1X9QA

4m5.3 anti-fluorescein single chain antibody fragment (scfv)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
255
structure length
231
Chain Sequence
b'SDVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPKVLIYKVSNRVSGVPDRFSGSGSGTDFTLKINRVEAEDLGVYFCSQSTHVPWTFGGGTKLEKDGGVKLDETGGGLVQPGGAMKLSCVTSGFTFGHYWMNWVRQSPEKGLEWVAQFRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGMEYLGQGTSVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4m5.3 anti-fluorescein single chain antibody fragment
publication title Substantial energetic improvement with minimal structural perturbation in a high affinity mutant antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 64
structure length 231
sequence length 255
ec nomenclature
pdb deposition date 2004-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x9qA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x9qA02
1BOGA 5DJ0A 4R90L 1P1ZB 1U91B 3VW3H 3WNOA 1HH9A 4KI1A 4X9FA 4GXUM 1V7NH 3O2WH 4NZRH 2W38A 2DQIH 4LARH 3S35L 2FJHA 5F7MC 3TWCH 2R69H 2BY2A 4Y5VA 1I1YB 3BEWA 1GZPA 1RUML 3UJTH 5BS0D 4MD0B 3RVUC 1FV1A 3QNYA 4RGNC 2Q86B 3DVGB 5C09E 5HPMA 5C0BE 1YEJH 5C0BA 4YIQA 4RMUA 3KS0H 5IB2A 3H7BA 5IEKA 3WHXB 5J13B 2BOCA 1NSNH 5DO2C 5DJCB 2QSTA 4A6YL 4PD4J 3DHMA 3BP6B 3TT1H 1J1PH 3U46A 5I1LA 4OM0H 4XX1G 5FHAH 2HG5B 2P7TB 3IETA 5DMJB 1UJ3B 5IHZB 5L2JA 1U92B 3M17A 4M7LH 4XP5H 1FFNA 5GZNC 2X4TB 2APXA 2OK0H 1CGUA 4P3WA 5BS0E 1UC6A 4EN3D 2Y5TA 4IRJC 4DN4H 4FA8A 5GS0H 2X89A 1OD9A 5HVHC 2JE8A 1UQSA 3RX7A 2PYFA 1A1MA 3O6FB 3C87A 4LLVB 4LOUD 4WW1A 5AZ2L 4QXUL 1KC5L 4LLWA 2X9WA 5FYLE 3QXDB 1JV5B 3I85A 3NOIA 4APQC 2F54B 4QY8A 2R23B 3E2HC 4NO2B 4HIXH 2DQTH 5I8CB 3UBXB 5IVXE 2XZCL 3LAFA 3MJ7A 1BWWA 5IFJA 5EPMA 4XMKH 3OKNB 4I3RH 1OAZL 3HZKA 4G42B 4XCEB 2B1AH 5E5RB 4HQQH 3CSYB 1FZJA 4XNZB 5CJQL 4EN3A 5KAQG 3HUJF 3KPRA 5T1LB 4U6XB 1A8JH 4LIQL 4NUJB 5I8EA 2QSQA 1SJHA 2VN7A 3FO0L 4N5ED 4H25A 4PRAB 3MUJA 1ZT4B 1MQKL 1PJ9A 4PGBA 4PJ8A 4YHNA 3UBXI 5J1AA 4TPRH 2VDPH 5E8OA 1ZTXH 4OLZL 1T21B 1IT9H 1X5YA 3F12A 3F7YB 4K8RH 4U1KB 2AKRB 5BRZD 3BGMA 5D1ZB 3RNKB 4L8SB 1KCKA 2WUBH 4WTZG 1S7SB 3HS0A 3OKEA 5LXGL 3G6JA 1P4LB 3GSRB 3MRDA 3PWNB 3HR5A 4PJEF 1RK1B 2VZ3A 3MRHB 2HTKC 3FB5B 4U31A 2A9NH 2FHFA 5D1QC 3G5YA 4GW4A 3WKMH 4FZ8H 4QHKI 1B3JA 2AEIT 2BSSA 4PP2A 3T77B 1B4JH 2YEZA 1CFTB 1B90A 4MJ6A 4PLKC 5DDHB 5JA8B 3ZKSD 4X4XA 1CLOL 4OF6A 1CD0A 3MXWL 4FFYL 4O4YL 4AIOA 4L4TD 2VERN 5GS0D 1E0OB 4W4NA 4OBSA 2J6EL 1C7TA 5BRZE 5GS1A 3RBSA 1R24B 1V8HA 2ZPKH 4RRPA 4IHOB 3CH1A 2X70B 3U79A 1D9KD 1RURH 1LEGB 4WEBH 3B5TA 2VC2L 4YXHH 4MAYA 4Z76B 3MR9A 1ZT1B 4ODHL 4YGVB 4NO3A 3N9GL 5SX4H 2RBLA 1H3TA 2E9JA 3O4LB 3BN9C 5C70A 4KXZI 3V6FB 3KPQB 1GC1C 1NCAL 1T0NA 1HQRA 4OT1L 1FNEB 1T04B 1KXVC 4MNHA 4YHZH 5EZLB 4L4TA 1J8KA 3VXSB 3VA6A 3ULUC 3O6KL 4J3VA 5L7XL 2VLRB 1HKLH 1MIMH 2H6PA 3AS2A 3QIBC 1L7IH 5B39B 3EYUL 4WUKL 1P53A 2VQ1B 5BVPL 2H32B 1K3ZA 4XXCA 1FIGH 3RZWA 2YD7A 1QBBA 1CE1H 1VGKB 1F13A 4XT1C 5HD8D 3WL9B 3CVHB 3QDAA 2E9BA 3NGBC 4MQTB 3S35X 4Z6AT 4KXZH 1OP3K 1YZZA 4KY1H 5B8CB 4L3CB 5HHOD 1I1YA 4FQXD 3A6OA 4KKLC 5DJAB 3LIZL 2FEEL 4MD0A 3O0RH 5T1KB 3F7VB 5F9DC 4M7KL 2Q86A 2B8OT 4NNXB 3DVGA 5FIEA 1S9WB 3Q0HA 5FCSH 4L3EB 5CGMA 1F4WL 5GGVH 4K3EL 1CWVA 5J0BA 1C5CL 1CDCA 3WHXA 4JQIH 1H15B 1JZ6A 3KXFB 5DJCA 2Y5EA 3BP6A 5D1XC 5A2IH 1KJ3L 5FO7A 5C0DB 3LEVH 1RUAL 1WFNA 2HG5A 5F72S 2P7TA 3ULUF 2Y7QB 4PB9H 1UJ3A 1CG9B 3DMMB 5E9DD 1U92A 4OLVL 5HHOE 2GSIA 2X4TA 4NN6B 2WBJC 3X3FL 4RAHA 4IOSD 4MXVE 3F7QA 4DAGH 3T3ME 1CFSA 5B3JE 1C16B 2LTQC 4L9LC 2EDDA 3CDCA 4HT1L 3O6FA 4LLVA 5A2LH 5KVFH 4WEMB 1F6LL 3I3EA 