1X80B

Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
329
structure length
329
Chain Sequence
EYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-oxoisovalerate dehydrogenase alpha subunit
publication title Molecular mechanism for regulation of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase complex by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 125
structure length 329
sequence length 329
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x80B02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x80B01
3KOMA 1TRKA 1OLUA 4GPEA 3JU3A 5ERYA 4D5GA 3EXIA 2JI7A 2UZ1A 3AHFA 2BFCA 5AHKA 2Q29A 2R8OA 1V16A 1UMDA 2AG0A 1NI4B 2BEWA 2E6KA 1Q6ZA 4KXVA 3DVAA 2BFDA 5K3SA 4KXYA 1W85A 5HYVA 2G28A 1JSCA 2PGOA 3EXHA 2OZLA 4KGDA 1OLUB 3LPLA 2BFEB 3OOYA 4GG1A 1B0PA 4Q9DA 1OLXA 5FEMA 3DV0A 2UZ1B 2BFCB 1PO7A 3LQ2A 1X7WB 3MOSA 1ZPDA 5HJEA 2EZ8A 1YHYA 1V16B 1PVDA 1UMDB 2O1XA 1QPBA 4KXXA 1X7XA 3F6BX 3HWWA 2W93A 1NGSA 1ITZA 1UMCA 1WCIA 3DUFB 2JGDA 2PDAA 3DVAB 2BFDB 4K9KA 2JIBA 1BFDA 1U5BB 2UZAA 3IAFA 3EXHB 4MQ5A 1W88B 2EZUA 2EZ4A 3AHIA 1OLXB 3AHGA 3DV0B 1YNOA 2BEUB 1V1MA 5K6TA 3EXHC 1NI4A 4JD5A 5IMSA 2JLCA 2BFBB 4COKA 1Z8NA 2C31A 1X7XB 1YI1A 1YD7A 1OLSA 1PYDA 4JUCA 4RJKA 2C3OA 5EJ6A 1UMCB 1WCIB 2JGDB 1DTWB 4JUAA 2BFEA 2XT9A 5HHTA 1X80A 2WVAA 2FWNA 5DEIA 2QTCA 1T9BA 1TKAA 5EJ8A 2VBGA 3EXG2 2BFFA 1V5FA 1GPUA 4JUBA 3M7IA 4JU9A 1X7WA 2O1SA 2WVGA 4K9OA 4WBXC 3M6LA 1UPCA 4MZXA 1V1RB 5EJAA 1V1MB 3LQ1A 2AG1A 1R9JA 2QTAA 1T9CA 1UM9A 2Q5OA 3EA4A 3EY9A 3DUFA 2JI9A 5I5EA 5EJ5A 3L84A 1U5BA 1OLSB 4GP9A 4K9LA 3EXG1 1W88A 1POXA 3HWX1 1QGDA 4GM4A 1X80B 3ZHSA 1PI3A 4XEUA 2X7JA 2BFFB 4C7VA 5K6RA 2R8PA 2BEUA 2Q27A 4JU8A 1X7ZA 3E9YA 1OZGA 1QS0B 4K9NA 2BFBA 1OZHA 1IK6A 2BEVA 3OE1A 1YI0A 3EYAA 2YICA 2C3MA 1UPAA 2VK4A 5DGDA 1UM9B 2JI6A 1DTWA 1MCZA 4QQ8A 3M34A 4QELA 2NXWA 1TKBA 2IHUA 2IHVA 3AHHA 3FSJX 2YIDA 1V5GA 3UK1A 5EXDA 1OZFA 2XTAA 3ZHRA 3F6EX 4FEGA 1V1RA 2XT6A 3HYLA 3LQ4A 2VJYA 1X7ZB 3D7KA 3AI7A 4FEEA 5K2OA 2BEVB 2DJIA 2C42A 2Y0PA 5I51A 1UPBA 4RJJA 1UMBB 4D5EA 3UPTA 3AHJA 4KXUA 5ESDA 2Q5JA 1KEKA 1QS0A 2BP7A 1X7YB 5EJ4A 3EXEA 2Q28A 1T9AA 3FZNA 1OVMA 2EZ9A 5DGTA 3ZHQA 4C7XA 5EJ7A 5C4IA 2VBIA 2VBFA 4K9PA 5ERXA 1RP7A 3IAEA 3M49A 3AHEA 4GM1A 1POWA 4MPRA 4GM0A 3AHDA 2IHTA 1YHZA 2FN3A 2WVHA 1V11B 2C3UA 3ZHVA 5EJMA 3ZHTA 2BP7B 2VK8A 4ZP1A 3EXEB 2Q5QA 2PANA 2R5NA 3EXIB 5I5GA 1N0HA 2G67A 1UMBA 4MPJA 1Y9DA 3EXFA 1AY0A 3AHCA 2J9FA 2BEWB 4JUFA 1X7YA 4K9MA 4K9QA 3RIMA 4KXWA 1W85B 1T9DA 2Q5LA 2C3YA 1TKCA 2VK1A 4JUDX 3FLMA 1V5EA 2OZLB 2V3WA 2IEAA 3ZHUA 5HGXA 4MPPA 2JLAA 5EJ9A 5I4IA 2G25A 3EXFB 5EXEA 1L8AA 2EZTA 2JI8A 2C3PA 2J9FB 1YBHA 4RJIA 1V11A 2PGNA 4QPZA
chains in the Genus database with same CATH superfamily
3GJ4A 3NHMA 2WHXA 1JAXA 1A7AA 4WINA 1THTA 4QDZA 1UJ5A 4KQ6A 1LJ8A 1HYGA 1KYIA 1G20B 3L1KA 2O4UX 2PKYX 4HVAA 5DSZA 3CUWA 3PV0A 3ZK9A 3LBIA 1QANA 3TRFA 5CVCA 3GDWA 2D6FA 1PT5A 4MRVA 4PQEA 4QIHA 3K8OE 1RT9A 4N7RA 1XRJA 1KKUA 1U2QA 4JSYA 3LUHA 4L73A 4C4XA 3CXUA 2GK4A 3IAM1 4H7IA 4IIEA 5ILOA 2PWPA 4DQKA 2BMFA 2G0AA 4P98A 4YC7A 1ZIOA 3DDHA 3WP1B 4Z1OA 1OX5A 2DT5A 2JH8A 4EW3A 1OXKB 3KCNA 2B5VA 1BS9A 5CX4A 2CBZA 3PGLA 4K6CA 1Q0SA 3LGXA 1KE1A 3VJKA 3WIUA 4GKKB 3AT1A 3T9BA 8MHTA 5IVPA 4HHEA 1N6PA 3T5AA 4HRYA 1PK8A 1Q12A 1IJKA 3VX3A 1PFWA 4DWOA 1BA2A 3T7SA 3S2FA 3GA5A 1ZRHA 1Z5OA 1SU6A 5AMXA 3MD0A 5GJVC 3ZX5A 3IDSA 5EHNA 1PEDA 3GRCA 3Q8WA 4QICA 3RJ5A 4RACA 5JNTA 2BSQA 3GBPA 3ZDCA 2WKPA 3OE7D 3EIXA 3QFFA 3RYTC 1XRPA 4LYYA 5JD6A 4KXYA 3K7EA 3MJDA 2UYYA 2FWIA 4OHXA 4OUDB 3RC9A 3VU8A 3WK7A 2YJTD 3NBMA 3C8HA 3OOEA 3QMVA 4JOSA 3O31A 1P1IA 1U8TA 4H4DA 4OH1A 5AO9A 4DXDA 1MPXA 1YGYA 4CLXA 4EKGA 2Q3CA 2WPNA 4CKEB 2GARA 3D02A 3UJNA 1VE1A 1YUMA 2IYPA 3H2HA 3NYQA 3ZI7A 1R6BX 3FCXA 2GAFA 5DWVA 4EJSB 2WJIA 1AG9A 3IXMA 3ESBA 4KACA 1FQWA 4FK8A 4KVAA 4N18A 3TG8A 1X0VA 4QOJA 1JW9B 5GINE 2DWQA 4WY8A 1R8JA 1NRIA 3DV0A 4N47A 2KI5A 1K7FB 1AOXA 3QXSA 4OXNA 4P4SA 3TVYA 3WDMA 1NRXA 1PFGA 3NGMA 3SHQA 2CFTA 3BZBA 3QPCA 4Q1VA 2P4EA 1DKQA 3ETGA 2ZREA 1ZCJA 2RBGA 1WXQA 2IYAA 3GPCA 1BXZA 4AJNA 1NXOA 3GT7A 3IEMA 5KNCD 2CMDA 2X4LA 2Q6KA 3FTCA 1ZBDA 1H1DA 1DJOA 4GUDA 1EQUA 3U44B 2H11A 3GZNA 1UMDB 3RRFA 1VLLA 2I7CA 2I8CA 1M34E 5CT8A 2ODQA 3D9QX 3UT5A 5SZKB 4QYMA 4EY3A 1Y98A 1XAGA 5BOSB 3X1WA 1QQTA 2V7PA 3AERA 4X7MA 3TXYA 1FVXA 3UHFA 1DGQA 1VYUA 4ZT7A 4E12A 1JDTA 4R31A 3FOWA 1F8UA 3ORHA 4UDNA 3O84A 4EJ2A 1CYEA 4BU1A 4IDNA 2E7ZA 1SY7A 4G2TA 3LLUA 3SWWA 1AT1A 3TXXA 2C95A 3RK4A 4WN9A 1H6AA 1P29A 4BQRA 1FMTA 4ZYXA 2JZCA 2B7CA 2NU8A 4MIOA 2NT3A 2R86A 2ZIVB 3IBSA 5K1ZA 2HQOA 4BTEA 3DP7A 3ZK8A 4X92A 2FX3A 3DE0X 3P0JA 2O0HA 1K4MA 2QSJA 5AW1A 5DNDA 3NGXA 3IEXA 3CVOA 1BH6A 3LPMA 1BE1A 2XA9A 4QTXA 4XQ9A 3WL4A 3NBZC 1I2ZA 2FQ1A 4A7PA 5I7EA 2FP4B 4G9BA 4I66A 2FZGA 2OHXA 5AUPB 1SVLA 2OD9A 2YVUA 4ZXFA 2AG5A 5AW6A 3GOHA 2EHDA 2Y9MB 3O91A 4JD5A 5DHPA 4ZV9A 4L16A 5C1PA 5IWAB 4FCCA 3CB4A 3AEKB 4OAPA 1SVWA 3EVTA 1N6KA 2BFBB 1I01A 2JS7A 3VSCA 3NRBA 4F5DA 4OMDA 4H17A 5A6SA 5CVTA 5H4GA 2AC2A 1QV7A 1RWKA 2FCAA 1T1RA 