1X8JA

Crystal structure of retinol dehydratase in complex with androsterone and inactive cofactor pap
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
343
structure length
343
Chain Sequence
LPFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGSIARIADFLGKKLSEEQIQRLSEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of the unique sulfotransferase retinol dehydratase with product and inhibitors provide insight into enzyme mechanism and inhibition.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Transferase
molecule keywords retinol dehydratase
total genus 124
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x8jA00
4M1SA 2FSFA 3RS4A 1AM4D 4IKEA 3VHXA 3U3MA 1RRFA 4PSAA 1ZBDA 3QXCA 2ZRDA 1P9WA 2Y8EA 5KDOA 1JALA 1G5RA 5H8WA 1EGAA 4RFVA 3L0PA 4K81B 2CE7A 5EE0A 2PLRA 2R6FA 2RGXA 2WHXA 4GNKA 4WIAA 3QNUA 5HZHA 4AYXA 3CW2A 2R65A 5L3QA 1X1RA 3A36A 5KNDA 2ZJAA 2O8EA 5TARA 4CEJA 1FZQA 1G64A 1SKYB 2ZI5A 1W48A 2ZRAA 5GVSA 1XD2A 2HLDA 2YVUA 1P73A 4B3GA 3QXXA 1HE8B 2G0TA 2JLRA 3B85A 5IF9A 4X8MA 1KSJA 1M34E 1K5GA 2REBA 5HKKA 2X8AA 3IHWA 4A0RA 1KK3A 3LXRA 2GF0A 1UDXA 2RGBA 4GSYA 4TLCA 3RSOA 4TMWA 4DT1B 1SVMA 1EWRA 3IIJA 3RNLA 1S1CA 4JL5A 1UKVY 1ZC3A 1NKTA 1JNYA 1UEIA 2GXQA 3PV0A 4RD2A 2CL0X 3T35A 4LI0A 2NO7A 4OL0A 4RFSB 3N2EA 4HAZA 4EJSA 4HLDA 2OCAA 4NCNA 2XXAA 2R6GA 4JL6A 3BWDD 2WTUA 3BB3A 4Q4AA 3KJEA 4ESHA 2IS4A 1MO4A 3TW8B 3Q85A 4A4DA 4GP7A 3RC8A 1W2GA 3QVVA 2VQSA 4QBHA 2AKAB 1OFUX 4MGIR 2QSYA 3TR0A 3GFOA 4LV6A 4RY2A 4PANA 4BFXA 3IPXA 4I81A 2JASA 5JRJA 5EXTA 4NMMA 4RFSA 3AKDA 5CK5A 1Z0AA 4LZZA 6Q21A 1OSNA 3CRVA 3MSXA 4QL3A 2X77A 3W34A 2ZS8A 2J0SA 1QHGA 4MQBA 3JZMA 4LYJA 2QBYA 4WZBE 3EG5A 1XX6A 2GCOA 4Q4LA 3TE6A 1PLJA 5CB6A 4PR0A 3RHFA 4JKIA 2IYVA 3CWQA 2O8FA 1ANKA 4IOKA 2OZEA 1R0WA 4LJ4A 4TQ9A 4WXRA 521PA 3H4MA 3K09C 1KDPA 1VCOA 3NBYC 5AJYA 2BEJA 3R20A 1ZVQA 4B6FA 1OH6A 2ZAMA 4JL8A 4HEJA 4Q47A 5EZ6B 4M1TA 2WAXA 4HB2A 4P33A 1P3JA 3HDTA 2C98A 4AURA 4EKDA 3ND9A 2BBTA 4UNNA 2CNWD 3VR3A 5K8UA 2J0UB 3B1VA 2N42A 2RCNA 1NI3A 2E1RA 2IC5A 3BGWA 1GKUB 1R7RA 4QGGA 2A5DA 2KSQA 4PO1A 4WZAE 5JSZB 3ZS8A 2KB0A 5DI9A 5H68A 4OBEA 4UNSA 4QKQA 2IYLD 1F5NA 3CR7A 2GK6A 2J41A 3ZH9B 1KI9A 1JR3A 1XF9A 3ZJYA 2GRJA 1R0XA 3HU3A 2ZRIA 2ZUBA 3HYTA 3SJZA 4G5OA 1D9XA 3EAQA 5J5CA 3AVWA 1SHKA 4AY2A 4U00A 2BV3A 4CZ2A 1LY1A 4KLZA 5FUXA 1II8B 2QI9C 5HZKA 4RD1A 3U60B 4PO9A 3R8FA 2AK3A 2VO1A 3QVUA 4MUAA 5JHGB 3D3QA 4FMCB 3ADKA 1GL7A 1J99A 4V0NA 3Q7QA 5AJZA 1PUJA 2O0HA 3M1IA 3ZLJA 3KQHA 1G8HA 3R8CA 1Q1BA 4TTQA 1OIWA 1CIPA 2AWOA 1E6CA 2VA8A 1GRQA 2JLWA 1GG2A 1UKZA 4RZ3A 4PAOA 2XTZA 3DHWC 1Q57A 4N0EA 4BPBA 1AGPA 1ESMA 4BLRA 1OIVA 3QPWA 2ONKA 2ZJZA 1JXOA 2FU5C 2OCBA 4B2LA 3UK6A 2RGCA 2GAAA 4ZCMA 5EP4A 5LPNA 4D26A 3PR1A 5AUOB 3A1TA 3OF5A 5EE5B 3KKMA 2ZXUA 4CEIA 4I1OA 4MRNA 1QHXA 3F3YA 1C9KA 2ZRCA 4JSYA 1E79D 2B21A 1COWD 1KK0A 3A1SA 3BD9A 4US2R 5DIFA 5AJXA 4QHSA 4PSKA 2MSDB 4LSGA 1UF9A 1L8QA 3A4NA 2BBOA 4BFSA 1E98A 1LF5A 1E1QD 1NVVR 2JDIA 4A0HA 2ZSAA 4N3NA 2OFWA 2FMXA 2R6CA 1DAEA 4QBFA 4RKEA 4KYUA 2O8CA 1VHLA 1LW7A 1T3LA 4DB2A 3L43A 1U9IA 2ZEJA 4L5BA 2G9NA 2CK3D 1TL7C 4LV8B 3ZZUA 2O8DB 1NBMA 2R62A 4D2IA 2VH5R 3T1VA 1Q21A 3EX7C 2D7CA 1BIFA 1G7RA 2BKUA 2CBZA 2QPAA 2OM2A 2ZRKA 2CMKA 2OE2A 3OESA 1IXZA 4P0TA 2GEUA 2ZI7A 1QHHB 3P20A 3LBNA 2FF7A 2UZ3A 3A1VA 3TW4A 4JT2A 5BQ5A 2VF7A 4QRHA 1S9HA 3CRQA 4P3YA 2B92A 4WBSA 1IJFA 3THWB 2OLKA 2BCGY 1X8JA 2IYQA 4PFSA 4A2WA 1ZM4A 2HYIC 2O0KA 3EASA 4KVAA 2BCJQ 2OFOA 4JLMA 1VPLA 2GNOA 3TQFA 3GMTA 3MGCA 3W5IA 1E9BA 1F3OA 1N3BA 1YU9A 2UZIR 3BFKA 4URWR 4V0OA 3WMFA 4R71A 2REXB 2VIIA 1QVAA 5CIQA 4DCNA 4DJTA 4YMUA 2ZR0A 2IXEA 4Q03A 2DB3A 221PA 3WNCA 5A4JA 2XB2A 1MABA 2NOAA 2QAGC 3WRXC 1DEKA 1Z28A 4LJAA 3SOPA 2IS2A 1BH2A 4OHWA 4BFYA 4TMZA 4EQ6A 2YWFA 3OEHD 4DLUA 4KFSA 3KQKA 4MGZR 5CJPA 4D6PA 4NCJA 2Q9CA 2QNRA 3MJHA 621PA 3LY5A 1WF3A 4GOKA 1G8GA 3AQ4A 2FPKA 5IT5A 3L2OB 4HB0A 3QKRA 3ZYCA 1W0JD 1G5TA 3LRPA 1GL6A 3ECCA 3RRZA 1F60A 3T1QA 4D0GA 2QROA 1PV4A 4JT4A 2P3SA 2BC9A 2LWIA 3OIUA 3FTQA 1SVSA 4EPTA 5FL7D 4FMDB 3C5HA 4DLVA 2W0MA 4QBIA 2ODBA 3RVBA 2QENA 3OIVA 4XD7D 1RKBA 3ZIAA 4NE2A 4HUTA 4RD0A 1E69A 4K46A 2HUPA 5JWOA 1RVDA 2G77B 4OHZA 4OI2A 3RWOA 1AZSC 3CF6R 2O52A 2ZI3A 3E5HA 1CP2A 5JJIA 2CHQA 3TBKA 3EPKA 5L3VA 1XMJA 4W5HA 5DHAA 1HYQA 1RJ9B 1LTQA 3D7MA 2OT3B 3MFYA 4RKFA 1EK0A 2H18A 2WWXA 3W3AA 1E0AA 3A4MA 4DUGD 5CLQA 3RABA 4KI0A 1IONA 2HF9A 4LHYA 1MO5A 5K8TA 1XXHA 2QPOA 4QHYA 4Q9LA 4UJ3A 3BH7A 3DMNA 2GKSA 4LOAA 1D6JA 2WIBA 3L0SA 1KNQA 1XTRA 1BKDR 1ZMXA 1ZM2A 2W00A 1G7SA 4JBYA 4PXAA 4PTLA 4Q1EA 5KNBA 3ZD7A 2YKGA 1WXQA 4U02A 1GNRA 2CJWB 4B35A 3THWA 2XEXA 3LVQE 4Q7LA 4Y0VA 1IN6A 1NMXA 4TLEA 2ZYWX 4MYUA 3K0AA 2AL7A 1JECA 5ELXA 3AUXA 2NZ8A 4LBYA 1NY5A 4ITRC 3AP2A 4OK5A 2RAPA 1DAGA 3QF4A 4FMBB 4U7DA 3TNFA 3KL4A 4U5XA 3KFVA 4HZUB 3CPHA 2AXNA 5F9HA 1T91A 5KU1A 2KJQA 4F4JA 3V4RA 2P6RA 4ZIRA 5EUMA 2ZAOA 2F1RA 4HB3A 3QUSA 3KKOA 5L3SA 1JXMA 4HUQA 4XVRA 4BGDA 2J0UA 5H70A 1SVLA 2EWWA 1HV8A 5FUYA 2FDCA 1OKKA 4LGMA 2YYZA 2C2HA 4KCGA 4BEBA 1US8B 2WKQA 4KSBA 3EPJA 2VSFA 4EPVA 