5C0CD 3QXDA 1JV5A 1LEIB 2VXQH 2MHAB 4X6FA 4TSAH 3IB4A 6FABL 2F54A 2DIJA 1EMTH 4NO2A 1H3XA 2H32H 2IF7A 5I8CA 3UBXA 4JHWH 1EHLL 4PS4L 2VDNH 4LCIL 3JWOL 5C2UB 3CVHH 3BKCH 3OKNA 3MGAA 5DVKA 2NXYB 1A02N 4PP1C 4G42A 4XCEA 4ZDHB 5E9DE 2ZUYA 4UMGA 3GSVB 3WFCL 3NN8B 5E9DA 5J9PB 3Q5YA 3CSYA 1C5BL 4YPGA 3SKMB 5C86A 2CKBL 4OIBA 1IKFL 1B9ZA 1YMMD 2FEDC 1ZLWH 1DSFL 5I6XC 5EULV 1X9QA 5CBEA 5T1LA 4U6XA 5EOCH 1AKJB 4X6BA 3H3KA 4NUJA 5C0CE 4U3XA 4RWYH 1KGCE 4PRAA 1ZT4A 3MROB 4XH2A 1PFCA 1YECH 3AY4C 2ZG1A 3TH2T 4DVRH 2VN4A 4J3SA 4LQFL 1T21A 3DVFA 3RZCD 2I5YH 1NKRA 3F7YA 2XI9A 4U1KA 2AKRA 4L3AA 4PGDB 4XCCL 5D1ZA 3BZEB 1IGTB 5FUZH 3RNKA 1M05B 4L8SA 5DRWB 1LP9E 1S7SA 1NCCL 3RAJL 3VMOA 4OZGB 1P4LA 3LN4B 3PWNA 4L8CB 1YMME 4MHHI 2A1WH 4YZFF 1RK1A 2PKDA 5KAQF 2WANA 3MRHA 1L9MA 3KAAA 3ZYZA 2QL1A 4S1RL 3HMXL 3D1MC 1ZGLM 3K1KC 3SBWC 1H3GA 1CFTA 1YMHB 32C2B 2B20A 5DDHA 3SQBA 3BQUB 2XTJD 3QHZH 4TNWK 1CF8H 4JQXA 1FLRH 2C4FT 3MBEC 4GAJH 1DR9A 4JR9L 4EKXA 1GRWA 1NCDH 1H3PL 1SYSB 4IHOA 4OZIE 2X70A 3ULVL 1LEGA 1Z0MA 3EFDL 2VLJD 4NKIL 1ZT1A 1T5XB 1F4AA 4YGVA 3WJJA 5BO1H 2HKFH 3STZB 4PRNB 3U7YH 3VGDA 5BVJB 3O4LA 5MEQB 1ZLUH 1ZV5A 4RFOL 5FKAB 3GI8H 3UJJH 3V6FA 3KPQA 3UPCA 3D9AL 1P7HL 5TPWH 4WUUB 4AT6B 1DVFB 3DRQB 1YN7B 4EUPB 2AXJA 2XTJE 4MAUL 4HS6B 3JV6B 3MLXH 4PJXB 1FAIL 2EH8H 2V9TA 5EZLA 4I48B 1EEQA 1AXSB 1BJ8A 5IVOA 5BCAA 3L5IA 2R4SL 1CLZL 1MCOL 2VLRA 3MODL 3SE3A 4J4PD 3QUYC 5ENWB 5B39A 4F9PC 1N4XH 2X09A 3WFDH 1OHQA 2VQ1A 5D8JH 2VLJA 2H32A 3MUGB 3HPLA 2VXUH 2R0LL 1X4YA 2YD8A 5IQ7H 3OL2A 4CUCA 1VGKA 2DJ4A 3WL9A 3CVHA 3MJ6A 4DEPB 4W70A 5LQBH 3RUGB 5F70A 1NMCB 1TVDA 5IQ9A 1CBVH 4WHDA 4LSDA 5B8CA 3P73B 4L3CA 3K4AA 5DJAA 3TN0C 1Q94B 4OI9A 4UI2A 2QADB 2PETA 5T1KA 1UCBH 3F7VA 1IFHL 5E99L 3TYFB 4F2MB 3D48R 2COQA 4N0UE 4ZUTB 3ESVF 4N0UA 4LHUB 3HG1E 4NRZB 4IJ3B 1EZVX 4L3EA 5FHBH 5JW3L 1T80A 4B0MM 4L5FH 5D93C 1QYGH 4F57L 2KUTA 4M6ML 1H15A 2P5WD 4F9LC 1RVFH 4FXGB 3KXFA 3DROA 3SOBL 4P59H 3O11A 3L3JB 5IGXL 1T7XA 4X6DE 4NO5A 2I26N 1I9EA 4Y19B 2Z35B 1D6EA 1UWEL 5ACMA 4LRNL 3DARA 1U42A 4YHOH 5D7JB 5ITFB 2Y7QA 1JK8B 3QEQB 1CG9A 2K7PA 3CFEB 4EUPH 4F58H 1EEUA 4AMKL 4K71B 2HRLA 1C16A 2AJSH 2MKWA 4R97B 3MV7B 2R2CA 3MV11 1AKJD 3U4BL 3VXNB 5T33L 4MJID 3SE8H 2OTUB 1LEIA 1C08B 2MHAA 5EWIL 1YNLL 3TA3D 1ZVHA 3SHSA 3A6BL 3BRGC 1I75A 3L95A 2NXZB 2P5WE 2XKNA 2XRAH 4PJBF 2AK1H 4LMQI 3AROA 4XVSL 2FO4B 4S1QL 4NOFA 4DZBB 4X9IA 2ZCKL 3VGAC 3PHSA 1KOAA 1LK3H 4KKBC 2DIBA 2QSCH 2NY5C 3FCTB 2KZ1B 3KYMB 5J9PA 1F4YH 3NN8A 4Y2DB 2ORBL 4PRHB 4I0KA 3SKMA 4UOJA 3F58H 4EI5D 1CL7L 4ODVH 5EUOB 4AIZB 2D7TL 1MCKA 1PKQE 3BPLB 1NEZG 3GHBH 3QPQD 1PKQA 2KQNA 4MXWH 4D94A 1QFUL 1LO2H 1A1NA 1AKJA 4MJIE 5C71A 4LRIA 3Q2CA 5E94B 1A3QA 3NCCB 4PD4K 4MCZB 1OB1B 1HK6A 2X4PB 3MROA 4P4KC 5A43C 1RJYB 5JOPD 5FM5M 2IH1B 4G9FD 5CSZA 4OKDA 1NCWL 4KRPB 2OS7A 1UA6L 5E2VL 5F6IC 5C08B 3VXQB 3BZEA 4IRSB 5DR5L 4YAQB 1M05A 4F33B 1BHGA 1Q72H 1TCMA 4ZFGH 1JPGA 3B9KC 4OZGA 3LN4A 5MEOB 1BAFH 4Y4FC 4L8CA 3DO7B 1LO0L 1B0RA 1JZ4A 3FJTA 2ICCA 4KROD 4LPTA 3WUZA 4C55A 1WZKA 4YK4B 5TE4H 4ODUB 1YMHA 32C2A 3LY6A 5MI0C 1CGXA 3BISA 2WLYA 3BQUA 3NCFB 5DC9B 4K3JL 2ZJSH 3RA7L 3S36H 3MNVB 5JOPE 4G9FE 3FT3B 2W0FB 3C5ZC 5CGYD 3KS0J 2CLRB 2OXGA 4UB0H 1SYSA 4C56B 4IS6B 2CK2A 2NY0B 3THMH 1YEKH 4BQ6A 4DUXA 4KTYA 3A6CH 1KFAH 1U8KB 1XEDA 2R1WB 2J8UF 1OAUL 3G5XA 1CR9L 3QPXL 1RHFA 4YDKL 3NIFE 3STZA 4IDJH 4PRNA 5BVJA 2HKHH 5GJSL 1DP0A 5MEQA 1UH4A 3K8MA 1MAMH 2X44D 1DVFA 3H0TB 1YN7A 4AT6A 2P1YA 4EUPA 5GZOC 1HHHB 4HS6A 1Q0YL 3JV6A 3ZKXC 4PJXA 3QZWB 2AJUH 3SO3B 5KVEL 2NZ9D 4I48A 3F8UB 5IOPB 1FNHA 1YC7A 1B88A 1PGRB 4PJ7B 3FO9A 3MRCB 