 3JQGA 1M2WA 2DM6A 4HY3A 3IC5A 3ONDA 1T26A 3VH4A 1QXSA 1FJHA 3H2ZA 4AJ1A 2YV3A 3H5AA 4B4UA 3RSHA 2J3JA 4ALIA 3LU1A 4CM7A 5JDCC 1Q0QA 4BKQA 1SZJG 1MG5A 3ETEA 3NT5A 3DWFA 3U4CA 4FOSA 5JC1A 1NNUA 1NR7A 1UAGA 3HNPA 4E5NA 2IDZA 4B8ZA 4XD2A 3AM4A 2YFHA 4DGSA 1DIBA 1PJTA 1R4NB 4PFJA 1B0AA 1DRVA 4OYRA 4UVGA 3EMKA 4YT5A 5CAEA 2LDXA 1KVQA 2LDBA 1EK5A 1NXQA 2VN8A 5MDHA 3BMQA 1E3IA 1LSUA 3VOSA 1JVSA 1X7GA 4H15A 4YJFB 1GCOA 1UZNA 3OFSA 3F46A 1PR9A 1AGNA 2CF6A 2DVMA 1D3AA 5F1OA 1VSUA 2X8LA 1O89A 2AW5A 3PPIA 3D5QA 2WTBA 3MJVA 2CVOA 1H2BA 3MTJA 3RUAA 3BMCB 1YQGA 3CZMA 5IDWA 1DJNA 1T2AA 5C7LO 3AOEA 1Q1NA 1ZEMA 4IXTA 4MVJD 3T4XA 4J0FA 1DC4A 1UJMA 4J7XA 4NG5A 3ZWCA 1P1RA 2QIOA 3CTMA 4YVFA 3PGXA 2WJPA 4Y8VA 1YJQA 1NQTA 3F5SA 1P77A 1YDWA 3W8EA 1E3LA 2PH5A 3I6IA 2AXQA 1CRWG 5IN4A 3KYDB 5ILOA 3HDYA 3RAJA 3IIEA 3H65A 3GQVA 2CVZA 1G0NA 4WCFB 5ITVA 4U6QA 3ETGA 1HETA 4BS9A 4IZIA 2NVBA 3DZIA 1EMDA 1WNTA 1R6DA 2QRKA 5A3VA 3OJLA 4CLHA 3AM3A 2UDPA 1PWXA 1XU9A 4HNHA 1LU9A 1KEWA 3E18A 4J7UA 4KP7A 4E5YA 2V6GA 2C29D 2Q4BA 4RDIA 1CETA 4OXYA 3VVCA 2RCYA 2C59A 1ENPA 1X15A 3VDRA 2X9GA 2OORA 3DMTA 1K2WA 2DTEA 5AOVA 3ZNNA 3KOUA 3WJAA 4D79A 2R00C 2EKLA 2PD6A 4RL6A 4IGEA 3GNQA 3KLMX 1HF3A 3JYNA 4JGBA 3VTFA 3TOZA 3E82A 3SLGA 4BKRA 1H5QA 3GY0A 2X0NA 3D64A 1EUZA 2Z1NA 4OQZA 3TZCA 3BTSA 3GGPA 5ADHA 1O8CA 4JROA 4RV9A 3K9QO 3NTRA 2B37A 4XYEA 1BGVA 4L74A 1R37A 4OH1A 1E1NA 3EZYA 2XAAA 1D8AA 2P9GA 4JN6B 3ITKA 4FGSA 3RJ5A 2DT5A 4MP8A 2C2XA 3X2EA 5G0TA 5BSHA 1SB9A 1VJTA 3IUSA 1LLUA 1WP4A 4MVJM 4QTZA 3NEPX 5A1TA 1A4IA 3FD8A 1NVMB 4OL9A 3PP8A 1ENOA 2NVUB 2ZJ0A 4LVUA 3WG9A 4Q3BA 5EIOA 4OOEA 1CWUA 4I9UA 1XG5A 4BO8A 2VZ9A 3PQEA 1RJWA 1W0CA 4RZHA 2Y93A 3ENKA 5DP1A 5L51A 1JTVA 2AE2A 1NFRA 2P4HX 2AQIA 2Q4EA 2J5QA 1UDAA 1KVTA 5IN5A 2D0IA 4B7CA 1BVRA 3U4DA 4FJ2A 2H1SA 3KBOA 1GEGA 3TN7A 4FJ0A 2G82A 4WJZA 1WPQA 3DOOA 3L6DA 1D7OA 3RUEA 2GYYA 4EYEA 2DKNA 4QO7A 2WMDA 2GF2A 3DOJA 4R54A 4E21A 5A06A 1XDWA 3LF1A 1EFLA 1QYWA 2WD7B 4NNJA 4W82A 2YQ5A 1EBUA 3V1YA 5BR7A 3HSKA 4OQYA 3WS7A 1LSJA 2FN7A 4DA9A 3CINA 3WDSA 4YBZA 1PU2A 4W6ZA 4B4VA 2Q49A 4FC7A 4WCFC 4WNCA 1WWKA 5IG2A 2Q99A 1YOVA 3K92A 3TZHA 5MGBA 4YAKA 4LW8A 2O7QA 3F6YA 4U0KA 3UAGA 3AY6A 4BKPA 1A9YA 4J91A 4TZTA 1PWZA 3DBHB 2EF1A 3K8ZA 2FY8A 4J2OA 4B7UA 3VH2A 4CMEA 3B20A 4M49A 4XQGA 1EFKA 1E5QA 3HFSA 2V6FA 5IFLA 4LCJA 4XR9A 5LC1A 1MGOA 3ZU3A 1EVYA 5DOZA 1MB4A 3LZ6A 4TVBA 4JBGA 3Q3CA 2VRCA 3AI2A 3DBRB 1PZFA 3N58A 4MP6A 2O3JA 2GUGA 3D4OA 5IZCA 3HADA 1HLPA 3DXFA 5TGDA 1E7YA 2HQ1A 2HUNA 1LQTA 4FDAA 4J16A 1Y8RB 4RPJA 4Q39A 4ZA2A 2PZJA 3VH3A 4DVJA 5DT9A 1DOHA 4AJNA 4MOWA 4M86A 1Q0LA 1HXHA 4E33A 1ZJYA 4I9HA 4DC1A 3JQ6A 3UCFA 2EGGA 5G0WA 1YRLA 1BDMA 2E48A 2H9IA 3NTOA 2HAEA 4U7WA 3DFZA 3EY4A 4HFJA 2FP4A 3L0DA 3UW3A 5CDYA 1DSSG 1C1DB 4R5MA 4URFA 4NBTA 5TC4A 4MKRA 3DAPA 3KV3O 3PJDA 4GLLA 1K6JA 1IZ9A 1DIRA 2BHLA 4ONEA 1ADGA 3RKUA 3RFTA 1IUKA 2QYTA 4JBHA 3UF0A 2IEBA 2FR1A 3JSAA 1YH3A 3NYWA 2C54A 3FBGA 4CLRB 1ARZA 4ZQBA 4J1SA 3M1AA 3ZNPA 1KVUA 4W7HA 1BXGB 3JQFA 2UVDA 4BO9A 1B3BA 2D8AA 1BXZA 4NZ9A 2GERA 4NBUA 5K6AA 1ZJZA 4CL8A 2W2KA 1EE2A 3G79A 