4M46A 3Q9SA 4LSMA 2H7CA 4UNQA 4F97A 2NXCA 1UP6A 3HCRA 4IIUA 4OJNA 3SK0A 5JSUA 2EWVA 1RS0A 4AJOA 4D9HA 2A5DA 1WCIB 2JGDB 4BFUA 3L7AA 4GWKA 5A3QA 3CLRD 4IQ0A 1JPUA 5CPFA 1VLMA 1X80A 3MYYA 4TS1A 5F5XA 4Z7QB 1MGPA 2D1YA 2PLFA 2RHLA 4LHZA 2MCFA 1PJBA 4JZKA 3KJFA 1GLVA 3WSVA 3OKCA 4L07A 1I2CA 4LXIA 4UAGA 4F8JA 1FFSA 1VMKA 1ZD2P 5KYXB 3T41A 2ZT8A 3IPLA 3U1VA 1E1LA 3H1EA 5BQ5A 4MO9A 4JROA 4AS3A 2I8AA 1NVXQ 2JK0A 3OECA 5EQFA 3ZCVA 1CZOA 3RBVA 3LZDA 1QIEA 1TMGE 3PR1A 3EN0A 4DZRA 3AUFA 3FYDA 1UPCA 1C7JA 1PF7E 3V4ZA 4TKUB 1QZ3A 1C1DB 2DH6A 2ZEJA 4R2XA 5D1NA 4MZXA 5EVJA 4BV9A 3MQ4A 1MEOA 1JF8A 5CEEA 4KR7A 1YNSA 1EK0A 5CAEB 3IHWA 2DBQA 1F12A 2AG1A 3I5UA 4ZT6A 3USES 5BWLA 4D96A 1QYDA 1FC0A 1JG4A 2H92A 1RKXA 4YRBA 2EL7A 4G0ZA 2H2AA 3RWOA 4HN2A 3MMSA 3HP7A 3PRHA 2O7NA 4I50A 4TUYF 3RVQA 4BMCA 4G81A 5DGCA 3EGXB 1R9MA 4DUGD 1Q7EA 1WW2A 3MZ0A 1AO3A 3O73A 1X7HA 4GZLA 1FYXA 1CYDA 4OK5A 4Q1EA 5LVAA 3P9NA 4M1TA 4OFWA 4O6VA 2GM9A 4PE5B 3RV4A 5BVHA 1EGQA 4LWPA 3HBLA 3VHLB 5J2UA 1WCWA 1DOAA 2QUAA 3MG9A 1PBNA 4NBNA 3HK2A 4OIFA 1XA4A 4LXXA 3U81A 1U8XX 5HPYB 4EH1A 1IWBB 2G63A 4P32A 3KYIB 1KVRA 5AK0A 4ZOCA 2D5LA 1NSTA 2C2ZA 2TSYB 4QUJA 2A9VA 3KR9A 1DOHA 2AN1A 3I45A 3O7WA 3OJOA 4IJQA 3SQOA 3U5TA 5TS3A 4HI0E 1EVQA 4GO1A 3SR3A 4C7VA 1KXZA 2WG2A 2V7GA 2AI3A 3GN1A 2DU8A 5DMXA 3ISJA 1UQTA 1SZCA 3JQGB 3UK6A 3WISA 2FXIA 2CHVA 2ZBFA 4RL4A 4N0EA 3R7NA 1VE9A 2OM6A 2X2PA 3WICA 4EMBA 4G5SA 1AQYA 1R9GA 1SVUA 4JODA 5ES3A 3TEFA 4IGAA 4BMVA 1TUEA 5L3SA 1K3FA 3OFVA 1P6UA 1T6ZA 2Y1WA 3L7JA 5L4NA 3IXQA 1UPAA 3RWMB 1ADYA 1P9RA 4P36A 5UKDA 5LA6A 2ZRHA 1GPAA 1T1GA 3GMSA 4AJ4A 4U6SA 4Y2SA 2WIBA 1KMHA 4INPA 1MZPA 3O9MA 5DX1A 4RTMA 2WLTA 1ZN8A 1T2UA 4UNIA 1GLNA 2FSFA 3OOJA 4OSOA 2UUOA 2OEPA 2XF2A 3VKVA 3UJ7A 5BRAA 5DBEX 5ITSA 4I1YA 2WJ6A 3FPEA 1YB7A 4URVR 4UCQA 3RJ9A 4HJXA 4CL0A 1M10A 3WZLA 3GAZA 3JAWB 5ARDA 2XVYA 3DMTC 3LC1O 4N41A 1NR5A 4NMLA 3FSJX 4ZOLA 2QN7A 2COEA 4YDSA 5D1HA 2WFAA 4BGEA 4HX2A 3WL6A 5KUTA 5DOZA 1D2EA 2LCFA 4XR9A 1ZWKA 5LQUA 5WRFA 1MNAA 4QLAA 3OE5A 1KQGA 2P5UA 1FFEA 2NZVG 4JEMA 3HUFA 4K8RB 3UWMA 5B5SA 1I2DA 2PIDA 3WLRA 4C21A 3X2SA 1PVVA 5KWVA 2GTIA 2QU7A 1S2NA 3BEDA 2MSCB 3EOAI 3R3ZA 4KTVE 3NMUF 4EPVA 2X19A 3PLRA 3KE9A 1EDOA 2ZIGA 4Y6SA 3VV3A 2Z9DA 4L15A 2H06A 2PWAA 4IZHA 4XWTA 2GFQA 3GGJA 2IYXA 2RHDA 3GRPA 3WB0A 4YMIA 2GKGA 3F0TA 4HGNA 3K6SB 2VHUA 1PG5A 1OVGA 4C20A 1NN5A 5JU6A 4F6RB 2O20A 1J0CA 2FMHA 3B9RA 3ZX4A 3AP2A 1QUFA 2V8BA 4EY7A 3EEIA 1FJHA 3MWJA 5I01A 4BLPA 4D02A 3D31A 3DB1A 4V03A 4MKFA 4FYHA 1NJGA 2JFBA 3TDMA 1W4BA 3TBKA 1UPBA 5I51A 1WDWB 1FFBA 3W5SA 1N9KA 1Z68A 1O54A 2IV7A 2HX1A 4CQMA 2CDRA 2KLBA 1Z83A 1K8XB 1R8XA 4HO1X 1QFSA 1WB4A 3BS4A 3PGJA 3U62A 3KOZA 3IVRA 4M9RA 4XYBA 3KSUA 2XNKA 3ELWA 5HR5A 3WAJA 1XB2A 5DT9A 1L8OA 5CB0A 2QOEA 3K8YA 3RHTA 3KZMA 5LQCA 2W5UA 1LPSA 3UHOA 5FPKA 5CT4A 5FULA 1M5UA 3BKXA 3EUWA 3M89A 3L6UA 2CW5A 4MQUA 4RKRA 2WABA 1J8YF 1U02A 2J1LA 3BN3A 4PZ9A 3ANTA 2HXSA 1OV6A 3DL7A 3WYCA 2GPAA 2WM3A 3PGMA 2P2ZA 4IIFA 1JFVA 3I34X 1BFUA 3D8HA 1WP9A 5JJ5A 1P5ZB 5DYIA 4Y2XA 5KBYA 4EEZA 3ICEA 5TGTA 2Z8YM 1W4LA 1KGSA 1F1BA 1JQAA 2IC5A 3DTNA 4W5RA 1NXXA 1N1DA 3IO3A 4UUQA 2DSNA 4W99A 1R6TA 4R5HA 4RJTA 4L72A 3R41A 4FBGA 3QLJA 3TZCA 4MMXB 3UXYA 3H11B 3P2EA 2FPXA 1NZFA 2YYYA 2ZYUX 1UWCA 3VOAA 1CZKA 3W7BA 3JD3A 1J0BA 1KC1A 3FCOA 3DHVA 5AVRA 3E5HA 3L7MA 2GM3A 3VU9B 4AO6A 1VKRA 1ZD4A 3GJSA 1Y6GA 2ZVDA 1XZJA 1KEUA 1U3TA 3AWDA 3HJBA 4GX1A 4ZI7B 1ZXXA 3OZSA 3VA7A 2CSXA 3DE3X 3JQCA 1JH9A 2ZYDA 3K0AA 3FCAA 1Y3BE 3N2GB 1RAIA 4ZT5A 1E96A 4XD7A 1QCYA 5AVJA 3W5BA 1KS9A 2V0NA 3KEGA 2C5SA 3ZCTA 1RC8A 5AQ1A 5GJBA 4PC2A 1FS5A 4GWLA 1JEQB 2QN2A 4QUIA 5G0VA 4ZCSA 4EG7A 4EGQA 5HKKD 4BNLA 2Z4SA 1V0JA 3EULA 4L9SA 1WPXA 3FWHA 4ODIA 5JNVA 4E3ZA 1WF3A 2NQTA 1J9EA 4M49A 2W7TA 4XX0A 3UFXA 4C2TA 2OHVA 4DGSA 4NEQA 3H7IA 2BP7B 2HWUA 3BHIA 3TOCA 4ETMA 1HYBA 1V45E 1IBLB 3K9HA 3T38A 2HA0A 1PQUA 4Z99A 4DSUA 1L4MA 1Z0SA 2NZWA 3O1JC 3O4JA 4L8FA 4RL6A 4NMWA 5DF1A 4ABYA 2JZOA 3TKYA 1BX1A 4AN1A 2ZB7A 3C45A 1DG1G 3ASZA 1QGED 4JLWA 3S1AA 4JHXA 1I2AA 3FMVA 3KBOA 2C2OA 2GLTA 4HTAA 5FD8A 1TQ2A 5A2GA 3SZGA 4E30A 2A7QA 1XD2A 2VF8A 2R8RA 5EXSA 2X22A 2BCEA 2ZBUA 2WD7A 4GPTA 5TR9A 2SBTA 4GEGA 4YP1A 3T5MA 4QNNA 3EG9B 1CVLA 3THXA 3ELBA 5K0CA 3ETEA 1ZDMA 3I1JA 3GUUA 3QNWA 4J2HA 1GNSA 3FGNA 2O2IA 3X1YA 2DWCA 1DEKA 4W9MC 3FTFA 3ERCA 1Y63A 3PL5A 3WFJA 1IUPA 1J33A 4C6TA 4AMGA 2GJKA 4RA9A 4MH0R 4BVAA 2W98A 5JEDA 1CLEA 1UANA 1RWXA 3TRIA 1QF9A 1GA6A 2B20A 2QUJA 1XHEA 2X9QA 4XVRA 2XWBF 2ZJFA 2YVLA 3BRQA 4H3KB 2ATCA 1FTYA 4UW9A 4GRDA 3WGNA 3A6PC 1VE6A 3CW8X 4HDQB 4RNDB 3ROKA 1U28C 2PR2A 2XOKA 3O8DA 1H8HD 3M4YA 4RH1A 2N42A 4Z4QA 2WFLB 1YZ3A 2ZQZA 2OZEA 2Q5EA 2GCPA 1GFIA 1V5EA 4CM8A 2OZLB 1RQNA 2F1OA 3Q2KA 4B1FA 1L9KA 1SKUA 3QYJA 4NICA 2V3WA 2GI4A 3SJBA 3DVQX 2AW3A 1MLDA 1XN4A 1E1DA 2G7ZA 2WQZA 3RYFB 3UJBA 3WO1A 1D5WA 1I6LA 4QDOA 1LVUA 4RK7A 3WB1A 1DB3A 2Z56A 3BRCA 4B3BA 4CM1A 4Y2QA 1KYZA 4GLBA 1Q19A 4S2EA 1LZLA 2ZXUA 5AVZA 3KQUA 3AF3A 2I4RA 4V2IA 5K8JB 1G3UA 4MUHA 4TYQA 4L4SA 1OH6A 2R8XA 4NP6A 1GL6A 5B4TA 