4PLJD 4LHUD 5F96H 5CMAB 5ENWA 3SDDD 5DEGB 1CFNA 1BGXL 1T66C 4HBCH 4YXLL 1S9KC 2HWZH 3MUGA 4KC3B 2PXYB 1G6VK 2A2QT 1N26A 3EOBB 5BV7L 3AGVA 1OM3H 5BZWB 1MHPH 4C58B 2QLVB 2Z31B 1KN4H 5CP3H 5LGHL 2W1NA 5DMIH 5GRJL 7FABL 2HLFC 3RUGA 4HWBH 1XCTB 3WHE1 4G6KH 5E8NA 4MJ4A 3P73A 5E6IC 3WYRA 2DQHL 2IMMA 4JO2H 2QQKL 1BVZA 4Z7WE 5C6TL 3TYFA 2FECL 2CIKA 1O7SA 4ZUTA 3ZYIA 4I5BB 4LHUA 5ISZD 4NRZA 3RWHB 3RY6C 4HCRH 1J5OH 4S10A 2IPUK 4UILH 4FXGA 5D2NE 3QUXD 5EZOH 4ZMAT 2DRUA 1NGQL 3L3JA 3TC9A 4RA3A 4KJWC 1F4XL 3MUY1 1MRCL 2CD0A 4Y19A 2Z35A 1IGCH 4MQ7B 3CD4A 4Z7NE 1YJDC 1FDLH 3FOMB 5D7JA 5ITFA 1JK8A 2RCSL 4X0KB 4PBVC 4PRHD 3CFEA 1R3JB 3ARGB 4JFDB 2PCPB 4WFFD 5LWYL 3BE1L 5IJVB 4PIRF 1KV3A 5I8OH 3MV7A 2BSTB 2DOCA 3T3PE 3OF6A 3BVNB 3VXNA 4FABL 5ISZE 3JWDC 4H20L 2OTUA 1C08A 1JGUL 1I9IH 2BC4B 1QSVA 4L8DB 4UV7H 5IBTH 1CXLA 2OR8A 4LAQH 4KPHH 4QF1B 5DHVB 5DRZA 2FO4A 2YPLB 4DZBA 3VW3L 5DRXA 1EH9A 2PR4L 2DICA 2AABH 2FSEA 3FCTA 1JYWA 4Y2DA 1V7NL 4GAGH 3O2WL 4PRHA 2DQIL 4WFFE 4WO4D 3TWCL 5EUOA 2IFFH 3EDJA 3LEYH 4ZNEE 4QHKJ 3UEZA 1MRDH 2I07B 2R69L 1A3RH 3VI4E 3PQYD 1KCUH 3P2TA 4YEEA 4HH8A 1TQBC 3UJTL 3VXMB 2VABB 4ZS7H 4UIKH 1TQCB 5E94A 4LPUA 1NFIA 1LILA 4MCZA 2BXZA 2X4PA 1YYLL 4Y4HC 1SBBA 1YEJL 2CKNA 4NN7B 1RJYA 1LK2B 1VEPA 3MX0A 2IH1A 4UTBH 4P46B 1OSPH 4XBPB 1XR9B 2DMBA 3ARUA 1N5AB 2NY0D 4YAQA 4F33A 3TT1L 1J1PL 2ID5A 4DCQB 4NJ9H 3UZEA 5CZVH 4OM0L 5MEOA 3WXWH 1UYWH 4U1LB 2F5AH 5D71H 3DO7A 2DL9A 3QBTB 4CU7A 4CU6A 4XP5L 5CP3A 4GG6F 3PQYA 4ZTPH 2OK0L 1QFHA 4J3XA 1G0XA 2R1XB 3ZE1E 1JJUA 4XNUH 4DN4L 5GS0L 1YY8B 4HWBA 5A16B 4ODUA 5J3HD 3V7AE 3L3HB 3S9DB 3RRQA 1JPSH 5DHVH 3MNVA 1I9RH 3FT3A 1NAKL 1C7SA 2W0FA 2CLRA 2BHYA 3IDXH 4HCRA 4XMPH 4XMKL 2UWEB 2F53B 4XPGH 4I3RL 1QP1A 4JQVC 3AB0B 2PXYD 1U8KA 2V9RA 2R1WA 1MELA 5F7EL 4X9GA 4UBDC 4I8DA 3L7EB 1U8IB 2ITCB 3OR7B 1KTLB 2CO7B 3QUZB 3U7AA 3ULSB 3B5GA 3DX7B 4YDIH 2OM5A 1G6RH 1PVHA 3RTQD 3TBYB 2DQGH 3C6LB 3CPLB 1LD9B 1HHHA 3QZWA 2YD4A 2EDWA 3KPSB 5EH1A 4QOKD 1VA9A 1U3HC 3WCYA 3QHFL 2FD6L 1SJEA 4B7LA 1J87A 1EV2E 3MRCA 4PJ7A 4AG4H 4Y89A 1ZTXL 5DEGA 2IGFL 3P11H 2YMXH 4PJGF 1IT9L 1A7BA 2CLVA 4QTHB 5H37G 5KS9B 3EJYC 2PXYA 4XNYL 5FK9B 3EOBA 1IGIH 1WFTA 2JB5L 2EXYD 4GS7C 5BZWA 3QUKB 4Z7UB 1CGYA 1I85C 1BWMA 3SDXB 3I3DA 2JCCE 2DQDH 4Z95L 1UT9A 4U1NB 2QEJA 3IAGC 1MIEH 1XCTA 2R39A 5EOCJ 4R9HA 4Z0XB 4UUJB 4ODXB 1B4JL 4OGZA 2XNAB 5D6DC 4QOKA 3LS5H 4WJ5B 1A7PH 5IVZB 1RPQA 3O9WD 1NMBH 2ZUWA 4HKXB 3QIUC 1WF5A 1I3GL 4OCWL 3RWHA 4NYLB 4QWWD 2WUCL 2HFGL 4JPWL 4TNWF 1QSEE 1EO8H 2A6JB 1KTKE 1U8JB 3IRPX 5E1AB 4WEBL 4I0PD 4MQSB 1CU4H 4YXHL 1FYTD 5JO5B 2P8LB 5D2LE 4MQ7A 4BELD 1IC4H 3QDJD 4RDQG 3FOMA 2YD2A 1KG0B 4O5LH 1R3JA 2R8SH 4OGAD 4JFDA 2PCPA 1QSFD 5IJVA 3I50H 3HLAB 1AQKH 4G8IB 3V6ZB 2BSTA 4HUKB 1X5ZA 3BVNA 3BIKB 3BKJH 4WEUD 1S3KH 4RQQB 4LFHG 1J10A 2BC4A 4L8DA 3SGJA 2ZG2A 3DI3B 5L9DH 1NUFA 4KUCF 1HKLL 1MIML 4Y88A 4QF1A 1L7IL 3QI9C 5DHVA 4HXAH 2X4RB 1KN2L 1YEIH 2UZXB 2YPLA 4Z0BL 1FL5B 2VDOL 2YA1A 3MMEA 4I0PA 4P46D 3WJLC 1FYTE 2YR3A 5BXFB 2BXYA 3MLWH 1FIGL 3GM0A 1CE1L 3QDJE 4XAWH 5DD3L 3P9LA 3SY0B 3O3EA 4LKXB 2P4AB 2VZTA 3ARFD 1T83C 1QSFE 2IPUG 1QSFA 1RZIA 2J3SA 1IAMA 2I07A 2NY1B 2WIIB 3M07A 4JREC 1CGSH 3OR6B 2K1MA 5DS8B 3VXMA 3S88H 2VABA 2DQUH 3IT8D 3BN3B 3O0RL 5F1IB 1G6RA 5I2IB 1QHOA 2VZ1A 2HH0H 1OAXH 4NRYB 1NBYB 1RZJC 5F1KC 2ZUVA 5HI5D 4KTEH 1LK2A 4P46A 1OTUC 1Q8MA 1XR9A 1HINH 4JQIL 2W0PA 2DDQH 1N5AA 2CO6B 3TPKA 2UVFA 3FKUS 1ZANH 3WDIA 4KJPC 4DCQA 3CCHB 3LVEA 4XTRC 1KLFA 5EB9A 4QRPD 4U1LA 4HUWB 4PB9L 1FAKT 3TP4A 1QBAA 1SHMA 3BP4B 3TESA 2YSSB 3I02B 2R1XA 4JFED 1UEYA 2C4FU 4DAGL 3QQ3B 3WLWD 4LASL 4JRXD 