3FPLA 2EJWA 2Y0CA 1H0KA 2GSDA 2Y1CA 2CF5A 1A9ZA 3BHIA 5HBRA 5EQFA 2Q1SA 4YQYA 4AG3A 1RYDA 3H3JA 1JLLA 2QYSA 2YQ4A 3M2TA 4CMJA 4DBVO 3MEQA 1DRUA 1GYRA 1NFFA 4ALMA 4IQ8A 5I7FA 1DC3A 1NWHA 2OZPA 1Y5MA 5LCXA 3S2FA 3OSUA 2NTJA 5KNLA 2PNFA 3A9WA 3GT0A 3H5NA 5JO0A 3MOIA 4QECA 1QORA 2X9NA 2NSDA 1I30A 3RFXA 3WTBA 2HK8A 1VPDA 1IHXA 3NV9A 5A9TA 4L73A 2YUTA 1R15A 2O3RA 5JY6A 4XQEA 3VHRA 5L4NA 1TB4A 5B12A 2GZ3A 1GUYA 1P3DA 1SCUA 4ALKA 3KSDO 1VL8A 1HYGA 2O4UX 1EVIA 2D3TA 4NH4A 4XRRA 4AVYA 4BNJA 1NAIA 4RPKA 3P2YA 4XJTA 4TZKA 3TZQA 2WYUA 2PGDA 4N5MA 2G0TA 3K30A 1QYXA 1T1SA 4Q3CA 2HCTA 4I5GA 1U3VA 4O59O 3JQBC 4Z0PA 2Q50A 1U9JA 4OMUA 3UGKA 3VPHA 5JNLA 2EGHA 3NGLA 2X22A 4XCVA 3L77A 3DZFA 4CUJA 1V6AA 3GNTA 3RBXA 1A27A 4ZRNA 1QR6A 4XZ3A 4J7CA 2NWQA 2HU2A 4NHEA 2EP7A 3OICA 1YXMA 4PG8A 3FR7A 2GZ1A 3CIFA 2VYVD 1ISGA 2VOJA 3ICPA 3PHHA 1HE5A 1PQWA 1NM5A 1DB3A 3VC7A 4OAQA 3UOGA 5DOVA 4BNWA 2ILTA 3CH6A 1YQDA 2O50A 1U5AA 2YHUA 3E1KA 4PIVA 1A71A 4A10A 4DIBA 1H6DA 1UH5A 1A5ZA 3ZN2A 3JQGB 3V5NA 4BNHA 3OEYA 4MKZA 4HBGA 1PL7A 2DBRA 1PZGA 4L8VA 4UVHA 8ADHA 2AEJA 1B26A 2P91A 1QLJA 1T4DA 3ZH2A 4GX1A 1R4MA 5ER9A 2EXXA 4YB8A 3HE3A 5KVVA 2G1UA 3NUGA 4J1QA 2BMAA 3D5TA 3IMFA 1BSVA 4UUPA 4ZGWA 3KXDA 2AQHA 1XEAA 1LLQA 1P1HA 4IGFA 4DPLA 1C3VA 2GN9A 3TL2A 1J0XO 1U28A 5FFFA 1FDVA 5I9NA 4IQ0A 1ORRA 3TSCA 3G1TA 4F46A 5TT1A 5FI5A 5THQA 1TA4A 3GMSA 1JA9A 2J6IA 3UCXA 3VAZA 4BIIA 1C14A 1P1IA 3BMQB 1F17A 4UEKA 4S1VA 2AHRA 1SC6A 1C0IA 1Y7TA 1RM0A 2EV9A 4MDHA 4R41A 2W2LA 2EJVA 3W4IA 1GUZA 3CMCO 3W6ZA 4RPHA 1I8TA 3GZNA 4WOKA 3ANMA 1IZ0A 3BAZA 4EJMA 2X0JA 1MLDA 3D4PA 1WXDA 4EDFA 2IEDA 4B4WA 4JIGA 2B69A 3C85A 1HSZA 3N74A 4P4LA 4A5OA 3WNVA 4DXHA 4BGIA 2DFVA 1EUDA 5AXCA 4B7XA 5GY7A 2ZKLA 3RJ9A 3GG9A 3LDHA 2YZ7A 4JX8A 5DCYA 3OIFA 2VRBA 4Y9DA 4HKTA 4N18A 4RZIA 1D4FA 2HLPA 1Z73A 1E3SA 2ZCUA 4ZQEA 3WWZA 3OQ1A 3L4BA 5JCJA 4J9UE 5C7IO 4KTVE 3LT1A 4U8GA 4A27A 1E1MA 3ADPA 4MIOA 4CV1A 4IUYA 2YV1A 3X2FA 4PLHA 3MJEA 4BNTA 1DBVO 3KZVA 3KYCA 1U3WA 5G2OA 4A73A 2WM3A 3WGZA 2RAFA 1U3UA 4GVXA 1XIVA 3WQSB 1K5HA 4CJXA 1ADCA 4U0JA 1EQ2A 3I23A 1YDEA 4PLGA 3FNHA 5JC8A 5CDSA 2ZQYA 2YDYA 4PZDA 2DU8A 3GHHA 3NT2A 3NAQA 4K26A 9LDTA 3MOGA 1H6BA 4BNNA 5DULA 1PJBA 1GUFA 1VKOA 2FR0A 5JE8A 4EUHA 3PYMA 4O63O 3GHYA 4QEDA 5JPIA 1U4SA 1OFGA 4L4RA 2G17A 3AY3A 4RPLA 3ST7A 4CODB 4AJ2A 1YJ8A 2DFDA 2QW8A 4YJHA 2NADA 4BMVA 2Y05A 1I33A 3W1VA 1HWYA 1WMAA 1A7AA 4RF3A 2V6MA 2CD9A 3WGHA 2HMVA 3B6ZA 5EN4A 1WMBA 1WDKA 3GFGA 3LF2A 4PLYA 2W90A 3DBVO 4R68A 1G0OA 5IAAA 1RPNA 3WIDA 2FSSA 4EJ6A 5U9CA 2RHCA 1RM4A 4TQGA 4JXKA 4IJUA 4BNYA 3TFOA 5B37A 1PZHA 1YL6A 1UZMA
chains in the Genus database with same CATH superfamily