3TKLA 1II0A 4UNRA 4KAXA 3J81k 3SZRA 1T3HA 4MRRA 1N6IA 2OHFA 3EA5A 4PPGA 3R9IA 2W2XA 4XTCS 1IXRC 1G291 1XDBA 3PUYA 3WMEA 5DI3A 2ANBA 5BYJA 1G4AE 2ZRNA 4O25A 2XXAB 1NIJA 4IDQA 3AGQA 1WQ1R 2HCJB 2ZU6A 3NHBA 4Q02A 2OESA 2RGEA 4TSFA 2NPFA 3WYFA 1W36C 1WMSA 2X1VA 4TSFD 1IY1A 1HEIA 1E2GA 4GDFA 2EFDB 1Z0KA 1S96A 2ZRGA 1XU4A 3KKPA 1SXJC 3EZ9A 4C4PA 5FOXA 2R9VA 4Q18A 2DWPA 3O47A 4RCZA 3C14C 1QG2A 2LCFA 3ADDA 3KUCA 4RD6A 5FBWB 4BZXA 1YQTA 2WKRA 1P2VA 3FDIA 1E0SA 1E2DA 2GILA 4L8GA 4NCIA 1ZM9A 2FSGA 1SVWA 3VKWA 5HTKA 1J90A 1G5PA 2ZSFA 3LQRA 3VMFA 1T0JB 1ZD1A 2YWHA 4JBXA 4WOPA 1MOZA 2AFIE 4NCHA 4Q1CA 4Q4HA 3SYNA 1Q44A 3B13B 4V0LA 2ZSEA 1E94E 3FMIA 3KUDA 1NNEA 2EYUA 1PLKA 5CDFE 2MMGA 4QG7A 4WAUA 4TLAA 1EFCA 4BRUA 3QSYA 3AKYA 2NMVA 4PHGA 3B7GA 4AKEA 5FTLA 1E79A 2AX4A 1N6OA 2ZRLA 3KQNA 4A2PA 4UJ5A 1G4UR 4JZKA 2WZQA 3W8NA 1JQJC 4FMCF 4WW0A 1RW4A 2O8BA 2Q21A 4A0FA 1VTKA 2JLXA 3OAAA 4L4UA 2D06A 3CKLA 2GBLC 4IOMA 3VNUA 3VHLB 2ZR9A 3LX8A 2BMJA 2KI5A 4KFRA 1KAOA 3PUVA 2RGNC 2ZE5A 4IDPA 2QM8A 1E2JA 1AS2A 3A1UA 3HU2A 5A5GA 3U7GA 2ZYTX 1G3RA 3WBJA 1ZP6A 4ARZB 1GRNA 1FTSA 5GJBA 2PCLA 3HP1A 4RZ2A 3RS0A 5E95A 3ZZ0A 4LHXA 4XOIA 2FFQA 1TU3A 4NTZA 4MKIA 1KZ7B 4DSUA 3TUZC 4HLUA 1I2DA 5FBQB 3B1WA 1OKKD 1D5CA 4JLOA 4OI4A 3KJHA 5KHOC 1GUAA 3K8YA 3FOZA 3TR5A 3PEYA 4IVPA 2QM7A 2WOOA 1IY2A 4I4LA 4TWZA 5DN6A 4V0ME 1N5LA 3ICEA 4Q9JA 2VP2A 5JS8A 1AK2A 4AKIA 2AR7A 5HE8A 4RJLA 3I5YA 3THXB 2ERYA 1SVKA 4BFVA 2ZM5A 2YHSA 3VKHA 4MKGA 4JLKA 4QGHA 1XJQA 5LDDC 3RS5A 1G3IA 3FE2A 1UBGA 2XITA 2RGAA 3TSOA 4Q9IA 2IWRA 2IX3A 4PHFA 2WVJA 2A5FA 4C0LA 4TQUS 4CYMA 3V4FA 3C5CA 1VCMA 3M0EA 1CBUA 1Z29A 3OE7A 2GJSA 3EWAA 4HAVA 2CNWA 4DCSA 3NTUA 2OBMA 3MAAC 3P4XA 3CB4A 1VKJA 1ZINA 1IOZA 3NC0C 5UKDA 2XZLA 4W7SA 4CEIB 4DIDA 4BLQA 2J3EA 1P6XA 5H1YA 1W44A 1XZQA 2B7BA 1LV7A 1CRQA 1KZGB 2GEVA 2Z4SA 2BMDA 3U6BA 3LDAA 3B1YA 1KDTA 2DFKB 5HPYB 4W9MC 2GZDA 1KO8A 2BM0A 2W83A 5SZJA 4OK3A 2WKPA 1OXSC 4G01B 4C7OB 4MKHA 2IK8A 3T1TA 3CNLA 1KI2A 3KX2A 4CEHB 2OAQ1 1N0VC 1FP6A 3CF2A 2ZR7A 2D7DA 2FE4A 1A2KC 1HE1C 2NTYC 2P0EA 3AP1A 4MUBA 4P32A 4S2EA 3UWKA 4X8HA 3AVYA 2PZEA 3LWNA 4FCVA 2HEIA 4LJYA 1VHTA 1WP9A 3CRRA 3OHMA 2Z5FA 1MT0A 2R2AA 4B73A 3R9WA 1KOFA 1W5SA 2FGJA 3I3SR 2B7CA 1CU1A 1DAHA 2QY9A 3MRSA 4H9GA 1ZM7A 4B6EA 2KE5A 2P5SA 3F8TA 5JS7A 1R0ZA 3KXLA 2WWHA 2WWFA 2VRWA 3SS8A 121PA 3SC3A 1SZPA 3U3RA 2QAGA 2ZSBA 4MGYR 4Q48A 4C30A 1P5ZB 2QAJA 3BFVA 4FW9A 1P75A 1JI0A 4XVQA 3LXXA 5AUQA 3GJ3A 3UIEA 1E2PA 1VYUA 1XBTA 3GP8A 1IAQA 1B23P 1ZNYA 1OHHD 4Q7JB 1DAFA 3KXKA 2W6JA 1DOAA 3GLIB 4NCKA 3CNOA 4QGFA 5GVRA 2H92A 3PEVA 3NBXX 1I4LD 1OYYA 4S35A 4L9WA 3UKDA 2G1JA 1HQCA 1TADA 2EYQA 1EXMA 4C0QC 2C04A 4TL8A 5EE1A 3KTAA 4M8NE 4HUQB 4CIDA 3TRFA 5E7IA 8OHMA 2YNMA 4OI0A 4PQYA 1Q20A 2ZSDA 1CJVC 4OQLA 2GCOB 4JLPA 2YINC 4CW7A 3PUWA 2GESA 3F0TA 3A4LA 4LX0A 2FA9A 4BFZA 1AKYA 3X1XA 1KSHA 2XOKA 2BOVA 1OH8A 3CH5A 3BB4A 2AD1A 2D74A 2TMKA 2WJHA 1Z0DA 2GTPA 2X19A 3M6AA 2GEDA 3B8HA 4QNMA 1W4BA 1GKYA 1Q0UA 3CZPA 1S0UA 2JJ2D 1GITA 1AQYA 4W5WA 1MO3A 4KFUA 4BASA 4MDFA 1F2TA 1A4RA 1ZRHA 2IF2A 3TVTA 2HYDA 4B2PA 4Q01A 2J7PA 2BBWA 2RH5A 2A3RA 3I4LA 1Z06A 4DCVA 4JJKA 2HT1A 4PZLA 4BQSA 1H8EA 1G21E 4YDHB 4FWTA 5JSZA 1VDZA 3BC1A 4ARZA 1H8ED 1E4VA 3NKVA 1U2RA 1W4RA 5KSZA 3QIAA 2PX3A 4E09A 4NP6A 1O3YA 1JJVA 1DARA 5CB8A 3BK7A 2BHRA 1X3SA 5BN3A 4TYQA 2WAYA 3U3JA 3VR4A 2BMEA 5BXQC 5LB2A 3OEED 3OZXA 1I4TD 2UVQA 3QOFA 4Q1BA 3W6OA 3ZVMA 2A2ZA 2PT7A 3LAWA 1KY2A 4D4LA 2CLSA 4F91B 3VNVA 1G6OA 4QHTA 3GEEA 4IEEA 3I73A 1SGWA 5CITA 1M1YE 2G1KA 1SXJB 3W6NA 5FTKA 1E2FA 1XNJA 3THXA 1G8FA 2BDTA 4AC9A 2V54A 2D62A 5JCPA 3Q7PA 4G1UC 3BH0A 2IF0A 2PLFA 3U3OA 2GCPA 1TAGA 3CH4B 2ZQ5A 5JLJA 3IPYA 3X2SA 3FMOB 1SKQA 3B60A 4TTPA 3T1OA 1OYWA 4HZIA 3I5XA 5IHPA 5P21A 4OHVA 1F48A 2FN4A 3ONWA 3X1WA 4OHXA 4M1MA 2V7QA 4EPWA 4FCTA 1ZCBA 3EZFA 2F55A 2RGDA 4G5GA 3BORA 2QL6A 1BMFA 1A82A 1KNXA 1LNZA 3P1JA 4Q4AB 2PMKA 4DWJA 3NIBA 2IL1A 1GSIA 2V1UA 3B6EA 2KBEA 4ZPXA 4HDOB 4PAQA 4HAUA 5B30A 4EPXA 1WDTA 2HJGA 4Q4JA 3NDBB 4E5UA 2D4HA 2V6IA 1TQ6A 1AS0A 4B43A 4DKXA 5D3MB 4ILEA 5DH9A 1E0JA 4NYMQ 3ASZA 4M2LA 3EA0A 3QG5A 4PO8A 5EP3A 4TYNA 2BJVA 3GJ7A 2VP4A 3SI7A 1OJLA 4K8OA 2G88A 1P9NA 2QU8A 4TZ6A 2UKDA 1B0UA 2RHMA 5JFGA 4TYWA 3RSLA 1FQKA 4M53A 4BWYA 2ODEA 3WRYC 1XMSA 4B3BA 1NBME 2GXAA 1XD8A 4LJ5A 4DCTA 5DISB 2O8DA 1A5TA 3L8YA 4YLGA 3TSZA 3B82A 3QKRB 3UG6A 2YJTD 4JVSB 4TQAA 4DLZA 4F7WA 2EW1A 1Q1QA 1ZUIA 3DDCA 3K53A 821PA 5G3YA 2PJZA 1FOEB 2JCSA 4LBZA 1DG3A 2OBNA 1E0KA 1X8LA 1DE0A 3QF7A 5C1BA 1CXZA 1R5OA 3KB2A 3GLGB 1RIFA 1OFTA 3QXSA 5ANRB 1SXJA 1KJZA 1OPXA 3MLEA 2Q3HA 1IN8A 1KI7A 3UMRA 1WRBA 1W36B 1S3SA 3T5GA 1VG8A 5EZ5A 2P6UA 3GJXC 1TU4A 1AZTA 2ZVQX 3MMPA 4LHZA 3OIWA 4RD3A 4UXIA 2RKOA 3SDZA 3SNHA 1AJEA 2IYSA 2H8KA 3CF0A 4LYFA 2G83A 3LNCA 3LW7A 4ZO4A 1PZNA 3SYKA 2WJJA 1XEXB 5KSOA 1OXTA 2AK2A 2IUTA 2DR3A 2XB4A 3LBIA 1II9A 3MUFA 4OJQA 4DZZA 2ORIA 3CRW1 4LYAA 4C0BA 2Q9AA 3SBEA 1JEEA 1XPOA 2V55B 4MGKR 3PIRA 1J70A 1NN3A 5C2JB 3BE4A 4R2HA 1ZUNB 1Z47A 5CYOA 1E9EA 2BVNA 2QMHA 2J5XA 2J9RA 3RS7A 3THYA 1VYVA 3QE0A 5DSZA 3K0AB 