2X15A 4WLFA 3L1UA 5YASA 4D2IA 1IN5A 1P75A 5EI5A 3OIGA 4AMVA 4RADA 4MUMA 5LJLA 1JA9A 1HLGA 1KPIA 4FI3C 1GA4A 1Y6RA 5TQ2A 1L7VC 5M04A 4YFYA 4ILEA 1PG0A 1CY8A 3AETB 1VB3A 5KU1A 3ZY5A 5IDYA 1I5RA 1YQTA 2DPLA 4BO0A 2AV6A 3OD1A 2NV6A 3PFNA 4KMOA 4CLRB 2PXXA 3H9QA 3HKBA 3KXIA 5FT9A 2IS1A 2XMCA 1J21A 1IZ0A 1BDMA 1K06A 1W4AA 2UUPA 1EMDA 1FXWA 1W1IA 1KJYA 2FN9A 1S7CA 3TTVA 1YDHA 2UUCB 1R0CA 4YLYA 3M4XA 1QB7A 4QUBA 5JS6A 3ADCA 1N3LA 2UDPA 3VVBA 5BUQA 3DYBA 4DQXA 4KMMA 4OQFA 5BSWA 4DKJA 1RR6A 3FI9A 4C22A 1XTKA 4LZLA 2BEJA 2EFJA 2YYSA 5SZJA 2VP3A 2FQWA 3W3AH 4DN6A 5JYEA 2CUKA 4R3WA 4A8JA 1FSPA 5IJ0B 5T4FA 1LTHR 2IXGA 5JT1A 3TUZC 4KFTA 1AMNA 2V4UA 4CM7A 3A4VA 2ZIXB 4U00A 4PLZA 1UDBA 1X1RA 2G1KA 3CV3A 4ZHQF 4R2KA 4R2WA 4UMDA 1JWAB 4OJKA 3W1WA 2QW1A 1OH8A 1JQJC 2RHHA 3D3QA 8LDHA 4HMOA 3ACCA 1RRCA 1RYNA 1VJTA 1QFZA 3CTMA 5IM5A 2OMKA 4HAOA 4IHJA 4ZEVA 3LPCA 2QL6A 1UBJS 4NKRA 3A58B 3TQCA 1K86A 4WOCA 2CBGA 2HMSA 2BF7A 2BEWA 1QTQA 1LFDB 2V45A 2YUIA 3I6QA 5IP5A 1TD1A 4XE5A 3GDGA 3Q7PA 5ITVA 3WNCA 3MCTA 1PJZA 1X9HA 2XB8A 1ZCZA 2Z95A 1ESDA 3KPYA 4HNQA 3D2LA 5HF5A 4AJIA 2I2WA 3W5DA 2XQKA 1N1GA 4FQ8A 1YZLA 4UXIA 3RAJA 2OFXA 3KHSA 5BVGB 1HEYA 4XD2A 4CKBB 4QM6A 1L8QA 4D80A 4J16C 1GUFA 1QH1A 5KVQA 2HHCA 3QQ5A 3D0KA 1FLVA 2OGSA 5KOHA 2J3EA 1H93A 3A7EA 4MV4A 1BDHA 4C7KA 3T3MB 1R9NA 4FFPA 3LP6A 4IKPA 4QJ4A 1OLUB 5KNBH 2XGMA 4DJJA 5EJ2A 2XMPA 5C2JB 3GJ8A 1ZCBA 4M0FA 1UC4B 2J3HA 3LW7A 3VKGA 1F2TA 2BFWA 2CHQA 4NBVA 4PGMA 4UEOA 1FYVA 4O4HA 3I5MA 4PZZA 4I4TB 1YI8A 4I2NA 4B7CA 4JBYA 1HE8B 3GEPA 3PFGA 1RHQA 2YBEA 3GCZA 3KX2A 3CN9A 4FZJA 5AHRA 5I9SA 3CE6A 3N0WA 4P22A 2H2HA 1GR0A 4S04A 1ZPDA 4EJSC 4MW7A 3GP8A 4P58A 4BNXA 2DG2A 1PW5A 2YV3A 3OQOA 1IQPA 1V8DA 1WMBA 3A2KA 1XIVA 2ONCA 5FXMA 1IDN1 3A1SA 1E6EA 2ZG6A 5ECWA 1DP4A 4DA8A 2VSOA 2A0UA 4XFDA 5E9WA 2PKXA 2C2YA 2EJTA 4QODA 3AV3A 1VPEA 1JSZA 2OZKA 1ENOA 4FLFA 4TVOA 2DQSA 5A1JA 3DJYA 4BEBA 4DCSA 4FNGA 5LUAA 4WOKA 3LH5A 1H65A 1M6WA 4WK2B 4US2R 3FFTA 3AR7A 2QD4A 1E2KA 2BVNA 3F7OA 4PG5A 4DJTA 4EK9A 1LC3A 1KI1A 1EIZA 2QM3A 3EXHB 4HLQB 3A2NA 4BO7A 3B9QA 2HDOA 1X1QA 2YWJA 2VYCA 4EPXA 4XYLA 1VHWA 2B1JA 5THKA 4AG3A 2CCKA 2C99A 3AOEC 3PEVA 3HKEB 4F91B 3K0KA 3BFJA 2J3MA 3GH1A 4CTNA 2WWGA 3AF0A 2BGTA 1S8OA 3FHTA 5BYBA 1OLXB 5EINA 4QDJA 1J2JA 5A7GA 2GCGA 3H75A 2RCYA 2M6KA 3C8DA 2R8YA 1JDZA 2GUWA 1L3CA 4HVCA 3OZVA 1ZOOA 2D4AA 3UW3A 1FOEB 4MWOA 4D6XA 2TRSB 2K2QB 3HR7A 3OWHA 1UBHS 1E7QA 4MZDA 3ZD9A 1WETA 4WUTA 4YP7A 4E13A 3CRNA 4EFLA 3MCAA 3ZDZB 2X5OA 1U7XA 1SIWA 2ZIWB 3K4PA 3QELA 3W8NA 2O59A 4EYGA 2XYPA 1NIJA 1OXMA 2L19A 4J7CA 5AK6A 1O9BA 3ANLA 3ZWQA 5FOTA 4RJKA 3U1TA 1TQ4A 4XDZA 4B6RA 5ISMA 1V41E 4B2YA 3WIVA 2FVXA 1KEEB 4FKMA 1MHTA 3I8OA 2FMFA 1M8KA 4IW3B 4GLJA 4JUAA 4P1ZA 3ZV5A 4BNJA 4YY3B 2QTRA 1E7YA 2FWNA 3SI7A 3VYWA 2REQA 5C7LO 2GEJA 2QTCA 1OI4A 3EZ6A 1WNFA 3LLCA 3FWNA 4X5OA 3QUAA 3L04A 4Q9KA 1CUFA 2FUKA 4HLNA 1Q22A 3DBHB 1LX6A 5FADA 1MJFA 3O8OA 2CLFB 2QR5A 3GMTA 5CYOA 3IVGA 1B42A 3FCUB 5IBQA 1AKVA 2BMJA 2C9MA 1U5AA 2VTKA 1ZSNA 2CT8A 2BGNA 3DKKA 1RAAA 5CVUA 1G66A 4AP9A 1GNLA 1NATA 3BZUA 1SIBE 1B6SA 3OZCA 4GE3A 4K9OA 5DRYA 1A4RA 1AHPA 4R1SA 4EFDA 4DMUB 3VI3B 2OVFA 2TECE 1A5ZA 3HB0A 1QZUA 1X94A 3MC1A 4M2LA 1I94B 1JR4A 3OCJA 3OQVA 1DEOA 1QUEA 2ES4A 3ITNA 3DTYA 3UWSA 5LOVB 3TSOA 4OHFA 3JCZA 1T9CA 1X1AA 2QTAA 4M9CA 3G1TA 5ES4B 4HUTA 5NULA 4E2WA 2P2NA 2SKCA 2JI9A 4MWBA 4TRJA 1V2HE 4BMOB 3EPHA 1M72A 4EKNB 4B47A 1ZMXA 5JCOA 2RE8A 1P18A 4DSZA 3VR3A 3DFKA 4B3IA 3D6MA 4JWKA 1IVNA 3OPXA 4CF4A 5LKAA 5EY5B 1XYVA 2GOYA 3FH0A 1EK5A 1L8LA 3GVXA 1NBIA 1EX6A 3LDGA 4V0RA 2ZSKA 1A7KA 2ISQA 5CVDA 4C5BA 3TVDA 1QYXA 2FUG6 4MINA 1EVIA 2F3UA 3W1EA 3C14C 4PYMA 5C8YB 1A1VA 1FW8A 2HJVA 4YT5A 1IEVA 2OV1A 2YCLA 1P2FA 1WM1A 1MT0A 3I2JA 2BLNA 2QUKA 1ODSA 4NY1A 3RYHB 3ZI0A 4JOCA 1T26A 1J0DA 3KM0A 1SIOA 1VKHA 5TLSA 4MW2A 4DM4A 1LLFA 3LT0A 3HFSA 1RZ3A 1Z7EA 5F21A 5TV2A 2OAGA 2EDAA 2H65A 4B76A 5HDQA 2X8WA 3BMQA 3E81A 4F85A 5FI3A 2YV5A 2WWVD 2QE7A 4B3XA 3BD8A 4GZ3A 1EU1A 4RW0A 3GFBA 3MCUA 3N59A 4L6IA 1MHPA 2P62A 3OA0A 1VG0B 3IBTA 2OHGA 3RFFA 1ZU4A 2QTMA 3EYAA 1NYRA 4FS8A 3LIPA 4ENWA 1WR8A 2ERXA 4YRNA 2VQ3A 4MV9A 2FSVA 4O0MA 2VK4A 4MQ6A 3BMNB 3CKLA 3JPYA 4YCDA 1T15A 4O1MA 3GARA 2UUAB 2XNSA 1YZVA 1Z4PX 2NNLD 3PUHA 3C3XA 4RY2A 2BZGA 4FKBA 4J9UE 4MP3A 4NCNA 4RK6A 5IEJA 2QBYB 3T4XA 1UXKA 1E4OA 1AHIA 2CEAA 2X1VA 1Z2AA 4G0NA 2CNNA 1K6XA 2FSIA 1TU4A 2QRLA 3MLEA 4G8DA 3UMGA 4ESEA 3ZV7A 4AMBA 2GBLA 3OFJA 4XRGA 1R0WA 4L7VA 3SS7X 3NIGB 5KQSA 3S8YA 1SBIA 3KHUA 3PJEA 4LRWA 3DH0A 3ANNA 3FM9A 2LIVA 2B37A 4JT9A 3BH6A 4CIVA 4DA4A 4CUJA 3HLYA 1K3TA 1KFEB 1MAWA 1PSDA 1RQXA 1SOWA 1Z4MA 2FR8C 3HKCA 2HRBA 1U9IA 3UK1A 2OGZA 4GOKA 3TQQA 2PUTA 1NMQA 4QASA 4DZTA 1CRWG 4HDMB 5D85A 5DTEA 4LBZA 1WSWA 3P9ZA 4AY3A 4WLEA 5BSVA 1GQ2A 3EDYA 1DBRA 1PQWA 3O26A 4JB8A 5EIHA 5EZ5A 1CR1A 4EVSA 1F8FA 3HDJA 3PPVA 4OQ4A 5ILGA 3TAUA 4AN4A 2PGIA 2VJYA 4IFIA 4EY4A 3CT6A 3RROA 4IJWA 4QO8A 3QE2A 121PA 1V8BA 1UM8A 4CQJA 1S01A 3IQEA 2VJDA 1HOTA 2XSZD 4KQIA 3AX6A 3MT8A 1H1LA 1TAGA 4PZYA 4TRRA 5EAIA 2PS1A 4J6FA 