1X7DA

Crystal structure analysis of ornithine cyclodeaminase complexed with nad and ornithine to 1.6 angstroms
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
340
Chain Sequence
TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
molecule keywords ornithine cyclodeaminase
total genus 112
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1x7dA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1x7dA02
1PGOA 1TA4A 1C14A 3JQ9A 1HYEA 2O48X 3OICA 3QE3A 2AG5A 4KP7A 2CSUA 1L7EA 2C29D 3QY9A 1BGVA 4J0FA 3DMTC 3OMLA 1IUKA 2J3KA 2VHZA 2OL4A 1ZK1A 4E13A 5TIIA 2GNAA 5CDSA 2W98A 3B1JA 1XWFA 3OQBA 5LDGA 4CLEA 5CP8A 1LDGA 1U4SA 4Z3DA 3RUCA 4YT4A 2O2YA 3ANLA 1Z45A 4XB1A 1A7AA 1W4ZA 3S8MA 1E7MA 3ZWOA 3G17A 3E6AA 3WB9A 1Z74A 1WAMA 3BMNA 5B37A 1W0CA 2I3GA 1DXYA 4GQAA 3VKUA 1KVRA 1FDTA 1HDZA 4OKIA 3HZZA 4PFJA 3AI3A 5GMOA 1Q0LA 1U7HA 1P44A 3L4BC 2GASA 2GN9A 1LQUA 2BFOA 1JAXA 3H6KA 3QWIA 1P1JA 5TJ9A 4DBVO 1YVEI 1NP3A 4PLTA 4CQLA 1GCUA 4LCJA 2GF2A 4E5KA 2YUTA 5HA5A 4PG5A 4EI2A 1U2DA 5BSEA 5LDHA 1GZ4A 2BGKA 5AXAA 5JMWA 3WG9A 2WEKA 2IEDA 3BHJA 5COBA 3TZHA 4RJTA 2D59A 2DTXA 1I3NA 1C0LA 4KQXA 4E2XA 3ROKA 1AUPA 5A03A 2OP1A 2PTGA 3PWSA 4AJLA 3I5MA 3OP4A 3FPCA 1KY5A 5DF1A 5C7LO 3SJUA 4UEOA 1H94A 4PLWA 5A3VA 1GQYA 3KB6A 3H2SA 4IGFA 4YVFA 3ADOA 3FNGA 1GZ6A 2Q2VA 1GFSA 4FJ1A 1PQUA 3V2GA 1P0FA 3WGIA 1HDCA 1TI7A 4GKBA 2E82A 3SXPA 1NQOA 2W2KB 3CMMA 3E9NA 3W4JA 3DTYA 3OETA 3WFIA 2AQHA 2OHXA 1UDBA 2BMAA 2SCUA 2GPTA 4GKVA 2BFAA 5ER6A 4CQMA 4DMMA 1EEHA 2B37A 3SC4A 1NFFA 4J91A 4DQXA 4IZHA 1SOWA 1LX6A 4J0EA 3KSUA 3EK2A 4K28A 2GUGA 2JHGA 1SEVA 4D43A 2PKRA 1GADO 3DB2A 2PGLA 5HBRA 1BTOA 2PZLA 4M55A 1MFPA 1LDYA 2RBEA 5TX7A 4GVXA 3PJGA 2X6TA 1H2BA 1E5QA 5G4KA 5DP2A 1PZFA 5F3RA 2P5UA 4F45A 1D8AA 4YEDA 4EW6A 1M75A 3GHHA 4II2A 3JQ9C 5DBGA 3TOZA 2NVBA 4RPKA 4FR5A 3WWYA 2P4HX 1U3WA 3FBGA 4IS3A 3A06A 4ZQBA 2C54A 4OOEA 3OEYA 2PZKA 1PQPA 1RJWA 1HEUA 4E4YA 1OZAA 3RUEA 4RF5A 1PJBA 1LTHR 3H8VA 2A94A 1MC4A 1A9YA 1N2SA 3I4FA 1R0LA 4B4VA 1JKJA 2OP0A 4EJ6A 4P4GA 1T2EA 2D2IA 3L07A 5JNLA 3KETA 3C3XA 4FFOA 1Y81A 5IZCA 4BV8A 2PD3A 4BNUA 5U9CA 4C4OA 1LC0A 3JTMA 4YQZA 4E6PA 4J9VA 1MV8A 3ZCXA 3WGYA 4E2YA 2X0RA 4B8ZA 3ROPA 3QVOA 1LDNA 1EE9A 3RBVA 1HE5A 3LC1O 4LMPA 4JGBA 4MJLA 2VRBA 4OL9A 4J2HA 2VRCA 1C1XA 1GUFA 2A9FA 1NAHA 2YDYA 4CLRA 1JU9A 4FW8A 3HHPA 4YXFA 4R16A 4AJIA 2IDZA 2O3UA 3ABIA 5JFOA 4FCCA 2BLLA 4RLSA 3PZRA 3L4SO 4D79A 2VUSA 4RDHA 3T4XA 1I8TA 2V6MA 4ALLA 4D3SA 4PGFA 2FWMX 3I23A 2D5CA 4PRKA 1UXKA 1OMOA 5A9RA 2IXBA 3AOGA 3JQDA 4PG7A 3WOHA 4O6VA 3JD3A 5KVVA 1KIFA 3EC7A 1LLQA 4DLAA 4NH4A 1J0XO 4LW8A 4NJMB 5I9NA 4E5NA 1PR9A 1A4UA 1O9BA 7ADHA 4TRNA 1ADBA 3KYDA 4R41A 4LMRA 2WYVA 1CERA 4BO5A 3BMOA 4FJ0A 1P1KA 3EAGA 4L4RA 4HUJA 5EL0A 3GZNB 1MX3A 3A14A 1NFRA 1QYCA 2EJWA 1C0KA 4I5DA 1X13A 1V8BA 2VHVA 1GQQA 2DKNA 3D4PA 1N7HA 4UUOA 1KEPA 1X14A 5TSDA 1E1MA 3JQGA 3OA2A 1RYDA 2VHXA 3MJSA 4CR7A 3ZWCA 3HFGA 2Z95A 2QRLA 2X5OA 1N8KA 5JSFA 1HZJA 2W2LD 2C7GA 2I65A 1LRLA 3QVSA 3O38A 3ROMA 4B7CA 3EZYA 4ZQFA 2POQX 3RU7A 1LLUA 4R1TA 3BA1A 1JVBA 3U0BA 2VCYA 3TFOA 3C1TA 5DNAA 5EMHA 2JCVA 1AN9A 1WVGA 5BSGA 4WOKA 4CM3A 2GR9A 1I01A 5CEEA 2HCTA 3ICPA 4OGWA 4DYVA 3TOXA 2YV3A 3JD4A 4L75A 4DQUA 1LQTA 2AMFA 1HDRA 4Z9FA 4MP6A 4EUEA 1LXCA 4XR4A 4AVYA 5HS4A 3VPGA 1ZFNA 2VNSA 4FS3A 3UOGA 2DUWA 3GPDG 1QSGA 1DRUA 3IKVA 5TC4A 4M54A 3MTJA 4XRGA 2X0IA 2NACA 1DFIA 1E6WA 4IQ8A 1DFHA 1TVEA 3Q0EA 3ZV4A 4IS2A 4Z0HO 2DUUA 2X7HA 4NDNE 3K92A 3WJ7A 1EZ4A 1PL8A 1EBUA 1OAAA 3ZW9A 2G5CA 1JLLA 1XQ6A 5ITVA 4A26A 1SOVA 3A4VA 1RYEA 2ZIZA 4UEJA 4AICA 4CPDA 5JDCA 3C85A 5ICMA 1Q7CA 1X1TA 4B4WA 2F00A 1QV7A 1ID1A 4BHTA 4JK3A 3EUWA 4RL6A 2HRZA 1H93A 3DBHB 2CVOA 1Y5MA 3ROQA 4CQMD 5JBIA 4ALJA 1DEHA 4U0KA 2CNBA 3WNQA 2W2LA 4YAGA 4MP8A 5B4TA 4Q3EA 1A27A 4Q9NA 2D0IA 2Y93A 1D3AA 4ZVVA 3PWZA 2WWRA 1N7GA 1ONPA 1NVGA 1T1SA 1GQ2A 1HKUA 1N92A 4K9DA 4CLXA 3U62A 4J4BA 3M6IA 1HETA 4YCAA 4WNCA 1RM5A 4P8RA 5FWNA 3D7LA 1DRWA 3P19A 4Y67A 1A9ZA 4MIYA 4F46A 3OF2A 4TKLA 1ONNA 1B14A 5GZ1A 2FR0A 5K0ZA 3P7MA 4BL5A 2CF6A 4PLGA 4G81A 1FXSA 2DVMA 4XYMA 2VYND 3KYBA 3RJ9A 3U9LA 1YOVA 2YYYA 3N74A 3KEQA 3OFSA 1M66A 5JCJD 2NUAA 4Y6PA 3OIGA 4ZU3A 4YBZA 4EEZA 2FOIA 5FFFA 2PR2A 1XA0A 2WMDA 2HMUA 1Z7BA 2FR1A 1BXGB 3CTMA 4CM4A 2YV2A 4URFA 4AJNA 3VH4A 3QWBA 5B12A 3TZQA 1BW9A 4IGEA 3GMDA 3AFNA 3E5MA 2WDZA 4FPXA 1PJ4A 1H0KA 4DLBA 3AFMA 2EF1A 1RPNA 4RF4A 1IULA 5IDQA 4BNXA 3WIDA 2WM3A 2NM0A 1VJ1A 3MEQA 1HYHA 4AG3A 2EKQA 2FR8A 5CG2A 5L40A 1GYRA 1RKXA 4AFNA 2QZ9A 5EQDA 1T1RA 2OMEA 2EGHA 2VZ9A 2X4GA 4H7PA 4XKJA 4JQCA 4N5NA 5EESA 1B26A 1VE9A 5L7YA 4YRAA 4WGGA 4ZRMA 4YTEA 2LDXA 3BTVA 1U9JA 4EZBA 1NWCA 2WE7A 1GL3A 1NR1A 2ZJ1A 2OBNA 3D5TA 4LRSB 1GEEA 5DOVA 2UDPA 2GLXA 2ZB7A 4J7CA 4PZEA 2PY6A 1YRLA 3JQ7A 1X1EA 4RCVA 1C3VA 5DZSA 4OQYA 3EY4A 3OJFA 5JLAA 4Y6SA 3F9IA 4XWYA 3WNVA 4UVGA 3M1LA 3OBBA 5HWSA 4TRMA 4CM5A 3BTOA 1B15A 3D3EA 3GRKA 3WMXA 4R1NA 1ZJZA 2IODA 4R9RA 4XEHA 4CMEC 4ALKA 3KZVA 1W6UA 4YT8A 2TMDA 5ENDA 4D45A 4Y8VA 4PCVA 2EJVA 2P91A 4A03A 3IC5A 1RM0A 3E9MA 4KDEA 