1X93A

Nmr structure of helicobacter pylori hp0222
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
43
structure length
43
Chain Sequence
b'TRAVSLYFSDEQYQKLEKMANEEEESVGSYIKRYILKALRKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein HP0222
publication title Helicobacter pylori protein HP0222 belongs to Arc/MetJ family of transcriptional regulators.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 11
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1x93A01
2BJ3A 2CADA 1NLAA 1ARRA 2WVEA 3FT7A 2JXGA 4ME7E 1EA4A 2HZVA 2WVDA 1IRQA 1MYKA 1PARA 2BNWA 2H1OE 2BJ1A 2JXIA 1B28A 2CPGA 3VW4A 2CAJA 2KELA 2BA3A 3OD2A 2K5JA 3H87C 2WVFA 2BJ8A 1P94A 2HZAA 1X93A 2K29A 4FXEA 2BJ9A 1ARQA 3VEAA 2WVBA 4HV0A 1BDTA 2BNZA 2K9IA 4D8JA 1BAZA 1U9PA 2BSQE 2AY0A 2K1OA 1MYLA 1QTGA 3VEBA 2GPEA 1BDVA 2K6LA 3QOQA 2CAXA 1MNTA 1Q5VA 2RBFA 2CA9A 2JXHA 3GXQA 2BJ7A 1B01A 2WVCA 3LGHA 3FMTA
chains in the Genus database with same CATH superfamily
4NRUA 2WVDA 1IRQA 1PARA 2BJ1A 3H5XA 4NRTA 3SFUA 3VW4A 3G5OA 2K5JA 2WVFA 1SH2A 2HZAA 3NO7A 2K29A 2BJ9A 1ARQA 3IR7A 2K9IA 4D8JA 2JBVA 2K1OA 2K6LA 1MNTA 2RBFA 2CA9A 3GXQA 2WVCA 2WK4A 3H5YA 1NLAA 2JXGA 4ME7E 1MYKA 3QIDA 1B28A 2Q2KA 4LRVA 2KELA 3OD2A 2AN7A 2WVBA 1BDTA 2BNZA 4LQ3A 1BAZA 2BSQE 1BDVA 3QOQA 2CAXA 4AAIA 1SIWA 2B43A 1B01A 3BSOA 3FMTA 2BJ3A 2CADA 1ARRA 2WVEA 3FT7A 2HZVA 2BNWA 3SFGA 2CPGA 2KKEA 2CAJA 4QPXA 3H87C 2BJ8A 1OG7A 1X93A 3VEAA 1U9PA 2AY0A 3UQSA 3VEBA 2UUTA 1SH3A 2ADLA 1Q5VA 1Q16A 2BJ7A 4O4RA 3NAIA 3BSNA 1EA4A 2UUWA 3UPFA 2H1OE 1SH0A 2JXIA 2BA3A 2KOEA 2A2BA 1P94A 4FXEA 4LQ9A 4HV0A 2H3AA 3LJPA 1MYLA 1QTGA 3UR0A 2GPEA 1OHNA 4MJWA 3NNEA 2JXHA 2CKWA 3LGHA 3NAHA
chains in the Genus database with same CATH topology
2BJ3A 2CADA 1NLAA 1ARRA 2WVEA 3FT7A 2JXGA 4ME7E 1EA4A 2HZVA 2WVDA 1IRQA 1MYKA 1PARA 2BNWA 2H1OE 2BJ1A 2JXIA 1B28A 2CPGA 3VW4A 2CAJA 2KELA 2BA3A 3OD2A 2K5JA 3H87C 2WVFA 2BJ8A 1P94A 2HZAA 1X93A 2K29A 4FXEA 2BJ9A 1ARQA 3VEAA 2WVBA 4HV0A 1BDTA 2BNZA 2K9IA 4D8JA 1BAZA 1U9PA 2BSQE 2AY0A 2K1OA 1MYLA 1QTGA 3VEBA 2GPEA 1BDVA 2K6LA 3QOQA 2CAXA 1MNTA 1Q5VA 2RBFA 2CA9A 2JXHA 3GXQA 2BJ7A 1B01A 2WVCA 3LGHA 3FMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ3 A;  2CAD A;  1NLA A;  1ARR A;  2WVE A;  3FT7 A;  2JXG A;  4ME7 E;  1EA4 A;  2HZV A;  2WVD A;  1IRQ A;  1MYK A;  1PAR A;  2BNW A;  