1OF1A 1XWIA 2FSIA 2WSSA 2NIPA 4MDEA 5IK2A 2YC4C 1N2CE 1ZAKA 4LK2A 4M1KA 3WP0A 1NJGA 1D2NA 4GZMA 3A6PC 1F2UA 1NL3A 2G3YA 4TMXA 2HV8A 5SZIA 1MRSA 1VCIA 2BWJA 3EARA 2CXXA 3QKTA 3GLGE 4G5QA 2WMOB 3REGA 4US1R 1TEVA 4DXAA 1QHIA 2IA5A 3VAAA 2X2FA 1JBKA 1YKSA 1CRPA 1T8TA 2B8WA 2FWRA 1U99A 3BAFA 1GTVA 4PC6A 5CIWA 5CM9C 2ZJBA 4F92B 3U7HB 2DWQA 2GXUA 5J4YA 5KPJA 5GJVC 1DO2A 5SZKB 4ZDKA 5B58C 3TVDA 4Q9KA 3PITA 2OBLA 1KO4A 4GP6A 2QN6A 2HDNB 5FPKA 1P4SA 2HJVA 3KJGA 3FWYA 4NPHA 2C9OA 5J4KA 1GVNB 1YR7A 4DLSA 4KBGA 1MRNA 2V6JA 4DC9A 4KHZA 5KTYA 3VX4A 2VHCA 4I99A 4A6XA 3IIMA 4FN5A 5FL3A 1W49A 4F4IA 1CJTC 3G0HA 4DLXA 1CR1A 4DRZA 4PC3A 4FD2A 1Z2AA 3IBYA 3FKSA 5KYKA 4NONA 3IO5A 4NYJQ 3GFPA 1G20E 3R7WB 4WXPA 3VKGA 2FG5A 3PFIA 3RRMA 5M04A 2V3CC 1E9RA 1G7TA 2RMKA 4DDTA 5IK2D 2V4ZA 4UXHA 3QXJA 4BRWA 1AKEA 2J0QA 3MJRA 1OHHA 1S1MA 1FMJA 5E7MA 5AK0A 1GWNA 1EFRA 3EIHA 4V0KA 4HZUA 1OXXK 2IWHA 4YMWA 3NH9A 4KFTA 3BERA 1G3QA 2W2VA 3CZQA 4IVRA 2NQ2C 4DBLC 4YQFA 1NLYA 2AKYA 5TB5A 4TL7A 1IY0A 4HAXA 2EFGA 1CTQA 3H2YA 4BLSA 1XTQA 2A5GA 1K6MA 4YMTA 3W5JA 1KHTA 1UDWA 2F1JA 3T06B 2ZVPX 3U4QB 1GAJA 1G7CA 2DY1A 4LBVA 1MH1A 2WWYA 4HLUC 4FCWA 2IS6A 2IHYA 4B34A 4P31A 1ELOA 5FOSA 2O8EB 3GJ0A 5E4FA 4KSCA 2JGNA 3IUYA 1VG0B 4D0LB 4DCUA 1XD2B 3AGPA 2W6ID 3AF3A 5FPYA 1DELA 2AN9A 4TMTA 1JR6A 2GWHA 5FPSA 2JJ2A 3T12A 4YMSA 4GI7A 4IDHA 2OSBA 2WWIA 3I32A 4PPFA 5FOWA 4R7ZA 4IFBA 4M0LA 3GLFE 1TUIA 3ZQJA 2ASEA 3FYHA 4TT3D 3SHFA 1S3GA 2GJ9A 2QORA 3K0CC 3IILA 3Q8XB 3LLMA 2J59A 3B9PA 1CLUA 2PEZA 5E7JA 3EC1A 1TQ4A 1Z6AA 4I1SA 4CGZA 2HXYA 2MSCB 1RE0A 1RRCA 1KI3A 4PC2A 1GRRA 4F93B 2WWWA 2PJRA 5EE9A 1SXJD 2ZI9A 2IYRA 2VHQA 1CR4A 2CCGA 3AEZA 4IXNA 3GJ6A 1FQJA 3JZAA 1MR3F 3N5CA 4RZUA 4TN1A 3FHOA 421PA 3BRWD 1VYTA 1G3UA 1Z22A 4CEJB 4GOXA 4HLQB 3L0OA 1FTNA 5CDFA 2GJ8A 5G41A 1Z63A 5KSPA 4B47A 1N5IA 5F3WB 2ZI6A 3QEJA 2Q9BA 1TTTA 2GZAA 3E2IA 1Z8FA 1Z0FA 1G9XA 3PEWA 4C0AC 2ZJ5A 4MA4A 1KO5A 2DWOA 3AVOA 2PZFA 2XOKD 2IUSA 2JA1A 4R98A 1FNMA 2QRZA 1RYFA 1YZTA 3AF1A 2NGRA 4ACAA 2EQBA 3CO5A 1GDDA 1GIAA 1ZCAA 2IYZA 4C9BA 3T34A 2CHGA 3ZZTA 2ZUDA 1LVGA 1FUKA 2EVWX 2I1VB 3NWJA 1R0YA 4MRPA 1CS4C 5C4MA 5J4LA 5JRZA 1J2JA 1E2IA 1TMKA 1UPTA 3QPVA 3VU9B 3A37A 3NXSA 4M9QA 1P62B 2CDNA 2V7QD 4EJSB 1T8UA 2F9MA 4JKYA 2PZGA 4A0GA 3Q3JB 2ZYUX 1IBRA 4G0NA 1QHSA 1Q3HA 4D80A 3PG5A 4LRWA 5DYGA 4DLTA 3GLIE 3I72A 2F43A 2RB4A 1Z2CA 5DI3B 3WBKA 2J7KA 4NBSA 5B64A 2PT5A 2XAUA 2ERXA 1BOFA 2C03A 1QHNA 2VL7A 2I4IA 2NO0A 5DE3A 1FMLA 2CLCX 4C0JA 2IEYA 3FPAA 4B71A 2WOJA 5JECA 2XJ4A 3DPUA 4M9XA 2YWEA 3DVLA 2QMUA 4X8OA 1NN5A 3K70B 3I62A 3K1JA 1NF3A 4AD8A 3IEVA 2R6AA 4CEHA 3P32A 4QJ4A 1ODFA 3LLUA 2EFEB 5F9FA 1E9SA 5TV2A 5GJWC 4Y0AA 2QBYB 4EJSC 5JEEA 1NBMD 3OAAD 3LX5A 2JATA 1FX0B 1JR3E 3AF4A 4UNPA 3WHKA 4FI3C 4Q19A 2QQEA 2QUZA 3RLFA 1Z07A 1NJFA 2CVHA 1NVUQ 5JEDA 2QT0A 5JHHB 5JMTA 4ZCLA 3BB1A 3NH6A 3SU8A 3TQCA 1G18A 2OUKA 5FOUA 1JAIA 2F7SA 2GXSA 4TYPA 4YC7A 3W6PA 4DLRA 2VPPA 3KZ1E 1QHHA 1QZXA 1W46A 5D3MA 5FOVA 2QP4A 1R8QA 3V00A 3NDPA 4LUCA 3TAUA 1T4GA 3CBQA 1ZIPA 3EPHA 4LJ6A 4HATA 1Z6XA 1JB1A 1G1MA 2EFHB 4RVCA 4D4MA 1E1RA 2NO6A 4XSGA 2H17A 5CM8B 4B33A 2Q3FA 4L16A 2WJGA 1NSTA 2ATXA 1TUEA 4BFWA 1YVDA 1DVRA 2AHOA 4CDGA 1Z5ZA 2AXPA 4IJMA 2J46A 4IXMA 3HU1A 4ZV4A 5FOTA 4A8JC 1T3SA 1XFAA 3H84A 2JDID 1HA3A 5DYIA 5DN6D 1TNDA 2GZHA 2OCYC 3PVSA 4DUGA 5KUTA 1WBDA 4N1AA 5HCNA 3TUJC 2Z83A 4ESVA 1UBCA 4JLDA 3ICQB 1BS1A 3B78A 2SHKA 3HJNA 4P4TA 1XCGB 4MITA 3S1AB 3W3ZB 4IHQA 5CK4A 1KK2A 2NO1A 2XZPA 4GL2A 1TPZA 3C7KA 5HR5A 1CEEA 3OFNA 2OAP1 1W0KA 2JJ1D 2OXCA 4URZR 4B2IA 2AWNA 1MKYA 2DCUA 3T5DA 4GMXA 4DIEA 5EXXA 5EJEA 5K8LA 5DGXA 1CJKC 2P2LA 1KI8A 4IDOA 3IEUA 2PBRA 1TEXA 1VCNA 2QEQA 3A1WA 1NG1A 2BEKA 3AV0B 3UMFA 2VHTA 2IYUA 2ZRHA 2EU8A 2WV9A 3CLVA 3P4YA 4QXAA 4TL9A 4LWZA 2ONJA 1M2OB 2JLQA 3H0KA 5BYKA 2DBYA 1QVRA 2R6DA 4E07A 4OQXA 1EESA 1OH7A 4AYWA 1NVVQ 4DSNA 3SQXA 1ONBA 4DVGA 3SJCA 2YOGA 1D2EA 1TQDA 4A1FA 2O8CB 2ZRJA 2CHVA 4KO8A 3V9PA 2FSHA 2IEZA 3QENA 2F3TA 4QJ5A 4UQOA 2FH5B 1ZU4A 2FOLA 2RGNA 4MYHA 4PHHA 5HKKD 1OB5A 3FGNA 1XPRA 1JR3D 1FX0A 4HDQB 3BJIC 3EIQA 1WB9A 5KSYA 3MD0A 4M1YA 5FR1A 1NVXQ 2QZ4A 1XB2A 4A2QA 3NVAA 2QP3A 4C2UA 2QTFA 3U7FB 1UM8A 2FJUA 1OXUA 1NKSA 1NVWQ 1KKLA 1U98A 4AKGA 2CCKA 3QBTA 1RPZA 4DDWA 4ZKDA 1UKYA 1OT3A 4KYIB 4TMVA 1ZD8A 4TLDA 1R2QA 4NYMR 4EUNA 1QBKC 1AN0A 1NSFA 3MWJA 4JBWA 4HSEA 2L0XA 1E32A 1L2TA 1Y3AA 4F4CA 3ZDQA 2CJWA 3U3KA 1XMIA 2XNDD 1N6NA 3EC2A 3BS4A 3SBDA 2VP0A 2O0JA 1PVOA 3A8TA 4ASUD 1WCV1 1ZD9A 2V9PA 3X1YA 2MSEB 4B75A 1KAGA 2VYFA 3L82B 2FPLA 1YE8A 2GAOA 2R8RA 4A82A 1R5NA 1JEDA 1GOTA 4BLTA 1Z83A 1U0HC 3UPUA 2VEDA 1LF0A 1M7GA 1E9CA 2ZIAA 3CWZA 4EQ6B 4IOLA 3T15A 1TF5A 1NMYA 2JJ8A 3IBGA 5FBRB 1A7JA 1W47A 2CCJA 2IBMA 5TDHA 2ZS9A 3CPJB 5L3SB 3EZ6A 1OIXA 1Q22A 4QJ3A 3KFXA 2Q6TA 5DLQC 2Z6VA 3QG1A 1N6KA 1K5DA 4MRSA 1ZU5A 2VP6A 5F2EA 1XTSA 2J1LA 3I92A 4Z8YA 2IT1A 3RANA 1U0JA 3DL0A 1K8RA 1SXJE 3CX8A 2DFTA 5SZHB 4EAQA 1FUUA 3I8SA 1XXHB 3KQUA 3GJ5A 3HR7A 4DEYA 3GCGA 2A30A 2DHRA 3NBFA 4DLYA 5CLLA 5CJ2A 3AVVA 1W0JA 3T61A 3QBVA 4TL6A 2H1LA 2XSZD 1XCMA 1FNNA 