2Y0CA 3NDIA 4XA8A 1I10A 3V1YA 1ZSVA 1NYTA 1ISFA 3H9EO 3KTDA 1ZK4A 1PWZA 4B7XA 3DONA 4XX0A 4CLOA 1DJNA 2VTEA 2UYYA 2YJZA 2ZQZA 3WBBA 5ICSA 2FMUA 2P9GA 3RI3A 1QYWA 3QWHA 1EK5A 1GYQA 2BH9A 2IE0A 5TLSA 1E7YA 3GEMA 4R3NA 1W73A 2DBZA 4CM8A 4E21A 1P1FA 4BGEA 3L6DA 3KEOA 3D0OA 3GY0A 4YJHB 1ULUA 3HSKA 4YRDA 4KQWA 5A9TA 2Q1WA 1JTVA 3SX2A 5TGDA 3WDSA 4XDYA 2WD7A 1SO8A 2NU7A 4PG6A 3PFWO 4R01A 3LT0A 3FNEA 4BO1A 1X7GA 4YAIA 4HX5A 1Q0HA 5T8KC 4XYEA 3TQHA 3PZBA 1WMBA 6LDHA 1A7KA 4I9UA 5B4UA 1MXHA 4AJ2A 4FFNA 2VWPA 4PLYA 3W6ZA 3GVXA 2HK7A 4QX6A 4A27A 4E3ZA 4MIEA 2D3TA 3FR7A 3U09A 2DM6A 1QLJA 1T2FA 3UXYA 4AJHA 1X7DA 3RC2A 1VLLA 5JXWA 2W4QA 2HQ1A 3GGPA 1IHXA 5IN4A 4HBGA 1TXGA 3ICCA 4N5MA 5L51A 4IM7A 1ADCA 4WLUA 1SC6A 3GGGA 4L0QA 3UFXA 4DIOA 1D7OA 2ZK7A 1BDBA 2OBYA 3PRJA 3FSRA 1QLHA 1PL7A 3EVNA 4DLLA 3KV3O 4JN6B 1PS8A 2FZEA 3IQDB 1YKFA 2O7SA 3MZ0A 4D42A 3G1UA 4BO9A 4YT5A 1DDOA 2YQ4A 4A7PA 2RAFA 1UAGA 3R3SA 1PZEA 1X0VA 5AVOA 2OXIA 4DIBA 1H2HA 2RH8A 4B4OA 3NAQA 5BNIA 1DRVA 4ZQEA 6ADHA 4FSHA 5G0UA 1E7RA 4L4SA 5F5LA 2Q45A 4DL9A 2RCYA 3AY6A 7MDHA 2PD6A 2G82A 4GL4A 1GUZA 4TMFA 5EQFA 1HSOA 1GDHA 1ZMOA 3DBRB 5EINA 3VPHA 1UXJA 4UUPA 3D5QA 2JD1A 2VWHA 4RPLA 4FDAA 4W9NA 3GQVA 3DZKA 5FI5A 1Q0QA 1EMDA 4NBRA 2HAEA 5DT9A 4G65A 2AEMA 1E3SA 4HFJA 1PGJA 3C7CB 3N7UA 5G2OA 2IEBA 3L6EA 5L53A 1KY4A 2O23A 4HKTA 5AOVA 4D46A 5C3MA 2PV7A 3I52A 4PVDA 4QFCA 2YDXA 3RC1A 1O8CA 1SB8A 4RVUA 4ZQGA 4ZHSA 8ADHA 4L9RA 4NI5A 3WSVA 4I5GA 1DIBA 4Z6KA 3KVOA 4YR9A 1VKNA 2YQ5A 3H2ZA 3GT0A 4I9HA 1NR7A 4CV3A 3EVTA 4O0LA 3DOOA 2G0TA 4IDAA 5EN4A 3GNTA 3I9KA 4KOAA 2WE8A 1TT5B 3F1LA 1A72A 3QWFA 9LDBA 3RUFA 3GVCA 3EHEA 5G4LA 4H3VA 1IHYA 4TVOA 1J49A 4MP3A 1GD1O 4I8XA 4I5EA 2JHFA 3S1LA 3WICA 5AYVA 2GZ1A 3UF0A 4F6CA 2UUOA 4RQUA 2R6JA 2D5AA 1G0NA 2B36A 4BKQA 4PVCA 3JD0A 4LN1A 1M2WA 3I3OA 3H5NA 4J2OA 2ZKLA 3GK3A 4CLHA 4WCDA 3WBFA 1QXSA 4ND5A 2IRWA 3CINA 3PHIA 4TKMA 2Q2QA 4IJKA 4R51A 3AU9A 4CMJA 3NT2A 1EVIA 3IP1A 3QV1A 3RKUA 3V8BA 4OJNA 1I0ZA 1VSUA 2W90A 3VTFA 3NTRA 4FC6A 4Z9XA 4WLFA 5ADHA 1UZNA 1U28A 1XEAA 2NV6A 4Q3DA 5IDXA 1YONA 1E6EA 3BMQA 3HE3A 4ROSA 2F1KA 2I66A 2FPIA 4RZHA 1T4BA 4WK6A 3V1TC 3ZNQA 4NBTA 3LC2O 4D0SA 4EITA 5HM8A 1WWKA 3PK0A 2Y1OA 5CDYA 4D41A 2X9GA 4Y9DA 4BNZA 3DQPA 3MOIA 2NLOA 4XQCA 4M49A 4NPCA 4O59O 4R5HA 4RV9A 3PIIA 4OO3A 2BRUA 1NBOA 4MVJA 2AQKA 2O3TA 4GLOA 5C7OO 4IDFA 3UCFA 1C1DB 1NWHA 3UKOA 2AEFA 2J8ZA 1R4NB 1ZXBA 4BKPA 2C5EA 1XG5A 4UREA 1PJ3A 1Y6JA 1T2DA 3HG7A 2FRDA 3O03A 1GZ3A 1ML3A 1NQTA 3JD2A 1LEHA 3TDKA 4BNVA 1VRWA 1UJMA 4HNGA 3GN2A 2BF7A 4NFYA 3H5RA 5JAZA 2XOXA 3GEGA 3GNQA 5DDIP 2UV8A 4PZCA 1VKOA 2HMWA 3DHNA 5JYEA 2CY0A 3JCZA 1Y8RB 4KZPA 2GYYA 4DREA 2X86A 5KJ6A 4GVLA 1ISHA 5L95A 2EKLA 4JP2A 3I9MA 4RF3A 1QYVA 2B5WA 2DBRA 1B16A 2PNFA 3IDSA 5JCXA 4A0SA 2V65A 4U6SA 4XB2A 3RBZA 5JDIA 4JJIA 1PZGA 1KEWA 3WSWA 1YJ8A 5F21A 3GH3A 1IB6A 5J23A 3GPIA 2P9CA 3GRPA 3H3JA 5DULA 2YZ7A 5K6AC 2I67A 2FSVA 1KBZA 2P9EA 3O9ZA 2GGSA 4HFNA 3I9NA 4EBFA 1LRKA 1EUDA 2X0NA 4BQRA 2GN4A 1TT5A 3EMKA 3GDFA 4W4TA 1FMCA 1FDVA 1H6AA 2FSSA 3I83A 3LLVA 4DA9A 3NRCA 3PP8A 1K2WA 2O2SA 2DLDA 1IE3A 3AUUA 1GCOA 5JE8A 2E48A 1MFZA 3PQEA 3MTGA 3KYCA 3V1UA 3NJ4A 2LDBA 3MWEB 4NZ9A 1JAYA 2BGMA 3ETGA 3SEFA 2EGGA 3HN2A 4QUKA 1QR6A 5EJ2A 1CJCA 4QSMA 1YDEA 1PWXA 5CEJA 4EGFA 3GHYA 4CL3A 1YQGA 1G1AA 1EDOA 1DIGA 2RH4A 4DC0A 4CMIB 3GLQA 2CF5A 1U8XX 1C0PA 4LRTB 4MVJG 1U2GA 3FI9A 2E6UX 4IINA 1YWGO 4PLFA 5IZCC 1LNQA 2IXAA 2VWGA 3KO8A 4ZJUA 3H9UA 3OIFA 2O3RA 3H9JA 4LVUA 4NIMA 4BO7A 1YBVA 2C07A 1IZ0A 5DBIA 1RM3A 1TEHA 3H3FA 1ZNQO 1DIAA 4BIIA 1MUUA 1PGPA 1TB4A 3A28A 2PZMA 2VOJA 3U3XA 1DC6A 4CUZA 5I8WA 1TLTA 1R16A 2X5KO 4CMKA 1ZZEA 1UZMA 3ANNA 3IJPA 4MDHA 1WDKA 5FI3A 4FIZA 3VDRA 3DHYA 1E5LA 5BT9A 1PU2A 1D1TA 4RVDA 2YV1A 1Q2XA 3ZWYA 1LDBA 1HWYA 1ZXLA 2AXQA 2C82A 4ONEA 1XYGA 3LZ6A 1LDEA 1KYQA 2Q50A 3MJVA 2VN8A 1SAYA 4A10A 1PR3A 2OORA 1A4IA 3QP9A 3KUXA 1I3LA 2NADA 1S6YA 2VZ8A 3X2FA 3GR6A 3JYQA 4E5MA 1PJQA 2VHWA 4QO8A 5L4SA 2XPCA 1HRDA 4WKGA 1ZMTA 5IZ4A 5DCWA 3DHEA 3FF4A 2EW8A 4D7AA 4Q39A 5ILOA 4OQZA 4GBJA 4XGKA 3AY3A 4FBGA 3GAZA 5BQFA 1WP4A 3ADPA 2Q99A 4NMHA 3I9LA 1HYGA 2DBVO 4PLVA 1Z7EA 1K6JA 2P68A 3ITDA 1V9LA 4WOJA 4I1IA 4ALNA 1J5PA 1PSDA 2C0CA 3GF4A 2NQ8A 2QRKA 4BO4A 3GGOA 1PL6A 4YPOA 2C7VA 4MKZA 1UDAA 2ZCVA 1Z6ZA 5C5IA 3GN1A 2HLPA 3NJ8A 5GZ6A 1ZW1A 4IDEA 4NHEA 5TF4A 3SBOA 1VL0A 4OKNA 4WLOA 2UAGA 5HS6A 2D4AA 5IXYA 1P3DA 3GDGA 2Y1GA 1DC4A 1I2BA 1DC5A 3DBRA 1P1IA 1PQWA 5CDTA 1KC3A 2VRCD 4BNFA 2EXXA 5IDWA 4RPJA 4EYEA 4TQGA 1UH5A 4MKXA 1YL6A 2DFDA 4INAA 4YJGB 4YACA 5CEFA 3H5AA 2EP5A 1RM4A 1PS9A 1SBYA 4O5OA 5A05A 5T57A 3GZ4A 1AE1A 4FD3A 5BR7A 3V2HA 2PLAA 3DDNA 4IY1A 2OZPA 4J3FA 4CM9A 1ADGA 4NBVA 3QRWA 3HDQA 1HDGO 4E5YA 4OXNA 3KLMX 4PG4A 1O95A 2DBQA 3OEWA 1DIRA 1U5CA 1EQ2A 1JKIA 1N9GA 5DOZA 1BDMA 5I8ZA 3DMYA 4IPTA 3WTCA 1HSZA 4RVSA 1G6KA 1QP8A 1J6UA 2V7PA 3QWAA 4PLZA 1LUAA 2XXJA 1NHGA 1E3LA 4E2ZA 1E3WB 4CMIA 5L4LA 3FWNA 4GSKA 3WWZA 4C7JA 1XCBA 1LA2A 5THQA 2VYNA 3WYBA 2NTJA 1QRRA 3I6IA 3NDRA 4FGWA 4AJEA 2ZB3A 3GOHA 1JWBB 