2QN7A 2HCJB 3OCCA 1ONOA 2RC5A 3LV8A 5TMBA 5KU7A 3LQRA 3V2HA 5EP2A 5HKOA 5K0TA 3U19A 4CXMA 4B3FX 1F5SA 1SOVA 2XNHA 3NUQA 5EPOA 5ILGA 1QQ6A 5TXGA 4JUBA 2Z1MA 5KWIA 2AOUA 3EOZA 1DWPA 1FLAA 3MINA 3ES9A 1AK2A 3GR6A 4IRXA 4DNOA 1YE3A 3AOEC 1XD2A 3IJEB 1QZXA 3NDPA 1W48A 1ZKDA 2FMKA 3P9QA 4OJKA 4EAAA 2DBVO 3DTTA 4ZDKA 3AC0A 4KL8S 4BGUA 3X2SA 2JFQA 2V4ZA 3KAPA 3VPCA 1QQ7A 2FEOA 4DQXA 5BUCA 1P1FA 2X5NA 3OZWA 1M2GA 3HBMA 2RIRA 5F3DA 3O90A 4OQFA 3UENA 1QO9A 5AVQA 3HZOA 1XZNA 3QU4A 4IL5A 5JTUA 2LE0A 2H1HA 1Q50A 1JEYB 3HXLA 3GBSA 3QXGA 4M87A 4RANA 4JSRA 1GTRA 1QKIA 5MFZA 1FB5A 3QNMA 2FPPA 2FKNA 2WINI 5F2OA 1E3MA 4C6TB 1TC1A 4BN4A 5AW1A 1ZK1A 2DH5A 5LNK1 4D4IA 3PC7A 2V7QD 4WUTA 5LSAA 2J45A 4PCLA 1VHJA 3ONWA 4N0QA 1DDIA 2RK6A 3LG2A 3PPXA 1ZGAA 1U8TA 3SX2A 5F5NA 3U7QB 5B64A 3PWTA 3ZS8A 5D5PA 5DF1A 3OVMA 3A1TA 1E6UA 4NK5A 5DDIP 1LW6E 1V8FA 4O4IB 4TSFD 4Z0TA 3KR1A 2ZJ1A 1UPCA 1QTRA 4E14A 3R3SA 2ZETA 2V58A 4FHCA 4BNDB 3AU8A 3ND7A 4GOND 1DQRA 4Q82A 3ROGA 4MMYB 1DHRA 4AJPA 4ER3A 2Q4OA 2AOTA 2ERXA 4IEEA 4W9NA 5ARCA 2OTCA 1DQNA 3H4TA 1C8VB 1M1YE 2O48X 4GR9A 4WXYB 5G53C 5MF6A 2A6PA 4MO2A 4E70A 4R40A 1N2IA 4Z1OA 5JV5A 4HZUB 1BKYA 2QVCA 2SKCA 4M36A 4Z8YA 4PYLA 5THKA 4D8VA 1IBMB 3ZXXA 4TS4A 2JKVA 1PN3A 2XRFA 3N8DA 2JI6A 3DA8A 2X58A 3IQZA 4G65A 4RVDA 5EIHA 3W6NA 3GQBB 2O2SA 2XX3A 2AUMA 1VL6A 4REOA 3EZ9A 4IH1A 5AW0A 3GLGB 4ZVMA 1DRWA 1CJCA 3VU9B 4U39A 1H4VB 4TRMA 5LXTA 4URYR 3BXPA 1PJZA 2C2HA 4AF6A 1NOKA 4E3WA 4NULA 4A8JB 1YBMA 4L5JA 3JRXA 2IITA 4OHVA 4RPCA 4U1RA 2V45A 4D9BA 4CQNA 4O0MA 1KGSA 3T5CA 4HF7A 4TSRA 1HMYA 4HDKB 5HBGA 2BGWA 2X8JA 4GKVA 5BO5A 3OJ0A 1OB2A 2CL6X 2GZ2A 4G5HA 4JLPA 4PLFA 1LJLA 1RZVA 1Y98A 4XQ9A 5ERYA 5EHGA 1WXWA 3AB8A 3G9ZA 3TLBA 5HJ5A 2MIIA 3TSZA 3UC9A 4DLNA 1RE0A 3PFCA 1SD1A 1BHSA 2SCUA 2J0SA 3OZGA 3MBOA 1N9ZA 4EG8A 1I2BA 4EW1A 1OI2A 4JITA 3R9XB 3FRJA 4QQFA 5E4YA 1GTL1 4M1OA 1KPGA 3H86A 4WCVA 2WQ7A 2O8DA 1GRQA 1HDGO 2ZBVA 3U3JA 5ALQA 2VQEB 3IUYA 2HF2A 3NDBB 1LI5A 1UQTA 4S1OA 2AA3A 2C2MA 1ENYA 2R6FA 1KPIA 3BE5A 4ACAA 4BQRA 3IT0A 2AZDA 7ADHA 5DNDA 4GL2A 1Y0BA 4RK0A 4E7PA 3F9IA 3RUCA 4JBYA 3WBBA 4RVHA 1EXNA 3KVOA 3KO8A 2PNJA 1L6RA 5CT8A 3GEGA 4XD7A 3FMPB 3HKBB 3PD0A 3AEUB 2JCXA 5H5JA 5B1DA 5LOVF 3I72A 4XJVA 1O0BA 2EHDA 3WLIA 1IWOA 1P1CA 1UBEA 5ALZA 3WA7A 4O33A 1P2UA 3UVEA 4HNRA 4JQOA 5K05A 3OPXA 2HH9A 2HFJA 4L3WA 3UUEA 5ENDA 2Y0BA 1G5IA 4X24A 4Y9TA 4X7BA 1AGXA 1EH5A 5B1HA 2IPLA 4FE4A 3EDYA 1U0GA 4KJZA 1XT6A 2FWPA 3HY4A 4UNSA 3NHWA 3OF3A 4L0QA 2JZCA 4CPDA 6REQA 2HJWA 1AZWA 1HQKA 3FMFA 2C03A 4QELA 3GVCA 2BYTA 5DM1A 1KMMA 2FW9A 2OMEA 1YDHA 3FTCA 1NA5A 2BWJA 1IEWA 2X1LA 2YICA 2JGAA 3R7BA 4EBFA 1XAIA 1ZKMA 3GC6A 1K9VF 1AZTA 2OCXA 4G07A 1H9AA 3BE4A 5DWDA 1UBKS 2Y68A 4MZXA 3COJA 1E63A 1JILA 1KJNA 4TLMB 4AMBA 4QBTA 4KGVA 3I61A 2RGNA 1V8OA 4G63A 4BNVA 2XOKA 2IXAA 4RADA 5DSXA 1PK8A 4DRXB 3Q2KA 3HKCA 1MGPA 5LMZA 2VJPA 1Z88A 3KWJA 3BSFA 4J16C 3PWKA 5LOVA 4JUIA 4LUCA 4F6LA 4EHFA 3UYKA 4TVOA 5AVYA 1IQPA 5H3LA 3RS8A 3UK7A 5J9FA 3MN1A 1NW5A 4QUAA 3RS9A 3M33A 3TZ6A 4I4NA 1KDTA 3LXXA 3EARA 1VG8A 3PSHA 4IBOA 4R9VA 3U1TA 3TMKA 4A8JC 3C6BA 2XI4A 4Q3EA 3LOQA 4ID3A 4EELA 4EHBA 5KI6A 1KOFA 5JRZA 2WFMA 3B8HA 1KOGA 4S0XA 3BPSA 5CYOA 5DBHX 2R5WA 3CUWA 1U8ZA 2A14A 2ACVA 4QHTA 2EQBA 4N8SA 3PYLA 5U1PA 4ZK6A 3SEZA 1AUQA 2PL5A 1JEAA 4KZPA 3O0DA 3V7FA 3WGNA 1FNSA 1UCFA 4UAGA 4XM2A 2UZ4A 4FM9A 2FOIA 3BJZA 5KTYA 2PRYA 4H31A 4EI8A 2OHJA 1NVWQ 2Z2YA 2ZJ2A 1EE9A 4TL8A 3II6X 2BEWA 1UF9A 2CLOB 3HN6A 1UMCB 3DXXA 5I9TA 3UB4A 4ETNA 6LDHA 5EIWA 1ZUWA 4M9UA 2GEFA 5LLDA 