1X90A

Crystal structure of mutant form b of a pectin methylesterase inhibitor from arabidopsis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
147
structure length
147
Chain Sequence
EMSTICDKTLNPSFCLKFLNTKFASANLQALAKTTLDSTQARATQTLKKLQSIIDGGVDPRSKLAYRSCVDEYESAIGNLEEAFEHLASGDGMGMNMKVSAALDGADTCLDDVKRLRSVDSSVVNNSKTIKNLCGIALVISNMLPRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords invertase/pectin methylesterase inhibitor family protein
publication title Structural insights into the target specificity of plant invertase and pectin methylesterase inhibitory proteins
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 65
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 1x90A00
1RJ4A 1XG2B 1X8ZA 1RJ1A 2CJ6A 2CJ8A 2CJ5A 2XQRB 2CJ7A 2CJ4A 1X91A 1X90A
chains in the Genus database with same CATH superfamily
2BU2A 3MPJA 1EGDA 4Q4UA 3C2PA 2YYMA 1OAHA 5M4MA 2DVLA 4FF1A 2CJ5A 4OO2A 4ZXVA 2D29A 1GU6A 1LVCA 3C3LA 1U8VA 2ZAFA 3S7WA 1RP3A 3KMLA 5B5VA 5K3IA 1JQIA 3GM6A 2IX5A 3TORA 4JEKA 2CX9A 2PNRA 4V26A 4JIOA 2VIGA 5K3HA 2C0UA 1SIQA 2DDHA 1XFXA 1Y0VA 2C12A 2JIFA 3D6BA 3EONA 2E80A 3D1IA 2BU5A 3OIBA 4L3XA 2EBFX 4AKGA 3D9DA 2EBHX 3TZ0A 4DOYA 2JBTA 4QICA 3SWOA 3BNGA 2Q8GA 3TZ5A 1GKZA 2OR0A 4G5EA 2YYLA 2YYIA 5GJVE 2Q8FA 3VKHA 3B96A 2EBAA 4JIZA 1XFUA 1X8ZA 2FP2A 2A1TA 3BNJA 5B6BA 2XQRB 2XS8A 3OWMA 1S26A 2JBRA 2IX6A 4MP7A 2PG0A 4H7QA 4V25A 3Q22A 2XS1A 4MP2A 1R2JA 2YYJA 2YYKA 3D9FA 1XG2B 4KCFA 1W07A 1SK6A 3FO3A 4FF4A 5M4KA 4KSAA 1FS7A 1Y8NA 4XVXA 3NF4A 2JBSA 4HKSA 3D2RA 4HR3A 4E01A 5M4PA 3MXLA 5K3JA 2FONA 1GKXA 2YYGA 1X90A 4X28C 3OWAA 2Q8HA 2Q8IA 3PFDA 3C46A 4AKHA 1EGCA 2OEVA 2CJ8A 5J6AA 1Y8OA 2F6LA 2GBBA 3UU9A 3AFEA 1RJ4A 3EOMA 3P4TA 4FF3A 1R3BA 1UDYA 2OJQA 5J71A 2CJ7A 3CRLA 2EC5A 4Q5BA 4IV6A 3MKHA 4F0XA 3N0RA 4FF2A 2OT4A 2AO2A 2R0NA 2ZDYA 1XFVA 2WBIA 4L3YA 4X28A 1SC5A 4M9AA 4MPNA 4U83A 3D9GA 4NXLA 1Y8PA 4L3ZA 1RX0A 2RF7A 3R7KA 3X0XA 1WS9A 3M9VA 1FS9A 3RKHA 3X29A 2CJ6A 3UBRA 4G97A 2BU6A 1BUCA 2HJNA 2LFWA 2R0MA 2ZDXA 3CRKA 1PK0A 4H81A 