1I36A 4NJOA 4RPHA 4HFMA 3KOUA 4R54A 4L8VA 5G0VA 4O1MA 3D4OA 4WE3A 5IFLA 1A5ZA 2PZJA 3FTNA 5A9SA 2Z1MA 4IMRA 4CMHA 3FNHA 4NFSA 4CUKA 3BZUA 4BO3A 2NSDA 4E0BA 4CM9D 1I33A 1EBFA 1PJSA 5DCYA 3WQSB 1EVZA 2V6BA 3W1VA 3GC6A 2EERA 5TJHA 1CQIA 1XQ1A 1RWBA 2P2SA 3EYWA 4YT2A 1H6BA 4CM4B 1FDWA 3NYWA 4UAGA 1NXQA 3WGQA 4EUFA 3MCVA 3BHIA 3UH1A 2QW8A 1OC2A 3W6UA 2B5VA 3U5TA 1OBFO 3FHLA 3I9OA 1QYXA 1E3IA 3HNPA 1V3VA 2EG9A 4C7KA 4KTVE 3OHSX 5EIOA 5CDGA 4FFMA 2FPPA 2EW2A 3IS3A 4BO2A 3CXRA 4HP8A 4BS9A 4QT0A 5JC8A 1LSJA 4W9NC 4ZQHA 3OQ1A 1T2AA 2Q2WA 3ZV5A 2V6FA 2ZTVA 3WGOA 4DBZA 4XIJA 2Y1DA 5L45A 1ZBQA 3P5SA 3TJRA 4IDBA 4CMBA 4CJXA 1BMDA 4YJFA 3ONDA 1EFKA 3LDHA 1MXFA 4FFPA 1ZK3A 4FFLA 1NNUA 3O8QB 4DRYA 3BIOA 4M89A 3ZNOA 2D1YA 3C7AA 2B35A 2D8AA 4GWKA 2RIRA 4YB8A 5L3ZA 3UGKA 5JAQA 3ZWNA 3PPIA 2GCGA 1E6UA 4BKUA 4UVEA 2FN7A 3COSA 2BKAA 2ZTLA 4BKRA 3HDJA 4OHUA 2VNAA 5MGBA 5T67A 4MINA 4K26A 3MJEA 1FDSA 4H15A 5AQ1A 1U5AA 3STHA 3UVEA 1E7WA 1NVTA 4WCFA 4JP3A 1HDXA 2FZWA 3RVDA 1MG0A 4CUJA 1ZEJA 3NUGA 1QV6A 1LBEA 4L76A 5H81A 3BMCB 3DOJA 4MVJM 3KRTA 1F06A 1Y8QB 1YH3A 4PZDA 1NVMB 2B4QA 3BMQB 5KKCA 3PVZA 3VZQA 2PFGA 1SEPA 5CG1A 1K3TA 3GVHA 1LJ8A 5GY7A 3WYEA 4EJMA 1M6WA 2Q49A 3ZWMA 4DVJA 4FC7A 1AGNA 4FB5A 4OSOA 4K6CA 3OJEA 5A06A 4DWVA 4QXMA 4NQZA 3S2IA 4R69A 3PJEA 4TROA 4CMEA 3K96A 1R0SA 3B70A 2R2GA 2C20A 2BELA 1GAEO 3WS7A 2NU9A 3ZHXA 3VH2A 4ZD6A 4AL4A 5DP1A 1MC5A 3ZW8A 1ONOA 2P4QA 1GR0A 4PIVA 4ZA2A 5KVSA 4NBUA 1H9AA 2J5KA 4FOSA 4QTZA 4KUHA 2DTDA 4CMGA 4RORA 4IDDA 3G0OA 3TFQA 1OFGA 1H6CA 3DMTA 1KVSA 5G0TA 2QHXA 2W8ZA 4OH1A 4IIVA 3GVPA 2ET6A 1ENPA 3VHRA 3TZCA 3Q6IA 2NWQA 3L4BA 3F47A 5AXDA 4Y98A 1UP4A 2Y66A 1KC1A 3INGA 3QVXA 2Z5LA 4M86A 3DAPA 4B7UA 2J6IA 3S2GA 4ND3A 1EUZA 1IPFA 2Q1SA 4JJFA 1F8FA 3P2OA 2X9NA 2Q1UA 4WASA 3W4IA 3ETDA 2BGLA 5BNFA 2NTNA 5T8KA 3JSAA 2DT5A 1IY8A 3LYLA 3VZRA 3IUPA 1KVUA 1ZSYA 4WNIA 3VDQA 1ZO8A 3PTZA 2I99A 2JFFA 2VWQA 3PYXA 3ZNNA 3PWKA 3I1JA 2QZZA 3LVFO 3CEAA 1X7HA 4BGUA 4Q3BA 3K2EA 4ZRNA 4AJKA 5CDUA 4WECA 5L4NA 1V3TA 4NG5A 4GH5A 4MVJH 2WYUA 2G1UA 4BNWA 3K31A 3S55A 4MVJD 4ND2A 1HT0A 2HKIA 1SNYA 1E1NA 1E7QA 2GRAA 3ST7A 2HJRA 3AM5A 3F1KA 4HXYA 4NK5A 1JN0A 2DU8A 5C7IO 4GGOA 3RUIA 2OO5A 1TT7A 2HMSA 4XR9A 4NK4A 1HL3A 3EGOA 2AW5A 1B0AA 3OJ0A 4GSLA 4YJDA 3ZHZA 1I3KA 4MVJE 1Y8QA 3KM0A 1ZK0A 1Y7TA 3U4CA 1Z82A 5G0SA 5KIAA 5JY6A 1O94A 1DB3A 1M67A 2NQTA 4JROA 3M1AA 5T6BA 1BXGA 4CQLB 3F46A 4FQ8A 3KBOA 3VTZA 4E32A 3RUAA 5A4DA 3M2TA 4Y6RA 1B7GO 3UAGA 3H9GA 2C2YA 3HDHA 4TWRA 2J3JA 1LLCA 3L0DA 1F0YA 1WDMA 2AQ8A 1O89A 3DC2A 3VH1A 3GA0A 4RPGA 1EK6A 4BGVA 4MOWA 1MA0A 2AE2A 1V0JA 1ZUD1 1HXHA 3GUYA 3ETEA 1BRMA 2I9PA 3AOEC 4XZ3A 4D0RA 3JQFA 3Q2KA 3RC9A 3ZU2A 2Y0DA 3Q1LA 5JDCC 1QORA 3WJAA 4IMPA 3LT1A 3PHJA 4NBWA 1I5RA 2ZQYA 1SPXA 2RHCA 1ZK2A 3VOSA 3PLRA 4CQMB 4XCVA 1PZHA 2O3JA 4ND4A 3Q9NA 1Y1PA 2BD0A 3CZRA 4Q3CA 3LC7O 2O4UX 3NDJA 3JQ6A 5A04A 4RQTA 4AJJA 3W8DA 2QYTA 1EVYA 1PJ2A 2O50A 3T4EA 3EZLA 2NU8A 4J49A 3UICA 3UN1A 4DPKA 2RHRA 2YW9A 4GPD1 4TVBA 4F6LA 2VUUA 1PGQA 2FHSA 1HF3A 3GG2A 4PLHA 1K89A 4QECA 1K5HA 2ZB8A 1ORRA 4DPLA 4J1NA 3NTQA 2GSDA 3R1IA 4EDFA 4YAKA 3L6OO 5KKAA 3FWZA 1BG6A 1UXIA 3HB5X 1R4MA 2HK8A 1EDZA 4I08A 3PQDA 5TQVA 1YQXA 4M8SA 4CLOB 3NKLA 4MO2A 3PDJA 3JYPA 5KJFA 4CLRB 1JDJA 3BTSA 1FDUA 3PDUA 4L73A 5DCUA 4W82A 4E30A 2WTBA 3QJ5A 3ZV3A 4N54A 3HFSA 3F6YA 5LCXA 2Y68A 3TRIA 3V5NA 2ZTMA 4LSWA 1BWSA 1M76A 2HMVA 3ZWAA 4IDCA 5T5QA 1U3UA 4DMLA 4R68A 1GTMA 1XU7A 2OFPA 3VPSA 1P1HA 3E48A 3D64A 3FN4A 3IAHA 2ZYAA 1YXMA 5C37A 5A3JA 3QW2A 3FBTA 4XD2A 2OOSA 1QKIA 2ILTA 4H16A 1T24A 2Z1NA 1GYPA 2G76A 3AU8A 3WYCA 1OI7A 2WSBA 4P4LA 4PN3A 2GO1A 4WCFB 4GX0A 1U8FO 1U3VA 1CRWG 1FJHA 1NPDA 2CUKA 3W8FA 4BB5A 1ZVMA 1MLDA 2PH5A 3RC7A 4BNIA 1GPDG 4Z0PA 5JC1A 3QIVA 4O63O 5TT0A 2DQ4A 1WW8A 3MOGA 2HJSA 3B1KA 2GN6A 3DEYX 3KSZO 1I24A 2Y1CA 1O5IA 4IQ0A 3S2EA 3C24A 5IXSA 3JQGB 5CPBA 4OAQA 4J7UA 4RVGA 3JQAD 1YB4A 5JYDA 5JAMA 5GZ3A 4QEDA 2I5PO 3ENKA 2AG8A 4AJ4A 4IDGA 1P1RA 3ULKA 3VH3A 3GG9A 3F5QA 5KCZA 2BFPA 5ES3A 4B8WA 5L9AA 3BXXA 2HSDA 2VYVA 3G49A 3KYDB 3BHMA 5I9MA 4EEXA 3IMFA 4RLHA 3QA9A 3RKRA 2BHLA 4A2CA 1HDOA 2DFVA 2E37A 3NV9A 3L9XA 5U4QA 1P33A 3H4VA 1U4OA 1U1IA 4G5HA 4XGIA 1IYZA 2JAPA 3LK7A 3AUAA 4HWKA 2NVWA 4ILKA 1EFLA 4BNHA 4JLWA 3JQ8A 4K1LA 4M87A 3RUHA 5A5EA 3PHGA 3JQCA 3GFBA 3LU1A 3JYNA 2OGUA 3INTA 4CM8B 3NT4A 4HV4A 3QSGA 3R0IA 1QYDA 2XXBA 5F1PA 1UP7A 3WR5A 5THKA 4AJOA 5IAAA 5CHEA 1HE3A 2WD7B 2A35A 4IJVA 2Y1FA 1CEQA 1B3BA 4JXKA 1C1XB 2PK3A 4DPMA 2B83A 3LSYA 1VPDA 2BI8A 1XSEA 3RUDA 2CDAA 1ARZA 4BMSA 3BMCA 4IIUA 5BNTA 3DZFA 3W4KA 4M1QA 1WPQA 4BNMA 5B1YA 5AXBA 3TZ6A 4OSPA 3C8MA 4DTIA 3TSCA 3DXFA 3TPCA 3WTBA 3DWFA 3BAZA 1ENZA 4J4TA 5KVCA 4JCOA 1E3JA 2NVUA 4BOYA 3R6DA 4WEQA 4R9SA 1F17A 5KTKA 4E31A 4CV1A 3CH6A 1NTOA 2FP4A 1ULSA 3BMNB 3QLJA 3R3JA 4W99A 1ZIDA 1T2CA 3RJ5A 5F1KA 3AWDA 5HRUA 2JL1A 1YBMA 3DBHA 3ONFA 4BUCA 3JYLA 3RFXA 5ENVA 2QRJA 5K9ZA 2WYWA 1AHIA 1M6HA 5IF3A 2DPHA 4GMFA 4KUEA 3CE6A 4BNYA 3RASA 3DZIA 3U4IA 2QG4A 2IZ1A 2CZCA 3LT2A 4RGBA 3PLNA 1F12A 3KHUA 1ISMA 