3GGSA 1VJCA 3Q6NA 3T9EA 3D6AA 2GHIA 1U9CA 1I3LA 3CVOA 1EGHA 4UDNA 1R6XA 1RTTA 1HZJA 2VSOA 4GKKB 4ALNA 1UKZA 1RC1A 2OESA 4GXTA 4ENSA 4PW0A 3AFGA 5BSUA 4AUMA 3OZUA 4BVGA 1CF4A 2R25B 3BKXA 2JBAA 3N8HA 2BBTA 1BH6A 4YAOA 1Z29A 1ZCFA 5TGZA 2PE5A 4G23A 5KB3A 3AQIA 4F5YA 4CL2A 4OF4A 4MIEA 1UK8A 2EKPA 3ESAA 1NF9A 1XZIA 3CKMA 4KBFA 3K8QA 3WISA 4QE3A 1V8BA 3OQPA 4IRUB 3OH8A 2J41A 2V03A 3FR8A 1FU7A 3JQCA 2ADOA 3QF4B 4I2NA 4E7OA 4WH0A 2QJFA 2JKYA 3FUXA 1R4MB 4BBJA 5F5LA 3SDZA 4ENVA 1W88B 4MR9A 3DZHA 4Y7DA 5DASA 4HNSA 3TUZC 5EZSA 1VHQA 4NU0A 5J4VA 1SEVA 2XQKA 4J6FA 2YOGA 1K92A 1DTWB 4JB8A 1B8VA 3DWIA 3CNBA 4IZOA 2HJ9A 5TQVA 2ANBA 3ESCA 2WIDA 1C7RA 2OC4A 1TA0A 1Z7BA 2AG0A 3RV3A 3QE4A 4C0BA 5JSQA 3NBAA 5KYXA 2G88A 1MABB 3F1KA 4K9LA 1GNTA 2INGX 3VR6H 3PSAA 1CUEA 1C7JA 2FZ5A 4G9GA 3T1QA 5DTMA 3O4IA 1GYQA 1J8QA 4DV3B 4RD1A 3UHFA 1JHPA 2O1EA 4XKJA 3RJZA 3S55A 4XOIA 1C29B 2AZMA 4G2TA 3JQRA 4RMJA 2ZJ3A 1RAAA 3B6EA 3CT6A 9MHTA 1BE0A 3UANA 3H2YA 1KK2A 1RXEA 1I4EB 1P2GA 1TLLA 4Z99A 1EKXA 3FKJA 2VQSA 1B0UA 3GFRA 4RBNA 1ZVQA 4R7GA 4PS1A 5F77A 1OBCA 3X0DA 3HY3A 3GZNB 2Y8EA 2QW0X 4QU9A 4LI0A 4K87A 5COQA 3UEOA 4BTVA 5KUTA 3KKQA 5KOJA 3TBKA 2JIZD 2W7TA 3K1YA 4Z2AA 4LRUA 3Q11A 2Q1XA 3DEYX 4HRAA 1U8UA 5D3MA 5DH9A 1BFKA 4WKPA 1Y37A 3NM4A 4N1AA 2X3YA 3JARA 2O2HA 4D99A 4ENQA 2Q41A 1AMUA 4EYSA 1UP4A 3TF5A 2CJXA 3KZNA 3ON5A 3PFHA 1ESEA 1R0SA 1Y3BE 1T2CA 1NQAO 1OZFA 4FMPA 5AVJA 4Q9LA 2Y27A 3I32A 4HXEB 3T3GA 4J2HA 2FW7A 1LD3A 1OC4A 1JAZA 1RQPA 3GLKA 1WU7A 2HZBA 1BVHA 2ACWA 1AGRA 1COWA 3I3OA 4F8JA 5B4UA 1ZN7A 3WGGA 2YX1A 5A2GA 1P4HA 4XJXA 1DC8A 1XQ9A 3GO4A 2AMYA 3U40A 1XJ0A 1V16B 5BR4A 1MN6A 3WGOA 4XVCA 2DHCA 3IURA 3JD1A 1IY8A 3PGKA 1E6LA 1GT6A 4BQSA 1YK0A 1E4EB 4WINA 5AJWA 3MT8A 4TV9F 3LC0A 4A6EA 3WDMA 2GHRA 4ANFA 4IH9A 3AWIA 3BJMA 4I5DA 4F4HA 2BN4A 3B2NA 3JAKB 4FFPA 1XQWA 1YUBA 2PTHA 5HDQA 3AUYA 3NJ8A 3OJEA 4WKNA 4Y6RA 5AKLA 4ZZ0A 1A72A 2CUZA 1TJPB 3EDQA 3PD7A 3IP1A 3I0MA 4QWMA 3VPSA 3ZUPA 4A8TA 2IUSA 3ORFA 4Q3KA 4ZMRA 1CTQA 4UTNA 2A5DA 2FE1A 1EP3B 3DXYA 1E6CA 2EBWA 2GVZC 4RYDA 3S8MA 3ZTTA 5KWSA 5IABA 1XRMA 5J47A 3C15C 3ROMA 4AURA 5F2EA 4N01A 5DGTA 3R7FA 3R8CA 2P8JA 4LDRA 3AEXA 3OU7A 4JJ7A 2W71A 4JOCA 1O9BA 4U7FA 4TKVA 3TSOA 5BN3A 4E51A 3V7YA 2PAFA 1QQBA 4MW2A 2Z6AA 3ZE7A 5T7BA 4MIYA 4BB0A 1TUEA 5MGNA 1RABA 2ZUCA 1L7QA 7ABPA 1ZHOA 1BU8A 3DE1X 3PGLA 3KVRA 5K3CA 4ZKDA 3CPJB 3V4RA 2ZJFA 1KIFA 3MMPA 4P22A 3WIUA 1TYBE 5DGDA 1RRFA 1TT5A 5HQ3A 3MRTA 2K87A 5CLFA 1T9DA 3G8DA 4P31A 1KDVA 1JDVA 3KXPA 1N5OX 3KUDA 4X3PA 2DLCX 4U2EA 3IBSA 4BECA 2AQKA 2B7CA 3QPCA 1M76A 2ZB8A 4PNPA 4TTVA 3RARA 3IUQA 3THWA 2HT1A 1XDGA 1U7XA 1Z9BA 3ROEA 3NV7A 4WZAB 4F1JA 1EZZA 3C3EA 1E3QA 1JIQA 2PXHA 1Z6PA 2WYIA 3NBKA 3W34A 1W1IA 4QG7A 3RTAA 1KEEA 1BE8A 2PZBA 3B51X 3ESQA 3GYGA 3JQEA 1W52X 3KTOA 4QTUB 2C61A 4KVGA 1MTOA 3GVIA 1AHHA 1R5JA 1QO0D 3R5JA 1NUPA 4P4SA 3O5AA 1NXOA 1M1YA 4QLOA 4C6RA 3FTFA 2CVHA 3KEQA 1HDXA 3NI2A 4GSYA 2P11A 4IIYA 4PSDA 4V0SA 4GP7A 4A0RA 1DCMA 2JHGA 1GR0A 5SV2A 4IQGA 3KWFA 2QTBA 5AI4A 5CRIA 1XHFA 4H3VA 5G0UA 2O8BA 4L9SA 3ZDXB 1F8XA 3OAAD 3JQ7A 3EAFA 3LUJA 4HB0A 