2I3BA 5DNYB 2YZ2A 4AIIA 3VX3A 5J47A 3AVQA 2IW3A 2F6RA 1L4UA 5EXPA 2QMOA 4PZZA 1KI6A 2FFBA 721PA 2WIAA 1RRGA 1G19A 2ZE8A 1HT1E 1D2MA 2G6BA 1HT2E 4CT4B 1BMFD 2ZTSA 1P9RA 2VHUA 2DFNA 5FBLB 3TLXA 3MG9A 1XTJA 3AH8A 2WJIA 2OCPA 3SJAA 1YR6A 2XGJA 1EX7A 3ZVNA 4URXR 1UKEA 1XD9A 1PLLA 2ECKA 2QTHA 2CL7X 3KJIA 3B2EA 2QE7A 3VR5A 3QEOA 4Z1MA 3DOEA 3W9YA 3AM1A 1N5KA 3P26A 5FH9A 3K0CA 4CVNA 4V03A 4HI0E 3EIEA 1HUQA 3FVQA 4BZPA 4JYBA 1HURA 1XJCA 1YJ5A 1I2MA 2W0SA 4IW3B 4JS0A 3SN6A 5J4HA 4XWOA 3GLHA 4G3XA 4TZ0A 4C0SA 3FHCB 4ZCIA 3ZD6A 1R10A 4ZI3A 2QRNA 1LB1B 2YC2C 3NEYA 1GKIA 4JYCA 4ZDWA 2FZ4A 4AG5A 5K8IA 2WMNB 5FPHA 4C0KA 2D2FA 4A8JA 4B3FX 1NIPA 1YRBA 1Z0JA 3VR2A 5A0FA 1XZPA 1V5WA 1ZIOA 1HH4A 5FI0B 1T6NA 2ZS7A 5JJKA 3I8XA 3KTAB 4GOJA 2QSZA 1Z6GA 2ANCA 4LJ7A 3VQTA 3K0SA 3FHTA 5FL7A 1U8ZA 3JVUA 2VP5A 3VFDA 2H5EA 4MKFA 3X1ZA 1P2UA 1IN7A 1Q1EA 2Z4RA 5LB4A 3U44B 2ZRPA 4M9SA 2FEMA 4AG6A 2CEAA 4XVUA 1KMHB 1N6RA 1OFHA 1YHNA 4JLBA 2IUUA 3ZS9A 3O8BA 1A2BA 5AJWA 3WY9A 4BUJA 1Z0IA 3AP3A 1COWA 2EFCB 1W4AA 4ZDJA 2I1QA 2K5UA 5EP2A 3SR0A 1PJRA 3AKCA 4QM6A 1JAHA 2YOHA 4P4UA 1F2TB 1UAAA 2IXGA 1ZYUA 4O0MA 1NN0A 3BFXA 2YOFA 2IYYA 1U94A 1DAIA 2WJYA 3TH5A 3K09A 4Q21A 1TX4B 3IGFA 2IXFA 2W58A 2HT6A 1CULC 4BFTA 3LFUA 1C4OA 5D3QA 3RWMB 4EFMA 5FTMA 1H65A 1P2SA 4QM7A 2O8FB 4AI6A 5L3RA 2FNAA 4OK6A 1IXSB 2XTNA 2ZUCA 2XNDA 5FI1B 4POAA 2X2EA 1C1YA 4HAWA 4H1UA 4G5RA 3FFAA 4Q7KA 4KVGA 4OI1A 3QPUA 4YDSA 1P2TA 2F43B 1BO6A 1TF2A 3GJ8A 2CL6X 1PUIA 4XD7A 1GP2A 3HPRA 3ZIAD 4D4KA 3WP1B 5EE3A 3LQQA 1ZJ6A 1XEFA 4Z54A 2BKEA 1T0HB 4RZXA 4AYTA 1T5IA 2RGGA 5B2ZA 1VIYA 1D8TA 4XWKA 2JLVA 5GADl 1X6VA 2QMEA 2NZJA 2OO7A 1KJYA 4Q1AA 1ZC4A 2NPIA 4JVNA 3U7EB 1KI1A 2DPXA 1E9DA 5TVKA 3H86A 1E2MA 5LD2B 4O3MA 3U61B 2QGNA 4C7OA 2QG6A 2JIZA 2PX0A 4DDVA 4BE7B 1U9IC 2PEYA 3AVTA 1W2HA 3VU9A 2WM9B 1KMQA 3DEFA 3AUYA 4LPSA 1A1VA 3REFA 2ZE6A 1Z3IX 1L7VC 4L9SA 2Q0HA 5KO2A 4WVFA 5FFMA 2FZLA 3BIFA 1KSFX 2OEPA 1CKEA 1DG1G 2Q3MA 2E9SA 2DYKA 1N0UA 5L3QB 1DS6A 2XSZA 1R8SA 3QKSA 4RCYA 4B76A 4DSOA 4US0R 5JJLA 1P60A 3OIYA 1DTSA 4DSTA 3AVXA 1YRAA 4KBFA 2QP9X 1E2KA 4O2LA 2O8BB 1P61B 1G6HA 1G17A 4ERNA 3IDQA 4J0QA 2ZETA 2HXSA 3GLGA 4ASUA 1WA5A 1N5JA 3B1ZA 4GMDA 1LS1A 1M6NA 3O8DA 4B3CA 1M7HA 3KKQA 1LFDB 4JVMA 3RRYA 3UANA 1KDOA 3LW8A 1W36D 3RRNA 3EXAA 1AA9A 3K70C 3NEJA 1HQYE 3K0FB 1KJWA 2KWIA 2QQ0A 3D8BA 1ZUHA 2C78A 3FKQA 4OQMA 2W6JD 4PAMA 4Q66C 3SJBA 1HY3A 1M7BA 1DPFA 3GPLA 2O5VA 5LD2C 3IHLA 3BOSA 3TK1A 3KXIA 1F2UB 4PPQA 4D0NA 4HLCA 4JLVA 4XH9B 4IEIA 3U5ZB 3DMDA 3PENA 1M8PA 2J0VA 2ZJYA 3CR8A 5AUNB 4EFLA 3Q5DA 2W2TA 3OEEA 4NHOA 4Q1DA 2WPDD 4JMPA 3FFBA 4XSHA 4C3ZA 2BIFA 3IQWA 3OFND 1U90A 3TAHA 4AKHA 4LC0A 2WWGA 5KOYA 1JPJA 4P4SB 1NN1A 3B1XA 2FX3A 1VMAA 5BN5A 4OQNA 2C8VA 1OE0A 4FXPA 5J4VA 4JLJA 2GVZC 4URYR 4GFDA 3E70C 1KO7A 3OE7D 2N1BA 5C4GB 1XPUA 3GLHB 3FMPB 3FKSD 1E3MA 1UFQA 2GDJA 2ODWA 4IRUB 1KO1A 1JPNA 5EXSA 1RYHA 2WSSD 4KXFB 5BN4A 2RHDA 3W8RA 4UKDA 3DZDA 2E87A 4LYHA 4Q9HA 3KQLA 4TMKA 1YZNA 1YZKA 2D3WA 3D31A 4D81A 3S1AA 1N6LA 5KDDA 3EPLA 3K9NA 4N0DA 1S9DA 5JWHA 3B9QA 2P67A 1GFIA 4KJZA 3GLFB 1II8A 2VBCA 1NLFA 3GJ4A 5FTNA 2A5YB 2C99A 4NYJR 4CT5A 1D9ZA 1U0LA 4TLBA 5DHFA 2WJVA 3MCAA 3GFTA 4QC2A 2QPTA 3U44A 2XTMA 3NBZC 1YR8A 4NZYA 2R44A 3ZQ6A 2QGZA 4ON9A 1QF9A 4QNRA 1RFLA 1KIMA 1KY3A 2V1XA 1EX6A 1G3MA 2YV5A 3ND8A 1E9AA 1Z6TA 4E22A 2ZYVX 4MH0R 2IS1A 1NLZA 1EFTA 1YZUA 4DHEA 3DOFA 2ZROA 3MWLA 3WYAA 4YONB 2N46A 3GEHA 2FGKA 3NG1A 4LC1A 3K70D 1EG7A 1CR2A 5EQTA 3GLFA 1EFHA 1EFUA 4BECA 3IO3A 1IM2A 4PPNA 1XTKA 1N6HA 1R4AA 2XX3A 3WNDA 4EFNA 4IOJA 5JCZA 4DT1A 2V8OA 1Q12A 3SE0A 4DDUA 2NO9A 4UNQA 1WE2A 4LBWA 1IHUA 1KTVA 3K0EA 1NRJB 1S2MA 1SVOA 1U81A 2J45A 3LD9A 3M4YA 3EZ7A 2FFHA 3CNNA 3HPQA 1FPMA 2GF9A 2PCJA 5CYPA 5G3ZA 1KDRA 1GILA 3HR8A 3QF4B 3A58B 4H1VA 2JLZA 3C15C 1SVIA 1JJ7A 1DAKA 3L0IB 2D2EA 2CE2X 4HAYA 3CIOA 3TIFA 3ZVRA 2VTKA 1NMZA 2VLIA 4KU4A 4ZIRB 1W7AA 5AR1A 2G0NA 3DZ8A 4UXJA 1X8KA 1XP8A 1P7CA 3TJZA 4ABYA 2OV2A 3C16C 3K9HA 2BM1A 4JIMA 4BLOA 4QOSA 3HYRA 4GZLA 1UBFA 2C77A 4PZYA 1ZNXA 2F1IA 5TXGA 5IDVA 1J8YF 3G5UA 3WMGA 4AWXA 4Z1MD 3AVUA 4EPRA 4LDJA 4X8LA 2JLYA 5JI2E 4LV5B 3ETLA 3SHWA 3GLHE 1E1QA 1Q3TA 1QG4A 4II7A 1DADA 4YXWD 2P6NA 3D6TB 2F9LA 2Z43A 3QI2A 1BYIA 4CF7A 1KKMA 1OH5A 1XTIA 4WZ6A 3PJRA 4Q5IA 4LY6A 1L4YA 2REOA 2VSOA 4PHTA 1CR0A 4O2RA 1G41A 1IQPA 1UBEA 2C96A 2OXRA 4KV9A 3R7WA 4DEXA 3BXZA 2GVDC 4URUR 3WNBA 5FUWA 1VG9B 3PCRB 4M22A 3UWOA 5BWMA 3QY0A 2A7QA 1OLOA 2LKDA 2C9CA 3K9GA 4LJ8A 4QFMA 1JQLB 3GLIA 3CONA 3Q5EA 4NH0A 2C9YA 4OYHA 1YZLA 2WSMA 1E1RD 2XJ9A 3AB3A 2QTVB 1EWQA 3EW9A 4JVLA 2C5LA 3O8RA 1RC8A 4I1UA 2AFHE 1UJ2A 2F1HA 4IFEA 4M1OA 5LBIA 1ZM3A 5B57C 3UG7A 2FEOA 1E96A 3PEUA 5HE9A 4A9AA 2WICA 4QBGB 5G40A 2GK7A 4PSVA 2FPMA 3KKNA 4B44A 1XCPA 3I61A 2GHIA 4NU0A 1N25A 4Z51A 3DKVA 1XRJA 4OQFA 4F38A 2NG1A 3CX7A 3O8CA 3QKUA 2ZRBA 3TUIC 1XEWY 1P72A 3BH6A 1E99A 3K0FA 4BZQA 5FBVB 3CRMA 3EZ2A 2JIZD 5L8VA 1GZSA 1NY6A 4A6PA 4V02A 3RS2A 1Q1ZA 3AF0A 4A8JB 4D82A 4Q4HB 3KDSE 3WHLA 5HCIA 4BEJA 1N6PA 1R5BA 1IN5A 1SULA 4PQRA 5AJVB 1NP6A 4M4SA 1GL9B 4DB4A 1LS6A 