1LLDA 4B3DA 3DKRA 1VI6A 3AI3A 1HYEA 3P26A 5AKZA 3ZD8A 3PQ3A 3LRTA 1ZHOA 4K40A 2NZUG 1K66A 1CW2B 2AFIA 1PKEA 1TZKA 1EDBA 4TGLA 2V6JA 1JHXA 1E2GA 1YJQA 2IT1A 1OKKD 2O2GA 3OESA 3R5SA 4CGYA 1G3RA 2FQXA 3JQ9C 3NHZA 5B37A 4DNOA 1CJCA 1U2DC 3EMKA 5H8WA 1QBGA 3QVOA 5GIOE 1DIRA 1M83A 1PT8A 1E2PA 3IDFA 4FFSA 4DQLA 3DHYA 5K0ZA 4FYIA 1A5TA 1H2WA 4G1CA 4J4HA 3CINA 1ABEA 3IEIA 4HC4A 4H7EA 2PLNA 5I9LA 1LSSA 2ZJZA 2ZPUA 1EH5A 2CUZA 1PFVA 1HK7A 2HWKA 2XECA 3A1VA 3G7SA 4F4CA 5CYGA 4KXUA 4YRLA 4LZNA 4A1FA 3S7ZA 1J8VA 1CQIB 1H0SA 2WYUA 3ZC3A 2YY7A 3BTOA 2PE5A 2P78A 3NOQA 2D2IA 4Y2PA 3DV2A 1NQVA 3K9NA 5KMGB 5LQMA 2QYOA 3PUKA 5JJKA 3K53A 2R7NA 3LV8A 4G0YA 5KI6A 1X1DA 1PZFA 1SXJC 4LHSA 1E3MA 4JOBA 4W4TA 4LQDA 4WLVA 4ZEMA 4EHHA 1HDZA 2J5KA 2NZYA 2ZUDA 4EEXA 1A72A 5K8LA 3ESYA 4DRZA 2VZ9A 4GVPA 1NT4A 1B8VA 1F2UA 1Z63A 1V9LA 1FSZA 2APJA 2QAGA 3DUWA 2NYRA 1CETA 3H84A 4ZCPA 4F46A 1E2QA 1IOWA 3P9PA 4CMBA 5C8VA 4IG4A 5CDFE 4ZRNA 2OILA 3KKNA 3KEQA 2IRWA 3UA3A 2E4AA 4QLBA 4YIHA 2NZ8A 4J2TA 1V1JA 1IBSA 3VZQA 4RCZA 2KBEA 1ZGHA 4O25A 2AOVA 3IFSA 4JYPA 3L4JA 2O2DA 2I6QA 4CMJA 1X8XA 1O9GA 3DSRA 3VKUA 4MPRA 2Q9UA 1FLAA 1UK8A 2AF3C 1N6RA 3E7DA 1G5PA 1VG1A 2R8BA 3OCUA 2HU5A 3LCRA 4N3CA 3IQXA 4CV1A 2W37A 1Z13A 4ZPJA 1PZXA 4FFDA 1HO3A 2E4WA 2ZWMA 3BF8A 3DDWA 3OLVA 4Q3KA 4D8YA 4D99A 1M1NB 3OEHA 3PD1A 4YCAA 1EBBA 1T3HA 1Q1ZA 2O2YA 4BX2A 1ONPA 1F4PA 3A2LA 2MJLA 3EAQA 1GWNA 2IUYA 3MGBA 5F3DA 5LZ4A 1NMYA 5CMLA 1E1CA 5G40A 1UKVY 2R1TA 3EXEB 3M1IA 1K0FA 3SXPA 4LTDA 4X65B 2PANA 1CY2A 4H1UA 3CLSC 2B92A 3GR6A 3GRRA 4V0NA 1QIIA 3FPGA 421PA 1ATIA 1M1XB 3OLZA 2MU1A 4PNPA 4TYMA 1T9GR 3RUCA 3VR4H 5JMOA 3LUKA 3DMHA 4P3YA 1YRAA 3DQPA 1P73A 4I8IA 1SQ0A 3HYTA 3PDIA 5K6AA 5M3BA 4EMSA 1E9EA 1O03A 3QNMA 3LDHA 2PX4A 2R65A 4V3CA 2UZ0A 4GGPA 2YWRA 1ODJA 2DCMA 3FZYA 1XWIA 3E3LA 1EFCA 1VSBA 1JQDA 3MFYA 2REOA 3PNVA 4CTJA 3K70B 2J9GA 1IY0A 2PZKA 2W48A 1WRBA 4MLCA 1Z34A 2KLHA 3VPSA 2YZGA 3HV2A 4MKZA 1H2EA 3AM4A 3M4NA 3NXKA 1X7YA 1Y1SA 4UKDA 4CDGA 1E58A 4BBPA 3N8IA 4FWTA 3RUHA 4JKYA 5F9FA 2O0KA 4HADA 3TZKA 2YRFA 4JCOA 4ARBA 4D9EA 5TARA 1NE2A 3AF6A 2XBMA 3HEBA 4Q4DA 3DPIA 1J22A 2C5HA 3ADKA 1C50A 1L3IA 2ZRLA 3DT6A 2WFZA 5BMVB 4DJAA 2DBZA 4JUDX 3CA8A 3EIHA 1VGVA 4DS3A 1MGOA 2CKDA 2CZGA 4JJEA 2IEAA 5J43A 4TVKA 4G0PA 4D4JA 1ABFA 2HNKA 4RGBA 4I9UA 4Q19A 5AHWA 3TB4A 3U49A 1I51A 3BF7A 3HSSA 1EFTA 4K88A 4LC1A 4AJLA 2WDPA 5BN5A 5B2EA 2HK6A 5CTAA 1QE5A 2WJ4A 1RFGE 2PT6A 5F4ZA 4ZU1X 1JU9A 1LZKA 4R7GA 5TQ0A 3ZVKA 1BJTA 4MQEA 1K6MA 3DHWC 1G7CA 2JF0A 3RVSA 3IS3A 1NI5A 3LKZA 1TTQB 2QZJA 3VR5D 3INTA 2Z2YA 3AF2A 5KYNA 1CC1S 1NVUQ 4GUAA 3ZXXA 4MB6A 1DEAA 5G3ZA 2GXQA 3MERA 5KYYA 3JQAB 1T2NA 2EZTA 5SY6A 4HSGA 1ISSA 1I7QB 1YBHA 1J2UA 4BP1A 1R27A 5KSYA 4R84A 1RE1A 1OFGA 2SECE 2VNIA 4ASUD 4C0LA 2RD2A 3Q3VA 1PIWA 4B2IA 3DO8A 2L69A 5CFMA 1ZJ6A 3OHMA 1KOFA 1DAEA 2V9ZA 4LW8A 4JB3A 5JNUA 1UDAA 2A94A 2ZFUA 5A5DA 2C4HA 3OPYB 4RQUA 2VIIA 3CIFA 3I6ZA 1XQ1A 1M8GA 3EXIA 4RD0A 1KOJA 1VCIA 2H1SA 2AXNA 4WKNA 4B46A 3TZQA 621PA 5JS7A 1S02A 1AO0A 2YNMA 2R751 3I23A 4RVOA 4AU1A 2DT8A 2HK8A 3R75A 3KB6A 2ZUBA 4G5YA 2JRCA 4HUQB 2CYAA 3OTGA 1E6LA 4G65A 5TDHA 4ER6A 5KNCH 1AUXA 2V7TA 4B5LA 1XP8A 1MIHA 4DCUA 4ZYZA 1T9KA 2ZSJA 3GPDG 4JR0A 1NJFA 4IJMA 2VLBA 2XUZA 3FBWA 1II8B 4C7OB 3TNDA 2ONJA 4BLUA 3AP1A 4R9UC 4BMNA 1X8KA 2JIRA 3LL4A 2YW2A 3K15A 1NYQA 1V71A 3FLEA 3OQIB 4HPJB 4JWTA 3HZHA 5FA6A 1E6UA 1NM5C 1XXHE 3VC1A 4BX8A 3LP8A 5SY4A 1WVIA 2NU7A 1S3GA 1T1JA 1L5VA 1IQUA 3WL3A 2RGAA 3RVOA 3TSCA 4AL4A 4U2FA 5K45A 4WNAA 4D26A 2B5WA 4MX8A 3OHPA 4UARA 2FWBA 1QQ5A 2WU8A 5COBA 1RQRA 1RBYA 2BISA 3FMOB 3RRBA 5KTSA 4Q4AB 1Z4LA 3C6QA 3BJMA 4GR9A 2OAEA 1PN3A 3A11A 2GAOA 1B1CA 1VTKA 2H1RA 3PSAA 1YBMA 5A7HA 4C4AA 5JC1A 5E9JA 4CT4B 5DP2A 1M1YA 2WMOB 3LKBA 1G291 3SJZA 4UEKA 3FVRA 1RVV1 1SD1A 1T91A 2IQ5A 5FWAA 3JQ6A 2I54A 4IJVA 1NG9A 3C6KA 1X0XA 5BP7A 4EG1A 1DHRA 1N3IA 1T8RA 3EGOA 1OA1A 4EYSA 3ZKWA 4DAEA 1R0XA 3WLIA 4PLFA 1SCQA 2J0UB 2XTNA 1G0OA 2ZR9A 5JXJA 5JADA 3L8YA 2G36A 5IUNC 2OFOA 4CIWA 1U3FA 2F8SA 3DS8A 4WH0A 1TZ2A 4JFAA 3QLUA 4E32A 3LA8A 1CJTC 3V42A 3VDXA 1EUCA 1ZD9A 3CWQA 1YIDA 4MGHA 2YL2A 4X45A 2AOUA 2WU3A 2X0RA 4URUR 3G5LA 3IMFA 3GP3A 2ZGVA 4RETA 5DKFA 3TLJA 2DXIA 4F4FA 4HZUB 3U7JA 2RDMA 1QRUA 2IWRA 5B58C 1P72A 3FUCA 4HSEA 3BTSA 1C9JA 1Y7PA 2RH8A 2C9OA 4UNSA 2ZB4A 5GPBA 2FAXA 3DAYA 3MTEA 2GPNA 4RE6A 4QPCA 2AEMA 2AQIA 2XZOA 3TQSA 2ASVA 2EDCA 1Z36A 3UUWA 3ZXSA 2GZAA 4MEBA 4YJHA 3PKIA 5A2QA 2WWFA 4MQ5A 2OSBA 4CKCA 2DUNA 3H6GA 4ZI5A 1T9ZA 3E9CA 2FR0A 5CP8A 5ED4A 1R6DA 3D4BA 4MYRA 1Z39A 3WL5A 1I33A 1E59A 1SB9A 4LXTA 4XIYA 3UOAB 1OBFO 3TTSA 1T0UA 3KBBA 2FEOA 1I4EB 2E4UA 2PBRA 4PIPA 3DV0B 3I32A 3HSYA 2W4IA 4PAGA 1A9QA 4M55A 3BGIA 1W35A 1QHGA 1E3TA 2XMBA 3DPSA 4Y2HA 2PD3A 1XMOB 3EVDA 3EXHC 1ULAA 4A82A 3UMMA 1IHXA 2P5TB 4HBGA 1WW8A 2C9DA 1JH8A 2H52A 2V8OA 4Y0NA 2F64A 2IDMA 2RMKA 5EZ6B 1UCFA 2ZKIA 3EQZA 4GECA 4LZPA 4AY6A 4XD7D 5F4BA 1I5EA 2PQMA 5JR3A 3T35A 3ORQA 1QNFA 2ZSIA 3WYBA 5J23A 3WLLA 3IPYA 1B0AA 1O1YA 3N6VA 4KR9A 1IOLA 2FFJA 3P9IA 1CRZA 5H16A 2OGUA 2C3OA 