1X93A

Nmr structure of helicobacter pylori hp0222
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
43
structure length
43
Chain Sequence
TRAVSLYFSDEQYQKLEKMANEEEESVGSYIKRYILKALRKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helicobacter pylori protein HP0222 belongs to Arc/MetJ family of transcriptional regulators.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords hypothetical protein HP0222
total genus 11
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1x93A01
1ARQA 2BNZA 2BJ9A 1IRQA 2HZVA 2WVEA 2CAXA 2K29A 2KELA 1BDVA 3GXQA 1B28A 1X93A 3VEBA 2CADA 2K1OA 1PARA 2JXGA 1P94A 1BDTA 1QTGA 3FT7A 1MYKA 1MNTA 1B01A 2K5JA 2RBFA 2BJ3A 2JXHA 1NLAA 1Q5VA 2GPEA 2K9IA 3QOQA 2BSQE 1ARRA 2CAJA 2WVDA 2K6LA 4FXEA 2WVBA 2BJ1A 2JXIA 4ME7E 1EA4A 2BJ7A 2CPGA 2BNWA 2WVFA 4HV0A 2CA9A 4D8JA 2BJ8A 3FMTA 3H87C 3VEAA 2BA3A 2H1OE 1BAZA 2WVCA 2HZAA 1U9PA 3VW4A 1MYLA 3OD2A 2AY0A 3LGHA
chains in the Genus database with same CATH superfamily
1IRQA 2WVEA 2CAXA 1SH2A 1P94A 1Q16A 2K5JA 2K9IA 2WK4A 1ARRA 2K6LA 2CKWA 3SFUA 2JXIA 4ME7E 2AN7A 2WVFA 3SFGA 3H87C 3VEAA 2B43A 2WVCA 1U9PA 3NAHA 1OG7A 2KOEA 3LGHA 1ARQA 2BNZA 2HZVA 4QPXA 2K29A 1OHNA 1BDVA 3GXQA 1B28A 3VEBA 2CADA 1PARA 2A2BA 3LJPA 4LRVA 1B01A 2RBFA 1NLAA 2GPEA 3QOQA 3UQSA 2CAJA 4FXEA 2Q2KA 2BJ1A 2CA9A 2UUTA 4D8JA 2BJ8A 3FMTA 4NRTA 1SH3A 2BA3A 4MJWA 3OD2A 3H5XA 2KELA 4LQ3A 3NAIA 4O4RA 2JXGA 3NNEA 3NO7A 2UUWA 3H5YA 3G5OA 1QTGA 1MYKA 2BJ3A 2JXHA 2WVBA 1EA4A 2BNWA 2CPGA 3UR0A 3BSOA 3UPFA 1BAZA 2HZAA 2JBVA 2ADLA 2AY0A 2H3AA 4LQ9A 2BJ9A 1SIWA 1X93A 2K1OA 1BDTA 3FT7A 1MNTA 1Q5VA 2BSQE 2WVDA 2BJ7A 3QIDA 4HV0A 3IR7A 4NRUA 3BSNA 2KKEA 4AAIA 2H1OE 3VW4A 1SH0A 1MYLA
chains in the Genus database with same CATH topology
1ARQA 2BNZA 2BJ9A 1IRQA 2HZVA 2WVEA 2CAXA 2K29A 2KELA 1BDVA 3GXQA 1B28A 1X93A 3VEBA 2CADA 2K1OA 1PARA 2JXGA 1P94A 1BDTA 1QTGA 3FT7A 1MYKA 1MNTA 1B01A 2K5JA 2RBFA 2BJ3A 2JXHA 1NLAA 1Q5VA 2GPEA 2K9IA 3QOQA 2BSQE 1ARRA 2CAJA 2WVDA 2K6LA 4FXEA 2WVBA 2BJ1A 2JXIA 4ME7E 1EA4A 2BJ7A 2CPGA 2BNWA 2WVFA 4HV0A 2CA9A 4D8JA 2BJ8A 3FMTA 3H87C 3VEAA 2BA3A 2H1OE 1BAZA 2WVCA 2HZAA 1U9PA 3VW4A 1MYLA 3OD2A 2AY0A 3LGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARQ A;  2BNZ A;  2BJ9 A;  1IRQ A;  2HZV A;  2WVE A;  2CAX A;  2K29 A;  2KEL A;  1BDV A;  3GXQ A;  1B28 A;  1X93 A;  3VEB A;  