1JNYA 3C1TA 2VZ8A 4L5CA 4OB6A 2VRCD 1CRZA 5E7MA 1A8QA 3B1YA 3WLNA 3OQNA 3M4JA 5JISA 3NMUF 3SOZA 3RVNA 4BX8A 4HX2A 4P1ZA 4OX9B 3SK0A 4RMIA 3ODPA 5C3UA 2GRUA 1E94E 1UIRA 1FW8A 4Q03A 2HW8A 2DT8A 3N2GB 2OK8A 3F6EX 4KN6A 2VZLA 4GXQA 2OB1A 1ONSA 1CY4A 1MUUA 4UXHA 5C8VA 2J3KA 1PFYA 5CJPA 3LA6A 3KKMA 3NC0C 1FP2A 3CUTA 2YHIB 3OE1A 5ALMA 1UUFA 3BWXA 4BQPA 4JDUA 2OCAA 5K8IA 4OK5A 1UXHA 1D4AA 4CF6A 4BJ5A 3FROA 4JK3A 4JODA 4LYHA 2ZRLA 3OUZA 4FFRA 4NECA 3DL2A 2DTDA 1ZR4A 1E3WB 1PX2A 2XGGA 2JARA 3I45A 4ESOA 3CVWA 1HX7A 1U2GA 3KDAA 1VJDA 1RWNA 5FPPA 1FYDA 3CUKA 3UJBA 2FSUA 4EATA 2BHNA 1P0MA 4GKBA 1NI5A 1YBAA 1RFLA 3C8DA 3S3TA 3THYA 2O6HA 2ZTUA 1PS8A 1XELA 4FHGA 4CN9A 1J8MF 1JF8A 3E2PA 3TMYA 2G3YA 3PEWA 4YPFA 2PMWB 3F47A 1ONPA 5FXMA 5F9MA 1JR6A 3ABIA 1CHNA 3HB0A 1Z4KA 5BXQC 4RCVA 4E2WA 1R5NA 5J1SB 2OCPA 4YRFA 3D7LA 4RO0A 2ABWA 1SVSA 3HG7A 1SN7A 4JYCA 4A03A 2FKAA 2HM7A 1HOTA 4MKIA 4OX9Y 1EA7A 2B7BA 2WWGA 3PE6A 4MYUA 3FAZA 3V2UA 1DZ3A 3VR4H 3K94A 3Q8MA 1G98A 3KFXA 3CWZA 5FEMA 2P78A 1C7ZA 2B20A 4I9FA 1M2NA 4ZTZB 5H83A 5I9SA 3EEQA 3STHA 5CPBA 1WU8A 4WVLA 2B8JA 1D0SA 2H8GA 5REQB 1ZSVA 3ET5A 2G1JA 3OF2A 3V34A 4WXRA 3I58A 1VL5A 2Q0XA 2J9XB 2V1XA 1YRHA 1AQ6A 2E55A 4WBNF 3ER9A 3PFWO 1N6LA 3GJXC 4ETIA 4FKBA 4GMKA 3RQSA 1QMGA 5AFSA 1R9JA 1W8IA 3OEHA 2WTAA 1G3IA 3AJRA 3F4BA 4RLHA 2CJWB 3S1AA 3QI7A 1TF5A 4ZJZA 3KEOA 1JG4A 4NMLA 3S7TA 4QO8A 2NGRA 1D1PA 1P44A 1R8JA 2OQ2A 4G24A 4RQUA 1ORHA 3RGGA 1OFHA 1NHGA 2FR8C 2Z2KA 1HQDA 2G6TA 3MBKA 4EL5A 5EGNA 3P2IA 1FFCA 1N1DA 1B7GO 1WA5A 2XYVA 5BWLA 1YR6A 3RUPA 3AEKA 2H2GA 2C2OA 1CUGA 2APJA 4LPKA 1KHTA 3OCXA 4QGAA 1N5LA 2PLNA 2Q3JA 1ZZEA 1B16A 1M54A 2ZT8A 2OAQ1 4YWJA 1L5FA 4BC0A 2O2YA 2PUAA 4JS0A 1QB8A 4LJSA 2ZBGA 3C6ZA 2P5YA 3AR7A 2GZDA 1TEVA 1W9MA 3CWQA 1DWOA 4BMSA 1BE1A 2PTGA 2W93A 4JKYA 5D1NA 1OBOA 5IJZA 1A97A 4QG3A 4B31A 4RC9A 3AEYA 1MBZA 2H48A 4W5JA 3SXPA 4QTYA 1HR0B 1BROA 2J4CA 3SX0A 1OKKD 4RYLA 2V7PA 1Z0UA 3P9XA 2XT6A 4HEA1 5HPYB 2RD2A 5JXHA 5BN5A 5H9WA 1LPPA 3GJTA 2EU8A 1AS3A 3TMAA 3QEBZ 1OT5A 1SA0B 1Y1QA 3MYRA 2WWFA 4Z9XA 4DMLA 1DIGA 2CYBA 3DMGA 2IZZA 3E5HA 3IHKA 1NE2A 2F90A 2CV0A 2UZ1A 3KVYA 3TW8A 1Y6RA 4GPIB 3V3TA 5EJ2A 1WETA 1G1AA 1FW6A 1T8YA 3CKYA 3PEFA 3QVTA 4DARA 1N57A 4IUBS 1KQOA 2QNIA 5EE9A 1EXWA 1HEYA 5FPQA 3OEWA 2COUA 2QN8A 2J08A 1KU0A 4HN2A 3REOA 4LHVA 5A3QA 4HDCA 4RJIA 1XQ6A 5LZ4A 4PGHA 4ZHQB 3CZPA 3A1NA 2QRPA 2XE6A 1EG2A 4GWGA 5BVGA 3ORHA 1EWQA 3IHTA 4CVNA 3FHOA 2VUTA 2C83A 2QRQA 4G0XA 1I3OA 4LXUA 2REQB 4UFPA 2QF7A 5LZ5A 2OBYA 3AP3A 5AHRA 2XV1A 5IARA 4MUKA 4FN4A 4MA4A 1II8A 3KQLA 1EIWA 3T95A 3EGOA 2YNMD 1NUHA 4HH0A 2VSXA 3L4EA 5HSGA 3OLVA 5G1PA 4P38A 1Z35A 1WXEA 1U2EA 2P9CA 1RU3A 1ZIXA 2XDQB 3O26A 1OAKA 4UVDA 3SS7X 4WZBE 1U7OA 4FS8A 4FFOA 1SC4A 2FGJA 1JAYA 1FFHA 4A0FA 1MZVA 5C5CA 3VC2A 5GM1A 2PZLA 2VDPB 3I52A 1UC5B 5IWAB 2X0IA 1CR6A 1O77A 1IATA 3LSYA 1UJ6A 1T2VA 4EG0A 1FEZA 2VWQA 3U60B 5C1OA 2FPOA 2GQ0A 4LZJA 4EGSA 3KQNA 1T6YA 1N92A 1WXQA 4O2AB 2AD1A 3H2HA 3N1UA 1V0JA 4KYVA 2XUJA 5FBZA 2Z9DA 1TADA 3KR9A 4AWXA 5CD1A 3BD9A 2DKOA 4DS3A 1T35A 1F2UA 1H2XA 3T9AA 3E48A 2GCNA 4LXGA 1IHYA 