3SQWA 2GBLA 2ZI4A 2A9KA 3NC1C 5C46F 3ASYA 1FW6A 4Z8XA 1M74A 3SEAA 2PMDA 2FV8A 2GA8A 1FL9A 3B5JA 3N2IA 3LBHA 4BFUA 4RD4A 2WBLC 1KMHA 2A5JA 4HB4A 1YR9A 4Q4JB 5EP1A 1CJUC 3THYB 2EWVA 3SFVA 2J7PD 4LHWA 5BW8A 1N0WA 3QKSB 2C95A 3DM9B 2VP9A 3N70A 4EIWA 4ZI2A 4M21A 2P65A 2GCNA 4YMVA 2GJKA 4LJ9A 4HDCA 1MABB 5AUPB 2J87A 5KDLA 1W5TA 2AD5A 3Q72A 2JAQA 2OLJA 5GJCA 4TYYA 1S4QA 3U6KA 4PQFA 1G16A 2B8TA 5TY0A 3PXGA 4D4JA 1KYIA 1X86B 1AGRA 4YXWA 4R2IA 1ESNA 1X1SA 1UADA 1OW3B 1J7KA 3FB4A 3QJYA 4R9UC 3RS3A 2VSXA 4JSTA 2CLDX 3UMSA 3KB1A 4IDNA 4LHVA 5JI3E 4WA7A 3G82C 1T9HA 2Z0MA 1IJEA 4LCBA 1FP7A 4Q7MB 1E9FA 1AQUA 4C0HA 1KK1A 3CX6A 4M1WA 2W6IA 4IVQA 1XEXA 2MMCA 1KSGA 3GD7A 5FPTA 2PH1A 4ZKEA 3ADBA 3Q9LA 4PX9A 1J8MF 1SHZA 2ZRFA 3AVPA 4EDHA 2JEOA 4KITB 3DO6A 3EWSA 2A78A 1E2EA 2XZOA 4URVR 4Q1FA 4E03A 4L15A 1RJ9A 1FFHA 3GEIA 3RC3A 5G53C 1CF4A 4M9ZA 1IN4A 2ZITA 3H1TA 1EFRD 1E4YA 2BJWA 3K9LA 4Q00A 3SFZA 1VG1A 5FTJA 2GETA 3VTKA 2JLUA 5EUQB 2B6HA 2IYWA 2P5TB 1T5LA 4CRWB 3R9XA 1I4DD 2H16A 5KPDA 1GM5A 3F5FA 2QA5A 5FUVA 4MYTA 3OEHA 1AIPA 2VHJA 1NG9A 4D25A 4GPTA 4JLNA 2F3RA 1DO0A 4AK9A 4B3XA 4OKSA 1TF7A 3LV8A 4A92A 2JLSA 3PUXA 4QGAA 2YWGA 4B48A 3U4QA 1V43A 2ZREA 1OB2A 1TQ2A 1Y63A 1W0KD 2JJ1A 5AWFC 4I1VA 4B3DA 4B32A 4MYCA 3LA6A 1AS3A 1UEJA 1KI4A 1ETUA 3IKJA 2IYXA 3X1DA 1MV5A 3CM0A 5JZVA 3C4JA 3IIKA 3PUZA 4A36A 1OXVA 1W1WA 2BBSA 3DKPA 3HWSA 4OJKA 4GRAA 1O87A 2ZJ8A 1E2NA 4FWIB 4PC7A 1GNQA 3C8UA 4NYIQ 4TT3A 1QDEA 2ODNA 1YZGA 1HTWA 2ZANA 5E3HA 5JWRA 5IRCD 1R6BX 4NL4H 5DO9A 3THOA 1G8PA 1GNPA 1QHYA 3E1SA 5F98A 1US8A 3RDPA 5C18A 1W4CA 3VR1A 2GJAA 4ZDIA 2HLDD 3ADCA 1RZ3A 2ZE7A 3PQCA 4MRVA 1RRPA 5JBQA 4OHYA 2VF8A 3ZVLA 2PL3A 3CUEF 4XTRA 2ZJ2A 2ORVA 2QE7D 2FFAA 2H7VA 1VECA 2ZPTX 4XJXA 5FR2A 5TMPA 2ORWA 4KODA 2XNSA 1E2HA 1E2LA 4EPYA 2ZRMA 4A15A 1CJMA 1DBSA 4B74A 2ZJOA 2WPDA 4HYYA 1DAMA 1QRAA 1XJ0A 2ATVA 3P27A 4V0MA 4PC1A 3TSWA 2HF8A 2DFLA 2CK3A 2KBFA 1XXHE 4G5SA 5J40A 3AF2A 1U8YA 3JVVA 3W90A 2IHBA 2LKCA 1SQ5A 3WYGA 2BMFA 4XIGS 3NHAA 2QT1A 3CPEA 3IQXA 3I1FA 1BYUA 1S8FA 4FIDA 3BBPA 1OFIA 3ZGXA 4LPKA 2OFXA 2HCBA 1U8AA 3GQBA 2OILA 2IYTA 3C41J 3FMFA 5KNCA 1OV4A 4XWAA 1XEWX 4JLAA 4GBMA 4NYIR 1XMVA 3TMKA 1MO6A 4TTRA 3UATA 3VR6A 4KLNA 4P4SA 4RSGA 3LH5A 4NKRA 3UXMA 3SYLA 3DM5A 3QXHA 4FINA 4DLWA 2OG2A 2H57A 1H8HA 3LVRE 1KGDA 1KI6B 1H8HD 1E2QA 3LO5A 4FMDF 4BLPA 4JJZA 3U2QA 4ACBA 1ZW6A 3AKEA 1SKYE 4GT1A 1F6BA 1Z08A 3L8ZA 3RAPR 1WBBA 2QAGB 3MWYW 4NDZA 2ZU0C 3TGPA 4C2TA 4W5JA 2CVFA 1YZQA 3MWKA 3WXMA 1VIAA 3QQ5A 1Z6YA 1ZNZA 3RYTC 1G8YA 1ZNWA
chains in the Genus database with same CATH superfamily
1QONA 4M1SA 2NZVG 4Y7DA 1AB5A 4BU0A 3DZFA 1L7DA 4IKEA 3QGMA 4WOCA 3VHXA 4BVHA 4ICIA 1ZBDA 3KKEA 1BX0A 3QXCA 3B52X 1G2QA 2D5CA 3I34X 3HB1A 4BQIA 3JVEA 4EJFA 1EGAA 3I45A 4K81B 2CE7A 4MWBA 2YRFA 1A76A 2W6MA 9LDBA 5LQKA 1P7WA 4XFDA 2ISSD 2FW9A 3QNUA 2R5WA 4AYXA 1F0YA 2R65A 3NBAA 2OPBA 4PYLA 5JCOC 4PXSA 3V55A 1GR0A 2ZJAA 3RW9A 1TT7A 2QUJA 2O8EA 5TARA 1YA4A 2I6TA 4ETMA 1FVXA 3CX4A 3QVMA 4Z5XA 1QDLB 2FPUA 1SA0A 3ORHA 4NC9A 1GPNA 1PK9A 1P73A 4GX1A 4IIXA 2O20A 2FHSA 1T8PA 1QQ5A 4U2CA 5IJAA 2EDCA 1F8UA 4UPEA 4LSZA 1WV1A 2HJSA 3O2SB 1BNCA 2R96A 1R0LA 1KSJA 1M34E 1K5GA 4LY9A 4R2JA 5BNIA 3P4UA 2QD2A 4MR9B 5IZ4A 2B3TA 2PRJA 3LXRA 1XCLA 2RGBA 5FWXB 4DLNA 2GRAA 3SQLA 3DOJA 3DH0A 4OAOA 1SXGA 3UT0A 1ZLYA 1JG1A 3ZWYA 1UEIA 1WXIA 2EGHA 2QRUA 5EWLB 2R47A 3VC2A 3OSUA 5HIKA 2CL0X 5KNBH 1AO0A 4LI0A 5GZ3A 1HDZA 2G6TA 5JC8A 4U7WA 3IUBA 2HSDA 2IW1A 4IJ5A 2QVZX 3EEIA 3D2CA 5KJEA 4B7AA 3RARA 2XXAA 4JJ6A 4R6WA 1IVSA 1I01A 2R6GA 4J7AA 2WTUA 4UEJA 4B6GA 1FS5A 2WYWA 4A5OA 5EHXA 3PD7A 4P3XA 5A05A 4MLZA 3FAZA 1I5OA 2G63A 2VQSA 3HFJA 1BHQ1 3HKCA 3TG8A 1OFUX 3FXAA 2ZJ4A 5BNFA 1XZEA 2OYRA 1JJBA 3SD7A 1X3LA 4MGIR 5F33A 4ALIA 3NORA 3IAS1 1K3FA 1V8DA 2DUMA 1DKLA 1WUJS 2PHZA 1Y1RA 3LG2A 4LSWA 2A67A 1K63A 1B8OA 3TXXA 2BDEA 2QXTA 1FBNA 3AJ8A 5EXTA 1PWYE 4NMMA 3QEKA 3V8QA 3CRVA 1VPVA 3KQWA 3A6EA 1QRRA 1Y48E 2VK1A 3MSXA 4QL3A 2ZS8A 2QPLA 3G8AA 1XN4A 1J2TA 4X61A 5ERYA 2JFZA 1QHGA 2CHEA 3EXIA 3TRKA 1YS2X 2A0XA 3ASUA 4MMXB 2Q3LA 3RYHB 1Y3CE 4BB0A 1FYDA 3GFBA 4MVWA 3NQ41 1A9SA 4CODB 3VR4H 3IPRA 1G38A 1XDDA 4KQFA 4PR0A 3RHFA 5I7UA 1ZVVA 1QMPA 2O2CA 3IT3A 5A5VA 1I0LA 1B8UA 2O8FA 1RQPA 2VDNB 1DQSA 2OAGA 2OZEA 1T3TA 1R0WA 4HVTA 2C3OA 2ST1A 3FN4A 4WXRA 521PA 3T9DA 1H2RS 1J97A 2F64A 5AJYA 1BDIA 4M55A 4HC4A 1CUCA 2JFVA 4KQCA 4B6FA 3AY0A 3IV9A 3ZXXA 3ESBA 1ETHA 3C3DA 3MW8A 5EZ6B 3BKWA 3SHOA 4D99A 4EGSA 2X0JA 2WAXA 4HB2A 4EHBA 1H1LB 2PMWB 1NUPA 3Q0TA 1WD7A 1V3UA 4I5FA 1W5AA 5F73A 4XCVA 3S99A 3NV9A 4KG7A 4EARA 1PBTA 3B5EA 2N42A 1EM6A 1QYXA 1S8OA 4L0QA 4Q9DA 1CX9B 2XMSA 4BB9A 4PO3X 4DPMA 4DGQA 4Z9FA 1MO2A 3FUTA 5M29A 2DSNA 2F59A 2PX4A 4BX3A 2I3GA 3NBQA 4DMMA 1J1ZA 3OJCA 1PG5A 2Q27A 5IAOA 3RVRA 2KB0A 3FKJA 3SBOA 1NBOA 2BCEA 2I7TA 3NVDA 4FT4A 4OBEA 2NZ2A 5EMHA 2PRKA 2R6JA 4H3SA 1LTKA 1MGPA 2VRBA 5LA6F 2IYLD 1F5NA 3T1YB 3Q11A 2ZYRA 1J06A 3UAGA 4AS1A 2QXYA 2AG0A 4ROTA 3PVZA 3ZH9B 1KI9A 1JR3A 3DVQX 3FGPA 4ZJZA 3HU3A 2ZRIA 4YNBA 2K2WA 4W1QA 4IO0A 3EE6A 1TZ2A 3SJZA 3STWA 