4OIMA 4XJTA 5KJ1A 3O8QA 5CFZA 1YL7A 1C0IA 3WLEA 5JAIA 2YHIB 2VUTA 3VAZA 3EW7A 1DHRA 3OM9A 3K2BA 3RWBA 1XDWA 1DO8A 2FPGA 3Q3CA 3CKYA 2Y1EA 3AM3A 3FPLA 4R3WA 1CIVA 4BV9A 3U4HA 1VL8A 2R00A 1LLDA 4XGNA 3T7EA 1HLDA 5IG2A 2Y05A 3RIHA 4B3IA 2ZATA 4GX2A 3U4DA 1YO6A 3U49A 5DBFA 1DFGA 1KVQA 2W2KA 1YJQA 4IUYA 2GDZA 1KEVA 1ISIA 1PEDA 4JX8A 4XYBA 3V2UA 1P9LA 3ZZNA 4Q3NA 4YJHA 5A5FA 4Z0TA 4J7XA 1I2CA 4RO0A 3KYCB 2PKQP 3TWOA 1P31A 1XELA 3G3EA 3ANMA 4GAEA 2CMDA 2WJPA 3UUWA 3NX4A 3H7AA 3JQBA 4DYDA 4MVJF 4XYLA 3E8XA 1YB5A 4XIYA 4YAEA 1GV1A 5TS3A 4D3DA 5IJZA 3AI1A 1DBVO 1MB4A 1JA9A 2VYVD 4KMSA 4X54A 4LGVA 2B0JA 3GEDA 1QMGA 2JAHA 2Y67A 1UXHA 2I3AA 5G4KB 2GZ2A 4MPDA 3GFGA 3IIEA 4XRRA 1E92A 4NFHA 1DJQA 5EPOA 1B3RA 3ITKA 4NJMA 1IPEA 2VT2A 1Y8RA 3IL2A 5IDYA 3AK4A 3JQAA 4WJZA 4DUPA 1BHSA 1VI2A 3D3WA 2HK9A 4XDZA 3ZWWA 3LT4A 5H82A 3M2PA 3DAFA 4ALIA 4R4JA 2EHDA 2H63A 5IN5A 3DO5A 4CM1A 1Y9EA 5AXCA 3NEPX 1F14A 1WZIA 2AE1A 4OXKA 2B4TO 3WGHA 1UR5A 2J5RA 4AJPA 2DAPA 1HTBA 4LCEA 8LDHA 3OA0A 2QQ5A 4CV2A 1CWUA 4S3MA 2TMGA 3F4BA 2X22A 1PS0A 3JQBC 4GWGA 5FEUA 3E5RA 4Z3KA 2J3IA 3JQAB 4YDRA 3PHLA 4L4XA 3ZDFA 1Y9AA 2C59A 4Z9YA 2IZZA 3WGTA 4Q3AA 3VC7A 1ENOA 3MJTA 3CMCO 4UULA 5I7EA 3E9QA 2AA3A 4BGIA 1GY8A 3NGLA 3G1TA 2CDBA 1XR3A 3K73O 1LRJA 3A1NA 1X15A 3BYZA 5BSHA 3ZU5A 4WUVA 1BSVA 4NU5A 1V3UA 3I6QA 4CR6A 1DPGA 3NTOA 1YBAA 3FNFA 1PGNA 3QQPA 4EJ0A 3NT5A 1LC3A 2VQ3A 1NQ5A 4GX5A 3INRA 1PJCA 3H9QA 4W7IA 5H83A 2HMTA 3TNLA 3ZV6A 2Q1TA 5I7VA 4XJSA 4B79A 1X0XA 2EP7A 1NFQA 1XU9A 1R0KA 1UAYA 2XAAA 5JS6A 4UUMA 2PWZA 4BVAA 2HUNA 1MG5A 1BVUA 3Q2IA 1E0DA 1GV0A 5TNXA 4J90A 5I9LA 3UCEA 5A1TA 1SB9A 2CD9A 3OSUA 3TL2A 3AW9A 1E77A 1HE4A 2PKQO 3KXDA 3FCOA 3MJ4A 2G17A 3GZNA 3FRJA 4XQ9A 1YDWA 4LSMA 4N7RA 3MWDB 4NU6A 2H6EA 4CR8A 4KTTE 2HO5A 1R15A 3PJDA 4J43A 3FD8A 3RD5A 3PQFA 4P4NA 4PRLA 2V6GA 1UDCA 5G0WA 4CV0A 1WZEA 3WGGA 4GLLA 4CODB 1A71A 2P5YA 5ER9A 3WQRA 1NPTO 3VPFA 3SLGA 3ENNA 1CQJA 2VHYA 4N5LA 1BVRA 4TRRA 3B6ZA 2X8LA 5JO9A 3DZGA 3TF5A 3OH8A 1Q7GA 2ZYGA 3VZPA 1ZKMA 4II3A 1KOLA 2JFGA 4UEKA 4HY3A 2UVDA 4JNKA 9LDTA 4BNNA 4OXYA 1P0CA 3F5SA 2VT3A 1B8UA 4DXHA 3H65A 4CM7A 1J4AA 4IBOA 4MVJP 1YQDA 1I30A 4RDIA 4U0JA 4PG8A 4RZIA 1FF9A 2X58A 3SVTA 4BNJA 2O3SA 4CL8A 1WDLA 3VKVA 1KERA 1O0SA 2C2XA 2CDCA 1DIHA 4PLCA 1AXGA 4ITUA 5I7SA 2R00C 2JJYA 3ZHBA 5TT1A 1DC3A 5A9SB 1NX6A 1NM5A 4ND1A 3WGZA 2X9VA 4NR0A 4R1SA 3JD1A 4WEOA 1R4NA 3WX0A 1LSUA 4JIGA 4J16A 1GPJA 3TL3A 2CVZA 4DIFA 3CPSA 3LQFA 3B1FA 3OQ6A 1SCUA 2IYOA 1BW9B 1N1GA 4XQGA 3DAGA 1ZSNA 2AEJA 1T26A 3VPXA 4I9NA 1LI4A 2GZ3A 3HADA 3X2EA 2H1SA 1LDMA 4J1TA 1K0UA 3Q11A 1GUYA 1F8GA 2B4RO 1V6AA 3DBVO 1JVSA 1OC4A 2B69A 4L74A 3O26A 5KOIA 4XYGA 3SJ7A 3RCBA 3JQ7B 4UVDA 2UUPA 3C1AA 3QVTA 2IZ0A 1NPYA 3PJFA 2FY8A 1KETA 4IQGA 2PGDA 1K6XA 2J3HA 4QFDA 2Q46A 3PXXA 3RAJA 5KWEA 3PIDA 1T25A 2JFHA 2EIHA 3I9JA 3RBXA 4BNTA 1AXEA 5JW6A 2H5LA 1R12A 4FGSA 2H9IA 1QG6A 3FR8A 4J9UE 4YJGA 1B8VA 5KVQA 1N1EA 3DZHA 1ADFA 1EE2A 1JKFA 4S1VA 4AJ1A 3QVWA 3RFTA 1MP0A 2Q3EA 4BO8A 5T64A 2ZCUA 5KJCA 1YB1A 4G2NA 1EVJA 1NASA 4WPGA 4FN4A 3ZH2A 3BTUA 4YWJA 3JQFC 1XLTA 3JYOA 1CYDA 4IZIA 5B4VA 2PGJA 1GEGA 3DBLB 2JCXA 4P38A 4IXWA 4U5QA 1G0OA 1PX0A 2AQIA 1PIWA 4RVFA 2JD2A 4BQPA 1FK8A 1R6DA 4KDFA 2NU6A 4GI2A 3C1OA 3RU9A 1KS9A 3PFFA 3CIFA 3ZN2A 5ILGA 4OOFA 3OJOA 3E82A 1E7SA 4HADA 2X23A 3WMWA 4CM6A 3DFZA 1PJLA 5L7WA 3KLPX 1R37A 3NGXA 1H5QA 5LC1A 2YFHA 2WD8A 3N58A 4YQYA 2E49A 2A92A 3GUCA 4JJGA 3DOCA 1UXGA 1HLPA 2GERA 1OOEA 2JD0A 4MVJI 4JBGA 5MDHA 3TN7A 5COAA 4F3YA 3GMSA 3ZWPA 4KWIA 3W8EA 3OJLA 1VM6A 2PH3A 4NNJA 1XHLA 5L7TA 5U1PA 3HWRA 2O4CA 2J5QA 3KSDO 2HRBA 3ZHYA 3IP3A 4K6FA 3ZWBA 1WMAA 1UP6A 3ZWXA 3LF1A 4CLDA 1E3WA 1R4MB 1VJ0A 4I5FA 3GVIA 3LLSA 1Z73A 1E3EA 4IJUA 3JV7A 4R1UA 4B3HA 1Z75A 4J1QA 3OIDA 4JBHA 3ZI0A 3E18A 1WXDA 2PD4A 1DLJA 3AY7A 3AJRA 3AM4A 1DHTA 1CF2O 1N9GB 3B20A 3SC6A 4A5OA 3ON5A 2PA3A 3EDMA 5DN9A 2YY7A 1YGYA 2I6TA 3OECA 2YFQA 5BSFA 3I4CA 4UVHA 4W6ZA 3WQQA 5K6AA 1E1KA 1IZ9A 2BFMA 5COQA 5CAEA 3K9QO 1VSVA 4GMGA 5F1OA 1BXKA 2QX7A 4HNHA 3L77A 2Q4BA 3VZSA 3SLKA 2O3QA 2NVUB 3PEFA 1UUFA 3K30A 4XQEA 4YJFB 4DC1A 3PHHA 1Q7BA 1U7TA 1HE2A 4KWHA 1XGKA 2EWMA 5ITWA 1P45A 3F3SA 3DTTA 4BO6A 3DFUA 3F4LA 4TRJA 4BNLA 1E1LA 1U3TA 3IOYA 4LVCA 4HFRA 3IKTA 1O6ZA 4ESOA 4RF2A 5JO0A 4UUNA 1N5DA 2I76A 4QQRA 3HUDA 3ONEA 2DC1A 2GN8A 1LSSA 1YE3A 4J1SA 1PJTA 2X1HA 3K8ZA 3WXBA 5TRTA 4E5PA 4WLNA 1S7CA 1P77A 2EEZA 4CMCA 1YOVB 2VTDA 4YA6A 1JQBA 3ZU3A 3JQEA 3ASVA 5F5NA 2ZJ0A 4B4UA 5A02A 3DL2A 3IUSA 2EV9A 3WFJA 1R66A 1NAIA 3ASUA 4D3FA 1YS4A 3L9WA 3UCXA 3UHAA 1DLIA 1D4FA 1P74A 4JBIA 1I2ZA 3MJCA 3RFVA 3RQSA 3ZWVA 2HDHA 5I7FA 1XKQA 4W7HA 5FYDA 4BNGA 1DSSG 1K6IA 3D4NA 1WLYA 1LU9A 2E4AA 4P22A 1AHHA 3VVBA 4E12A 2HU2A 1KVTA 3JQ8B 3HN7A 3O4RA 4GGPA 2JCYA 2YHIA 4PLPA 3D1LA 4FJ2A 1B2LA 1H9BA 4TSKA 4BNKA 3CZMA 4OM8A 5JDIC 4ZN6A 1Q1NA 4ALMA 3RROA 1VJTA 1NHWA 5JY1A 4E33A 1ZCJA 5KJEA 4B3JA 2ZYDA 4EUHA 2ZB4A 4QO7A 2IYPA 3WLFA 4DGSA 1YL5A 3RSHA 3ZNPA 4BMVA 4E2WA 1T4DA 3TZKA 3DZBA 1CETA 3PYMA 4YRBA 4YAJA 4IJWA 4MKRA 4U8GA 