2NY2B 3FQRB 5A16A 3QWQB 1P9MC 1A7QL 3L3HA 2AVGA 1I8KB 3FB6B 1ROWA 2VXQL 5HI4D 4OQ1A 3OKOB 1EMTL 1LHZA 3HI1B 1BIHA 3TBTB 4RNRB 3D0VB 1HQ4B 2UWEA 4Q9CA 3CVHL 3BKCL 4QRPE 5DEFB 4QRPA 5DT1L 1GSMA 1MJ7H 3C5JA 4KVCH 5CIPH 2IG2L 3L7EA 1U8IA 2ITCA 3OR7A 1KTLA 4I3GA 3H6JA 4JFEA 3ULSA 4JRXE 3DX7A 2XQBL 1FNLA 1JPST 2EXWD 3BZFB 2NY6C 3HC4H 3TBYA 3C6LA 1LD9A 4XGZB 1JGLH 2HTLC 3GMNB 2GAZB 4QXGH 3KPSA 5F44A 3X11A 4JZJB 1WZMA 1OOAA 3MNZB 2N7BA 1N3NB 3X13A 4P2YA 1IZKA 4JO4L 4KZDL 2NYYD 4BZ1H 5KS9A 4HLZH 2AQ2A 5FK9A 5GS3A 9CGTA 2CMRH 4LEXH 3QUKA 4Z7UA 3L3OB 5CJOL 3BDYL 4W81A 1K4CB 3EAKA 4OSUH 4KJQC 3SDXA 2A1WL 2DLTA 2N7AA 2D4DA 2GT9B 3QXVA 5T3ZD 1K8DB 3VG9C 1UXWB 2QHRH 1PZUB 4Z0XA 3V8OA 3G08B 2XNAA 3VWKB 4WJ5A 4DKDC 5GRYA 3SKJL 5IVZA 2OSLA 1SYVB 1WTGT 3EZ8A 2FGZA 4HKXA 1CF8L 4ZO7A 3CK0H 4FFVC 4NYLA 1NCDL 4LQ1A 1CZ8H 2HLAB 2B5IB 2BY3A 1FFOA 5E1AA 1U8JA 5HHMB 4JFXA 3QDGB 4BQ9A 1YQVL 1T2XA 1XR8B 3HZMB 4YBQC 4G7VH 2P8LA 1N6VA 5E8EA 3W5MA 5J8OA 5T3ZE 2HKFL 3KWWB 3U7YL 3VI3F 4Y4KC 5F6HI 4LVOB 4FMKA 1OAYH 2HT3D 4LCWB 5TPWL 3V6OC 3V6ZA 4XC3H 3HAEH 4LBEB 1K6QH 4Q6IB 3SKOB 1F02I 3DTXB 5F7FA 4RQQA 4C4KO 3HE6C 3K46A 4JJ5B 4WW2C 1SJXA 1EPFA 2X4RA 2DLFH 1H0DB 1FL5A 1C5DB 4KKCD 1L0QA 5HYEA 4Z8FL 3WFDL 1JGDB 5EU7E 2VXUL 4OCMC 2DKUA 2GJ6E 3BYYA 4KDTC 4RDQF 4JCLA 5HYSG 3SY0A 2WWMC 4LKXA 1WAAA 3PL6B 4XB8A 1ZHBB 1UM4H 1MI5B 5EO0A 5IMKB 1CBVL 2R0WH 3FHAA 5CIPA 1INDL 3ZKQD 2WIIA 1CCZA 1MFNA 1I1RA 3MJ9H 4R96B 2UYLA 1EEYB 1FFRA 3OR6A 5GGQH 2WP3O 5DS8A 1L6ZA 2PO6C 2NY2D 3T4AB 5F1IA 1DBKL 1AJ7H 1NBYA 4N0YH 5KSBE 4D9QE 1QQDB 4JPVL 5FHBL 4LPXA 5JOFB 1NPUA 3CXHJ 4QRRB 4L5FL 3WDJA 2XKUA 3HI5H 5FYJD 3HUJB 4QNPF 4ETYA 1NFDE 2P5ED 1TVHA 5C8JB 3CCHA 4N8VG 3QEGL 3BP5A 1W72H 2GK0B 1IEHA 3VU2A 4HUWA 4YHOL 2Y06L 1B0WA 5HYJD 2ZUQB 2XZQL 4YQXH 3BP4A 3L1OH 4OFIA 5KANI 3KPTA 1A6VL 1G7PB 2YSSA 1U41A 3QQ3A 4MZ2A 2XZZA 4MNQD 1OTSD 3BKYH 3FQRA 4JE4B 5IHUH 3EO9H 1T6WA 3ZHKA 4PJHE 1I8KA 3FB6A 2IQAB 5I30H 5J57B 2P47B 1NKOA 1WGOA 4X4YB 4PJEB 1KENH 3IJSB 1MOEA 5FYJE 5BMFH 1QOKA 3OKOA 2JF1A 2XRAL 3VCLB 3TBTA 3E2HB 5F9WB 2P5EE 3D5OF 1DN0B 4OLXH 3D0VA 1J7VR 2NR6D 4FTVD 4ACPA 1HQ4A 1JTOA 4KFZC 4NQSA 1LK3L 3GBMH 2QSCL 4P3DB 4YH6A 5EU6B 1MRFL 3HC3H 5HYJE 1F4YL 3JTTB 2AEQL 1VHPA 4YPJA 4ODSL 5TQ2L 3F58L 1HSBA 4ODVL 3SDCB 4MNQE 3PXJA 4MNQA 1EFXB 4MXWL 3BZFA 5KG9B 1BOYA 1GGTA 2AJZB 4XGZA 3GMNA 1AHWC 2EYRB 2GAZA 4P2OB 5L8JB 3PP3H 4HPYH 1BJ1H 3PHQB 3TJEH 5A40E 1KNOB 4JZJA 5D72H 4ONFL 3MNZA 1P84J 1N3NA 3HAEA 5EDXA 4I77H 4HAFA 4OM1L 1KB9J 4FTVE 5F7WC 3WS6A 3MPCA 5IW1B 1P4IL 2EICA 5SWSB 5GJTH 3KYKH 3VRIB 1Q72L 4QHNB 3ELAT 1CDIA 4ZFGL 3L3OA 3MBXH 5KOVC 3FQUB 1RI8A 5FOBB 4ZS6D 4EOWH 5K9QG 2GT9A 4BFIB 4PRPB 1UXWA 1HN1A 5TE4L 3G08A 1WVZA 3MJ9A 3EOAB 4DGVH 4MQXD 3V5KB 4MA7H 1SYVA 2ZJSL 4HGKC 1BQHG 3G5ZB 4PB0H 1I1AC 1MUJB 4PBXA 2KBGA 4NGHH 2HLAA 4Q58C 2H2SC 1Q9KB 3DSNA 1FNGB 4Y5YC 4TNVK 4D0DB 4PRBB 1FPTL 5LGJB 1Z2KA 3QDGA 3HZMA 3A6CL 4PG9B 4N8CH 1KFAL 1FORH 3REVB 2BNRD 3T0BA 5C07B 3OKYA 3KWWA 2Z8VC 3OKKB 4IDJL 2E3VA 1W72A 1P2CB 4LU5H 1MI5D 1NBZB 1KCSH 4LCWA 1YA5A 5HHQB 2VJXA 2WNGA 3U1SH 4M5YL 4HUXB 4LBEA 2AJUL 2IPKA 3SKOA 5DJYB 3DTXA 1BLNB 2NY7H 3HZVB 4KTDL 5DD0H 3RVUD 4DGYH 3VRLE 2CRYA 4P2QB 4RGND 5F96L 1IAOB 4JG1H 3MCG1 1Z9OA 4NJAH 1IL1B 2VDKH 1C5DA 3I75B 4KRNA 1ZLWK 5IMMB 1JGDA 3UP1A 3INUH 1GIGH 1UJTA 5GGSB 2BNRA 2V6HA 1OM3L 3FOLA 5TGBA 1MHPL 5L6YH 3ILQC 5DO2D 1KN4L 1O0VA 3KPMB 1EGJH 3U0PB 1ZHBA 3WMSA 1D6VH 5TE7H 1MI5A 5DLMH 2GTWA 5FEBA 3N1GC 4TUKL 1U6AL 4GW5B 4G6KL 1CFQB 1E4XI 1JRHI 4R96A 2HJLB 1EEYA 4JRYD 5GZND 4JO2L 4GRLB 4OLWH 4Y5VC 3T4AA 1M7IB 3STBA 4B5EA 4IRJD 1QLRB 