2FUG1 2JBHA 4KE8A 3AERB 4LRYA 3K0FA 4R6WA 2ABWA 1CR6A 3L77A 3QIVA 4TL8A 3ZWMA 3N5KA 4UFPA 1P1BA 5F33A 3B70A 4ZEWA 1MXHA 2G70A 1R37A 5A02A 1ODTC 3B1WA 4I50F 4KWCA 5CBPA 5HHTA 1NNEA 2D3WA 2VT6A 3BFPA 1NF8A 1XEWY 1WKCA 4B6QA 4PN3A 4BN5A 4F38A 2CNKA 5LJIA 1GPUA 4OBWA 2RHGB 5HG0A 3RC3A 5J2UF 3DOCA 1E4EA 1FFAA 1MO2A 1N5DA 4WBSA 1QE3A 1MENA 1YQDA 3KTOA 1XZQA 1AZWA 1WY5A 3PPIA 4FHGA 4PIMA 4M7OA 4M8KA 2EW8A 4P2BA 2QLLA 3AVQA 3SMQA 2E89A 4C0WA 3B6KA 2A5LA 5JSYA 1WA5A 5LD2B 4FC6A 1N32B 4JL5A 4UZFA 3LQ1A 1PJRA 3VH2A 4GMXA 4JP2A 1JU4A 1YGPA 3C87A 3FDIA 1BU5A 4HWKA 3WRVA 4DCGA 3HXQA 1OC2A 4DNQA 3CUSA 3V8MA 1RKQA 4EGFA 3U6KA 1G2PA 4HGRA 1QX4A 2PZBA 4V2UA 4V1CI 4C14A 4DNXA 2CV1A 2P2YA 4PM4A 1LPMA 5I9BA 4K26A 1M2NA 1QZXA 2XAAA 4IEFB 1KR2A 2O7RA 1XDWA 1DX4A 5B2ZA 5A6SB 5MFPA 1GD1O 1FRVA 2YWBA 1W4CA 3CKMA 3NEPX 2QLNA 2JHAA 3BL6A 5U9CA 3FRJA 4WZBA 5IVDA 2V9CA 1YRHA 3VC7A 1RYHA 3FTNA 4CHTA 4F11A 4A92A 2GYYA 2F3PA 2BKAA 1B8OA 2VRWA 3IQFA 4UFNA 5M29A 4DR2B 1BN6A 1X80B 3D7MA 2G9UA 1LWOA 5FNVB 2O8BA 5E2AA 1KK1A 1MA3A 1ZH2A 3HCCA 3TI9A 4YYZA 4OREX 1JWLA 3I2IA 3GT3A 2HR1A 4A27A 2E4VA 1GEEA 1P0QA 2P9YA 3HJTA 4S1OA 1SUEA 3VNVA 3HZRA 1NR7A 5A4IS 4ZZ0A 1KDOA 4JU8A 4ARSA 1MC5A 6LDHA 4ZOLF 3QG1A 4C7BA 3T9FA 1KY2A 2R25B 3K5IA 4FQ5A 4Y2JA 1JJFA 1O96A 1JFTA 1P45A 1HXHA 4Z9FA 3S2YA 3MS2A 4KKVA 3SX4A 3T9DA 5FTNA 3E1SA 2QTBA 3AP3A 1XMJA 2WLSA 3NONA 4Q82A 2Q7XA 2AUTA 3GK3A 3ISVA 4BFSA 4EA8A 3W9YA 1J07A 3IQZA 4LV8B 2DH5A 3VHXA 1E3IA 5E95A 2X3UA 3ZPXA 3VC3A 2ARKA 1XNGA 1QLHA 4FYKA 3STHA 1IBKB 1TC1A 2CXHA 2EFCB 4I50B 1FQOA 4MP8A 4LJ6A 4AUNA 3I2FA 3F6CA 1H2YA 4O4JF 4X1IB 4MS4A 3R7DA 1IMOA 1KYTA 1I0IA 1W2WB 1SKQA 1P9OA 2G8NA 2AZ4A 5BVHB 4B7XA 4YPFA 3GH3A 2IHUA 1W47A 3DOHA 3UYKA 4HL6A 2PRYA 2CLSA 1K68A 2FRVA 4P7GA 3ROPA 3TD2A 2JFQA 2QT1A 1H4TA 4NFYA 3KOXA 4DLRA 1ZH0A 2WJZB 3K5HA 2VZ8A 2LP4Y 3HQ4O 4J3JA 5ALTA 3A3YA 5JVDA 3OLCX 4BYGA 3Q9NA 4I7EA 1N2CA 2LV8A 2P75A 2JGEA 1JJAA 1V7PC 4KI7A 1YJAA 4D9IA 4KBFA 2O50A 1UKYA 3KG2A 4H6PA 5EFZA 3MN1A 2Z04A 4R8KA 3GFRA 3C85A 3Q6MA 4JNKA 2ZE6A 2H4XA 3B2EA 2H08A 2QSUA 5I4BA 3JZAA 4EHKA 2A0YA 4I5DA 1IY2A 1ZA1A 1O3YA 1O95A 2XQGA 1QO7A 1NAIA 4R9NA 1OFUX 1WUYA 3AY6A 3CCCA 1O6CA 5F2OA 3TZHA 3W9BA 2B2XA 4DSTA 2B9VA 4QOIA 5GOZA 3MJSA 1UR5A 2A1TS 2HV9A 2UAGA 3Q5DA 4MROA 1XQ9A 3ZY6A 3GROA 1T25A 1EQ2A 3KFVA 4QAQA 3QVVA 4A91A 3ROEA 3C7KA 1Y9ZA 3DZKA 3TE7A 5LA6B 2CL0X 4N9WA 4UUOA 2QV0A 2IIBA 4GLLA 1KMHB 1SCUA 3BILA 2CHEA 5JDCC 4QPJC 1WWKA 4E08A 4UE3S 4U02A 5JDIA 1VIVA 1IM8A 1UT5A 2CNLA 2PZGA 5HRUA 2O2HA 3F8TA 1LWNA 2PUEA 3CLUD 5AW5A 5LB2A 1GU7A 3DEJA 3M70A 4N8DA 4FM9A 3W9UA 5FWYA 2FW1A 2VPXA 1NU6A 1P62B 2HU2A 2WT4A 4MVJD 2GQ0A 4UZSA 2Q45A 2VXBA 4FOOA 1WKVA 3DD5A 3ITDA 1UC5B 5E38A 3CF2A 1O87A 1K4YA 1BS2A 3A4NA 3GRFA 3L49A 1CUZA 4Z2YA 5JS2A 1ZVJA 3W2TA 1QS0A 3RYIA 1NF3A 1SUDA 3BRWD 1T9AA 2P9EA 4D3ZA 4EJ6A 3UGTA 2WV7A 1W6UA 1SXJD 4FSXA 4EW2A 2J85A 2WA1A 5AI6A 1NNI1 3DONA 5KU7A 1N78A 4ERXA 4DABA 1TCCA 1G8HA 1JG3A 4G1VA 2Q6VA 1VMIA 2ZP1A 3EARA 1PCXA 3QE3A 3V8RA 2QG4A 3G1UA 1X1EA 5TT1A 4RMJA 5HILA 1V39A 5BQXA 1MQAA 2VBFA 4EUNA 2DR0A 4J03A 1CEQA 3K8QA 4PBSA 4EX7A 1WUJS 2P4UA 1DFGA 3ET5A 2PA0A 2BFPA 3DE1X 3F8SA 1GUDA 1LBHA 1ODIA 2PJUA 3F78A 4YACA 3LE8A 2H5LA 1C0KA 2B0JA 3GLIE 1Y3IA 3W9SA 1MQ8B 4MDFA 2F8TA 3OIFA 5CT5A 4ECAA 4CQMB 2B0CA 1Q16A 3BBPA 1CS0B 4EPTA 4JBGA 2C2KA 3MWFA 4MJ3A 4ROSA 1A27A 1QC5A 2ZZNA 2DPHA 4BJ1A 5JFOA 3VHRA 4BJ5A 1RRKA 4C4OA 3HPQA 2PGAA 1VPLA 1I3MA 3DOOA 5B7QA 3SBEA 3WGHA 4K2HA 4D9MA 5ITZA 4GAEA 1W5BA 3FNFA 5G1NA 1FF9A 4BNHA 3N2YA 1ZK3A 2ZIAA 4PX5A 2A1UA 5EZQA 3BSYA 3W8FA 4BE9A 4OQZA 3BICA 4NAUA 1RIFA 4ZVNA 5IBCA 3HBNA 1ZM4A 1KHHA 1OAOA 3BIOA 4EG3A 3KTAA 2A0WA 4L5CA 1I0LA 4OXRA 4IICA 4TMKA 2BKUA 4ZZ2A 4EDFA 4CIYA 1E2DA 1A96A 1DJNA 3LWBA 2ZJBA 3UJPA 4ZDIA 5A4FS 4U2GA 3ASYA 5LYJF 3AIMA 1Z0IA 4YCJA 1R4NA 2IZ5A 2AMVA 4BP9A 1VCOA 1U63A 3R7LA 3JYLA 1XXLA 4RXMA 1SEPA 5IDWA 2CNBA 1O6FA 4Y9DA 5IBPA 3VYTB 4KR3A 3GEHA 5LDGA 4FMDF 4N0PA 5T6MA 1PSWA 4I6GA 2YDXA 1EA5A 3QKWA 4Z49A 2JJ8A 1FRZA 1JHPA 4JDPA 4G8JA 1ENPA 2B99A 4RZHA 4G41A 1P31A 2GO7A 1ZH6A 3JQ8B 3IE2A 1ZR4A 3FPSA 2PR7A 4OSEA 1E2UA 4DKXA 2FE1A 3LOUA 7ABPA 1AUOA 2HLDA 2RHBA 1ZRSA 3WJ7A 4OFZA 4OY3A 4F9TA 1AA6A 4E88A 1G8JA 1NJ1A 3EIUA 4X9XA 5FOVA 1YRYE 1IN8A 2D5IA 4PSAA 2J5QA 1E6MA 3LTEA 4UULA 4RDIA 5HXAA 2Q5LA 3IMCA 4V0QA 3SEQA 3VZSA 3H0EA 3MIIA 3T1NA 4NCIA 3UANA 3K2EA 4XX0B 5AVTA 2EGGA 2BI4A 4NBTA 3CO5A 1LI5A 3IURA 1L5YA 5EJ5A 1AUQA 4TTPA 1LA2A 5LPNA 2QVGA 2AQKA 5FA8A 1XXHB 5LLDA 1FXWF 1R66A 2PRSA 2W8ZA 4IMRA 3W4KA 4BBZA 5AOAA 1U0JA 5L53A 3ZHUA 4WY2A 3VR3D 3IIMA 2FTKE 5FIUA 3DAHA 2FH5B 2H5JA 3M9WA 4C7MA 5BQOA 2QRQA 4FS3A 1PS9A 4GMKA 3PUVA 5HE8A 3NT4A 1QGZA 4LVNA 1GVNB 4N5HX 4RE5A 3KKKA 1XYGA 3FD8A 2K4MA 2AT1A 3VZBA 2QRVA 1JV2B 3R6GA 4FLEA 3CY6A 2VCEA 4KRYA 2I29A 3TLEA 1M8JA 3GPIA 2EJVA 2XCTB 3OPQA 3OFNA 4OL0A 5BV0A 4HAUA 1KMMA 1YK0A 1NFRA 4RA9B 4KXNA 5C34B 2Q5CA 3V8VA 4QPZA 2PZFA 3U4QA 3JZMA 1GSHA 2C5EA 1J2RA 1RJFA 2QN6A 4KLZA 1SIUA 4ZN6A 2IS4A 3LT5A 1JFFA 1G8GA 3N2ZB 3GCXA 1E3SA 1KH2A 