1NNLA 4KR0A 4M9RA 3KRTA 5G3ZA 3G13A 4KPGA 3RW9A 3GGOA 3UA3A 1HK7A 1NP3A 1XTKA 3HCPA 3NHSA 4W5NA 2DSTA 4FSDA 4UEJA 4EEZA 3LO8A 1UQUA 4NNOA 1M6WA 3CUUA 3CPEA 4PR3A 1E3JA 4H7HA 1XKTA 1C30B 2R6GA 3FPKA 3N28A 4RCYA 4UHCA 5ADUS 1GKIA 1JZTA 5LU8A 1P2FA 3AUFA 3EVNA 2AN9A 4H4CA 4RH0A 5F1YA 3VYSB 2P4EA 4FXPA 4PHHA 4BWFB 4OIMA 4F56A 5DX0A 3ZGXA 1YCDA 2W2LD 3DEAA 1SPXA 4D44A 4FU0A 1L9KA 2ZSAA 1SCJA 3KD2A 3TK1A 1U3CA 4MGIR 3CMMA 3LRTA 5JIBA 3ZGNA 1NKTA 4J75A 5AMXA 2FWJA 2P9TA 4HVLA 3P9IA 2BIFA 2BHSA 3KFLA 5DZSA 1VE5A 1C9EA 1QHHB 3QIVA 3WYGA 2NMVA 3WICA 1SU7A 1JHUA 5K4GA 1MPTA 1GV1A 4V24A 1D2AA 3D9QX 2VCEA 5C3MA 4LF4B 3W5SA 5AJYA 4HDSB 4JC0A 5IW8A 4EHIA 1C9KA 1G8GA 5B6PA 2WSBA 1M6VB 4CV0A 5LMNB 1OBFO 2IKQA 3CR8A 3SEFA 2I8LA 4A4DA 3OQJA 4C0LA 2B8TA 2H00A 3CXUA 3VOBA 3W2HA 2Q0QA 5K3BA 4R69A 3N6RA 3F7MA 1V48A 2V4MA 4JEIA 3UAYA 3ZE8A 2FMHA 4C0JA 3FYUB 4XGNA 3UC5A 4BEVA 4NBKA 5NLLA 2NSJA 4GMXA 1MO5A 2X2OA 2ZWVA 1Y9AA 4LQ4A 3SHVA 4M54A 1I6WA 2EC5A 2P5TB 3NIFB 2BP7B 3LWDA 2GO1A 2J30A 1WKVA 1PEAA 4F9EA 5E9JA 4EWLA 1GGKA 1UOQA 1S3FA 5HIJA 3LDFA 4N8EA 4R1LA 3A05A 4U6SA 4WDRA 2FPGA 1ISJA 2VRNA 1E77A 4KQWA 5B55A 5IHPA 1SVKA 4I3HA 2NU8A 1D1SA 2I1WA 2I1QA 1BS1A 2OCYC 1RKUA 3DL7A 3B13B 2V7XA 3QPAA 2R8PA 1VLQA 1M33A 3O8QB 4B7ZA 5FJJA 1NVVQ 3DEJA 2HQSA 1FVOA 4N5IX 3IBCA 3T7RA 4C3UA 4Y2YA 2ZQZA 2FQQA 1RVDA 5SYNA 1EWRA 2JVKA 1MEEA 4NVRA 1YDGA 1ADJA 4RA6B 4CKEB 3FJ1A 2Z6QA 3LKZA 3WVNA 2HJSA 3PFIA 4V0KA 1T34A 3BFVA 3BZUA 3B7WA 2QN6A 2SECE 1NYQA 4PRKA 1GNVA 1L4NA 4AP9A 1WZNA 4AMYA 2DAPA 1T2NA 2NG1A 1OLXB 1FU4A 3WTCA 1ZHFA 3P71T 2WU1A 2CLMB 4L6IA 4MROA 3SC6A 1G6HA 4KQJA 4LTDA 4B0OA 4DV4B 4AY6A 4A2PA 4J7AA 1MMFB 3WB9A 4L7VA 2GYVA 3O4FA 1O1YA 2R3SA 2X7XA 4LOAA 2IH2A 1H1DA 2AX3A 2C9OA 1W19A 4RLFA 3SHQA 2I87A 4BRUA 5T57A 3L4KA 3DVAA 4CEHA 1ZJWA 1A5SB 2QB5A 3BTVA 2ATIA 3FSRA 3HCEA 1W8DA 3OIYA 3WO0A 3FDXA 1K97A 4MQLA 5CLQA 1PS9A 1JFTA 4YRCA 2Q07A 2BAGA 4R8RA 3PUJA 4V1CI 2XD4A 3KQSA 5JQGF 3FZQA 2GH1A 2H07A 3K8OE 4N5DA 2YL2A 2OKCA 4GIBA 4D74A 3FUWA 1P6QA 3TTSA 3L49A 2OGZA 4F4JA 4HPXB 4ID9A 2ZATA 4QOSA 3ZZ0A 1P1JA 3IDOA 4D3ZA 1HL7A 5GONB 3RS5A 4ZDJA 3E9NA 4P5EA 1Z3CA 5DNEA 4UTPA 4YP0A 3FIUA 4N5HX 5DHFA 4D0GA 3LT0A 1OYVA 3VJKA 3U6KA 2N42A 3KSAC 3RG8A 1CV2A 1F9AA 1WUHS 5AM5A 1AA9A 3O38A 1ST2A 3GJ5A 3NTQA 4UPDA 3RI3A 4A92A 5F21A 4BO1A 4ALJA 1X1TA 2DECA 5E1DA 2GETA 1LTQA 1BRTA 1PDWA 3TGLA 2R8ZA 1N2ZA 2WC1A 2F2TA 3E7WA 1DLJA 4QGGA 1F51E 1SUIA 2QRZA 1JIXA 4LX0A 2VHVA 1ZITA 1YQ9A 1T4CB 3FYUC 3OWOA 2IHVA 2JHCA 3L46A 4GVLA 5TPWB 1ZK2A 3SSMA 4EO7A 3DT9A 2MINB 4J1TA 3PD1A 1QANA 4TXMA 2CJPA 2YTZA 2GCIA 5ALNA 5ECYA 2B61A 2YN4A 5B57C 3OKFA 3R74A 2JIDA 4F84A 1NVVR 4YUXA 3HA7A 5FYQA 1RPTA 4X20A 4AT1A 4LN1A 4RVGA 4UBLA 5FPKA 2ESRA 5AIBA 4Q4HB 5EKSA 4MR8B 3I0ZA 2A9QA 3OZEA 3ZHBA 1NN0A 4V0QA 5JQGA 1E6EA 2UYCA 4JBLA 1H8HA 1O94A 1PO7A 3DFFA 1C81A 4V0LA 2G4CA 3QPVA 3R0VA 4RHTA 4XQCA 3EVEA 1JJIA 3RSFA 2D1QA 5D3ZA 4AYWA 5CEFA 2F59A 2JD1A 3MTGA 4Y1FA 4HQLA 4AW9A 1N3YA 3IBYA 1LLFA 2N9UA 4EFKA 3AKZA 1IBKB 3H2JA 5TDHA 2I66A 4Q3DA 1K3TA 3KLBA 4L0DA 2YKGA 3R5XA 5C1IA 4TS1A 3IR5A 1CT9A 