1NVFA 2VDQB 4IDEA 4BMNA 1QS0B 1U6IA 1QQ7A 1QGAA 3PDUA 4RPCA 1O97C 2G28A 2ZSIA 1UK8A 4PCAA 3BILA 4OFWA 5EY5B 3R5SA 1U2ZA 3JQAA 5NULA 5I9LA 1Q77A 4B1FA 2HNBA 3TQQA 3OHPA 1CG6A 4Y98A 1PJBA 1N92A 2H59A 4O8CA 4CBVA 4C2BA 4EZIA 3QFTA 1M0WA 3ADKA 3GLTA 4FZRA 3NCTA 4W5QA 1J99A 3VYSB 9ABPA 3AO0B 3BRQA 3Q7QA 5LP1A 2WTMA 2Q7XA 2FXVA 3HCBA 1RQGA 3M1IA 4Y1EA 2CKMA 4Z0NA 1SC1A 3VDRA 4PSUA 1GA1A 4TTQA 3ACBA 2AWOA 3K15A 3T7IA 3RSGA 4C3UA 2JLWA 1USIA 1UKZA 2X7XA 3GNSA 4EDFA 4I55F 3DHWC 1DMRA 1XQYA 5FP0A 4NXMB 1BE1A 2ARKA 2MU1A 3OG9A 3P2MA 3QPWA 4XYBA 2ONKA 4K9SA 3USES 1JXOA 3KR2A 5J5VA 1VBKA 4ZT6A 5A9SA 1OZGA 1PGJA 4YP1A 3EGDB 2RARA 2OM6A 1ISPA 1JB9A 2GBGA 2VWQA 3S2UA 1KEEB 4BGUA 1UPUA 1MH9A 4TUYA 1VC2A 5EP4A 4D26A 3C3WA 1YBAA 2EKDA 3A1TA 4CEIA 2OHJA 4Q9AA 3I3OA 3V4PB 2MDTA 4I1OA 1ODLA 3JTMA 5D5PA 4E88A 1I32A 5K09A 1SG6A 4E5SA 5H4GA 4QJBA 1QZTA 3SWWA 7ABPA 1A8PA 2R5FA 3H11B 2UZ1B 3A05A 1YMUA 2VK8A 1GZUA 2Q5CA 4YO7A 4HK4A 3W1WA 1CF2O 1L8QA 1ZWLA 3A4NA 3TRDA 8LDHA 3T9EA 3E82A 3M6LA 4A0HA 5BSFA 3OEWA 2R6CA 1MX5A 3VTFA 3E0XA 5K4HA 3KKLA 3DQQA 3U19A 4JXKA 4TXHA 1JFSA 4DB2A 1C0LA 3C85A 3L43A 2PMBA 2JRLA 3D4BA 1XL1A 3ZZUA 4AB1A 3D1LA 3DWGA 2O8DB 4D2IA 4RNCA 5FADA 3PRHA 4TWJA 3ZX4A 5LWHA 3H99A 4K9LA 4O6VA 2EFYA 2O6LA 3HO6A 3OESA 4MR8A 2I29A 1V7ZA 3AR6A 4RUKA 2GEUA 3DE2X 4PFQA 3PYLA 3EVFA 5D85A 3LBNA 2C3PA 3NT2A 4RTLA 5TQVA 1B3BA 1S2OA 3A1VA 5MGNA 3ZNPA 3PR2B 5I47A 2DQYA 1QGUB 3GGJA 3O0TA 4HSGA 1EVIA 4GGOA 3NC4A 1ZJWA 1S9HA 1RAAA 3NOOA 3GWZA 4WN9B 3SC4A 2B92A 4O4IA 3MCWA 1PTJA 2O1WA 4KLRA 1KAEA 1UBLS 4MB2A 3QYPA 1Q91A 2I99A 1IJFA 4ZTZB 3B89A 3LTEA 2BCGY 3VR5H 3O4FA 4JP3A 4A8PA 2X9LA 2HYIC 1OTHA 5K8VA 1FLNA 2ZB2A 1RCTE 1EUDB 4TKVB 4GGMX 3Q3VA 2JBAB 3LRTA 4HQFA 5EMMA 4R31A 2XVZA 3H0EA 1Q17A 3DBHA 1T9ZA 5JLAA 4EA8A 4V0OA 3WMFA 4RA9A 3SLKA 3RFXA 4X0EA 1SUCA 5CIQA 4DAEA 2ZR0A 1EP1B 4OSEA 1LX6A 1VIVA 2JBHA 5FX2A 3QTBA 3RVNA 2DB3A 1MABA 3NUGA 3WJAA 2JI7A 2I4NA 5IJXA 2QAGC 4OM7A 3G0DA 3J81A 3EF1A 3R40A 1Z28A 4ED9A 3T4EA 1H69A 2AJ8A 4TMZA 3AHGA 1C8LA 4E5DA 2FWNA 1W93A 2C4VA 2C9ZA 1UZAA 3HI6A 4NOKA 4DDHA 4W5NA 3IP5A 1L5HB 3HZOA 4GOKA 3RV3A 5JOQA 1FPQA 4LFBB 5DTRA 4G84A 4CLHA 2Y0BA 4ZAYA 3QKRA 2PWYA 5EKDA 2OO5A 3U9LA 3LRPA 3T1QA 2RAFA 1PAUA 1E7QA 3TJMA 3JQ6A 1J0CA 2ZWVA 4JT4A 2P3SA 3BK2A 3ZQKA 3OIUA 3K1ZA 5BSVA 2A9FA 4FHEA 2OHGA 3GL9A 4EPTA 2PWBA 4FMDB 3OT4A 4WXMA 4XLLA 1AGYA 2EJTA 4G5XA 3VO2A 4Z4FA 3AX6A 1RDFA 1U0TA 2E89A 2W0MA 3GVPA 4BUCA 1KETA 3JTEA 3H1BA 4DLVA 4OTZA 3RVBA 4DF3A 2EP7A 1RKBA 4RD0A 3ELYA 5ALXA 4OHZA 2QVYX 1AZSC 3GGGA 2E5FA 3KYBA 2ZI3A 3N0XA 5DJ5A 3E5HA 3B48A 4JJAA 4GEKA 1S89A 1FDUA 2CHQA 2RHRA 4MWSA 2X58A 1XMJA 3OA2A 4P82A 4G4JA 3LCRA 3N8IA 1HYQA 5EHGA 1CZNA 2C8JA 3BF8A 2OT3B 3CV3A 3HP4A 4HDKA 1Y4UA 3EXHC 3DOUA 3KQQA 3KQYA 5MF6A 3FI0A 3W3AA 1F7UA 5F78A 3PDJA 4DUGD 4L0MA 1KERA 1IONA 1WWKA 4KI0A 4AMVA 1JA0A 2L2QA 5K8TA 3PCTA 3RHTA 3M6VA 1EFPA 1H4TA 4QHYA 1CZUA 4QOFA 2R6R1 4QSMA 4QRDA 4Q9LA 5CLFA 3W5UA 2QN9A 5DXFA 4LOAA 1WUKS 3CE6A 4Z7JA 4CWAA 2HWXA 1G7SA 3IUMA 1ZRNA 3WLRA 2F1KA 4A8HA 4E94A 4MX8A 2N75A 1UR5A 4RVUA 4JI1B 1HNWB 2XEXA 4Q7LA 4Y0VA 1YB6A 2VDUE 2Y1EA 3DMTA 3RQSA 1YQQA 1MJHA 1R64A 1NW7A 1W30A 3AM3A 3INGA 4HDMB 5K20A 1A8UA 2HIHA 3N3AC 4L2IB 4FDAA 1VSBA 5HIIA 1D07A 3QF4A 4NPCA 2M2IA 5J2TA 5KMGB 4U5XA 2GJ4A 4Y8VA 3KFVA 1DOHA 2AXNA 3CPHA 4OGLA 1T91A 1L7RA 2CLHB 2ZIVB 2BGKA 3AJ9A 3BMNB 3QUCA 4K6GA 4TGLA 5KB3A 1NMQA 2OSVA 2P6RA 4D97A 2ZAOA 4PZ9A 1EP2B 3GRAA 4HB3A 1RWMA 1JTFA 4EEKA 4B4VA 4BNKA 4YJHA 2P78A 1ECFA 2BHNA 5L3SA 4RXTA 4HUQA 4UASA 2FZWA 2J0UA 3HUEA 4FQ8A 1SVLA 5CA1F 1EAYA 1U80A 5FUYA 4LRUA 1RLJA 3GT4A 3Q4GA 4HDAA 1OKKA 4Q3NA 2WKWA 2YYZA 3WZ2A 4DSZA 1WDMA 3BZBA 1VDMA 4LYGA 2BFEB 4BQOA 2WKQA 2X3YA 1SELA 1W85B 4M8KA 3OF2A 3TKLA 4J3JA 3FUVA 3OO1A 3WKAA 4UNRA 3WI7A 4B6SA 3SZRA 4EAAA 1JILA 3JWPA 1SXPA 3Q0EA 4YQEA 1A88A 3H2SA 2GN8A 1XDBA 3U49A 1M34B 1ZY2A 1W8DA 2GZ2A 4LXHA 4MS3B 4W1RA 5BYJA 1NNLA 1VHWA 5LR6A 4UM9B 2XXAB 3H8WA 4S1OA 4C1NA 3QUTA 1WQ1R 2HCJB 1FFAA 2ZU6A 1UZLA 2GHTA 2RGEA 2XBLA 3C2QA 2NPFA 3J80A 3P52A 2EOAA 4U6NA 3OZEA 1UC9A 2EFDB 3CUVA 3H05A 3VAZA 2FMIA 1OWOA 3KKPA 3EIXA 5GONA 2JNWA 1XPJA 1UAGA 4Q18A 4REQA 1TM4E 3C14C 3ACDA 1E7YA 1HE2A 5IVIA 3ABZA 2N1MA 1QMGA 3KUCA 4RD6A 4G4GA 4BO1A 2FFRA 3I2IA 4RTKA 3A6LA 2WKRA 1UQRA 3SZMA 4I9FA 1DKNA 4IIJA 3GLSA 1CETA 2EQAA 4NCIA 3VKWA 3ZV3A 4F46A 4W63A 2BGUA 3WQQA 5K0ZA 4PYOA 5IJWA 2XXJA 2XCLA 3LL4A 4Q4HA 3EMDA 3RI3A 3SYNA 3ZZMA 4CM4B 5KOJA 3S2GA 2GKGA 1WO8A 2AN5A 1SC9A 3D9QX 5H3HA 1WDKA 4IGFA 3D6AA 5BR4A 4AZ0B 2I7DA 2DBRA 2QVGA 2BH9A 2EYUA 5CDFE 4QG7A 1MRZA 3T3EA 1ZGAA 2YZ7A 1L5KA 2AOWA 4HQKA 1FRFS 3QSYA 4PHGA 3B7GA 5JC1A 3O7MA 3LMKA 2ZRLA 4EI8A 2VFAA 1EGMB 1UDCA 1G4UR 3WL5A 4DG9A 3ZLUA 1HL3A 3DXZA 3A2KA 1JQJC 3FYCA 1T5SA 4G36A 3ZE8A 5BSTA 3CR3C 3DMGA 1JDZA 5E6SB 3NHWA 1RW4A 4NNPA 4UE3S 2O8BA 5A7FA 1V2HE 3KUUA 4AMBA 2FZGA 4IRMA 2YFHA 2Z2YA 1CUGA 3ET5A 3ZHOA 1TYBE 1BVYF 4MINA 5K3AA 2YJZA 3GT3A 3T9AA 2WD8A 1JP7A 5T7BA 2NZYA 1B8VA 1Q16A 3QPAA 3QVGA 2YQ4A 4LVUA 2GSWA 1CEQA 2V6BA 3VHLB 5B7QA 2C97A 4KFRA 1KAOA 