2CAD A;  2K1O A;  1PAR A;  2JXG A;  1P94 A;  1BDT A;  1QTG A;  3FT7 A;  1MYK A;  1MNT A;  1B01 A;  2K5J A;  2RBF A;  2BJ3 A;  2JXH A;  1NLA A;  1Q5V A;  2GPE A;  2K9I A;  3QOQ A;  2BSQ E;  1ARR A;  2CAJ A;  2WVD A;  2K6L A;  4FXE A;  2WVB A;  2BJ1 A;  2JXI A;  4ME7 E;  1EA4 A;  2BJ7 A;  2CPG A;  2BNW A;  2WVF A;  4HV0 A;  2CA9 A;  4D8J A;  2BJ8 A;  3FMT A;  3H87 C;  3VEA A;  2BA3 A;  2H1O E;  1BAZ A;  2WVC A;  2HZA A;  1U9P A;  3VW4 A;  1MYL A;  3OD2 A;  2AY0 A;  3LGH A; 
#chains in the Genus database with same CATH topology
 1IRQ A;  2WVE A;  2CAX A;  1SH2 A;  1P94 A;  1Q16 A;  2K5J A;  2K9I A;  2WK4 A;  1ARR A;  2K6L A;  2CKW A;  3SFU A;  2JXI A;  4ME7 E;  2AN7 A;  2WVF A;  3SFG A;  3H87 C;  3VEA A;  2B43 A;  2WVC A;  1U9P A;  3NAH A;  1OG7 A;  2KOE A;  3LGH A;  1ARQ A;  2BNZ A;  2HZV A;  4QPX A;  2K29 A;  1OHN A;  1BDV A;  3GXQ A;  1B28 A;  3VEB A;  2CAD A;  1PAR A;  2A2B A;  3LJP A;  4LRV A;  1B01 A;  2RBF A;  1NLA A;  2GPE A;  3QOQ A;  3UQS A;  2CAJ A;  4FXE A;  2Q2K A;  2BJ1 A;  2CA9 A;  2UUT A;  4D8J A;  2BJ8 A;  3FMT A;  4NRT A;  1SH3 A;  2BA3 A;  4MJW A;  3OD2 A;  3H5X A;  2KEL A;  4LQ3 A;  3NAI A;  4O4R A;  2JXG A;  3NNE A;  3NO7 A;  2UUW A;  3H5Y A;  3G5O A;  1QTG A;  1MYK A;  2BJ3 A;  2JXH A;  2WVB A;  1EA4 A;  2BNW A;  2CPG A;  3UR0 A;  3BSO A;  3UPF A;  1BAZ A;  2HZA A;  2JBV A;  2ADL A;  2AY0 A;  2H3A A;  4LQ9 A;  2BJ9 A;  1SIW A;  1X93 A;  2K1O A;  1BDT A;  3FT7 A;  1MNT A;  1Q5V A;  2BSQ E;  2WVD A;  2BJ7 A;  3QID A;  4HV0 A;  3IR7 A;  4NRU A;  3BSN A;  2KKE A;  4AAI A;  2H1O E;  3VW4 A;  1SH0 A;  1MYL A; 
#chains in the Genus database with same CATH homology
 1ARQ A;  2BNZ A;  2BJ9 A;  1IRQ A;  2HZV A;  2WVE A;  2CAX A;  2K29 A;  2KEL A;  1BDV A;  3GXQ A;  1B28 A;  1X93 A;  3VEB A;  2CAD A;  2K1O A;  1PAR A;  2JXG A;  1P94 A;  1BDT A;  1QTG A;  3FT7 A;  1MYK A;  1MNT A;  1B01 A;  2K5J A;  2RBF A;  2BJ3 A;  2JXH A;  1NLA A;  1Q5V A;  2GPE A;  2K9I A;  3QOQ A;  2BSQ E;  1ARR A;  2CAJ A;  2WVD A;  2K6L A;  4FXE A;  2WVB A;  2BJ1 A;  2JXI A;  4ME7 E;  1EA4 A;  2BJ7 A;  2CPG A;  2BNW A;  2WVF A;  4HV0 A;  2CA9 A;  4D8J A;  2BJ8 A;  3FMT A;  3H87 C;  3VEA A;  2BA3 A;  2H1O E;  1BAZ A;  2WVC A;  2HZA A;  1U9P A;  3VW4 A;  1MYL A;  3OD2 A;  2AY0 A;  3LGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...