1YJ5A 3AJEA 3FR8A 1S2GA 2X8JA 4M1QA 5AJHA 4AUKA 4ER5A 2R4TA 1U0RA 4D5GA 2C82A 2BTEA 2FW6A 4JT8A 2CLEB 2R48A 2QHXA 3DAPA 2DR3A 5AXCA 1T4GA 3PTAA 3IRUA 5AI5A 3QMMA 3U4GA 3NHRA 4LJYA 3W5IA 3EBPA 3ZGNA 1SD2A 2ONYA 2QTVA 4TVBA 3D5TA 3U16A 2O8NA 4M1ZA 3PCXA 3PPXA 2RK3A 3NI2A 1Z75A 2EGHA 1GNTA 4LSZA 2IKQA 4QYSA 2IIQA 4PNEA 1YQWA 3G1WA 2VRCA 3G0GA 1EFRA 1DKNA 3MGAA 1IUNA 1E5QA 3I0MA 2JKYA 4P5EA 5JH7F 5JO0A 2ZYHA 4Q93A 3U9SA 4UQOA 1NUUA 4WJZA 1KRWA 2VHYA 2HSZA 4Z2AA 4BIIA 3E15A 1W2HA 4O4HF 4CMCA 2OXIA 1NSYA 1UXIA 5JWRA 1LS1A 5ADUS 1AHHA 3R3XA 4ZQBA 2GEVA 3KLOA 5IARA 3GAFA 1SURA 5KPDA 3WYDA 4HX5A 1T8WA 4Q03A 5TQ2B 4DDVA 5B3LA 4BYMA 1O8BA 1L1RA 2PRJA 4F84A 4YQFA 4MGYR 2ZUSA 1RW4A 1E3EA 4H0NA 4QA9A 1J0AA 3E5MA 4W82A 4XEUA 2CKMA 5JQGA 2PLRA 1C4KA 2WP8J 2H9AA 4DR5B 2HIMA 4B4WA 5JROA 1Q2UA 3B7GA 4RYLA 1YK1A 3T1HB 1JFLA 1RPAA 4N0MA 3WBJA 3F9RA 3LGSA 5DU2A 5CB4F 4KBGA 1B8UA 1Z6YA 3A04A 3PFKA 1NURA 3FUTA 1WBJB 4L0DA 4NYMQ 1P74A 3VNBA 3R5JA 1F8XA 1YRWA 5G0UA 5LBIA 3FGOA 3I6YA 3SHTA 4PY2A 1FRNA 3QXJA 1JBKA 1XEXA 1OBOA 3S28A 5AKKA 4A8JB 4I1PA 4U5XA 3NNDA 4B8YA 1J25A 5IAAA 1I6KA 2X9LA 2YJZA 2AZMA 2F1KA 3BQMB 3ZI4A 5KKCA 4HFRA 5LMNB 3REOA 3KKQA 1RACA 3D3JA 1NP3A 2ISCA 2QD3A 5H70A 1IAQA 4L8WB 1JPJA 3FKSA 1CZRA 1SBHA 1GPWB 4IHJB 1QZZA 1DADA 1RWNA 1XBTA 2Z6AA 4RTOA 3PXDA 2PS0A 3QWAA 1XEAA 4FBMA 4ZK6A 2FG6C 3QBVA 3G79A 1XK7A 4JYAB 1FFXA 1E3QA 3QYAA 4FE4A 3TOZA 2NZXA 2OM2A 1RLOA 2W6CX 5JLJA 5M7EA 4GR5A 3GFSA 3O83A 4QRHA 2J5BA 1KQFA 4NOJA 4RAOA 2IKSA 3CIOA 4YB8A 1U1FA 3C5WP 3IBGA 2PVSA 4QDKA 4B6PA 2BW0A 4D3SA 1IL0A 1QH1B 2IXFA 4KO3S 4XQ0A 5KOHB 3GQBB 2VUSA 3O92A 2FMKA 3P0HA 1AM4D 1T9HA 4GYYA 1JKMA 3WRXC 1U8ZA 2VRNA 3OBBA 3IR6A 4KN5A 4QHSA 1ZZGA 5L7YA 5EPUA 3SZ3A 4BL5A 1JQEA 4U9UA 6PFKA 1Z4NA 1OD6A 1E8DA 1ZOLA 2IY7A 2VSYA 3MTDA 1NQOA 4ZVMA 3SF8A 3DO6A 3OM9A 3I8XA 4OLHA 9MHTA 1ZI6A 1F2TB 5BV1A 4QPDA 5IN4A 4O4HB 4M1SA 4RVDA 1SHZA 2VF4X 4Z9XA 1H2HA 3NNNA 3L8CA 1XNHA 3L40A 4B44A 3GNLA 4M87A 4TWIA 4A10A 4ZD6A 2PFGA 1Z6AA 2IU3A 3QJ5A 3SM9A 1SCNE 4E14A 2ODNA 5HNKA 2NP6A 3L9XA 1OIVA 3TIIA 3VPHA 1T1SA 2JANA 5FOXA 2HJWA 1DHTA 2ZWPA 1WZIA 4FFBB 4B3MB 1BVRA 4D43A 1P2TA 1U2PA 2WG1A 1GR1A 2VF7A 3KB8A 3D1LA 1WPGA 4BRWA 4QZVA 1QP8A 3CXRA 2CE7A 3AESA 5IFKA 2VQ6A 2Q3EA 2ZATA 3RG2A 2WHQA 3IVAA 4I5GA 1EM8A 1XTZA 2QF7A 1QHHA 3PHCA 3FIJA 3K92A 3AOGA 3NUQA 1U3VA 1PFUA 1VKOA 3W6ZA 5LMCA 4RA6B 2Q2OA 4IH4A 5EJ8A 1JT9A 1KA9H 2P90A 4LS3A 2Y27A 5EKSA 4RD4A 3NIWA 4ISCA 4D8VA 4H31A 1LDYA 1KMQA 4YJ2B 5BYAA 2NQ2C 2VSNA 3L4EA 3UW1A 4YMUA 4JYMA 5E9QA 2V65A 3FAZA 5LBUA 3NWPA 1DXHA 4BX0A 1EVYA 2JEYA 5BRNA 1USUA 3PNQA 4ABTA 2NIPA 4CM4B 2RI0A 5LLSA 4A8HA 4QOEA 4WECA 1KYYA 2EQAA 3PB3A 1M75A 1M7HA 2A8YA 4HLUC 2W6MA 3PS9A 1AGXA 4HNRA 2GM5A 3CJRA 4GSLA 3ROZA 4Q4CA 4KX5A 1ZINA 4IXDA 1U6JA 2OLJA 3HR8A 4PQRA 2ZS9A 1ZCFA 5FBRB 4RVCA 1CF2O 3B6IA 4FHDA 5FFNA 2FZ4A 4TYPA 1HTTA 1R6XA 4GBED 1F2DA 1XO1A 4M6WA 3RVLA 5KSZA 1YQ9A 1AF7A 3I9FA 9GPBA 3EDMA 4FCVA 3QELB 4R1QA 1NZJA 1Q0HA 4YRRA 5LD2C 4C4SA 4KDRA 4P86A 4EAQA 2DTXA 1GTZA 3HWSA 4I19A 2IH2A 2FA9A 2HNBA 1N6IA 3NTQA 2DRIA 3QA9A 4I08A 4RUKA 4OI1A 1U3UA 1Y5LA 2HBZA 3D1VA 3RVRA 2Y66A 2VHXA 2ZRNA 6Q21A 2G82A 3WIDA 1BIFA 1SA0A 3ZLVA 2N9UA 3CE9A 2REQB 3E2PA 4XGQA 4WBNA 4RS4A 4CG1A 1IRIA 1X13A 3H8WA 4DWVA 1YVUA 4P3NA 1XR3A 1ZM7A 5DWDA 4DBVO 1DAIA 2BEUA 2R8PA 3HXLA 4ES6A 4OSPA 5HX7A 4BUZA 2XVMA 1NXTA 4IDGA 4IIJF 1KI9A 3RWBA 3E9YA 4MGZR 3WG9A 3EPRA 3OA2A 2G6BA 1T6YA 3COVA 3U4CA 4N5MA 3HB5X 4YCLA 2IF2A 2JCBA 3IPRA 4K6MA 2XCIA 2Y0BA 1XDUA 1P44A 3DMPA 3AUTA 4JDUA 4L08A 4TLLB 3R9IA 2BEVA 3OE1A 2ZIZA 1D6NA 4J7XA 1B2LA 4C76A 1YBVA 2GWHA 1VPWA 2PUCA 3RTGA 1UEJA 1J7JA 2VQDA 1JS1X 2VF2A 3CZPA 3ADOA 1Y1PA 3EIEA 4FTWA 1V8PA 1NKVA 1UFOA 4O1IA 4Y8VA 1C5KA 1I7LA 2WAXA 3GIDA 1QIHA 2ECFA 4GU5A 3SFTA 1EFHA 3Q9UA 2VXOA 2LCQA 1SBYA 3WLFA 5KOJA 2CE2X 4ZZ1A 3R0VA 2D2EA 1JIQA 1LRKA 1TKBA 3CB2A 4NS1A 4D97A 4DREA 1F17A 1JKXA 3LUBA 4WX2B 3MUOA 1NY5A 3UMRA 3G9TA 5IJZA 3FHCB 1Z33A 2YIDA 2I2DA 4IIGA 3TFWA 3D0OA 3RSSA 1HDOA 4GI2A 1QP7A 5FBLB 3CLVA 3SLKA 1FDIA 4A2WA 4BGVA 5B3KA 3T3PB 1GXSA 3DCYA 1YVDA 4LQCA 1O6ZA 3HN7A 3CVUA 2IXAA 3RBXA 3D2CA 3B6ZA 4JENA 4RQBA 2IV3A 4YNBA 2MDTA 3MIZA 2OYCA 2JJQA 3SOZA 3U7HB 1KI2A 1E79A 3FNEA 2RGRA 3IPCA 1D09A 2GDJA 2XZPA 3DOIA 3IKVA 4BRZA 1EVEA 5HS4A 1OFIA 4YTEA 3BMQB 5AYVA 5HSGA 2PUGA 1V3UA 4IDOA 4JP3A 2J9YB 4X44A 3CFYA 1XWFA 1L4EA 1GZ7A 2W8BA 4O2AA 4QXQA 1FUYB 3U80A 5HM8A 1U99A 4PTZA 1DQSA 1HTBA 1KO8A 3AI7A 1NBEA 1XDZA 3A10A 4EF5A 3GLIB 1XTRA 4QNMA 4WXMA 1S7GA 3TAHA 1NY6A 1WD5A 1GTSA 1HT3A 3JARA 2X23A 3Q3GE 4XVHA 4IXWA 1PUXA 4ITUA 2JLUA 2OFWA 3A9TA 1GZ4A 3IOBA 3L8MA 4X1YA 5J3JA 3RADC 1W5AA 3D8UA 1FP4B 3PQ2A 2QM8A 3E9DA 3OC6A 3HDQA 5C5EA 3NUGA 2BWJA 1FRQA 3WLPA 3MS4A 3GV0A 1P5JA 4LJ5A 4GT1A 5ICGA 1D2HA 2ZZKA 3M4ZA 3OQNA 1SK9A 2FSSA 3GJQA 4BOYA 3K73O 1M54A 3W8DA 3EC7A 5KDOA 3IVCA 4R7ZA 3HPRA 1TVEA 1F7VA 3UENA 3K16A 1AURA 3EZYA 3TINA 4E2ZA 1FSFA 1GRNA 4U6NA 2XE4A 4RTLA 2ZBGA 4X95A 4KGVA 5EUCA 4DCOA 3ZE7A 1KO1A 1JMVA 1Z06A 2IPMA 2PUAA 2BKVA 5HQTA 1ZOSA 4OJQA 1H5NA 