3H9EO 1M6EX 2PUJA 3G79A 1JEYA 4EG5A 2WDZA 4RSHA 5A5GA 3GA5A 2P6MA 2XYRA 2ZYTX 4ZI7B 1SQ0A 3HCOA 4XFKA 1RJFA 4K6KA 4Q3LA 1M2EA 3E35A 3M9LA 4WCFB 3B3JA 4TS4A 3SE7A 3V8BA 4ARZB 1LI7A 2X22A 2FETA 1I9GA 3RASA 1TQHA 3P2YA 3PTLA 4RY9A 1UXHA 3ZZ0A 4XOIA 3S1SA 3NTOA 1GY8A 4NTZA 1NR7A 5FCDA 2QMZA 3BRSA 3PYMA 3SSMA 5JDCC 5EJIA 1NRXA 1SWVA 1UAYA 1UM9B 1Z5NA 1YCDA 2NUAA 2Q0QA 4ENQA 1RQRA 1OKKD 5AOCA 3ZTTA 4UTOA 4E5VA 4EF4A 2VTVA 4OI4A 3AI7A 1J25A 2IITA 2Q45A 4B2YA 4MW7A 2A9VA 4QUBA 3PEYA 5ERGB 2R85A 1LNSA 1VL1A 1NX6A 4IVPA 2JFNA 3QXGA 4QUKA 2EZ8A 3MOGA 3ZV5A 4I4LA 4TWZA 1KS9A 3CJRA 3F71A 4V0ME 1Y1TA 3RVMA 4ZYXA 3ICEA 1PL7A 1AK2A 2AFVA 4KAJA 5DM2A 2B4YA 4AKIA 3R7NA 2CNOA 3JD1A 4ZV9A 4POOA 1HLDA 4WCFA 3OUTA 3FBGA 2PRYA 4MKGA 4JLKA 1XJQA 3Q1LA 5LDDC 1XWWA 3O8NA 3RS5A 3YASA 3FDFA 3OP1A 3T7DA 3BWYA 1BXRB 4CCYB 4Q9IA 2IWRA 3PXEA 3CTPA 4W9NA 2JCBA 1E1DA 4PHFA 1XDGA 3N05A 4WKBA 2JGMA 4C0LA 1EHIA 1V5GA 1QV7A 3WLFA 1NV8A 1FLDA 1X7XA 3D1VA 3E3AA 4CYMA 1HZJA 3SPXA 3V4FA 4C4XA 1L4KA 2PUDA 5DBEX 1UBHS 3PC4A 4PX5A 4HAVA 3BHMA 1V37A 3NTUA 2CL5A 4AF6A 1Y1QA 3BG5A 1LA2A 2OBMA 4G25A 3P4XA 3EOZA 3WK8A 3VM6A 1IOZA 3EF3A 4B6PA 1RZRD 5UKDA 1IZ9A 3D59A 3GC6A 1PZGA 5LKRA 4CEIB 4UUPA 1VBMA 3ROPA 4F72A 1G6Q1 4L2IA 4XJVA 2Z4SA 2RHLA 2XCRB 3EYWA 3JWJA 3JRWA 3LDAA 4OVKA 1WUIS 3FRHA 1Q0QA 2DFKB 5HPYB 5LZ2A 2R86A 3O3CA 3AONB 4P1ZA 1FXSA 3NTQA 2ZUTA 4P4GA 2ZJ6A 5IUNC 2IK8A 3IAFA 3VV2A 5HSGA 2VN8A 4Q6WA 3S55A 4BIIA 4YCAA 1THGA 2B2CA 2ZWMA 1TO6A 2EZ9A 1N0VC 1FP6A 2PKYX 2ZIZA 3GLKA 1BE6A 1A2KC 2FE4A 2JIRA 2NTYC 4JA0A 4P32A 1WHTB 5TMBA 5BN5A 5LNK6 4X8HA 3AVYA 2PZEA 3LWNA 3ROKA 1H3NA 3DAPA 1ADBA 4TVKA 3A26A 4LJYA 1P0QA 3PFWO 1FDWA 1PEAA 1WP9A 3ESXA 5DX1A 2P9QA 5J9FA 2RIRA 2NTJA 2GN2A 1XKLA 4WFIA 2CBXA 4KX5A 2X9GA 1OV6A 2Z3ZA 3MRSA 1W4LA 3VZQA 5DTIA 3ZD9A 2GLTA 4B6EA 5JS7A 3IV6A 3OWOA 4AZ3B 1R0ZA 1P9OA 2OQ2A 4L9RA 3P97A 4UATA 1AHPA 1A9OA 5I8ZA 3SC3A 3A9SA 4R8MA 2H9AA 5K0EA 1RXYA 5HUHA 2VT3A 1Z73A 3QQPA 5LDGA 2QAGA 1K8XB 1UPFA 1M2WA 3HBMA 4QT0A 1ZSYA 1E3LA 5DNVA 3R7AA 4EGJA 4FZVA 7ADHA 3BFVA 4NK5A 4C1BA 4FW9A 1JI0A 1X80A 2GF2A 2OWEA 3ACCA 1QFZA 4NF2A 1NP3A 3WA7A 3HB0A 3NAMA 1B23P 3TEMA 1K4YA 3RSCA 1CFJA 3KE8A 3NHUA 4G89A 4HNSA 2CFSA 5I5GA 3T3DA 4Q7JB 4HWTA 5HRCA 3SR4A 4LF6B 1C30A 1WZNA 3TLGB 4WQMA 4I4TA 3RJTA 1RMTA 3PU6A 5FF9A 4QGFA 5GVRA 1JU4A 3EGCA 4FFBB 2V8BA 4RLQA 1H66A 4BDSA 5BR1A 1MAAA 1KVSA 2NP7A 2YV2A 1I4WA 3RWBA 3E3OA 4L9WA 4O33A 4QWWA 5JZ9A 3PUHA 2IPMA 3BXOA 3GYGA 5LYYA 3UGTA 1E6EA 2EYQA 5H0IA 2P2GA 3NHYA 2UXBB 3FZNA 1XAGA 3N8GA 4C0QC 5KHLB 2HA5A 1Z33A 3Q2KA 4NFYA 4KWHA 3J7AC 4RLSA 5DM4A 1WR8A 3D81A 1KMMA 3LYUA 8OHMA 2WSBA 4OBWA 4P2BA 2ZSDA 1L5NA 3HN7A 3LUBA 3RVOA 4JLPA 1T34A 2YINC 4KDCA 3E7DA 1R9MA 1QJ4A 2GESA 2R4TA 4GXNA 3CYFA 4OYLA 1NQXA 3VYWA 4DR4B 4BFZA 1RTKA 4YCDA 1KSHA 3MJVA 2B2XA 1RLUA 4OHOA 2HM7A 4BXOB 2XW6A 2AD1A 3AK4A 5A62A 2LNDA 2H1SA 1Z0DA 3M6AA 4CFYA 2VDLB 2GPWA 1E89A 3HHPA 4JQCA 1Q0UA 2DP4E 2VDKB 4FP9A 4Y6SA 4M38A 2G9ZA 4BASA 5FJIA 1ZRHA 2IF2A 1HM5A 3TVTA 4B2PA 4R3NA 1PJ2A 3DLPX 3HXKA 2RJ3A 5FRDA 2RH5A 2QLNA 2UVDA 3KM0A 4PGGA 1WOMA 4EB3A 1REQB 4IY1A 3ZD8A 1RMQA 1Z06A 4HDKB 3OLYA 4JJKA 4MWOA 4PZLA 3DMTC 1OMOA 1RQNA 1T36B 4EYSA 1IM5A 1ZX1A 2Y05A 3BCSA 1HWYA 3PA6A 3K4HA 3PQ4A 3BC1A 4OLFA 4YDHB 4RCVA 5LKAA 1H8ED 1H4SA 1M8KA 2NVUB 1WUHS 3H7AA 5KSZA 3WV4A 1S7GA 2NSJA 1MCZA 2PUWA 4MW4A 3LUDA 3W4JA 1FSFA 2QN8A 5G0WA 4BQQA 4TYQA 4W5RA 5F23A 1C2TA 5AW9A 4RULA 4QGSA 5LA6A 1IPEA 2YWDA 3IXLA 1OD6A 2UVQA 5DLYA 3FYDA 5F77A 3WK9A 1VSTA 1UL1X 1W6RA 1OXKB 3LAWA 4YRFA 2Z6QA 1KY2A 3LJKA 2CLSA 4F91B 1JKJA 1Z3CA 3F9IA 5B3JA 3CGGA 1M1YE 5CITA 1SXJB 3PIIA 3GR6A 5DPMA 4DR1B 5BOSB 4BO2A 3W6NA 1L7XA 4OB8A 5HMLA 5I9SA 2QJTA 2D7JA 3AW9A 3M6FA 5JCPA 5A71A 3E9EA 1Z5OA 4G1UC 2PLFA 3QX3A 1N7JA 1BWSA 3M2TA 1WMAA 3D4NA 3GX1A 3IAM6 3IESA 1PJTA 4YP0A 1JNXX 1HZZC 3I5XA 6AT1A 3BWXA 4HZIA 4YP9A 4QJIA 4DCMA 1VLVA 1K2WA 1Y7PA 2JF0A 2B30A 4DEVA 1EXVA 1EFPB 1XK6A 3LQYA 1ENYA 3RC9A 2OTCA 3X1WA 2CJYA 1ZUWA 1RHKA 2V7QA 2XF2A 1ORIA 4OEHA 3CMMA 2IHNA 2X7JA 3HP7A 4DBLE 3BORA 4EB6A 2FSPA 1XYVA 3O4VA 3QTTA 2IU0A 5DYTA 4Q4AB 5JFTA 2UXCB 1CDEA 1HEUA 3KHTA 1BDHA 1TAHA 4WLNA 5SY4A 3UMBA 2FEKA 3WLAA 1L1RA 2VYNA 3FVVA 3QU2A 3R6GA 5KI6A 1QX3A 3AEUB 3KSMA 3Q7EA 4E2ZA 2BP7B 2V5UA 1JSXA 4Q4JA 4F2WA 4E5UA 1U1DA 4IKOA 4DKXA 3EIWA 5DH9A 4RGBA 4W6QA 3ML1A 1G0OA 4NBKA 4C87A 1C7QA 1DJMA 3EA0A 2XMPA 1GLGA 1VL8A 2CXRA 2J6BA 2XIQA 3G9UA 5K6TA 3SI7A 5EVJA 3H11A 3UJBA 4DYHA 5L95A 2MJLA 1P9NA 1RYNA 1MB0A 2OO3A 4X7RA 1SOVA 2IXTA 2H4JA 2XQFA 1E8NA 5IBQA 2ODEA 3I4CA 2OPHA 2EX4A 4B3BA 1NBME 1ZSNA 2QDXA 2JKYA 5FT9A 1ISGA 3AETB 3LGXA 3JSAA 2O8DA 3AEUA 4NZNA 4CLOA 4V0SA 5THQA 2BD0A 3MM4A 2FPIA 3B82A 5JAZA 4HJXA 1DINA 4M7PA 1I1HA 4JVSB 4TQAA 5HGXA 3HUFA 5I3CA 5AVXA 4R8KA 2INGX 4RF5A 1B2LA 3IULA 2QY6A 3MTJA 1BWQA 3DDCA 3K53A 2IU4A 3ZWQA 1SZJG 821PA 2PJZA 1DBQA 2PUAA 4NENB 4AQ7A 3LUCA 5TR9A 4Y2UA 1OLUB 1X8LA 4P54A 3JAMA 3FYUA 1MFZA 2WM3A 3C8MA 3FZEA 3QMPA 4BNTA 3KOMA 1C7FA 1WCIB 4QECA 1OFTA 3TIIA 5K0SA 1KJZA 1OPXA 3WJ1A 3PGKA 1DC8A 1V5FA 1J2YA 4CKBB 