4HKRA 4IRNA 4LQQB 4Q5CA 2J7AA 3AFFA 1FS8A 1SIRA 2RFQA 4L1FA 1EGEA 4KTOA 3LGQA 4LQSB 2BU8A 2ZKJA 3SXQA 5K3GA 2AZEA 2UXWA 2E0AA 1IVHA 1K93A 2OEXA 1XFZA 4O5MA 3TZ2A 3SCEA 3FCJA 3MMOA 3D9EA 5BRKA 3HWCA 1PI1A 3F29A 3MDDA 1XFYA 1K90A 2REHA 3Q24A 3Q23A 1X91A 4Q0TA 3CE2A 2YGWA 2FP1A 3BNFA 3TTBA 3VADA 2RDZA 4E02A 4DZYA 4E00A 4Q17A 5GJWE 1T9GA 2VF1A 4H85A 4MPEA 3L1TA 3VKGA 2ZO5A 1JM6A 5B5WA 3GNCA 1UKWA 1GJVA 4FZ4A 4L38A 4MPCA 4P79A 3LG1A 5M4NA 1XFWA 4J1VA 4W9UA 3Q0AA 1QDBA 2BU7A 1IS2A 2R02A 3GQTA 4WJYA 2BTZA 4N5FA 3SF6A 1K8TA 4KSFA 5BRMA 3II9A 4ZYJA 2Z1QA 2PO4A 3MPIA 4P13A 2QR4A 4KS9A 1RJ1A 4RM7A 2E81A 4Q1OA 2VR0A 3TZ4A 2R03A 3MDEA 2CJ4A 3X0YA 4AI6A 3BNHA 2R05A 4AKIA
chains in the Genus database with same CATH topology
1RJ4A 1XG2B 1X8ZA 1RJ1A 2CJ6A 2CJ8A 2CJ5A 2XQRB 2CJ7A 2CJ4A 1X91A 1X90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJ4 A;  1XG2 B;  1X8Z A;  1RJ1 A;  2CJ6 A;  2CJ8 A;  2CJ5 A;  2XQR B;  2CJ7 A;  2CJ4 A;  1X91 A;  1X90 A; 
#chains in the Genus database with same CATH topology
 2BU2 A;  3MPJ A;  1EGD A;  4Q4U A;  3C2P A;  2YYM A;  1OAH A;  5M4M A;  2DVL A;  4FF1 A;  2CJ5 A;  4OO2 A;  4ZXV A;  2D29 A;  1GU6 A;  1LVC A;  3C3L A;  1U8V A;  2ZAF A;  3S7W A;  1RP3 A;  3KML A;  5B5V A;  5K3I A;  1JQI A;  3GM6 A;  2IX5 A;  3TOR A;  4JEK A;  2CX9 A;  2PNR A;  4V26 A;  4JIO A;  2VIG A;  5K3H A;  2C0U A;  1SIQ A;  2DDH A;  1XFX A;  1Y0V A;  2C12 A;  2JIF A;  3D6B A;  3EON A;  2E80 A;  3D1I A;  2BU5 A;  3OIB A;  4L3X A;  2EBF X;  4AKG A;  3D9D A;  2EBH X;  3TZ0 A;  4DOY A;  2JBT A;  4QIC A;  3SWO A;  3BNG A;  2Q8G A;  3TZ5 A;  1GKZ A;  2OR0 A;  4G5E A;  2YYL A;  2YYI A;  5GJV E;  2Q8F A;  3VKH A;  3B96 A;  2EBA A;  4JIZ A;  1XFU A;  1X8Z A;  2FP2 A;  2A1T A;  3BNJ A;  5B6B A;  2XQR B;  2XS8 A;  3OWM A;  1S26 A;  2JBR A;  2IX6 A;  4MP7 A;  2PG0 A;  4H7Q A;  4V25 A;  3Q22 A;  2XS1 A;  4MP2 A;  1R2J A;  2YYJ A;  2YYK A;  3D9F A;  1XG2 B;  4KCF A;  1W07 A;  1SK6 A;  3FO3 A;  4FF4 A;  5M4K A;  4KSA A;  1FS7 A;  1Y8N A;  4XVX A;  