3IJRA 2XF8A 2EKPA 3HQ4O 3LF2A 3T7CA 3ZGYA 3A9WA 4U6QA 4TZKA 2VZ0A 1V35A 5KNLA 3HDYA 1Y5RA 1ZEMA 1PTJA 1VL6A 2QIOA 5FF9A 4OYRA 3AOEA 4MIOA 3ZU4A 3AI2A 3QHAA 1D1SA 1VC2A 1HZZA 1IOLA 1BXZA 1HDYA 4BMNA 4DQVA 4R5MA 1GU7A 4BKOA 4ZGWA 4CMAA 2JKVA 4N18A 5JPIA 1JW9B 4FOOA 5HTOA 3E03A 2QYSA 1LSOA 3GNSA 2Y99A 3PGJA 3HJAA 4BO0A 2DTEA 1ZJYA 2NTVA 2AHRA 5EERA 3Q9UA 1L7DA 4UVIA 4ID9A 1C1DA 2Y0EA 1DAOA 4LK3A 3VVCA 2YHUA 1B8PA 3D3WB 3ORFA 3PI7A 3WIEA 1JWAB 1H6DA 2O7QA 2VOEA 4RVHA 1IL0A 3S2FA 4KUGA 4TZTA 1ISJA 3G79A 3C7DB 3FTPA 2DPGA 2X5JO 4GX1A 1ISGA 3PYLA 2C5AA 3K5PA 2X0JA 3P2YA 4FFRA 2ZTUA 4WLEA 5CPFA 1NQAO 1UZLA 4U7WA 1L1FA 3GDOA 3AUTA 1ENYA 3DBLA 3GAFA 4WCFC 1EQUA 3DZJA 4LISA 3UW3A 1I3MA 2GD1O 1SMKA 1DOHA 3AUSA 3E1KA 4ZICA 3K6JA 4IXTA 1EUCA 1KEUA 3DR3A 1ZH8A 1I32A 5JCJA 3PGXA 2CFCA 1DAPA 3HB4X 1W8DA 1MGOA 2OUIA 2BI7A 2CVQA 3CSDA 4J4HA 4OMUA 4WLVA 2A4KA 4J6FA 1CDOA 1SZJG 3BMOB 5JMPA 4A73A 4D44A 2NNLD 2Q4EA 1WNTA 3CUKA 4YYZA 1XIVA 4BB6A
chains in the Genus database with same CATH superfamily
1F8UA 1PGOA 3AIOA 5AHWA 3GFVA 3QE3A 5AO9A 2J0SA 2E4XA 3AL0C 3OPYB 1FNCA 3R9XA 2NO0A 1NJFA 4O4HF 5HJ7A 1BGVA 2P67A 2I4MA 1T3TA 3OQIB 3SSMA 1G5RA 5KTOA 2XJ9A 2ZRKA 1QQ7A 2L17A 4V02A 1OVGA 2O0KA 4WZBB 4PU0A 1ZK1A 3L8CA 5CGZA 3BH7A 3OQBA 4L5AA 5I45A 4CLEA 1FX1A 1KNXA 2Q6KA 3TBHA 3F78A 3H2GA 4YT4A 2O2YA 3PT9A 1Z28A 4PICA 2XDAA 1N57A 1Z45A 3UJ8A 2V9ZA 2AFHB 4I6GA 4JI2B 1W4ZA 1E7MA 1JRLA 3U26A 5LXTF 2PAAA 1Z74A 5FQNA 1H66A 3CNLA 1W88A 2QG9A 1NVUQ 2AOVA 3DTNA 3ER6A 5B37A 1FBNA 1W0CA 1KZGB 1U99A 4X1IB 4BX2A 2VSOA 3HVUA 1CR0A 2QMEA 2NZWA 4FKMA 5JH7B 3VBCA 3INNA 3OFVA 1CR1A 1KDYA 2PUDA 5IH7A 1D0IA 2X2PA 1LQUA 2BFOA 3AERB 1UMBB 3GZJA 3E7FA 3SXUB 3G9XA 3WBKA 2NVOA 1XJWA 3R3WA 4QGHA 3ZY5A 1N34B 4JUFA 1NP3A 2B2CA 2GJ8A 3C5WP 1GCUA 3FSJX 4JP8A 1Q22A 4F2DA 4LF5B 4JUAA 1RNLA 2FWBA 3BH0A 3HCPA 5TV2A 1E6LA 1P2SA 1QDLB 1AZSC 2Z3VA 4KQ9A 1U2DA 2O2HA 4CI9A 1K7CA 5JMWA 4ZZ0A 3WG9A 1ACJA 5BQXA 1OFIA 4HDSA 2IOHA 4KVZA 2ZJ8A 4KH0A 4KODA 3G0IA 1JJAA 3FKQA 4M4SA 1AUPA 3WLMA 1DEOA 1I0IA 2G4VA 3EIOA 3O8NA 3WDKA 4WX2B 1UFKA 1UKBA 5JPDA 3FPCA 1KY5A 1US8B 2HRRA 5DF1A 2J3EA 1H94A 1GO2A 3LK6A 1A5AB 2YASA 4YVFA 3ADOA 3FNGA 5CD9A 1BHJA 2Q2VA 1GFSA 1KU0A 1HL7A 3UMVA 5BXQC 5M5BA 3V2GA 1K9SA 1P0FA 1MOPA 4GKBA 3IT1A 4ITVA 3RG2A 5FI1B 5I8PA 1D03A 2WSYB 2ZPUA 3H97A 5EZYF 4R2JA 4DV6B 3FTDA 5BMVB 1W0KD 4RKWA 2B4YA 1DVRA 1GVNB 5A3RA 1JEOA 2BFAA 5J5VA 4Q9JA 1AK2A 4OI4A 5ER6A 2ZIXB 3AZQA 3H2IA 2B37A 3IAAA 4D5GA 4DQXA 1E9EA 2FSIA 2PA0A 4TZ6A 1G5PA 3MF4A 2IS4A 1L7AA 4J0EA 2J09A 4XLZA 5ETJA 4AN4A 3KQLA 1A1SA 1QVAA 2JDIA 2QTNA 2COEA 4YJ3F 4LCBA 2RK4A 1GADO 3Q6NA 3WIBA 5IYZB 4KI7A 1MFPA 4G24A 4BZPA 1TDJA 1YUBA 2WTNA 5EMJA 5TX7A 4DJDC 1E5QA 4KXYA 1Q19A 2WB4A 3G9ZA 2XUPA 4PZZA 9MHTA 2C99A 3V3KA 1L8OA 4I4TF 3AY0A 3OM1A 4II2A 1A2QA 1U0GA 3U1VA 3E3OA 3TOZA 3F97A 2NVBA 3H17A 3LDFA 1HLGA 3QVKA 4FR5A 1QCYA 3NIGB 2FSGA 4OHBA 3FBGA 2E21A 2WPNA 3KQQA 4R8KA 3CVXA 1PQPA 2V0GA 1RJWA 1EZZA 4E4YA 5AW0A 4QGGA 1D4ZA 3DCJA 1PJBA 1RAEA 3L7NA 3RWMB 3W1WA 4NBSA 4O2RA 4KXLA 5KTMA 1J20A 1MC4A 1OA0A 3O5AA 1XU4A 1R0LA 4GOXA 1EB8A 2AFRA 2BMVA 4GI7A 3AONB 2OBFA 1EDEA 1KSFX 1K6MA 5KDLA 5IEBA 3TLGA 4OA5A 4J2TA 3T1VA 3CNQS 4OF4A 2PD3A 4ZODA 4NOMA 4BNUA 2DWPA 4G8JA 4KYVA 1LC0A 1O2DA 4Y9RA 1FJ2A 4GT1A 4EHFA 1MV8A 5J4KA 1T0IA 1R0YA 1IN5A 2FFRA 4UE2A 1RHMA 3D6TB 1Q1ZA 2YC2C 1GLVA 5AW3A 5KTSA 3AERA 1EE9A 4KG7A 4YRLA 3S44A 3ETLA 4PY2A 4NU0A 2VRBA 4M53A 5JH7A 3IAS6 2FWAA 2PMBA 3NBYC 1C1XA 1UXOA 2JH3A 2MMCA 1OASA 2A9FA 3F7OA 1IOWA 1TMKA 4YRFA 4IWNA 4EX6A 4V38A 4CLRA 1JU9A 3WHPA 4BTEA 3HHPA 3T5PA 4R16A 1L4HA 4AJIA 1Z5NA 3M6XA 3UMYA 3N6RA 2WUDA 2ZR7A 3DMRA 2PS1A 2A4MA 4HQ0A 1W44A 3L8EA 2O8FB 3VU1A 1YHZA 5B3JC 1G2IA 1YZQA 4GLFA 4WHMA 1I8TA 3M1IA 4FDUA 3EXG1 2HBYA 3QI7A 2FWMX 4CN9A 4PWYA 3DAHA 1GZSA 3GJXC 3QE9Y 4PG7A 3LP8A 4L8WB 1KMHB 3S40A 2NSYA 2AF3C 4C7VA 521PA 2HEIA 5L8VA 1KOJA 4DLAA 3H19A 2QT0A 3QA3E 4NH4A 3EZ7A 1VIDA 4E5NA 2FSVC 1PR9A 5ECGC 2A59A 2CFOA 1V5FA 1KMMA 5J2TF 3AR9A 4IIJB 3SJZA 1ADBA 3KYDA 4UASA 4J0JA 3KJGA 4BO5A 3TLEA 3QBDA 3O8CA 1P1KA 3FOZA 4R2KA 4YP9A 1YNSA 1GRQA 2X2OA 1GQSA 3TAHA 4RK4A 5EL0A 2BDTA 2G5PA 2REXB 3ZDEA 2KWIA 3JZDA 4KX5A 4I5DA 1OX4A 2VDJA 4L0MA 3B6KA 4V0ME 3SSNA 3TXXA 2IHNA 2OQVA 2OESA 4ISBA 3HNOA 1Z4QA 1JIXA 1N7HA 5KCMA 1XZJA 3MLBA 4UUOA 5FNVF 3AESB 1E1MA 3P20A 3TYXA 3JWIA 3OA2A 3C5EA 2VHXA 1VTKA 1QB8A 3L0CA 2ERXA 2FLKA 2QRLA 3B6EA 3TX6A 1PR5A 2JJ1A 4EEKA 3TAXA 1E2DA 3WLAA 2FCRA 5DN6D 4PIMA 2HF9A 3AB8A 3CKMA 3QVSA 1V45E 1EJ6A 4ZQFA 3TH5A 1XDSA 5CFPA 1LLUA 1UJNA 2UYOA 1RU3A 4R1TA 1FX0A 4X20A 5FADA 3UA4A 2WNSA 4JT2A 3DLAA 3NM6B 2VCYA 2ZBRA 5DNAA 2B8WA 3BGIA 1I7DA 4DJ5X 1G5IA 1WTCA 1E2NA 3I01A 2OCLA 3JVVA 4Q7QA 4CM3A 4M1MA 1IEQA 4TTRA 4HCJA 3EOBI 3KR1A 2HCTA 4KO8A 1MTOA 2PX2A 3RSZA 4OGWA 2R0QC 1NUUA 1Q21A 1TUBB 2R1ZA 3THRA 1HY3A 2HDWA 2MYPA 4OEHA 1PT9A 4DYVA 3VPBA 5KYTA 4TV8A 5DN6A 2FRXA 4Z49A 5H02A 3KJEA 4WDRA 2ODQA 2QJRA 2ZXUA 4AVYA 5HS4A 2OHFA 5IKEA 2O1XA 4MSUA 4Y3UA 1BEZA 4TKUA 3VNVA 3GPDG 3IDAA 