2FZEA 4XH9B 2PZLA 4QYWA 2P67A 3IV9A 3BREA 4JBNA 1OE0A 3ZDBA 5CCEA 1X77A 3OFSA 1D07A 4G63A 2NUTA 3C74A 1GHTA 3UGJA 1E3WA 5DJ5A 1WU8A 1P6XA 5DNAA 3MRTA 1BWQA 3DC2A 4O02B 2VN8A 2WV9A 3ZGLA 5HOQA 4AKIA 3ZTTA 1AGNA 4MCHA 1I7PA 1Q15A 4K03A 4S1WA 3C24A 4TM7A 1SZDA 1PSZA 2W58A 3I83A 4ZVKA 3ICPA 2HJ9A 3UKOA 3NFRA 1IM5A 4AKTA 3HJGA 1H1LB 1EE9A 1NQTA 4RCVA 2EKZA 1U7HA 1E9SA 2AEEA 3X0DA 5E3HA 4RK1A 4BQNA 1RP7A 3EEYA 4NU0A 5FUWA 3QEJA 4WUVA 1IIRA 2AFIB 1YXMA 2G1PA 3EFEA 1SXIA 5FL7A 1CU1A 1QRRA 5LP6F 2FOXA 5FRDA 3KOYA 5J4LA 1P0FA 1CXZA 2PMWB 1ZGZA 4B74A 1OHHA 3FFXA 1ZJWA 3QUCA 3WMEA 3D5QA 1SUWA 1IHDA 1TM2A 2XBUA 1VPVA 3DW3X 1ZUHA 1C29B 2ZRJA 1J70A 4KVGA 2YHAA 1W46A 4MGIR 1KI6A 1V4VA 3L8FA 1W49A 4B3RB 4P4NA 2I2CA 4NMXB 1SR8A 3FB1A 5L3ZA 4EPWA 3Q0IA 4LF6B 3RAFC 3CRQA 4S1VA 2AK2A 2Q5QA 2QJFA 4YQYA 4PAQA 2X0DA 4BATA 2JKZA 2HPZA 2LCIA 3KKMA 4B6OA 4UATA 2XRFA 4WFIA 3ZV3A 4JMLA 4L0MA 4MLPA 4DZZA 1J7KA 3NVAA 2Q4RA 5CIYA 2OWEA 2XJ4A 4G36A 3OZUA 1L7RA 1TM3E 4Z0PA 4B32A 4UMEA 1PX0A 1VHLA 3CLHA 1QU2A 3UGQA 4Q7MB 2PYDA 2QAGB 4D8WA 2Q07A 3D3EA 4DEVA 3LF2A 4FP9A 3FJYA 5CPBA 1VG8A 1YJ8A 3ZW7A 4JI2B 4CCWA 2I2FA 3OO1A 2QD1A 4B84A 4IFTA 4WXYB 3OCXA 2PK3A 1U2EA 2GRJA 3LRXA 3OI7A 1IHPA 1KDTA 3ADDA 1F2VA 3G9XA 5HQ3A 3EGDA 2QJOA 5LNK6 2FEWB 3QOWA 4EBBA 4R71A 2B21A 1UH5A 3MQ2A 4L4XA 2R0QC 3VISA 2FWMX 4AF8A 4K9MA 1P0IA 4LFBB 1YFKA 3LCMA 4HB2A 1O0CA 4YT2A 1Z7YA 3KJGA 4KV7A 2VJBA 4BVBA 1CE8A 1C1XA 3IUSA 5EPOA 3WX0A 3LT2A 4C3VA 2GESA 3R5XA 4JXXA 2AZTA 4KYVA 3DFUA 1K8YB 2LD4A 4DLYA 1KI4A 2VDWB 3ACDA 3KZNA 4ALJA 1CR4A 1E1CB 2DJ5A 2R1TB 2W2KB 3B1FA 3DZHA 3ED1A 3GWZA 3PC2A 3SF0A 1YTUA 3A31A 3TWOA 3OIVA 3BDVA 5BWMA 3DD1A 4CDNA 2VYVA 4O1HA 1C4OA 4M0PA 3NJ4A 2H8KA 3KZVA 4UEQA 5DLPA 2R1UA 2Z4TA 1KZYC 1DRUA 3TLMA 4KR2A 3BIFA 2AL7A 4H9GA 1UFRA 1A2OA 3N39C 3OIDA 1PR6A 2QZ4A 1CUYA 4ZDJA 2OB1A 1U1IA 3EUAA 3VU0A 3MELA 4ZALA 5A4AA 3QFHA 3PC8A 3PDIB 2NO6A 3NYIA 1LLQA 3H9JA 3QA3E 4LI3X 4QQRA 5FPHA 3NTOA 4R0MA 3BIWA 3UBTA 1DQPA 1V5WA 2W43A 2IK8A 2LNDA 3AONB 2O8VA 3BOSA 5HK9A 3MILA 3DLPX 3KQQA 1PZHA 3T9AA 2OGWA 3BD7A 1PFQA 2VUIB 4BMXA 1BDBA 3D2AA 1YRQA 4U63A 2OCGA 2PU7A 1SXPA 1Z4KA 3ORSA 4NRDA 3IDZA 1R8QA 3HU1A 3IX7A 1W0JA 2R11A 2D8AA 1L7PA 3GC6A 1GL3A 5CR9A 5D3ZA 2CDCA 4OU4A 5BSTA 1E2MA 2VJMA 3DMGA 4UVDA 1U7DA 1PJSA 1UT8A 2J4DA 3KXDA 1KNXA 4WY5A 4DPMA 2WYWA 3NV9A 5FLEX 4OMUA 1JR3A 4BUJA 1KS2A 5LWHA 5DX8A 2H1OA 1Z8DA 3EJ6A 3DXFA 1BWPA 2VPWA 2JIZD 4EG6A 1TA9A 1FW6A 1FTWA 4MYHA 3JQDA 4MHOA 3LPNA 1CS4C 1J56A 1HFJA 1JDPA 2C00A 2VDKB 3FHLA 3GZJA 3IB3A 3LGAA 4QNRA 4Z3KA 2QZ9A 2QG9A 2ZSUA 3O1IC 4V0ME 4A5OA 1U0BB 1PJTA 3GUCA 1ZOPA 1MIOA 3JQQA 3IUEA 4NCHA 2C2BA 2GCIA 3LAWA 1AE1A 4CQNA 4TRNA 4BO8A 1IXRC 2VJQA 4JNCA 1PGOA 1DPFA 5TQ0B 4Q3DA 4UE2A 5F7JA 3V00A 4B6GA 4B3HA 5IT5A 1L3BA 1Y3FE 2CNDA 3H5RA 3EZ2A 3QVTA 2EG5A 2AJBA 2JLRA 1FYDA 4HPXB 3RHSA 4DG9A 4OQPA 1NWHA 2BBWA 3A9SA 3BORA 3Q3HA 4KI0A 1OFUA 1SPXA 2JJ2D 4V38A 3RYCA 1NKSA 3QOYA 3FCCA 3RT1A 4A8TA 5F7XA 5BY2A 5KYYB 1U8AA 2ZAMA 3GLTA 1TOAA 3QBJA 5G41A 2E4ZA 2O3RA 2W6IA 4QT0A 4S1TA 1X8LA 4DTIA 3H9CA 1E3DA 2FUNB 1K0UA 1DARA 2DFNA 3K6KA 2QVXX 3MWKA 4O5AA 3UJ9A 4JASB 4QTYA 1NZDA 1O95D 3C3AA 2ZIUB 3ORRA 2NVUB 4ZYVA 4X1OA 5AICA 1TYZA 2H1IA 2HNAA 2MT9A 4FD2A 4U2CA 2JPDA 5KVAA 3ORYA 3L6CA 1GAXA 1K3UB 4PHGA 1TX4B 3V8NA 3GLFA 5KHAA 1XZKA 3FDZA 2K7FA 4H7HA 1AKTA 3L7NA 5E2IA 5BSGA 3T5TA 2IVZA 4BY9E 1NW5A 2E55A 3FPHA 1EVJA 4YH1A 2FZKA 3R77A 5FJJA 1MO5A 1YDMA 1Y8ZA 4R1PA 1IBMB 4XCVA 2HY7A 4MVJM 1YCHA 4L8YA 4MR7B 5I7VA 4MQMA 4MW0A 5FTKA 2JLQA 2X7HA 1K98A 1TZMA 3N53A 2C77A 4MJLA 2I6FA 2FPIB 4JV5B 1P1KA 1DINA 1J5PA 3GXBA 4GOOD 1C41A 1IWOA 2IY9A 2JGNA 3DBOB 4KQ2A 3V3TA 4MUFA 4A6EA 2O1XA 5JZOA 2BTOA 4D25A 3EOBI 5EWMB 3Q88A 4HDRA 5BQFA 2MMCA 1EEXB 1FNDA 1NP7A 1SVKA 1ZFNA 2P2LA 2XOXA 2OPHA 1F51E 1TF5A 4A8JC 1O9HA 3RTEA 2PRKA 2NU7B 3ZDAA 4U7HA 2FSUA 3G13A 5CXXA 3OP1A 2LPMA 4Z7OB 4WNAB 1E20A 4DAOA 2B82A 4QQNA 4Y2TA 3RTBA 1LBEA 1YR8A 1ST3A 2YDYA 3BSSA 4ND8B 1R8YA 4RKEA 5EUBA 1V6SA 3MTQA 2A3NA 1U5BB 4HTFB 3WLKX 1QTNA 1ZGGA 2HJGA 4Q7KA 5J1TB 1DC8A 2Q49A 3BGWA 4Y3UA 4F5YA 1RE0A 1HH4A 3KR1A 4N39A 5F64A 4YXWA 2BGGA 1HMPA 4C0XA 3RO7A 2ZT5A 3SQWA 1M1YB 3OWXA 4P3OA 4QD3A 3W2IA 4MCIA 2VDVE 3TIXB 2Z8ZA 3PA6A 2ZJ6A 3NU1A 4AN0A 4C0BA 1FP6A 2F3QA 3HUTA 1OF1A 4DIFA 4AQ7A 1RPZA 3G2MA 2IP2A 4PC1A 4R51A 1ULHA 1V1MA 2FHSA 4QARA 4V39A 4Q3EA 1QG4A 4NJMA 1EX9A 1IFXA 3PEUA 1IEQA 2WRZA 4JP1A 3WGVA 1IY8A 3P9KA 2XQIA 4O2LA 2PLWA 1K5HA 1R5JA 2ODAA 3DZ8A 1TM4E 5EIBC 5E6UA 3WY9A 1PDWA 2IP1A 3N74A 3WV5A 4G56A 2QR3A 4X7RA 1EUCB 2OD7A 4G2NA 4TX1A 4BGIA 3L02A 1HOXA 2E3JA 1QP4A 2AOUB 3C6XA 3ZZ1A 1YU9A 2CLOB 4HRVA 1KSJA 2P6OA 2HKIA 3TSYA 1HDEA 3RSOA 2QXUA 1NU8A 1LUAA 4IINA 4AVYA 4DG8A 3QE4A 3VVMA 2F43A 4AIIA 2QI9F 1NJSA 3R0ZA 2WMNB 3Q85A 2H31A 4HNAA 3PIRA 3RIHA 1Z73A 3QU7A 2FPOA 2EAUA 1NMSA 3V46A 4JBXA 4QGHA 4YJHB 2C29D 4Q3CA 1RNLA 4CKCB 2D54A 4JI8B 3P20A 1SQ6A 3K96A 3CCBA 1LI7A 2D2XA 1TQDA 3AIOA 1OWOA 3FDXA 2COKA 1DQRA 3C1UA 3VR6H 1X7WA 3UWPA 2YN4A 1K6EA 1LB1B 2DFDA 1G5HA 3I37X 3SM3A 2Z8YA 3X2FA 