3NF4 A;  2JBS A;  4HKS A;  3D2R A;  4HR3 A;  4E01 A;  5M4P A;  3MXL A;  5K3J A;  2FON A;  1GKX A;  2YYG A;  1X90 A;  4X28 C;  3OWA A;  2Q8H A;  2Q8I A;  3PFD A;  3C46 A;  4AKH A;  1EGC A;  2OEV A;  2CJ8 A;  5J6A A;  1Y8O A;  2F6L A;  2GBB A;  3UU9 A;  3AFE A;  1RJ4 A;  3EOM A;  3P4T A;  4FF3 A;  1R3B A;  1UDY A;  2OJQ A;  5J71 A;  2CJ7 A;  3CRL A;  2EC5 A;  4Q5B A;  4IV6 A;  3MKH A;  4F0X A;  3N0R A;  4FF2 A;  2OT4 A;  2AO2 A;  2R0N A;  2ZDY A;  1XFV A;  2WBI A;  4L3Y A;  4X28 A;  1SC5 A;  4M9A A;  4MPN A;  4U83 A;  3D9G A;  4NXL A;  1Y8P A;  4L3Z A;  1RX0 A;  2RF7 A;  3R7K A;  3X0X A;  1WS9 A;  3M9V A;  1FS9 A;  3RKH A;  3X29 A;  2CJ6 A;  3UBR A;  4G97 A;  2BU6 A;  1BUC A;  2HJN A;  2LFW A;  2R0M A;  2ZDX A;  3CRK A;  1PK0 A;  4H81 A;  4HKR A;  4IRN A;  4LQQ B;  4Q5C A;  2J7A A;  3AFF A;  1FS8 A;  1SIR A;  2RFQ A;  4L1F A;  1EGE A;  4KTO A;  3LGQ A;  4LQS B;  2BU8 A;  2ZKJ A;  3SXQ A;  5K3G A;  2AZE A;  2UXW A;  2E0A A;  1IVH A;  1K93 A;  2OEX A;  1XFZ A;  4O5M A;  3TZ2 A;  3SCE A;  3FCJ A;  3MMO A;  3D9E A;  5BRK A;  3HWC A;  1PI1 A;  3F29 A;  3MDD A;  1XFY A;  1K90 A;  2REH A;  3Q24 A;  3Q23 A;  1X91 A;  4Q0T A;  3CE2 A;  2YGW A;  2FP1 A;  3BNF A;  3TTB A;  3VAD A;  2RDZ A;  4E02 A;  4DZY A;  4E00 A;  4Q17 A;  5GJW E;  1T9G A;  2VF1 A;  4H85 A;  4MPE A;  3L1T A;  3VKG A;  2ZO5 A;  1JM6 A;  5B5W A;  3GNC A;  1UKW A;  1GJV A;  4FZ4 A;  4L38 A;  4MPC A;  4P79 A;  3LG1 A;  5M4N A;  1XFW A;  4J1V A;  4W9U A;  3Q0A A;  1QDB A;  2BU7 A;  1IS2 A;  2R02 A;  3GQT A;  4WJY A;  2BTZ A;  4N5F A;  3SF6 A;  1K8T A;  4KSF A;  5BRM A;  3II9 A;  4ZYJ A;  2Z1Q A;  2PO4 A;  3MPI A;  4P13 A;  2QR4 A;  4KS9 A;  1RJ1 A;  4RM7 A;  2E81 A;  4Q1O A;  2VR0 A;  3TZ4 A;  2R03 A;  3MDE A;  2CJ4 A;  3X0Y A;  4AI6 A;  3BNH A;  2R05 A;  4AKI A; 
#chains in the Genus database with same CATH homology
 1RJ4 A;  1XG2 B;  1X8Z A;  1RJ1 A;  2CJ6 A;  2CJ8 A;  2CJ5 A;  2XQR B;  2CJ7 A;  2CJ4 A;  1X91 A;  1X90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...