1U0NA 3FCAA 1DRUA 1AOXA 3AVVA 2W2VA 2X0IA 4J0GA 3W7VA 2H7VA 3KE8A 5E0KB 1PEYA 3KDAA 1DFHA 3L0BA 4FFBA 3PXGA 4A6EA 1XLWA 5EWLB 2F3TA 4UE3S 2I2DA 4Y0AA 1AKEA 5JPIA 3TS1A 4NDNE 3WJ7A 4BWYA 1PL8A 1G18A 1H22A 3PQ7A 2G5CA 5ITVA 4GU5A 1KI6B 2F3RA 3A4VA 1G8MA 3O2JA 4C7MA 5LZ4A 4AICA 1CY4A 1E8NA 2H07A 4I50F 4CPDA 4RQBA 2JLCA 4DRXB 5ICMA 1X1TA 4EHHA 2AL7A 2BTQA 3UA3A 1JKXA 4UUAA 2G67A 1S89A 4HHEA 4IVPA 4RL6A 2GXUA 2V7QD 4CQMD 3UMBA 4B3BA 1Q6ZA 4GECA 4KFRA 4G01B 3D8BA 4IIJF 1DEHA 1X1SA 3BSFA 4P36A 2CNBA 1VL5A 3WNQA 3A2NA 4BQSA 5EXSA 2OV1A 1KFKB 3FOBA 3GBSA 4HAOA 5CIWA 5B4TA 4WKBA 4RABA 3OQNA 4EO9A 4Q3EA 4W5QA 4NZPA 3WO0A 3P45A 4V3BA 3CX7A 3GJYA 1D3AA 2C4KA 5CX4A 1WU8A 2RK6A 2J46A 1GQ2A 1HKUA 3MW8A 4G5OA 1M1XB 3BKXA 5IDVA 3TQOA 3U62A 1RHKA 4BX0A 2JGKA 2BFFB 2JLYA 2C3MA 4WNCA 2RB4A 3V3TA 4CDGA 1HO3A 2NZVG 1WUIS 2HPAA 3A58B 3D7LA 1J9GA 3PNYA 4II7A 3TR6A 4ZVRA 3NEJA 5J9FA 3UPDA 5AVTA 1RR6A 2FEOA 2QM3A 2R8ZA 5K0ZA 4C0QC 3D6MA 1B4DA 4PZ0A 1ESMA 3IDFA 5L3QA 1CQIB 2D0PB 2QTBA 1PW5A 3RYIB 3HVHA 4PLGA 2IXGA 5DNYB 3NO4A 3THXA 5F64A 3RVQA 2ZVJA 1VMDA 3KEQA 2UZ4A 3IP9A 2QYHA 1JQ5A 5JV5A 5EIXA 2C04A 2ONYA 4TUYB 4EEZA 5BW8A 2XA9A 1T1EA 3KEFA 1VE5A 1TCBA 2FOIA 3F2VA 4G4SO 2F64A 5CYPA 4DLZA 5ANRB 2J45A 1RYYA 1BXGB 3LV8A 1PG2A 1U7XA 2YV2A 1QG4A 3HPQA 4AJNA 3VH4A 4QJ3A 5B12A 5EHXA 3CKLA 1HQCA 3FVRA 3AFMA 4C04A 1RPNA 1WUTA 5IDQA 1UT5A 1TW2A 3A9TA 3MEQA 5AJYA 4WXPA 3I61A 2EKQA 1YK0A 1QQ6A 4JUBA 1EE1A 4Q3LA 1OXBB 3IDZA 3JR3A 3UG7A 4AFNA 4L57A 3MGCA 1T1RA 2O2IA 4A16A 2PVSA 2YJ5A 1NDQA 2OMEA 3CH4B 3FJ1A 5FRDA 3FOCA 1FFCA 3E15A 1KR2A 4BVLA 2WG0A 4O33A 1T9CA 5JANA 2WG2A 3CLRD 4P54A 2VFAA 2UUCB 1BS9A 3BF8A 2EFEB 1VE9A 3DMHA 2P2CA 3B9RA 4J0IA 2Y2UA 3AETA 4WGGA 4G5SA 3KS9A 3ZVRA 2C4WA 2LDXA 2P27A 1U9JA 3QXXA 4TLLB 4EB3A 2L0XA 3IVGA 4EENA 4LZZA 4QOGA 2J87A 2PYDA 1T0UA 4OLAA 3LW8A 2VP5A 3V80A 3RTDA 2V5AA 1JA1A 5J4YA 3DYBA 4HR7A 4PS1A 3OQMA 1YRLA 1X1EA 4DSAA 4OK5A 1C3VA 3AQ4A 1G7RA 2XTNA 3G6WA 3G88A 1S3FA 4XWYA 3UATA 4E22A 1PT7A 3M1LA 4I1RA 2QLLA 4TRMA 3BTOA 4KBGA 1B15A 2AOUA 3FFWA 5K1ZA 1H2AS 2QU8A 3WBJA 2ODEA 3OX4A 3WMXA 4K9PA 2AUTA 1ZJZA 1G5FA 3EVZA 1BOOA 3HA2A 4JNCA 4XH9B 1QAMA 4F1KA 3A4LA 3BRCA 3DM9B 4PNPA 4ZARA 4BBJA 3T5BA 3M83A 4ALKA 5I01A 1KRXA 1NUHA 4LDJA 1QDEA 3ZLUA 4LFCB 4K86A 5B7NA 2YFYA 1TQ4A 2QKYA 1WMFA 4MB6A 4XGRA 2XBUA 4PCVA 4Y8VA 1XKXA 2E4UA 3K9FC 5HK9A 3E9MA 4KDEA 3RSLA 2Y0CA 3WKEA 1IBCA 3NDIA 3REQA 4P93A 1VIVA 2PO5A 4EYGA 4L07A 5ALDA 1RQGA 3H9EO 3A6JA 3KTDA 1XT6A 1DNPA 5GWXA 4AT1A 1B2RA 1QIHA 3GJ0A 4B7XA 3DONA 3O93A 2ZWMA 2VTEA 3ADDA 5ICSA 2FMUA 2HTEA 1EFTA 1RP7A 4Q7EA 4MAAA 3RI3A 2OR3A 4B09A 2ECKA 2IE0A 1FDOA 2ST1A 4BZWA 1I7SB 3TIXB 4FI3F 5TLSA 1E7YA 3DV0A 4YY3B 1W73A 2HW8A 2X15A 1HQYE 2NXNA 4BGEA 3KEOA 2G80A 3D0OA 3GY0A 4LJAA 5G53C 1ULUA 3HACA 3T3GA 3QEAZ 3KPYA 4JL8A 3L0PA 2GKGA 2Q1WA 1AKQA 3D0KA 3Q7PA 5BN4A 2P77A 1U0BB 1W4CA 5TGDA 1SXJA 2WD7A 1VPEA 2NU7A 3WAGA 3CZAA 4H18A 3DFMA 3SKXA 2QSUA 5CT9A 3A0UA 3MS4A 1PDOA 1S3GA 2R7AA 1W8IA 2QMYA 3OLVA 4XYEA 1YRWA 2R25B 3WLNA 1WMBA 2GSWA 1A7KA 1SKMA 1GU0A 1Q50A 2C5HA 2QTLA 5A4JA 1IDOA 3DD1A 3W6ZA 2QOEA 1XRSB 4MH0R 4HUQB 1EM8B 3MBIA 4E3ZA 3D6UA 3A4IA 4P58A 3OZUA 1AZLA 3Q9LA 1A9XB 1JDVA 3GLSA 4AJHA 5CVTA 1X7DA 1VLLA 3C15C 3MFQA 4N3BA 3IQIX 1FP4A 3BG5A 3GGPA 3CS3A 1KS2A 5AR1A 5SY9A 1XNHA 1YC5A 2PUFA 3E9ZA 4N5MA 1D6MA 3D8RA 2BSXA 4W6QA 2AXPA 4FYVA 3NXKA 1IHOA 1SC6A 2OY0A 5DTIA 4CTOA 1BDBA 2OBYA 4DA7A 3FSRA 1PL7A 3EVNA 4H1VA 4B3SB 4KU4A 3KV3O 3T1TA 4NXMB 3CX8A 4WKCA 1PS8A 4W1PA 4O3MA 2FZEA 1V26A 4JLAA 4WZBE 4N03A 5DLDA 2HM7A 4M0LA 4D42A 2JH9A 3G1UA 3NBUA 2J67A 3NHYA 2ZT7A 1DDOA 1KP9A 2R8PA 1Y5NA 1Z68A 3KU1A 4BO9A 2RD2A 2RAFA 2OXIA 3LVRE 4F2WA 2JVJA 2FX2A 2YJ3A 3ED5A 3QUTA 4LF8B 4YNBA 1G4AE 5A3QA 4DMLA 2HB6A 1E66A 3X43A 4FSHA 4LJYA 3LD9A 2VCHA 1RMYA 2MCFA 4GSYA 1AUXA 4TTTS 3IALA 5IF9A 1OSNA 1VPLA 2RCYA 3AY6A 3U7IA 4DL9A 5BY2A 1GCIA 5LP6C 2F43B 1XVTA 3NPMA 5LLTA 2EAUA 4RS3A 4HGYA 1Z8HA 1GUZA 2X1LA 5D8DA 4Y2QA 4IG4A 4HAYA 1VLMA 1GDHA 1L4KA 3B85A 3V7WA 3I30X 3ORQA 5FNVB 3W79A 1ETUA 1UXJA 2H2DA 4UUPA 3VR4A 2JD1A 2XMRA 3G2LA 4IUDS 4KQHA 3PDHA 1XTJA 4C4ZA 1LPBB 1UPFA 3TM5A 3ZDXB 4HAUA 1U8EA 1TCCA 1WXWA 3QNMA 4W9NA 3JXEA 4FVTA 1H5UA 3PNKA 5CNMA 2HHHB 1U3GA 4UM8B 4YUVA 4BE9A 5DT9A 4KE7A 2AEMA 4HFJA 5A2GA 2JI9A 1FRQA 3BL5A 1ZD4A 3B13B 3O3CA 3WNZA 3EWAA 4NOLA 1PGJA 4RESA 4YJ2A 1E9VA 3QMPA 4INPA 3KAJA 1J8FA 4JVMA 5FTKA 4HKTA 2C88A 3BDAA 4E5VA 3CRZA 4H3KB 4FMDF 3ZE6A 4BV3A 2ID8A 1EJ2A 1CZNA 1IXYA 4GXRA 1TF5A 4QJ4A 1FDRA 4S04A 1H8ED 1R1DA 1P0MA 1ULBA 4UM5A 1GGEA 3LSTA 3VR3A 3GEHA 3PPYA 3WSVA 3LXRA 3HXMA 2OXRA 2NUPB 3LUFA 3KVOA 4GS5A 5KKNB 2CL7X 1N2IA 3IE0A 2MDTA 3O84A 4PO3X 2R1TA 1DCKA 1NNI1 1NR7A 3AVOA 3GL9A 4CV3A 4D57A 3UGQA 1GDDA 4O0LA 1FNSA 2JGLA 5P21A 1ZKDA 2IHJA 2Q07A 3I9KA 4QHYA 3MBOA 4MGIR 1TT5B 3L6CA 3W5CA 9LDBA 3SU8A 2O2DA 1ZNWA 4ER5A 1CFJA 1IHYA 1ZD8A 3EVFA 5FPSA 1GD1O 4MP3A 2JHFA 3S1LA 3WICA 4PBSA 3R5HA 4KIJA 3BILA 4EKYA 3DWEX 4OSEA 1YA8A 2C1XA 2WZQA 3MXOA 3ETNA 2R6JA 3DT6A 4LAFA 2PL9A 2C5GA 4PVCA 