2H1O E;  2BJ1 A;  2JXI A;  1B28 A;  2CPG A;  3VW4 A;  2CAJ A;  2KEL A;  2BA3 A;  3OD2 A;  2K5J A;  3H87 C;  2WVF A;  2BJ8 A;  1P94 A;  2HZA A;  1X93 A;  2K29 A;  4FXE A;  2BJ9 A;  1ARQ A;  3VEA A;  2WVB A;  4HV0 A;  1BDT A;  2BNZ A;  2K9I A;  4D8J A;  1BAZ A;  1U9P A;  2BSQ E;  2AY0 A;  2K1O A;  1MYL A;  1QTG A;  3VEB A;  2GPE A;  1BDV A;  2K6L A;  3QOQ A;  2CAX A;  1MNT A;  1Q5V A;  2RBF A;  2CA9 A;  2JXH A;  3GXQ A;  2BJ7 A;  1B01 A;  2WVC A;  3LGH A;  3FMT A; 
#chains in the Genus database with same CATH topology
 4NRU A;  2WVD A;  1IRQ A;  1PAR A;  2BJ1 A;  3H5X A;  4NRT A;  3SFU A;  3VW4 A;  3G5O A;  2K5J A;  2WVF A;  1SH2 A;  2HZA A;  3NO7 A;  2K29 A;  2BJ9 A;  1ARQ A;  3IR7 A;  2K9I A;  4D8J A;  2JBV A;  2K1O A;  2K6L A;  1MNT A;  2RBF A;  2CA9 A;  3GXQ A;  2WVC A;  2WK4 A;  3H5Y A;  1NLA A;  2JXG A;  4ME7 E;  1MYK A;  3QID A;  1B28 A;  2Q2K A;  4LRV A;  2KEL A;  3OD2 A;  2AN7 A;  2WVB A;  1BDT A;  2BNZ A;  4LQ3 A;  1BAZ A;  2BSQ E;  1BDV A;  3QOQ A;  2CAX A;  4AAI A;  1SIW A;  2B43 A;  1B01 A;  3BSO A;  3FMT A;  2BJ3 A;  2CAD A;  1ARR A;  2WVE A;  3FT7 A;  2HZV A;  2BNW A;  3SFG A;  2CPG A;  2KKE A;  2CAJ A;  4QPX A;  3H87 C;  2BJ8 A;  1OG7 A;  1X93 A;  3VEA A;  1U9P A;  2AY0 A;  3UQS A;  3VEB A;  2UUT A;  1SH3 A;  2ADL A;  1Q5V A;  1Q16 A;  2BJ7 A;  4O4R A;  3NAI A;  3BSN A;  1EA4 A;  2UUW A;  3UPF A;  2H1O E;  1SH0 A;  2JXI A;  2BA3 A;  2KOE A;  2A2B A;  1P94 A;  4FXE A;  4LQ9 A;  4HV0 A;  2H3A A;  3LJP A;  1MYL A;  1QTG A;  3UR0 A;  2GPE A;  1OHN A;  4MJW A;  3NNE A;  2JXH A;  2CKW A;  3LGH A;  3NAH A; 
#chains in the Genus database with same CATH homology
 2BJ3 A;  2CAD A;  1NLA A;  1ARR A;  2WVE A;  3FT7 A;  2JXG A;  4ME7 E;  1EA4 A;  2HZV A;  2WVD A;  1IRQ A;  1MYK A;  1PAR A;  2BNW A;  2H1O E;  2BJ1 A;  2JXI A;  1B28 A;  2CPG A;  3VW4 A;  2CAJ A;  2KEL A;  2BA3 A;  3OD2 A;  2K5J A;  3H87 C;  2WVF A;  2BJ8 A;  1P94 A;  2HZA A;  1X93 A;  2K29 A;  4FXE A;  2BJ9 A;  1ARQ A;  3VEA A;  2WVB A;  4HV0 A;  1BDT A;  2BNZ A;  2K9I A;  4D8J A;  1BAZ A;  1U9P A;  2BSQ E;  2AY0 A;  2K1O A;  1MYL A;  1QTG A;  3VEB A;  2GPE A;  1BDV A;  2K6L A;  3QOQ A;  2CAX A;  1MNT A;  1Q5V A;  2RBF A;  2CA9 A;  2JXH A;  3GXQ A;  2BJ7 A;  1B01 A;  2WVC A;  3LGH A;  3FMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...