4MAMA 4RPIA 1P4JA 1CD5A 2HYIC 3T7AA 4BVHA 2Y1GA 2CFSA 4LHYA 3TLYA 1E18A 3FF1A 1PWHA 3AB7A 2P9TA 3LSYA 5G1PA 5IFLA 2EV9A 3KUKA 1GTJ1 5EJFA 1UM9A 1QYIA 4KU4A 1G8FA 1ZSYA 2F1RA 1JT2A 1L5HB 2XEXA 2ZBDA 3EA4A 3EY9A 4L02A 4DLPA 4EY5A 3DUFA 4RIIA 5IBRA 2VWHA 1Q1AA 1H66A 3I0NA 4X1KB 1R0YA 2PCJA 4QGSA 1NQUA 1TZCA 3FUXA 3R7BA 1G18A 2V6MA 2ACKA 1ECBA 5KYUA 4XYGA 1JFRA 1WQ1R 3K30A 3JW8A 2QLTA 3O3MB 5FTWA 1MJ5A 4ND1A 1TK9A 2A88A 4H6XA 3ZW8A 4BCBA 1POXA 1ZK2A 4E7OA 4IKEA 4L6CA 1IUKA 5AUQA 3LUGA 2BM9A 4GXNA 3KT6A 1V5IA 1PR4A 5CH5A 4NMMA 3RVBA 1VQ1A 5C81A 3OZIA 4RYDA 4ERNA 5IKPA 1YR9A 3L6OO 4U0JA 4HUJA 1PNOA 4MVJI 4YV0A 1MB2A 2A9QA 4BV8A 5K6RA 1F48A 3TUJC 1SC3A 1Y6JA 4QOHA 1K89A 1M66A 1E4EB 4X8OA 2NVOA 3BTVA 2PGDA 4X8LA 3QVSA 4K86A 2ZYTX 4HR7A 3RREA 1Q92A 2XIJA 3IHKA 4OTZA 3D4OA 5EYPA 3RSFA 1A69A 4IVNA 5JVDF 1O08A 1YJCA 1G19A 3H2JA 4K9NA 4TMXA 5MGNA 2ZANA 2UUBB 5KVSA 2PSJA 4PFSA 4JQYA 4CMEA 1WHSA 2XEDA 1GGKA 3VTAA 1UDCA 5DGDA 4Q21A 1G2IA 5A7FA 2NYVA 3L4BC 4NXMB 3EH2A 1IOZA 3S0JA 1JN0A 5K8CA 5KYKA 1IBRA 2XE8A 3IEUA 4PHCA 3OUZA 3HC7A 5F1OA 4ZAWA 4E5VA 1AKWA 3G23A 3VX4A 4FGUA 2A57A 3T5PA 5ADHA 3ZHBA 3ND7A 4EI2A 4D9KA 1QFJA 2GGSA 1KZ9A 5A5GA 4B33A 4WZBB 3ZZTA 1XZMA 3H2SA 3I64A 2IHVA 3GLVA 1TJ5A 3TUIC 1V5GA 1I4LD 2DKOA 1ACJA 3AR6A 1AVTA 1VJGA 2GZ1A 3MINA 2OE2A 1JXOA 3EQ7A 3G8YA 4LOLA 5SICE 3FCEA 3ZJ4A 2O8BB 2YC4C 5DT2A 4ESOA 3IMGA 1L7AA 1TTHA 4ZTZB 3MBKA 3SQLA 2XTAA 3IR7A 2PT9A 4FEGA 4DC0A 1L5ZA 3HRKA 4FILA 4O4IA 3WFZA 1PJ3A 3LQ4A 3R76A 1B93A 2WA2A 2ZWOA 4X0EA 3SHWA 2P6MA 4ARAA 5AIBA 2G4VA 1Z22A 3O5AA 2YQZA 2WWHA 2WKWA 4PSKA 3OU7A 4JP5A 1O96B 3IT0A 3D0QA 4I4LA 1Z4OA 4MJXA 1ZH4A 4EVRA 4ROTA 4H4EA 4HK4A 2PL3A 3O7MA 3W6OA 1ZK4A 3MS7A 4LTNA 3MB8A 3NFYA 3R9KA 1FK8A 3VHXB 2GX6A 2Y0PA 2R60A 1XPUA 4UM5A 1B16A 1EXWA 1GG5A 2CK3D 3FOAA 2B94A 1WU7A 2HCJB 4N8SA 5SYNA 5CFOA 3KR0A 1F6DA 1RM3A 4M0DA 1KDPA 1KY3A 2C88A 4D8UA 1Z62A 4TKZA 5A0VA 3ST7A 1BQ4A 5HCUA 4XXHA 2YRXA 4M86A 3GHYA 3ONWA 3JV7A 3QFSA 1F7UA 4RVFA 3RF7A 3AXTA 3VI4B 4F12A 4PG8A 2FSVC 3A1CA 1USIA 1BEUB 2CCGA 2X1MA 3L2OB 4FE7A 2Q4DA 1HG1A 3P0RA 5DM2A 5F5NA 3ZJYA 1YAHA 2J9XB 4W5WA 5G0WA 5ESDA 4E11A 3U3ZA 2X3FA 4IGEA 4Z9BA 3OCZA 4NFHA 4EFKA 3KFXA 5E6RA 5LB4A 2ZTVA 4L1KA 5EJ4A 1EUDA 4XOUA 5I9NA 2DCUA 8GPBA 2E18A 3FKQA 2W00A 3S8EA 3KKZA 4N0QA 4RS3A 4NU6A 4EO4A 3FKSD 1L4UA 1OVMA 4ZFNA 3AG6A 1MOPA 2XE6A 4WVLA 4PAOA 4JXJA 4FIDA 5KNDA 4NLLA 1RMTA 1U9IC 3R44A 1X70A 4HXYA 4KH1A 4BLRA 1KSFX 4KJXA 4YDHB 1XQXA 2LRHA 4IYJA 4JGGA 1XZIA 3FZQA 4BO9A 3T3NA 2XVXA 1S2OA 3GPBA 4A8PA 1BXGA 2C04A 3HB7A 5JECA 1OT5A 2MMGA 4PVCA 1ZR2A 1T5BA 4Z3OA 2NPFA 1KAGA 4DB2A 2A0KA 3ZIAA 1A9PA 1NQAO 4KSCA 2KM1A 3E84A 1N0VC 1QRAA 1EBFA 1SCUB 1SH7A 1YS9A 2EXXA 1CV2A 3EWSA 4OB6A 1H5QA 1RJ9A 2RGEA 4Y2RA 5EXXA 5HMMA 2XHZA 1UJ6A 3KB2A 3UJHA 5LNK1 1SCBA 2CV2A 3QEMB 1DC4A 3U4MA 1Z0ZA 3PNOA 3D7SA 2XGJA 3PHIA 1P61B 1X74A 2HZ7A 2WTNA 3JD2A 2HLPA 4HFNA 4KQ1A 4YEDA 5B53A 4F2DA 2GHRA 2TYSB 3DO5A 3TSAA 1OH5A 1ILWA 4P7KA 4DA6A 1IRXA 4PLCA 4ZVUA 1XLUA 4TQGA 4BQOA 2X5NA 3ZXUB 1WB9A 3AEQB 5AKLA 2YHIA 3VSBA 2BRUA 5A04A 1QK3A 1CHNA 1GCGA 1MAAA 1V11B 3DE6X 3ZOKA 2BJVA 3T52A 2QS9A 1JWBB 3AINA 3CPEA 5FQOA 2WILA 3AFGA 3VQTA 2VWPA 5DSXA 1T4BA 2ZB2A 4BVEA 4ND5A 5GGXA 3D6AA 2Z1MA 4Q15A 3LHIA 3SZLA 1WV1A 1QQBA 2IYUA 1Y5IA 1QGUA 3GNQA 5CCDA 3UAZA 1TECE 2YH2A 4EHDA 3SEZA 4TYNA 4W1SA 2XNHA 3I6BA 2ZJ8A 3WI7A 3ZS9A 4BZXA 4E5NA 2OB2A 4J0EA 3N8DA 4NBWA 1P5RA 3V8PA 4QU8A 1OJ7A 4CVNA 2C96A 2YMQA 4NU5A 4N7MA 3IXLA 3FYHA 1CDOA 1XCLA 2A30A 4G24A 1L4YA 3EVFA 4UVGA 5HIIA 1UOPA 2PFKA 4MB0A 4QU0A 4EYEA 3IT1A 1A1SA 1DT3A 4F6CA 4WD3A 1WXGA 3KLNA 5TPZA 3MTAA 3DCNA 3SQNA 1MG5A 3E3AA 5KSWB 4FGZA 5A6VA 4KQ9A 4NZ9A 3SGLA 2F2TA 2HRZA 4L5BA 2WNIA 3IOEA 4QLOA 1W19A 1KZHA 3UG7A 3UPDA 1GL9B 4BPRA 4DMRA 1WQ3A 4KZPA 4C0JA 2Q6TA 3MHPA 4EKEA 2YMMA 2C94A 4IJ6A 4BECA 5DLYA 2I6TA 3SBDA 4AURA 2QAGC 1C7QA 1SVSA 3LLMA 4B8WA 4EG5A 2H6EA 5F73A 1QC5B 3TL3A 3DTVD 2GCNA 1MO4A 1P9WA 5CW2A 4Q48A 3G2OA 3H9UA 4MS3A 5DM4A 5DK6A 3ZWCA 2NU9A 4E2XA 4TN5A 1EVKA 1MJHA 2Y2UA 3ZDQA 2IW1A 5ITZB 1XQVA 1GPKA 5JD3A 3ZHCA 2JFXA 4B3SB 3EASA 3TN7A 1HI9A 1V7CA 2Q46A 1LLUA 3CNBA 3H5LA 5ALVA 2BKLA 2YFYA 3DLHA 4O33A 2JI4A 4EARA 1EEHA 3TD6A 3TDKA 4IWNA 3RH0A 1Z6TA 3O8QA 5J4HA 3K9WA 4KVZA 5DASA 5BOVA 2G83A 3TL2A 1RQ7A 3FPCA 4KE7A 2V1UA 1U2TA 2UU9B 5CEFA 3RSLA 4XWAA 2DY1A 1PRYA 4PFQA 1FSGA 3OZBA 2OBYA 1R4NB 5H59A 2BHRA 2RH5A 2C8KA 3B6EA 4UHEA 3UVEA 2R6GA 4JYZA 2HRQA 4X3CA 4MUYA 5FWNA 2X1HA 4YASA 3AEXA 5LQDA 1XRSB 3IESA 1OBVA 4RNCA 3MT0A 2DTEA 4ISBA 4RHUA 4CI9A 4OQEA 4CU5A 4Y7DA 4LF7B 3BTUA 5I8ZA 5TMEA 5JYCA 2HSEA 3RTAA 3FTDA 4LX0A 2OHOA 1GADO 1RTTA 5J1SB 2ZS8A 2VUHB 3ZN2A 3GVHA 3U0BA 1P3JA 3WGLA 5ENVA 1UC8A 2Q62A 3NGLA 4FOSA 3F3KA 3AJAA 1A9RA 3NWBA 4ZMSA 1ML4A 2JFZA 3LM8A 5L95A 5IVIA 4DFDA 3EVZA 4YAUA 3O1HB 2I62A 3LXMA 2ZUEA 3R5KA 5ERYA 1RWVA 1J1IA 1AQNA 3R3YA 3E9RA 4PR0A 5JSKA 1IJBA 1B7GO 5IXJA 1WG8A 3TR6A 1YC5A 5JQGF 2V54A 4F72A 2VJNA 3ROXA 3SKVA 3JD1A 1CSEE 1FL9A 1OIXA 1GPMA 4RPKA 3TB6A 2IUTA 4CRWB 2GS9A 4FB4A 1MN6A 3NWEA 2JVKA