3H2KA 2CJWB 4J2OA 3RVLA 3CF4G 2FNAA 3ISVA 5HQJA 1L5HA 1FU8A 4GQIA 1I2MA 1LVUA 3K2IA 4ND5A 1DX9A 3VOTA 1PK8A 3CT6A 3QTTA 2Q2QA 4IEFB 4IJKA 1E1RD 1J97A 1YOBA 3F8TA 4R51A 5G41A 4BCDA 1EVIA 4JBYA 2GPWA 2AC2A 3VUFA 4BAUA 1VSUA 5DW0A 4DWWA 2VBCA 4LF9B 1K3FA 5CNKA 2PUEA 4RHTA 1RBYA 1UZNA 3OUTA 5BQ3A 3OO1A 4JC8A 2AOXA 2HWKA 2P5TB 5JZBA 7REQB 1ZJWA 1WEKA 2IPMA 4YASA 3MUNA 3HDVA 1T9AA 3PUJA 3R7BA 1GUDA 2QNBA 4I6EA 4JI3B 4DADA 1S96A 2I62A 4ND8A 1A7JA 2B8TA 1ZJ5A 4NFLA 3AT1A 4RNDB 5GV8A 4PXSA 1P9NA 5KYVA 1KQPA 4X8LA 2XNCA 1DGQA 3GLFA 3ZNQA 1RLTA 4X6XA 5C8VA 3SG0A 3QLVC 2XRZA 1HNXB 2XBMA 1TX4B 4LBYA 4R1QA 2HNKA 4EITA 4G4JA 4WN9B 3VR5A 4OM7A 3A2LA 3G02A 5CDYA 2ZYVX 5K4HA 4FHCA 5IAGA 3R74A 1C9YA 4MA4A 1T5TA 4D26A 2AQKA 2O3TA 3F2IA 1J1UA 4BNHA 4K8RB 4ZCPA 4XUCA 1IB0A 3UKOA 1ZIXA 2J8ZA 4RAQA 1ZXBA 2CLEB 2FW9A 3CLSC 5ULLA 4BKPA 4ZK6A 5JYBA 2Q3FA 1YU6A 1W0JA 1PJ3A 4EQZA 1T2DA 3RYHB 3RW9A 1UAAA 3ETHA 4M1ZA 4BPRA 5J47A 5JBQA 1GZ3A 1ML3A 1KIAA 2X8JB 3O2QB 5BYJA 3UXEA 1RWNA 4F4DA 2CSXA 1C9MA 2P0EA 1ZX1A 1GXSB 4TV9B 1VGVA 3M9WA 1UJMA 5AI6A 4MA0A 2BF7A 1M7BA 3N2IA 4NFYA 4PXAA 3WL7A 5FAKA 1CY7A 3D2CA 1O94D 5KHOC 5B64A 5DDIP 1Q15A 1GFZA 2XUQA 3CR8A 1C3JA 4PZCA 2LPMA 1F4LA 1II0A 5DTRA 1MMFB 4TWBA 3SR3A 3GLIE 2VKQA 3W34A 3GELA 1Y42X 3STYA 4DLTA 2EBWA 1CUXA 1Y8RB 2HLNA 3K9CA 3EIFA 3MUEA 4QODA 2IPXA 3EG9B 4MR7A 5KJ6A 3I2JA 1Q2UA 1OXUA 4GDFA 5L95A 3WY9A 1GA6A 1N2OA 5AM4A 4JP2A 2PTHA 1EFUA 1XP8A 4QL3A 3IP5A 5F33A 1OT5A 3I9MA 3B7WA 3N8IA 1RWPA 2FZGA 2B5WA 3CKKA 3RS3A 2DBRA 1B16A 2PNFA 1KFCB 5JCXA 1FMJA 4A0SA 4XB2A 2Q7DA 3TW6A 4Y0VA 1Z39A 4FTWA 5D2CA 3IXQA 1C50A 3QENA 1WUKS 3QTBA 4L8FA 4TT3D 1OH8A 1YJ8A 4NH0A 1IB6A 2C8VA 3RVSA 2JIDA 3BSWA 1JHZA 2FSVA 2JIMA 4W1QA 1T5SA 1Z7WA 1OGYA 2GGSA 2WIDA 3GGDA 2YZKA 4HFNA 2PUVA 4U9UA 1TUIA 5JZMA 1K5DA 2GM9A 3BB4A 1VLQA 3MCAA 1TT5A 4ZDIA 1DAEA 2BMDA 4KXQA 4QRDA 5JD3A 5ES4B 5KYUB 5LJLA 4FOPA 3PP8A 2A5LA 2RGNA 1DIOB 2PMEA 1SBCA 1ZVJA 3TI7A 4CIVA 3AUUA 1GCOA 2IHKA 2WIBA 3IBYA 3NHMA 3OCUA 2E48A 3JATA 4TUYF 5EJMA 5HFJA 3WADA 5K0EA 2PO7A 2RGWA 3MTGA 1HDEA 2RI6A 3BK2A 3AHDA 3KYIB 3NOVA 3V1UA 2E1RA 3VQTA 3KZKA 4ZI2A 4L27A 5CB4F 3EFOA 2H8KA 4L5IA 1AS0A 2R85A 2W71A 1NOJA 4XTCS 5FUVA 5I9TA 4CIWA 1T5OA 1TECE 2BGMA 3SEFA 2C98A 1LF5A 3F6EX 5P8WA 1W1IA 5DMXA 1RE1A 5JS1A 2JI6A 1WSAA 3NFRA 4UXHA 3WLRA 1JQEA 4D8UA 4DNPA 5EJ2A 5JIBA 2Q6IA 3QUQA 5FBQB 3ETJA 5CEJA 1PE0A 1RHUA 3WYAA 4CL3A 2AZTA 1RHJA 5EPUA 1YQGA 1E6MA 1MTZA 4DC0A 1FC0A 1QU2A 4MV9A 3FA2A 1PZXA 2CF5A 1XJ0A 4MVJG 1KYVA 2LVBA 2ACWA 1Y0BA 3IERA 2E6UX 5ALKA 3DUFA 2I1QA 1LNQA 1XFAA 2I2XB 2PR7A 3KO8A 4KIUA 4E08A 4RD3A 2B7LA 2XZLA 1RIIA 2GN2A 1JV2B 3OWXA 5CYOA 3SPXA 5HYVA 1CQWA 1G6HA 3A27A 3EF3A 4GPTA 4Y0NA 2C8LA 1PVVA 3MELA 1IZ0A 2H5EA 2XVXA 4NJEA 5AIBA 3B5EA 3QQ5A 1KDTA 4LXTA 4ZT6A 5J63A 2PUGA 3FG9A 1YRQA 2VOJA 1V5IA 1TLTA 4OP1A 1JHUA 1ZZEA 3OLXA 4LZPA 4MDHA 4YRMA 2XAUA 1YHNA 5FI3A 3VNBA 3K8OE 1VMKA 1WD5A 3O75A 3DHYA 1PVOA 1TZMA 2WNIA 5BT9A 3VU9A 1FSFA 1PT5A 1RZUA 2BL4A 1BWRA 2R7NA 4M1OA 2IHYA 3NONA 1XDDA 4EGJA 4Q4DA 2V8BA 3BWYA 2VTVA 1V1RB 3DLTA 2HMYB 3OTHA 4L15A 4N12A 1ZINA 121PA 3OQVA 4IEIA 5DASA 1SPBS 3MYRA 2FQQA 3PDWA 4YP1A 2Q50A 2NT3A 3URKA 1WSBA 3DNFA 2LTAA 4OIFA 2ZUSA 3MJVA 2VN8A 3S1AA 3FKJA 2EX0A 1TM2A 5K0TA 2VCEA 4ESEA 4GR4A 2HWYA 3NOQA 4I2NA 3U17A 3K0KA 3N2KB 5LXTA 4LECA 3PNMA 2RFLA 4IIJA 5BV2P 2WTAA 3BX1A 3N0XA 2XYRA 3GR6A 5CVVA 4KQ6A 3X2FA 3EXHB 1MZVA 2VHWA 3C3WA 3JQRA 1BHQ1 1Q3HA 2XPCA 3NALA 3QOFA 4PHCA 4QASA 4RZUA 4DM7A 4AY3A 5MGNA 2V4UA 1G3IA 1IQUA 2A5DA 3II6X 2QTGA 3ESCA 4YCJA 4JEMA 3WNCA 3TUZC 2IOQA 4D7AA 5CK5A 1P4GA 4P0PB 3F3KA 3R2JA 2XE6A 1CRZA 3AY3A 4F72A 1OFVA 5KTYA 2AC4A 2IFTA 2XOKA 1JFFB 1GKKA 3I9LA 4JC4A 4NMHA 4RD4A 4GYKA 3CLKA 1PCXA 2DBVO 4FILA 3B3AA 4PLVA 5IMSA 1DKRA 3NDBB 2ISSD 2AJBA 4I1IA 4PAOA 3GF4A 1JHMA 4E07A 5BYKA 2QRKA 1MW8X 4UTRA 2F8TA 4LY6A 2G9UA 4UZSA 2A57A 4YJ2B 1EGMB 4RKYA 1VHDA 2C7VA 4G89A 4QDTA 1NL3A 4YJKA 1F7UA 2JLWA 1UDAA 1Z6ZA 1QANA 1G4HA 3PPXA 3SBDA 5C5IA 3GN1A 2XXAB 3NASA 1ZW1A 3SBOA 4NSNA 1DRKA 1VL0A 4C0AC 3U9SA 2I55A 1I4LD 4NNOA 2UAGA 5EHQA 4W7SA 5B53A 3WRXA 1RRPA 2QDKA 1P3DA 1DMRA 3KOOA 5FNVA 1U2DC 2Y1GA 1DC4A 3DBRA 4XM1A 4EKEA 3A1TA 3AF2A 4JJ8A 3JVDA 3NVAA 4A82A 4P35A 2EXXA 1NKTA 4F3RA 1JEYA 4LRWA 2HA3A 5IDWA 1MA3A 3H3XA 5CLLA 3Q8LA 4F06A 2C9BA 4F1JA 5JS8A 2QTVA 3MGAA 4D9FA 2IBSA 2KLHA 1UBRS 2CBXA 3FDFA 3IJEB 4YACA 5T57A 1PS9A 3UYKA 3FNQA 5KOHB 1XD8A 3RS8A 1LBQA 3DDNA 2ZSHA 4J3FA 4CYMA 1ADGA 5IC6A 3CN7A 3T3PB 4ASUA 3QRWA 1NVDA 1NLFA 1HDGO 3FCUB 4B5KA 4E5YA 3T4PA 3MWGA 2VUIB 4JOQA 2J0QA 4EDHA 2JI4A 2BMEA 4TWIA 3PUXA 3PUYA 3KB2A 4KQJA 1CTQA 3EBLA 4QDOA 2KI5A 4TN5A 4ZC1A 1U5CA 1GP2A 4BLWA 1JJBA 1Z22A 4GKJB 1CY0A 3H5WA 4I0WB 1X86B 2DUNA 1HSZA 1JPVA 2GD2A 4KO2S 4N1AA 4EO7A 3TECE 1E6CA 3SMQA 1GWNA 3AF4A 3WGKA 3TPZA 3ESAA 4PLZA 3W90A 5KMGB 3HB0A 1UIMA 3M81A 3FTCA 2FXIA 5FXMA 3BORA 2GESA 4HVTA 1U9IA 3E9DA 3B1ZA 1NHGA 1E3LA 1NBIA 1UDRA 1Z12A 2BMWA 4PCLA 4ZEWA 5L4LA 1CVLA 3W9YA 1J8MF 5LFAA 1Q0TA 3N28A 4YV7A 1W7AA 1V11B 5B6JA 