1Q1JH 3QCVH 3NTCL 4RGNE 2OJZH 3O41A 1OAQL 1QQDA 5JOFA 5E5UB 4HCRL 3QNZB 4QRRA 1J5OL 3B2VH 4APQD 4RAUB 4UILL 3HUJA 2EE9A 4M02A 5EZOL 2FRGP 5KVMC 5C8JA 5C0NC 2GK0A 3NA9L 5EC2B 4X7DC 3LV3B 3DLQR 4LPWA 4FQJH 2AJXH 1R0AH 4YHLH 1IEAB 3AMKA 1GGCH 1E4XH 2ADGB 4JRYE 1JRHH 4JRYA 1G7PA 2O5XH 2V2TB 5MENB 2X5PA 4F37K 5IW3A 1EFXD 5I8OL 5CD3B 3MRNB 2LTQB 3WIFB 3ULUH 1KCVH 5ALCL 2IQAA 2C3XA 1BREA 2ZZUT 3JSSA 5DC4B 2EO1A 1I9IL 4UV7L 1A9EB 4PJEA 3IJSA 1QO3A 4KPHL 4LAQL 4APQA 3VCLA 2Z9TA 1DN0A 1OARL 2NY4C 3CFIC 3V8CA 5CGTA 3T2NH 1T03H 5CP7B 2BERA 5SWSD 2UZIH 4LLMB 5K59F 1GPOL 5BZDB 1IQDB 4WI3A 1NBQA 5EU6A 5I9QC 4F15B 5MEPA 3JTTA 4GAGL 2DTMH 4QHLB 2NLJA 5FO9B 2IFFL 1B2WH 4PTTB 4OV5B 2R2HB 1EFXA 5KG9A 5I71C 2HTKD 1G7IB 2AJZA 4XPBH 2JJWA 2EYRA 4P2OA 5D1QD 4I2XB 4WNQB 4ZS7L 3PHQA 3TV3H 5I1DB 3ZE0E 1AD9A 3MFGB 1KNOA 1IKNA 1JZ3A 3IGAB 4PLKD 1RQ5A 4MXQC 5I73B 3MRGB 3NBNA 3ZTNH 4UTBL 1OSPL 3S4SG 1GXEA 4ZFOB 3PGDA 4PJ8C 5ANMB 5IW1A 4UV4H 5SWSA 3D0LB 1FN4B 1T1ZB 4MNGB 3VRIA 2NX5D 3KDMB 4QHNA 4EIZC 4H5SB 4NJ9L 3RHWK 5CZVL 1UYWL 5E2TH 5D71L 4HS8L 2OP4H 3BT2H 1KBGH 3V5DB 1NC2D 2J7LA 4ZTPL 4BFIA 1EGJA 5CKGA 4XNUL 3MRRA 4MSWB 1ZHKB 2H3NB 3BN9D 5FDWB 3EOAA 1VACB 4EZMA 2XY2A 4OCYL 3NIGF 4X4MA 5DMYA 3V5KA 1JPSL 5IBLC 3OGOE 3F62A 3G5ZA 4NQTA 4K2UH 5JUEL 1MUJA 3ULUD 4TVPD 2R9HC 4P9MH 2W0LA 1Q9KA 5IESH 1NANI 1P4BL 1FNGA 1F3DJ 3IDXL 2NX5E 4KGLA 1IBGL 3KPLB 4D0DA 4XPGL 4NCC1 4PRBA 5GS1C 5IB3B 5LGJA 4WI2A 3OXSA 4PG9A 3ZYJA 4E41E 3REVA 4EBQH 3U9PH 1VFBA 3CDYA 4H1LG 3OKKA 4MAYC 2AXHA 5MP6H 3EBAA 1BD2D 1P2CA 5CUSH 1NBZA 1G6RL 2AV7B 5HHQA 2DQGL 1SY6H 3W9DB 1Z5LB 3U30B 1N8ZB 4HUXA 5E4EC 4YJZL 2G5RA 4GRMB 1L0XA 4UINL 3LS4H 1MCWW 4KKLD 5DJYA 3UTTB 1BLNA 3HZVA 1S9VA 1UZ6F 4FG6C 4MLSA 4TVPE 2FLBT 4P2QA 1IAOA 5GS0C 1B6DA 4OUOA 1NANH 4HK0B 4WHTB 2YMXL 3SGEI 1IL1A 1BFOB 3GB7B 1U8LB 2NCMA 5IMMA 1U8OB 1I7TB 1IGIL 1KLGA 3P4LA 4R26H 3VJ6B 2G2RB 1BD2E 5D1XD 5CHNB 2DKMA 3NZ8B 1MIEL 4PJBB 4GW5A 4KK6C 4U6HB 2O61B 2HJLA 2H26B 2WBJD 1MCSA 3HKFA 4GRLA 2NQCA 1YUHB 3UX9B 4XX1E 3LS5L 1P7QD 2YA2A 1A7PL 3CZFB 3MXVH 4OLYH 4FS0A 1QLRA 4YDJA 5C0FB 1QRNB 2VLKE 1NGYB 3O2VL 3QNZA 2XV6B 3SGEH 3NH7H 3BUYB 4JKPH 1UB5A 3PG2A 3NAAH 4OD3H 1EO8L 4EXKA 1F8TH 3EDDA 2ESVE 5J13C 1BMGA 1CU4L 4FNLH 5D1XA 1AGEB 5EC2A 4KMTH 3LV3A 1IC4L 1NEUA 1H3WM 4UAOB 2F15A 1KT2B 4PP1D 5HD8C 3GHEH 4M00A 4K8RC 3L6FB 2ADGA 4O5LL 2R8SL 2Z0BA 3MQIA 5MENA 3I50L 2Y36L 5CD3A 1AQKL 2FEDD 3FQWA 1P7QA 3UTQB 3D2UB 4WWID 4JO1H 3Q6GH 3PJSB 4OF3A 3BKJL 1WWWX 1S3KL 4Z5RB 3P9WB 2YC1B 3GO1L 2A9MH 1JVKA 4N5UA 3O6FC 25C8H 1VADB 1A9EA 5L9DL 5DZNA 3MLUH 4QTIL 5ACZB 1H3VA 1R3KB 1O5DT 1X6NA 5D96B 4X7TB 5FO8B 1GOFA 1PY4A 1FL6B 3MLWL 1H8OA 3IXAA 4LLMA 5BZDA 8CGTA 3B83A 4LSQH 3W0WD 4QHLA 1A7OH 1X5KA 5FO9A 2FDBP 4XWGL 3P9MB 4PTTA 4OV5A 2R2BB 2R2HA 1RZKL 3V52H 1CGSL 7CGTA 4XNZC 3CXHK 1EAJA 1AP2B 1G7IA 5I1CL 1KELH 2FATH 4U7SA 4I2XA 3S88L 4WNQA 4XHQA 5I1DA 2GSGB 3SQOH 2HH0L 4MMXC 1SY6A 1YEHH 2D7PA 3IGAA 4M7JH 3IDYB 1R3HB 1FNFA 1FQ9C 4AEFA 2WM0A 3MRGA 1F6FB 3MBED 4PGJA 3S3JA 3AY4A 4ZFOA 3PE9A 3RNQB 5ANMA 5FDYA 4X8JB 3GMLA 2NNAB 4KUZH 3D0LA 1T1ZA 4JY4B 4MNGA 1ZANL 3ET9F 3BWAB 1JZ5A 3EIFA 2YBRB 4MHHG 4H5SA 3W0WA 5D1ZC 2BHZA 3V2AR 4JFYA 4L8SC 4QRSB 1Z9MA 3P4NA 4KZEL 1N2RB 2GTZB 4MB5A 3V5DA 2JJUA 2CUHA 4G8GE 1LO3L 5J4MA 3T1WA 3UO1H 4P2CG 5T1DL 1IM9D 1ZHKA 2H3NA 1J0KA 5ACLA 5FDWA 1VACA 4C4KT 2OJEB 4KQ3H 3CSGA 1MFAH 4ZYKA 4OD1L 1P7KB 2P43B 3P0VH 2C1PB 4C83B 4NC0B 1C12B 1DLFL 1S7TB 4HBQA 5A2FA 2YPKB 2DB8A 3KPLA 3PWLB 4RAVB 5IB3A 3RI5K 2NY5H 1V3JA 3GNMH 4X7SH 1MFDH 1MJ7L 1U36A 4KVCL 3WXVH 3CC5B 3X3GH 2BNUB 4M48H 1ZEAL 5JXEC 4CL7A 