1E79A 2N46A 4RJKA 4GFDA 4WI1A 1PW5A 2QZ9A 1DAOA 4J0QA 2V6JA 2NZUG 1J2EA 1JB9A 2YFKA 3BFJA 4CCYA 1G64A 1ZIOA 2D2IA 2Q2QA 2W00A 3HDJA 4C9BA 2PSSA 5A9RA 4MUIA 4ND8B 1QLHA 3T99A 1I5OA 1IM5A 2QD3A 1UODA 1RJ9B 1O6ZA 3RYHA 5HCUA 1RQLA 2Q2OA 2D62A 4KV7A 3OCZA 5FV4A 1I6MA 6GPBA 1ESMA 2HA7A 3LP8A 4YHBA 4X8HA 4EKIA 1S9HA 3MQ4A 4C3VA 2ZROA 3U7HB 1GU7A 4RD2A 3VDQA 3E9RA 2Z98A 1GL7A 1IOWA 2R6HA 2VXYA 3F7NA 1NYLA 3FTQA 1FPMA 3IRUA 4BFCA 4CM3A 4E13A 1ADFA 1SKAA 2EFDB 2I9PA 4FHEA 3ZW8A 1QONA 4HZGA 5CDFE 3PC8A 1RQ7A 2QQFA 5AO9A 1OI4A 1W9HA 5K6TA 3C16C 1U04A 2HCBA 4PANA 1UZAA 4AJKA 2CXRA 2IE0A 4IVQA 2GSWA 2A9OA 1E3EA 1YUMA 1UPFA 1I13A 1PGOA 1HA3A 2G71A 3D0KA 4CKBA 3RC3A 4JBWA 4M3NA 3BT7A 2HSJA 3ZVNA 2ZIEA 2I0FA 1B4DA 1ECLA 1P1KA 3JR7A 3HWRA 4PO9A 3DAHA 3LIIA 1NKVA 1U2QA 2VPTA 4PS0A 1P0QA 2H7VA 7YASA 1IB0A 2OFPA 3UKOA 1TM3E 1NTOA 2YHBA 2X0EA 1UFQA 4PYIA 4BBPA 2I2BA 1IONA 2XRZA 4FE7A 2FRVA 5AR1A 4EMTA 1K7FB 2GYWA 1KXZA 3DB2A 3EQZA 1TVMA 3WFZA 3GRYA 2CUKA 4P2GA 2XUHA 1Q16A 4C0WA 3LP5A 1V3QE 4YA6A 4CMAA 1XCMA 3FVQA 1KFKB 2XF8A 3CO0S 3KL2A 5DHUA 3FOFC 5K0GA 1WO8A 2Q2NA 3ETJA 4IILA 4DTIA 1MAAA 2F1JA 5HS4A 3BH0A 1T9AA 1A9SA 1YULA 3U9SA 5KJ1A 1SOWA 4RCZA 3K9BA 1RYEA 2HA5A 1ORIA 2ZIXB 5KQLA 3O75A 4L4SA 1BG6A 1NMEA 1QVAA 2FPUA 1JFVA 4OPMA 3CVUA 1WPRA 3MWFA 4NONA 1CDDA 3PI6A 3PRHA 2QRNA 2GN4A 4BKOA 1A50B 4FEAA 4UDOA 1CZHA 1YJBA 2IIQA 3QX9A 2R87A 5GJWC 1S01A 2GASA 2B4RO 3F5QA 3U4GA 4A91A 1NHWA 3U3ZA 5BW8A 1TYDE 1FP6A 3I1JA 2CLDX 1GILA 1L3CA 4R2LA 2Y92A 3PI7A 4KLCA 3RASA 2CL0X 3IX7A 3O2SB 3THXB 1ZXBA 4MI1A 5A05A 4OYYA 3ZU2A 3TB6A 1UINA 4IF6A 4DRZA 4MR7B 4CQMB 2CWDA 1DV1A 2E18A 2PKCA 5HFNA 2II6A 4CR7A 4WFQA 3G02A 2PIDA 3A6KA 4BO4A 3M8KA 1CPYA 3E0QA 2XXBA 2QXTA 3DE5X 2GTPA 1TUIA 3L02A 4OKNA 4GP9A 2WM2A 3PJFA 4CDRA 1AUXA 1SQSA 1P75A 4HGRA 3COPA 2VYVA 4ZT6A 3HNRA 4YRKA 3RTDA 1BXRB 1DWQA 5F33A 4BQEA 1O7JA 1U2TA 4DPMA 2MU1A 2LCFA 2OYRA 3LVRE 4WZBA 2BM0A 2IELA 3MJCA 5AVOA 4DLPA 4O1HA 6ABPA 1XMIA 1RDFA 4MTLA 5E95A 1GGVA 5DM4A 4ERNA 1L4HA 1OJLA 4RXUA 1MNQA 3DHNA 1PD0A 1IVYA 2CLEB 3DYVA 1AV7A 4PYNA 3CQ9A 1QKJA 2DWOA 4TMZA 4KOEC 3TE6A 1L8AA 2P2LA 3ZDCA 2L2QA 4RH1A 1KI8A 1Z5VA 3FDZB 4AUKA 2WNHA 1SO8A 2FW0A 2J59A 4EPRA 4PZEA 3H8WA 4L4XA 5FIUA 3PQ3A 4FMBB 2JFBA 5K51A 2GNOA 3HVKA 4WLOA 3OOEA 1TAHA 5H9VA 1F0PA 1MAWA 4QLAA 4UHJA 5B4VA 4KK3A 4QYMA 5EHQA 4TWRA 4RGBA 3RTEA 3N2KB 2FLWA 3H1AA 4FNAA 1QLWA 4P2BA 3EVDA 3E05A 3HKEA 5B1SA 1PCXA 1SCNE 1X7XA 2GCOB 3Q7IA 1R00A 2BFOA 5IDVA 3SKYA 3C97A 1OWMA 4YJ2B 2QJTA 1KEKA 1YS4A 2MSDB 4HB3A 1I36A 1V4NA 2Y9PB 2BFEA 3ZHZA 4IDDA 1NXXA 3MPOA 2M9MA 5AJTA 4BL5A 2I65A 3M9WA 2EFHB 4O4JF 3AL0C 4L78A 2R7NA 1NLMA 2LPMA 3SC4A 4BATA 1BDIA 1E9RA 1TCAA 3PHJA 4HYQA 4KOAA 3VFDA 4ECAA 1CRLA 1QWSA 3HI4A 4I4TF 3VGJA 3AH8A 4PYJA 5IAOA 1I01A 2RHLA 3HNOA 3FPJA 1UMDA 1FX0A 1QHFA 4GS5A 5G0VA 1D0VA 1M2OA 2BUCA 2EG9A 4DMUB 3BXZA 2GWHA 2R2GA 4LY3A 2VHQA 5CH3A 3U81A 3A3YA 3N70A 3NP9A 5K4AA 5LA6F 1I0ZA 4M55A 4BTLA 4A15A 1ZIYA 4B3HA 5BMVB 1VMEA 2AJ8A 1O95A 4J43A 5SY4A 1X1AA 1IPHA 1VLZA 4JENA 5IAKA 3KM0A 3VZQA 4E88A 2VTBA 2CT8A 3U09A 2JEOA 4YO7A 2TECE 