3SF0A 1XCBA 5THQA 4C7JA 1RLMA 3WAJA 2JI7A 2WJZB 1DG3A 4Q15A 1PR0A 2GEKA 4NDZA 3I6IA 4KDCA 1CE8A 3CHYA 2ZB3A 3GOHA 3GJ5A 1YB7A 1UFRA 1JWBB 1DQRA 3K0FB 3KB8A 4FWBA 1I36A 4MYCA 5TF0A 5DVZA 3PA6A 5I4BA 3BBPA 1VLZA 1BJKA 4RPHA 4FNOA 3KOUA 1WU7A 3BAFA 4HFMA 4UZFA 1C30B 1JE0A 1X94A 1FYXA 4O08A 4O1MA 4X93A 1FP4B 4WE3A 4BQQA 2XCQA 3ZXUB 5T6MA 2WZDA 2ISQA 1QTNA 2Z1MA 2A30A 4LOIA 3FNHA 1DPFA 1K27A 2NSDA 2CLSA 4YAWA 1GRRA 3TFWA 4E0BA 5I3CA 4FWTA 3EVGA 4P4TA 4CM9D 1VMEA 1EBFA 1CUBA 1PJSA 3AHFA 1JFRA 1OZFA 2GHQA 3INYA 5DCYA 5DIZA 4NZYA 3EZ2A 2GWHA 2C77A 2EERA 2QTZA 4MR9B 3W1VA 4QU0A 2P2SA 4YT2A 2H29A 1IUPA 1L4YA 1S7GA 1RYFA 1I6MA 1H6BA 2H4YA 3GQBA 4CM4B 5JVDF 1RYZA 1UEIA 1PJAA 2XQVA 3VKUA 3VSAA 1LB1B 4MUXA 1VJDA 2BKUA 3DKVA 4D0LB 3SR4A 2GF9A 2B5VA 4TYPA 1OBFO 2VAVA 3FHLA 3QOWA 3AF3A 3VTAA 1FLNA 1Q1BA 1Z0DA 4UCWA 2G1PA 3UAWA 4C7KA 4C87A 2CVHA 4QBKA 4EAAA 5EIOA 2QR3A 3N2KA 3ZQ4A 5CDGA 1T6NA 2FPPA 2EW2A 4PSVA 1JDZA 4EPWA 4HP8A 1JG7A 4BS9A 4QT0A 3X1WA 2C8KA 3BE5A 4L2IA 1KJ9A 1RPJA 4DBLC 3EAQA 1VCIA 2LCFA 3ZV5A 1T15A 2HCJB 2VDWA 1HFEL 5HOQA 2FRVA 2FZKA 3N39C 2Y1DA 3PL5A 3ACBA 3L43A 5L45A 5LDDC 3P5SA 1V25A 3LCUA 4I6JA 5AW4A 1OXKB 4EGQA 2BGRA 3NATA 4FIDA 3SIPA 1FIUA 3HKCB 4YJFA 5C8YB 5EA2A 3ONDA 1MEOA 4NV0A 1ZK3A 2NXJA 4X1IA 1YAHA 2JS7A 2H5IA 4RJLA 3RTCA 4C2UA 2D1YA 2R68A 2B35A 2D8AA 1TMOA 2RIRA 3N6XA 4YB8A 3UGKA 3TVYA 1YMVA 4UNSA 1Z5WA 1JR2A 2GD6A 2OVFA 2N47A 3PPIA 4Z9BA 4YUWA 1EIWA 3OZDA 3PJRA 4DIUA 1KKLA 4DV0B 4BMOB 3HDJA 3RYTC 3AINA 5G0VA 3NBAA 2VNAA 4OHUA 5MGBA 5EWMA 4QIHA 5T67A 3D8NA 4H15A 2IUFA 3ICQB 4K6OA 1BKSB 1MD9A 5EE3A 3H11A 1OYOA 5F7XA 4MCIA 1OBOA 4U7GA 1IONA 3RAPR 1VYUA 4JYPA 4GXNA 3B12A 3QPUA 3WHLA 2PL5A 3DGEC 1Z5PA 2Y1XA 4HGPA 4RIFA 4WJKB 1YRBA 5JJBA 5KDDA 3HL4A 3LH5A 2XODA 3EUAA 3EJ6A 1XP5A 2Y76A 4I8DA 4I9GA 4PZDA 2C4MA 3T9CA 2B4QA 5GP1A 2GRJA 1D6SA 3T7JA 1Q1AA 3PVZA 2PFGA 3LUHA 4FZ3A 1E5DA 1OAOA 2QROA 2O2JA 3ND8A 1KH2A 2F1RA 4K8OA 3DXYA 1EX1A 2OCKA 3GVHA 4X6UA 5GY7A 4EJMA 4TV8B 2C2MA 4HEHA 4L4YA 5FR2A 2HA4A 4DVJA 1R4AA 4KXVA 1N2JA 3OZRA 4DDWA 4TVKA 2ZI4A 1XHEA 4ZKDA 3AEKB 3BXOA 3OJEA 4QOIA 3TD9A 2VNIA 3CRRA 4H7DA 5JLJA 1V9CA 5JVDB 1PRYA 5EWMB 4TROA 3FYDA 3C3JA 4DR5B 1U94A 2C20A 2BELA 1I3CA 3WS7A 1P7ZA 1YQEA 2NU9A 4GC5A 3WMGA 1NMEA 5DP1A 3DMFA 5B1SA 1MQ8B 2DYKA 3DPUA 1GR0A 5AUPB 4M8KA 4U2DA 5HR5A 1XF9A 2FWPA 4BQRA 2ANCA 2ADOA 4ZI7A 4J76A 4FOSA 4JI0B 2DTDA 3R9WA 2FG5A 4CMGA 5KYUA 5D3QA 1NXPA 1N2GA 4GI5A 3ZGLA 1RCTE 3QBEA 3MRXA 1U2TA 3S8EA 3PDIB 1Z35A 3WK8A 3T52A 2G72A 4D8WA 2DWCA 2EZ9A 5J2TA 2RSLA 5HF9A 5B6PA 3FB4A 1TKBA 2Y0PA 1HNZB 3L4BA 4QBTA 1Q44A 1SOMA 4P2BA 1UP4A 3GXOA 4H6XA 5AXDA 2HF8A 3MT8A 4M86A 3S2GA 5K0JA 4ND3A 2HC9A 4ACAA 4F1WA 1YR8A 1ZIOA 3L82B 1E2PA 2NU9B 3WKAA 1DZ3A 3FYUB 1Q91A 1RWMA 3OT1A 3BH6A 1UFVA 5D1HA 5D3MA 2BUAA 1WKCA 1V8PA 4KHZA 2YVQA 4P3XA 3G85A 5E6UA 1TA9A 4FHFA 2G9ZA 5T3YA 3VZRA 3AV0B 3THSA 3VNSA 1MORA 2FG6C 3T1QA 5E9WA 2WVJA 4ENTA 4YCMA 1K97A 3NHJA 3PYXA 1ZCBA 4FYMA 4JYCA 5DLQC 5J5CA 5SZIA 1L5NA 3HJTA 2C4UA 3CEAA 1X7HA 4BGUA 4OXQA 4ZRNA 5F4BA 1G60A 4J94A 4YP0A 3KKOA 4D92A 4Q82A 2JIZD 1VCOA 2IVFA 4MVJH 3R7DA 3LJKA 3RRXA 4OD0A 1JSRA 2XVMA 2GJ4A 4MVJD 3U3KA 1WXXA 5FPPA 2GVNA 4KPGA 3TSOA 2HKIA 2BGUA 2WMYA 4LXGA 1M2FA 1QHNA 4OXRA 2E0IA 4M1WA 4UDNA 4BFLA 1B6SA 1DDIA 1USWA 2DU8A 4GGOA 1HDIA 3RUIA 3TBFA 1TT7A 4Q7LA 4HMQA 4XR9A 1JFLA 3EGOA 1Q84A 2AW5A 2I7TA 4GSLA 3ZHZA 2B25A 4M21A 1NR5A 3VXKA 2O5CA 1VKZA 3R77A 3OCYA 4IJ5A 5DM0A 5KIAA 4MVJE 5FL3A 1Y8QA 3HWWA 3KM0A 2Q0HA 3FLMA 3LKDA 4IQ4A 2VK1A 5G0SA 5LA6B 3OU2A 3O3NB 2JIZA 4ZAVA 3IQWA 4AULA 3IAEA 2ZBPA 1DB3A 2B94A 2C3UA 3G2OA 1WSDA 4R0MA 8ABPA 4Y2JA 1ZI9A 4JROA 1MR3F 3IPAA 1BXGA 1CZOA 2VZEA 3FWKA 3LHDA 3EJWA 4OJTA 5AKYA 3VTZA 1PHPA 4CQLB 1F4VA 4RTQA 1R7RA 1RJEA 5K3BA 4YV2A 1FLAA 3BIXA 3DJYA 3RUAA 1L7NA 3GLFE 1X8XA 2CGEA 4BQFA 2FMFA 4URYR 4H08A 2C2YA 4R9NA 3KFXA 2ENWA 4TTIA 5E8RA 1LLCA 2YN4A 5FUWA 4A8JB 1IBMB 3ITNA 3OZTA 5FP0A 2PFSA 4OLJA 1PKXA 2QN6A 4CU2A 4GOJA 3DC2A 3X1XA 4IWYA 1Y3BE 3URMA 1SELA 4DV1B 3I73A 3F67A 4LNUA 4M0CA 1EK6A 4BGVA 4KQFA 4MOWA 1Z7YA 5A1JA 3HB9A 1YDGA 4LBWA 1V0JA 1VHWA 3EXG2 4WJLA 1ULTA 2ZITA 4FR2A 4Y6QA 4D6YA 3GUYA 1CRPA 4RA9A 1JHOA 2LZ0A 1ECPA 2YBDA 3Q1LA 3HM9A 1M1NB 1QORA 3KPVA 4HVAA 4L85A 3U7HB 4KIWA 4EG0A 1J21A 3EQ7A 3CLUD 4EHKA 2ZQYA 1E1QA 3RSFA 3L4JA 1DWPA 1OILA 4F56A 4IH9A 2NPOA 1ZK2A 5AVKA 2JJ2A 3T35A 2VP0A 4CQMB 3H1TA 3N2ZB 1PZHA 4ND4A 3AJDA 1Y1PA 4I66A 3F3MA 2BD0A 1QFSA 2O4UX 4LTMA 3VR0A 3QYFA 2D1FA 1J06A 3DVAB 4AJJA 3QKRA 2WYHA 2D7CA 2QL5A 2AZ4A 1FFBA 1VJRA 2HWXA 3U7JA 1W9HA 3LECA 2O50A 4AZ3B 4EJSC 1RWVA 2NU8A 3UN1A 5JSUA 3O8BA 1EAMA 2YW9A 3EA0A 4BP8A 2VUUA 1PGQA 4EB6A 1QAQA 13PKA 1ZPDA 4Q9HA 1DCTA 1M2GA 3G0BA 5JISA 2MSKA 3NHFA 2X8JA 4Q00A 2GAOA 4JVOA 5AKHA 3BZWA 5JAOA 1L4FA 3FWZA 5KKAA 5AW9A 1RI5A 2G3YA 2VLBA 4NBKA 2HK8A 4I08A 1NXSA 3VA7A 2N1BA 3AB7A 1VHQA 4M8SA 4UU1A 3ZVLA 4F12A 4IIYA 4Q1EA 1YS9A 2MINA 4FKBA 4QJBA 4QVKA 4CLRB 1FDUA 4KSYA 1RJGA 4LX8A 3QJ5A 4OHWA 3ZV3A 1ND5A 2VNHA 2YRFA 3CLTD 3DDUA 3QXHA 4FP9A 3F6YA