1T0PB 3RWDB 2JJTA 3WJJC 2Z93B 1F45A 3HC4L 3EO1B 2AV7A 1KB9K 4HIIB 3W9DA 2F8XC 1Z5LA 1N8ZA 1PY9A 4JRWA 5DQ9B 3DUSB 4GRMA 3UZQA 3RVWC 1EA9C 3UYPA 4OGYH 3UTTA 3ZKMC 1JWMB 3FHQA 3LZFL 4CVZB 2D7MA 1RJZB 5FKPB 5HPOA 2OQJB 3NCYP 4TOYH 5FECB 4HK0A 4NC2B 3A0OA 4WHTA 3GSWB 1BFOA 3GB7A 2MKLC 4JM4L 3SE3C 4BZ1L 5JW4N 1U8OA 2HT4C 1I7TA 2FLRT 3BP7B 4YFEA 1LE9B 5D9SB 1PSKL 5B22A 3VJ6A 2J12B 1V7MH 1M7DB 1NGWB 2G2RA 4OSUL 2B0SH 2FL5B 5CHNA 2VITB 4EUPG 3NZ8A 2VXTH 4PJBA 1HIMH 4U6HA 2QHRL 4UNUA 2O61A 3VDBA 3PHOB 5B8CC 1BJ1J 1YUHA 2L7UA 3VH8G 3CZFA 5FYJL 2EDFA 5C0FA 1QRNA 2EIZB 5I1AB 1JPFB 3CFCH 3CK0L 2AGJH 4RBPH 5F97E 1NGYA 3OX8A 5CEZH 3V4UL 5E70A 3EJZC 2WSKA 3BUYA 3V95A 4F7PA 3L9RB 5LG1A 1N59B 4XP9L 2IBBA 4PR5B 5HSFA 1YPZF 1R5IB 3H9SE 2V7NA 4Y8DC 4XP1H 2M26A 2XG5A 1AGEA 1L7TH 3OPZL 4YHMH 3CUPB 4FZEH 1KT2A 4TNVF 2YUWA 4KKBD 3L6FA 3MJ8A 4TSBL 4Q74A 3DMMC 4HZLB 1OAYL 4X7FC 4NN6C 4GW1B 4XC3L 3UTQA 2O5ZL 3D2UA 2NW3B 3PJSA 1OGAB 2YC1A 3ZLQC 3Q1SH 1VADA 3ECBA 2BX5A 3VFGL 3ZDZF 1WITA 1R3KA 4XC1L 1U93B 4JANB 2DLFL 4X7TA 5FO8A 4P4KD 1FL6A 4LLYB 3WO3B 5F71A 1MAJA 3ALXA 4FQIH 2IFGA 2AP2A 1P6FA 3K1DA 3H9HB 4HFUH 4R3SB 5H94B 1F42A 2NXYC 3WNMA 2JIXB 1G0DA 3B9KD 1MFCL 1MJUH 3P9MA 2R0WL 2R2BA 1ZA6B 5CJBA 5GGQL 5CAYB 1JN6B 2GSGA 1CE6B 2W9EL 3Q6FB 2J8UE 4LSRL 2EDNA 4LRIC 4N0YL 5I17B 1IGJB 5DSCB 3R1GH 4O02H 2XKSA 3EDFA 5BW7A 2P8PB 1MWAB 2HVJB 2VAAB 2Y23A 4U1MB 1DBJH 3RP1A 3C5ZD 2G9HB 2NNAA 1WV7T 4JY4A 1FG9C 2OL3L 3BWAA 3MA9H 5DGQA 2YBRA 1W72L 1A6TA 4QRSA 2MTPA 3SCMB 1N2RA 4YWGH 3S6CA 3IJHA 1INQB 5HHNB 1J05A 1ULVA 4YQXL 5FB8B 3IFNL 4XRCB 2YA0A 1FRGL 4PJGB 3NPZB 1WFOA 3BKYL 4K3GA 1OAKH 4BSVB 4WWKB 5IG7A 4HAGA 2OJEA 5H8DA 5GZOD 4PJIF 1KENL 2YXMA 1P7KA 3BQUC 3JTSB 5BMFL 4C83A 3DWTA 1C12A 3O45A 1S7TA 2VWEC 5DVNA 2YPKA 3PWLA 5EU5A 5FCUH 4RAVA 1YEDB 4G6AC 5FYJU 1GOHA 3MLVH 3GBML 1T66D 5DJZB 3BH9B 3EFFB 2GQHA 3HC3L 3TYGL 4KK9C 3CC5A 1KSRA 1NAMB 4WVRA 3QXAB 2FIRT 4KV5F 3P3YA 3RWDA 2HLFD 2Z93A 3EO1A 4NQCB 4ONGH 4HIIA 1KIQB 2DYPB 3QG6B 3PV6A 3N85H 4BQBA 3V0WL 5E0QA 2ERJB 5DQ9A 3DUSA 3BDBA 4HPYL 4WIQA 2VZSA 3TJEL 1DVFC 1Y18B 2D3VA 1JWMA 2P48B 5D72L 2FYYB 4S0SD 1MY5A 1MWAH 3O3UN 5FKPA 2XA8H 4QLRA 4I77L 1E27B 5FECA 5C0EB 3T2QA 1EFQA 2BVPB 2RFXB 3FN3A 5GSRB 5GJTL 1JI1A 3BP7A 1LE9A 4X83A 3KYKL 5JR1L 5IP4A 4Q9RL 4UQ3A 1M7DA 5GRZA 4GBXB 1NGWA 2KH2B 3RWJB 2FL5A 4KJWD 4OFDA 4EOWL 2VITA 5GRUH 1WBYB 4G9DB 3E6FA 2EDYA 3O8XC 4DEPC 4OGXH 3QZWG 5SWZE 5TDOB 3Q3GA 2GJ6B 4RMTA 3T0VA 1NMCC 3PHOA 4ETQB 2W9DH 5M7QA 1U3ZA 5T1MA 4MA7L 5TJWK 4HWEH 2EIZA 5I1AA 2QADC 1JPFA 5IV2B 1QACA 2W92A 4NNPH 4NKMB 5DUPH 4PB0L 2A73B 2PTUA 3GMOB 1H5BB 1FO0H 3HHRB 4FQ2H 1K5NB 4IJ3C 3L9RA 1N59A 4GQ9H 4KAQH 4PR5A 4UT7H 5FGBA 5HGHB 5KSBB 1NAMH 4N8CL 1RFDH 3UROR 1FORL 4KK8C 3CUPA 4Y16B 4KHTH 4PJXF 2YN5A 5CJ8A 4NZUH 1S7XB 4GAFB 5D7JC 1QTYT 4LU5L 2H1PH 5F9JA 4HZLA 2DWDB 4AEHH 4GW1A 4UDUB 3U1SL 4PLNC 3WIHH 5MHSD 4JFPB 3BD5A 2GEEA 3Q5OA 3QWOB 4K71C 1OGAA 1YEFL 4R97C 2NY7L 2PTTB 1CFBA 1MCPH 1HDMB 2H9GA 3SGDI 4DGYL 4GG6E 4EJ1C 4JANA 4JG1L 1K85A 1NCTA 4U4BA 4Y4HD 5EU4B 4JFQB 3ARWA 2NXZC 2UY6A 4LLYA 3RUGF 1X4XA 5CILH 1JGEB 5L6YL 2DMKA 4R3SA 4KQ4H 5H94A 1YDPB 3IU4H 2VAJA 3WD5L 1PX4A 3W2DL 2JIXA 3FAXA 3HE7B 3PWPD 2R4RL 3T0EE 1D6VL 1MCCA 5TE7L 5DLML 4Y2DC 3FAWA 1ZA6A 4JREB 3RWCB 3BPLC 1JN6A 4OLWL 5TFSL 1I1FA 5F8QC 3Q6FA 1CGWA 1Q1JL 3QCVL 4V1DD 3D85D 3SGDH 2OJZL 5F7UA 1K8IB 1IGJA 1L0YA 4OAWB 5DSCA 5GS2H 2P8PA 3CVIL 5I1IL 1MWAA 2HVJA 2VAAA 1KB5B 2EEDA 4U1MA 4PJ5E 2HVKB 2G9HA 2XN9B 3FO2A 4PJDF 3MCLH 4KRPC 1RZ8A 1QNZH 4ZFZB 3PWVB 3K2MC 4HZAA 3PWPE 4PJFB 4NQUA 4KHXH 4IRSC 4FQJL 2GI7A 3QCTH 3OJVC 