3LCVB 2X2PA 4QDOA 4DM4A 2IPNA 3ICEA 3W90A 5EXDA 4ZQIA 5CX1B 5HGXA 5DW3A 5KHAA 4LVNA 1DQZA 1RHUA 1H2HA 3IUJA 4C4ZA 1L4KA 1RYFA 1TM4E 3A32A 3PHBE 4IR7A 4WSOA 4JFRA 5L7YA 1IHDA 4O1IA 5FL7A 3RVQA 1F8GA 1PKXA 1VPLA 2C0QA 2Y66A 4WD3A 2QD1A 2ZPUA 4IS2A 1G3RA 3UOAB 2RAPA 3I5YA 2FWIA 3GLRA 4PZLA 1RLUA 2E5FA 2EG5A 1HNXB 3I9V6 3UG6A 1Y3HA 2REOA 3BDVA 3PXUA 4O4JA 3VSCA 1NNEA 2Y76A 1IBSA 2R2AA 1PV4A 1LC0A 1R5OA 3WIOA 4BU0A 4HCJA 1K8XB 2RDMA 4EO4A 4ROSA 1FBNA 2AEEA 1X7ZB 4PM4A 4FINA 3FAKA 3H6GA 2GD6A 1KOJA 1QH0A 1ULSA 1Y5NA 1RT9A 3GH1A 4F4IA 3UTDA 4N6OA 4XB2A 4KFCA 3TJMA 4OP3A 4Z2YA 2WWYA 3AXSA 5LA6A 1UK6A 3D4IA 4AB1A 1OTHA 4HUQA 5C2JB 4QOGA 4LDQA 2O05A 3DT6A 5M04A 4JLJA 4EGJA 4J0GA 3G0BA 3O92A 1R8QA 5AICA 1U0TA 1EFAA 2O14A 3SN6A 3Q3VA 4MARA 3IOEA 3LNCA 2CUTA 4G8DA 3U7FB 1C1YA 5E2IA 3LK7A 2KX7A 3RRMA 4FNGA 1BS2A 1M2FA 1FUUA 1DV2A 1H6CA 2FDCA 2QSZA 2NU7A 3BHJA 1PIWA 2OM6A 2A35A 3P32A 4JFAA 3SQNA 2PFKA 2HDWA 1CR2A 5JALA 3UJ7A 2ZZNA 4O6VA 3T7CA 3NNDA 1WQ1R 1XTQA 1RFGE 1TC2A 4ARBA 1UR5A 5C4IA 4DLAA 1DFIA 2RAVA 3T9DA 1J8DA 1IH8A 3F7OA 1LZKA 3HVJA 5AM1A 3V8NA 1RPZA 4EOGA 4EQ6A 3LVQE 4HWPA 4YXFA 2DPHA 3LOPA 4DAEA 3PDUA 3RE1A 5ECGC 3B38A 4FZ5A 4N5NA 2V98A 5AI6A 5FI0B 3RS3A 3PQDA 5CVDA 2FW8A 2XB4A 1ZMBA 2IU3A 4MQUA 2UXCB 4KE8A 2EEZA 1XKQA 5FOXA 3U6BA 4MB6A 1ITZA 3I9MA 5CEJA 1XL1A 4PC6A 5DBFA 3FNEA 2NIPA 5I7OA 5EXPA 3TNFA 1AKQA 1OYYA 2NZYA 2QRUA 2QTVA 3MLBA 5DIFA 1WUYA 5G0SA 3RAFC 2B2CA 2EX0A 3ZWBA 2ZWPA 1OW3B 1JDNA 1ZPDA 4NABA 1KNXA 2W48A 2W98A 4R3NA 1OFUX 1DQPA 1QPBA 1XZ8A 4ISCA 4EW6A 2OG1A 3UK2A 3LMKA 1WZIA 4NH0A 3GAFA 3OPYI 5DHPA 1DEHA 1GFIA 2B3DA 1K98A 5EXEA 5EYPA 1MV5A 5CEEA 2Q5JA 1X1SA 3OESA 4ABTA 2ZWIA 2IJGX 1QOZA 1QF6A 1LDNA 1VB3A 2X1MA 3DONA 3IL2A 1E2BA 3K53A 2IIPA 3B1KA 5M2QA 1IBLB 4ZI7B 4L27A 3GRPA 3TIXB 1NIJA 1II9A 1JXAA 2FK8A 3AKEA 2J9FA 2JLAA 3E58A 2FVYA 5CHEA 1WXHA 3A37A 1AKVA 2BD0A 2NSLA 3HHPA 3NG1A 4MW9A 1JDUA 4J4TA 4YWHA 4PNHA 3RRYA 2D4AA 3E0XA 2YJZA 1UOPA 3ZLUA 5GV8A 2O9JA 3I92A 2I3BA 3GEPA 2XYHA 3IIKA 4Y6GB 4O4LB 3ZH9B 5KC8A 3G5TA 1UKAA 1KBQA 1FLDA 3V1NA 4R0MA 3EBOA 2ZDHA 3EXEB 2VDRB 1HURA 4WXPA 2QGNA 4DSNA 5K3OA 1CJKC 1E61A 4PGAA 1IM8A 2D1FA 2IHNA 1L7DA 3EPJA 2ZSFA 2H4JA 4Z7JA 5JNWA 4JA2A 3RIYA 2DHEA 5B3AA 3LA8A 5D85A 4KH1A 3DAFA 4JLKA 4GAEA 2XMSA 3ORQA 4WOPA 1TYEB 3RS2A 4D5EA 1DBPA 3IB6A 1JR2A 1F14A 1NONA 2FAXA 3R7LA 4UPEA 3IVGA 4E0BA 1YRAA 3DE7X 2EWWA 5CFQA 5KSOA 4D82A 2VP2A 3LQ1A 4UUNA 4YDSA 5D6OA 1P1BA 5BW6B 3OECA 4KNYA 4S2EA 3D8RA 1HGXA 1T91A 2ST1A 3G68A 4XUGB 4LJ5A 3HGTA 3NWBA 2QTNA 3A4NA 4CLOB 1IPEA 1F0NA 2RC6A 4PFSA 3WJ7A 2W8BB 3QWBA 4I50A 1MC1A 3RS7A 3WK7A 4RTQA 1KDYA 3UHJA 1DJQA 2K2WA 5F9FA 1R0XA 4JGIA 4LJ4A 1C1DA 2B1JA 4GM0A 2FV8A 2PHZA 4YMHA 5KOHB 3FX2A 3H9QA 2ZVPX 4KWEA 5KNDA 4TMFA 1QO7A 5FBKA 2XPCA 5FUBA 4NCHA 2UUOA 3OCJA 1USIA 4PAMA 4QOIA 4L8WB 3NWPA 2VP4A 1CQIB 4KNVA 2NVWA 4JQZA 5CNKA 1JR4A 3CW2A 5DU2A 5ANRB 5EZYB 3RYTC 1PW7A 2YC4C 3K0AB 4ABYA 1D6MA 1E9AA 1WABA 3GMIA 4HGQA 4WK4B 1X42A 4I1UA 4Z1MA 4B3GA 4RUKA 1SOAA 3WV5A 4F91B 1JHVA 1RRPA 3D5EA 1BXGA 3KZXA 3RVKA 3CKKA 3GLGE 3W2TA 4DT1B 4G25A 4IM7A