3A6JA 4F5WA 1QK4A 1S3SA 5FORA 2DCMA 3BM5A 8ADHA 3EAFA 3OIGA 1AZTA 2C4UA 2H5IA 3MMPA 4LHZA 4RD3A 1M2NA 2RKOA 2X0RA 3C6KA 1QZUA 1YB5A 3RGGA 4BV8A 1ISRA 2G83A 3LNCA 3BCUA 3O1HB 1CQPA 2FUEA 3SYKA 4L28A 1NTRA 1GUFA 5CIYA 1GPJA 1OXTA 2H1RA 2DR3A 3LBIA 1II9A 3T5PA 1GXSB 2UAGA 2YWCA 1NDQA 5TJ9A 5A6SB 3CRW1 4LYAA 2QTCA 1DHRA 1NATA 1PIWA 2HHJA 2RI0A 1JEEA 1W75A 1ZJ4A 1FNSA 3X2EA 3PIRA 1J70A 1NN3A 2BFFB 1U9ZA 2Y1GA 3IL2A 3ECAA 4D46A 3PS9A 5IAJA 1YGPA 4R2HA 2VTEA 4JYZA 5IWAB 2BVNA 3E7PA 2UDPA 4F86A 4ENPA 2J5XA 2J9RA 2HKIA 3THYA 1SMKA 1VYVA 2CBGA 4IP0A 1F6DA 3F1LA 5CH8A 3URKA 3WP0A 3INNA 2FMTA 4D1YA 1T9BA 3LHKA 4JJFA 3UOGA 3ZUPA 3VTZA 3KOWA 1ZVKA 3MIZA 5SZIA 4F04A 5AOAA 4MZXA 5B36A 2GUGA 2YXLA 2YR0A 1BCSB 3A6FA 3WYBA 1W8IA 3I9OA 4MV3A 4GQIA 5CLHA 4B4WA 2QYOA 3E1KA 1N1MA 4LDNA 1YAJA 4RS3A 4XX0B 3VAAA 4DR3B 2QRLA 2VS1A 3QFRA 1V9SA 3S40A 4DTIA 1T8TA 2TMYA 4X20B 3DMFA 1PBNA 1RBQA 5PNTA 3PHIA 5J4YA 5KPJA 1XNGA 5CFOA 1L8AA 4IWYA 3U37A 4RW0A 1QRDA 4B83A 4NDNE 5JBNA 4F1JA 2OBLA 1KO4A 3C1AA 2HBYA 1P4SA 3KJGA 3PXUA 4NPHA 5GGYA 1WP4A 2DPGA 3V97A 3DLHA 1YR7A 3Q2OA 4FQ5A 1ZQ9A 1YV9A 4JWTA 4HXGA 4WV3A 1ARZA 4DC9A 4HADA 5DGTA 2NU7B 3DAYA 5AVYA 1KL7A 2VHCA 1V11A 4RESA 3EXEA 4NWIA 4V2IA 1BCRA 1W49A 1NNSA 3KQPA 2GYUA 2IE0A 1G5IA 3P9IA 5B1EA 1V8BA 4G63A 4BFLA 4LXIA 1MW9X 4PC3A 2Y4OA 2XMZA 5F9MA 4BO7A 1QQBA 3AUKA 4EG3A 4PW0A 3IO5A 1G20E 1VYHA 2BRUC 2EERA 3M2PA 5EPOA 3FGZA 3OX4A 5FA6A 7REQB 2AVNA 1PTJC 2FG5A 3PFIA 5JSFA 2CSUA 3R77A 1NQAO 4QZVA 4LTNA 2ZUEA 1AHNA 1W94A 5LQCA 3U5TA 3MHTA 1CW2B 1I6LA 1AKEA 1PR1A 1SC6A 3JQBC 2HJRA 3H5WA 4L73A 3T9CA 5CFLA 2HMAA 1JJAA 2XMBA 5D84A 3VSAA 4S1NA 4E4RA 5K9ZA 1A97A 2PSFA 3TDKA 3OFVA 4JI0B 4BY9E 1AX9A 1RPJA 4IHAA 5DNUA 3AFOA 3CVVA 3ZDCA 4CQNA 1EFRA 2HADA 2NTEA 1OXXK 2MSLA 2DR2A 4KFTA 3BERA 3ZW9A 4IVRA 2I3ZA 2GLUA 2PD3A 1NLYA 1IWOA 3EEYA 1E59A 1CTQA 2ZSUA 1P29A 3H2YA 4IIFA 5FTWA 5K6RA 5KOHB 1C9NA 2FKAA 4O63O 2VQFB 1WNTA 2UUBB 3MGKA 4EK9A 1BEEA 3T06B 2ZVPX 1YNOA 2JGRA 5FAKA 1PNTA 1GAJA 2UV8A 1M9NA 3MD9A 4OHMA 1T36A 1BVRA 2CMDA 3SMQA 4QVKA 1XTPA 4IIDA 2HGSA 4P31A 4FGJA 3E5NA 4JB0A 3ESYA 3O93A 1L8XA 3V6LA 1XQ1A 3A2LA 3IUYA 4X41A 2OHHA 2J9XB 4LXYA 3CT6A 4AROA 1JSZA 4OYYA 8GPBA 5AXAA 1L0BA 1RBZA 2PR2A 1DELA 3GIDA 3GPDG 2R8EA 4RSRA 2C5FA 4TMTA 5FPYA 3WQSB 2W42A 2P9BA 3BMXA 3K20A 1J20A 2F67A 1AXGA 2OSBA 1MG5A 1RR6A 2AVDA 2J3JA 4GZ5A 4IDHA 1NTOA 3E8XA 2N0SA 4PPFA 4QUDA 4R7ZA 3GLFE 3OC0A 1Q7EA 4URFA 4L3OA 1U1GA 3FYHA 3OLCX 1S3GA 3DTVD 5F3RA 1RSZA 1UBMS 5I7WA 1I1NA 3B9PA 3GZNB 3OPNA 4X93A 5CB4F 5EJ8A 1TQ4A 2H3HA 5C34B 1C2YA 1MJGM 1JKFA 1YKGA 4NR0A 4C06A 2HXYA 4QARA 1X92A 4XCXA 1UC8A 3BD7A 1FTYA 1YZYA 3QVWA 3P9PA 1T8YA 2PRSA 3A2NA 4O2BF 1CUYA 1U8FO 2ZI9A 3RK4A 3DBRA 3AEZA 2V7GA 4I8IA 1FQJA 1KAQA 2FLKA 2O48X 4RMGA 4TN1A 3GNLA 1KZYC 3BRWD 4M0CA 1W34A 4CKWA 1JA9A 1GU1A 4HX2A 2YJGA 2AN1A 5B37A 3BK1A 4MVYA 3RBXA 2WF7A 3TNYA 5JD6A 3TZCA 1FTNA 3MWGA 3B36A 3KSAC 1J5EB 3D5QA 2XLBA 1N5IA 3I52A 5F3WB 1C1XA 3QEJA 1UUFA 4KMOA 2H4FA 4PF1A 3L8GA 1DQYA 4PLTA 1GAQA 5F2KA 5C51B 1TTTA 4I08A 2XRMA 1G9XA 4WBNF 4MI6A 4EBBA 5DHTA 1XDZA 3IAUA 5HJ2A 3TCKA 1GYPA 5AVZA 2DWOA 3ZCTA 5BWCA 1RMYA 1TJNA 2JA1A 3LLCA 4HYTA 1FNMA 4MEJA 5T64A 1YZTA 2EJVA 5CNMA 1CRWG 3ZE2B 3IERA 3ZLVA 2A0UA 5CA0A 1IIBA 1GIAA 1ECGA 1WDWB 3C43A 2IYZA 3HKBA 3W77A 4FSDA 5DK4A 5AMXA 2ZUDA 4ROSA 1YOVB 4HGNA 5JRZA 3E9ZA 1XRSB 3RQIA 1J2JA 1E2IA 1Q0ZA 1UPTA 1GPDG 3TZHA 3O6VA 3PWTA 3ZY3A 5AM2A 4MJ3A 3IPAA 5T4HA 1ZOIA 5FNVB 3QJGA 4EJSB 3CSUA 2JCGA 4JKYA 4BKMA 1S01A 4G0NA 4OHKA 4WNAA 1QHSA 2GEBA 3I9JA 3THSA 1JL3A 3PG5A 1N32B 2FQWA 4JX9A 4O1HA 3GLIE 2G9QA 3KYCB 5HJEA 2ODAA 1Z2CA 2RB4A 3F3SA 4PYQA 5KQGA 2XUGA 5HS6A 3NHPA 4QPNA 5B64A 1UDBA 3EQ6A 2PT5A 1BOFA 2C03A 5BSUA 2FPIB 1MHTA 2VL7A 4MPPA 3RSFA 2HBRA 3WDLA 1NW4A 2EKLA 3LT2A 1ZVJA 2O1EA 3ZOZA 4B71A 1VMDA 2WOJA 5JECA 3IVGA 4BS9A 1OR8A 2A86A 3EBOA 5FEMA 5E3JA 2FZ5A 4PBTA 4R41A 2BSXA 4XX1A 3Q7TA 3SK0A 2H3EA 2R6AA 1BVHA 1CHNA 4RF2A 3LLUA 4TTJA 2EFEB 2I03A 5F9FA 2RI6A 4XPIB 5ENVA 1LFAA 1SY7A 2FKNA 2BM9A 4HS9A 3SX0A 5JEEA 2QBYB 3OAAD 4PX2A 4UNPA 2D1FA 4KIUA 1JT2A 4Q19A 4M36A 2QR5A 4XGKA 4LN1A 1D6SA 3VR3D 4X62B 4PNHA 4DR6B 3HU5A 5HIAA 1NVUQ 2FFJA 1PNOA 4Y3UA 4ANFA 4ZOLA 5JHHB 4Z7OB 4MUMA 2HX1A 4BVGA 2BMVA 1G18A 5LZ9A 4M8LA 4JHLA 2F7SA 1ZI9A 1X7ZA 2R8YA 4QAQA 5JDIA 3KZ1E 3I04A 3RSZA 1IRXA 1TKCA 4EUSA 5D3MA 1E3WB 1WLYA 2XT9A 5JSYA 4U7FA 1HDOA 3Q9NA 3V00A 3R7SA 3VJMA 3NDPA 5DCUA 3F97A 3C0KA 4M0UA 4D74A 4KVFA 2B9VA 2HU2A 4G4SP 3PJFA 3QMWA 1JB1A 4H7PA 1EVJA 4KO4S 5A03A 2NO6A 1OZFA 4JX8A 1JG6A 4B33A 1ZMRA 4KEAA 1DXHA 4ZEXA 1NAIA 1HFWA 3RT7A 3C3PA 1Y6GA 1TUEA 3WV5A 4ALJA 3QV1A 1DVRA 2EKPA 6ABPA 2QTWB 1Z5ZA 2AXPA 4IJMA 4UD6A 5HF9A 5THKA 4IXMA 3HU1A 1X14A 2QW8A 5FOTA 1FFSA 1TAQA 5DGHA 2JDID 2R751 1KR2A 2L18A 4GOOD 1JEOA 4WBNB 5I5EA 1ND5A 4J90A 4RENA 4N1AA 3TUJC 4HQ6A 4JLDA 3NP9A 2Y92A 4EO9A 1IL0A 2Z9DA 2BJHA 4H59A 3HXOA 1YQUA 3B78A 4P4TA 1LJ8A 3S1AB 1QHEA 1PS9A 4GLBA 4E1BA 4BV9A 2NO1A 1IK6A 3SSOA 1JSCA 3C7KA 2JIQA 4MQEA 5HR5A 1BJTA 3UAVA 1U8UA 4X1YB 2OAP1 2PUTA 2D5AA 2Q3CA 1MKYA