2ZUSA 1YNKH 4X5LA 3SCMA 1R0AL 4BK5A 4X98B 1HKFA 1INQA 1D5IH 1GGCL 5HHNA 3U83A 3DUUB 3HNTH 3VXUB 1GC1L 1JRHL 2QQLH 5FB8A 4UBDD 2WQ8A 4KGJA 3VXRE 1MLCB 4BUGA 4PJGA 4BSVA 4WWKA 4V1DA 3ULUL 4TVPL 4YK4C 1KCVL 3QO1B 2HRPL 3DGGB 5IFHH 4ZPVB 2F5BH 4OZ4B 3JTSA 3P0YH 1NC4B 1U3HD 5EO1B 3V0VB 4E9LA 4Z7VE 5JLZB 2OTPA 3VXPB 5EUOF 3T2NL 1YEDA 1OQXA 3GMPB 3OZ9H 2NY0C 1FO0A 1UACH 4RGMB 1ND0B 4PLOB 1II4E 3W81A 2NPLX 5DJZA 2NTFB 3BH9A 3EFFA 3EJYD 4PGEB 4LHJB 4OJFL 4OLUL 4PV9B 4GBXD 1NAMA 3QXAA 4JDVA 1CTNA 4D9LH 1B2WL 3T0DA 1RHHB 3FFCD 4NQCA 2CPCA 1KIQA 2DYPA 3QG6A 4XPBL 4LDEB 4S2SA 5TDPB 5HGBB 1AFVL 1Y18A 4Q9BA 3WUWG 1W8OA 3WIHA 1RZJH 4ELME 4CMHC 2VKXA 2LAAA 3CFKB 4WI4A 4NQED 3SO3C 3BGFB 2XWJB 1E27A 5C0EA 4GRWE 1ZKAA 3GSXB 3VD4A 1D7FA 2RFXA 1QFWI 4XXDB 1QBMH 4UV4L 5HBBA 2DQJH 5F1OB 3CMGA 5IMLB 4GBXA 3I2CH 1JF6A 4JKKA 4LSSH 3RWJA 5E2TL 2VH5H 3TO4B 1JI2A 2Z31C 4G9DA 4B53A 4DOHB 3IVKB 3KPPB 3FFCE 3FFCA 4OFVA 3LD8B 4HC1H 1WEJH 5TDOA 1MCWM 2ED7A 4ETQA 1EZVY 1FH5L 4MWFB 5D6DA 5EIVA 4Z78B 1CDGA 4NQEE 4V2CB 4NQEA 5C9KA 3C5SB 5IV2A 2LU7A 3V0AC 4NKMA 4LSPL 3DX8B 3K8KA 3UPAA 1ED3B 2A73A 5I66A 3FB8B 1QFWH 1RIUH 4P9ML 3TPUB 1CI5A 4ZTOH 4NO0B 3QI9D 1VKXB 5HGHA 2EEAA 4MA3B 2EXYC 1S7QB 3AU1B 1HHIB 2MOVA 2PW1B 3N50A 4HIJB 3RI5F 3QAZB 2HJKA 1S7XA 5JZ7C 3NPSB 3DNKA 1DQJB 1BP3B 4XCFH 2DWDA 4Y1AD 4HKBB 1Z3GH 4UDUA 3ARGC 3F7RA 4JFPA 2BRRH 3LKQB 3T1FB 1MFBH 3QRGL 3QWOA 1TJIH 2A83B 1KIRB 5EORH 3QWRD 3UAJD 43C9B 3BRDA 4M93B 2PTTA 4PYGA 1FNSH 1HDMA 4HWNA 4LKCB 4PRID 2I27N 4QWWC 5J89A 4JFQA 3E3QC 1XGQB 5GGTH 3P4OA 4JDZB 4XHJC 3GKZA 1IARB 3ZKNC 1OTUD 1J9CT 1JGEA 4FMFA 3PP3K 4OQTH 4OZHF 1KTRL 2IAMB 5GISH 5GGRY 5ESQB 1FL3B 4KJPD 3HE7A 3CIQA 5L2KD 2YRPA 4Y1AE 4XTRD 3RWFB 1MCQA 3CLEH 2N56A 3VXUD 3B9EA 4QRTB 2HFEA 1EEZB 2UY7A 5JPMB 3QWRA 3KJ6L 2V5SA 4HEPG 4OLYL 2KL6A 5DUMH 4PRIE 1TQCC 1MH5B 3MO1B 1K8IA 3MLPA 5E5MB 5AG9A 1AXTH 1NC4D 3NAAL 2HVKA 4NN7C 2XN9A 4NZDA 3ZDXF 4P46C 5BQ7B 2Y4SA 4ZFZA 4FNLL 3PWVA 4PJFA 4RCAA 4KMTL 1VFUA 5FFLA 5L2KE 5I19H 4HXBH 1CD1B 4X98A 2D2OA 3GHEL 4Z77B 4Q0XH 3IDMB 5D5MF 5GRWA 3S96B 3VXUA 4WFHD 5LCVH 5C92A 1VEOA 1MLCA 2DS4A 4LK4A 3SDYH 1QHPA 4HC1A 4HGWB 5DVMA 3WNKA 2NY6D 4JO1L 2DI8A 3Q6GL 4X80H 2WAHA 3QO1A 3OJDB 3DGGA 2HTLD 2A9ML 3C8HA 4ZPVA 5JQ6H 4OZ4A 1GYAA 3MLUL 1NC4A 5EO1A 4NFCA 3V0VA 3NA4A 1I7RB 5JLZA 4HLZG 1VB9A 2VQTA 4KU1A 3GMPA 4GMTH 4AK1A 2GKIA 5E6ZA 1ND0A 5D7IB 3EOYG 5E03A 2FJGB 4PJCF 5J7CC 4PGEA 2W07A 4LSQL 4WFHE 1SVCP 3AB0C 4PV9A 1EHNA 1A7OL 5KOMC 3DGCR 3CNKA 4KJQD 3SO5A 3V52L 1RHHA 2IC2A 1Z9SA 3QUZC 4MDJB 1T2QL 5EFIB 1MEXL 5CINH 2EYSB 4JN2A 1KELL 4JFOB 5DFVC 5TDPA 3WO4B 1XF3B 3C6LC 3DECA 5HGBA 3FQNB 1N0XH 4GOSA 1PD6A 2HMID 3VMPA 4TULL 4M7JL 3DV4A 3CFKA 4U0RB 3BIAX 2V17H 3VI3E 4LLAA 1KACB 3GSXA 4FFVD 4XXDA 3RL1B 3ZDYF 4OIIH 4RMQA 3MNWB 5E8DH 3NMEA 2A6DA 2DQCH 5GGTA 2CUMA 4LFHD 5IMLA 3DSFH 5BJTA 3TO4A 1W0VB 5D7LE 4YBQD 2VO5A 3QR2A 3IVKA 3KPPA 4X99B 1PX3A 3REWB 4OQTA 2BVEA 1X7QB 5I16B 2ZNXA 1PEZA 4GSDH 3UO1L 1OVZA 2AK4E 4Y4KD 4EQ2A 4H8WC 2XQYG 5C9JB 4MWFA 4Z78A 5FGCE 4KQ3L 4LEOB 4OCSH 3C5SA 2UWEF 1MFAL 3JUZA 1IGMH 3RKPA 1SEQH 3K3QA 4IIQC 1EJOH 1ED3A 3P0VL 4D2NA 3FB8A 3HE6D 4GKSB 4P23B 5DURD 1ZGLB 2AI0H 3TPUA 4NO0A 1VKXA 1IC5L 3VFVB 3H9YA 2NY5L 3GNML 4X7SL 2YD6A 3GIZH 1MFDL 1I1CA 3VG0H 3K7UA 4MA3A 3GSNL 1S7QA 3AU1A 1HHIA 2PW1A 4JN1H 3WXVL 4HIJA 3B5HA 4M48L 2WWMD 1BZ9B 1U8QB 1X5AA 5I75B 2ZP0T 4QNPE 3NCJH 2BSRB 3V6OE 2VR9A 3T1FA 3T4YB 4I9WD 3O6LL 4TVSa 4OGYL 3T0WA 3WBDA 43C9A 2PO6D 4CVUA 4P9HH 5EBGA 4ENEC 3HE6A 4AL8H 2BFVH 1UVQB 4K7FA 2BZDA 4A2LA 4TOYL 1MNUH 3OJMB 4PUBH 3SDXF 1XGQA 2XXMB 1J12A 4JDZA 1L6XA 4P2RB 1ITBB 5FA3A 3HRPA 1V7ML 2E7BA 2IAMA 5F1NA 1HH6B 1FL3A 2B0SL 2HT2C 3L3IB 3VA2C 1X5JA 2ARWA 1IGFL 4TSCH 5KZCD 3RWFA 3ULVE 2VXTL 5E00B 4X7EC 3DRTB 4QRTA 3TT3L 1HWHB 4RMVA 1EEZA 3AMLA 4I9WE 5JPMA 1CIUA 4N8VB 2NY1C 5I15H 3OHXB 4G43B 2X4UA 2PO6A 3QFJB 3UTSB 1IAII 2D4FA 3HNVL 4E42A 3CFCL 3MO1A 4U33A 3E6HA 5GQBA 1YEEL 5E5MA 4YX2H 5SWQB 3AS3A 4NM8H 2VSCA 3L5XH 4I3SH 3FQTB 4NT6B 5HDBE 3U82B 1MCHA 3KYOB 5BQ7A 5KVDL 1NBVH 1L7TL 2BOBB 4HKZA 4FZEL 1CD1A 4LF3B 4Z77A 5GRXG 5I74B 3MUZ1 4OKVB 2J88H 2VL4A 2VL5B 5ID0B 1AO7B 5JQHC 1WZLA 4XVTH 4HGWA 1IAIH 2NY2C 3OJDA 2J8HA 1AC6A 2Z4QA 3TIDA 2R0KL 3AREB 1U3YA 1CFVL 3G5VB 4LSTH 2Y6SC 3EZJB 1NGPH 5DQDL 3MV8B 1I7RA 1E28B 5IVXF 4U2ZA 3LEXB 4CN6A 1LMKA 5D7IA 4LLUB 2FJGA 1TFHA 5JHDD 2WBKA 5I9QB 3MLZH 5EC1B 4MDJA 5EFIA 4OFYD 4LPYA 1QG3A 2EYSA 5DWUH 4JFOA 1MREH 5KVGH 5IEHB 4M3JA 12E8H 1JP5A 3HR6A 1JBJA 2X42A 4PJAE 4M9OA 1OPGL 3SE4C 3KYNA 4JZJC 3R1GL 3HCVB 1UGNA 4UZGA 1J8HB 2ADFH 1DBJL 5IKCB 4TQEH 1RY7B 3SPVB 1I1AD 3RL1A 3WS6C 1BQSA 2HFFB 2EDKA 3MA9L 3ROLB 3B8YA 3DYPA 5JHDE 5TF0A 3NZHH 4QKXB 5C1MB 1W0VA 3CX2A 4AM0B 1DQLH 1AQDA 2G75B 3REWA 1RUQH 4RX4A 2CK0H 1X7QA 5ECJE 3MRFB 5ADPL 5I16A 1LEKB 3HI6L 2PYED 1DBMH 3MOAL 1XZ0A 4CVXB 3JWDL 5C9JA 2D7QA 5K9QI 4LEOA 1A64A 4EIGB 3VWKC 1LQSR 3BH8B 4ZD3L 3O6MH 3I6LD 3S5LB 4P23A 4GKSA 1ZGLA 4GAYB 5JORB 4NUGH 4HD9A 3VFVA 4Y5YA 2OCFD 1OGTB 2VDRH 2B5IC 1T4KB 4EI6B 3J8F7 1JHLH 3TM6A 5EZJA 3QIWB 2EDLA 3ILQD 2PYEE 4OCXL 4XMLL 2BSED 1U8QA 1JYXA 4M9PA 3FRUB 3FRPG 4G3YH 2IBZX 2BSRA 4PV8A 5HYSA 4LVOC 1PAMA 4LP4A 1LVEA 3I6LE 4MQXC 4TUJA 3ARRA 1MWAL 2GCYB 4Q6IC 2Q3ZA 1UVQA 1WCQA 4JEGB 3F7PC 2XTLA 5FUCC 4PJ9B 3L3GB 3T2OA 4P2RA 4XPFH 1KYOJ 2VSDA 4BZ2H 1KPRB 3LRHA 5LAXB 1PLGL 3L3IA 2V5TA 3SKUD 5C0ND 1OW0A 5GRUL 4OF7A 1F90L 1PG7H 5AAMA 2GITA 3PL6C 3GBNH 2I60L 1JNJA 4N8VA 4B50A 1U8PB 2FR4B 1KJ2B 2DJUA 3OHXA 4G43A 5IMOB 1DQDH 1GZQA 3QFJA 5TQ0H 1WWBX 3UTSA 4HWEL 4BFEA 2GJZB 2C3HA 3CGTA 5C7XH 3MOBH 1F58L 4NNPL 5DUPL 4N1CA 2X89D 4O9HL 1FO0L 4FQ2L 4DUWA 4HUUB 3FQTA 4NT6A 4GQ9L 4KAQL 4UT7L 3DV6B 2AW2A 2NY4D 4WI6A 1G7LB 1A4JB 3P77B 1JNNL 2BOBA 1A1OB 4ZODA 5F3HB 3U9UB 3R0MA 1OP9A 4TTDC 4LF3A 2IALB 4OKVA 4BH8B 2VL5A 1AO7A 2H1PL 4MXVF 1Q9OB 1SEBA 2ZUQC 3T3MF 4AEHL 3VXTA 1TNMA 5L0QB 5B3JF 5FYKH 3WIHL 2F8OA 3LH2H 1A22B 4ALAL 2JJVA 1FGVH 4JLRB 1MCPL 3IDNB 3MUHL 3KPRD 4M1GH 4Q2ZB 4WU7B 3MRKB 3AREA 3G5VA 3PWJA 1I9JH 4YHIB 1AGCB 1ONQB 4NM4L 5IHBA 3MV8A 1DUZB 1E28A 1XF4A 1XFPA 4MXQD 3LEXA 5JIKA 2ADJB 1J8HD 4JFFB 2W65A 5F9WC 3QEUB 1TZHB 5CILL 4PJ8D 4LLUA 4H0HB 4P5TB 1JPTH 1A6AA 2JB6B 5KTEH 4P57A 1IJ9A 4HUMB 2WWKO 4LSUH 5HDQH 3S4SB 2Z92B 5EC1A 5C0JA 4KMLB 4M61B 3SDCC 3RJQB 4M6OH 5IEHA 4JFZH 2E6PA 3KPRE 4CN4A 4P2OC 3PIQB 2K3TA 3OXRB 1H3UA 2AEPH 1IKNC 3CU7A 3HCVA 5IBLD 1RD6A 2QKIB 1J8HA 3S37H 5IKCA 3SPVA 1S7UA 3BJLA 2OR9L 3MCLL 3KG5A 2R9HD 2HFFA 1DQMH 3ROLA 1SM3L 1QNZL 3KJ4B 1ES0B 1LP9F 4N9GB 2CQVA 1BQHA 1CD8A 1OLZA 1UZ6E 1YNKL 3KLDA 3D3VB 4AM0A 2WLZA 3TNMB 1KTDB 2G75A 5F9OL 3LN5B 4FXKB 3G6JE 3MRFA 4RBPK 2PUQT 1LEKA 4MAYD 1E4WH 3TBSB 2DN7A 4DGIL 4CVXA 3H9ZA 1UH2A 5DD6B 4H1LB 1N6QH 1MQ8A 3RU8L 4DVBA 3P0YL 4UQ2B 1CQKA 3C2SA 2NW2B 4FG6D 3NVQA 2AXGB 4GAYA 5GHWL 5JORA 1NGZB 3MLSL 1EBPA 4OZIF 1UM6H 1P5UA 3OZ9L 1UACL 1OGTA 1T4KA 2MMXA 2XFXB 3BI9X 4Z7QE 3PGCB 3GJEB 2EDQA 2G60H 3QIWA 5DJDB 1DN2A 1LO5B 3WS3B 2E9WA 4D9LL 4M43L 2GK2A 3FRUA 4KK6D 1YPZB 4N1HB 1RZJL 4OTXH 5DHYB 2GCYA 1QR1B 3C2AH 4N90D 5I1JH 4L4TE 4YBLB 1CDHA 5ETUB 5DJXB 4MB4A 4PJ9A 3U2SB 3L3GA 4XBGB 1CTOA 2ZSVA 2F74B 1P1ZA 4HMDA 3I2CL 5LAXA 1U91A 4P48A 3KGRA 1C1EH 3QRFM 4BYHA 1OT1A 5DC0A 4DQOH 1WEJL 1EJ6A 4W4OA 4K8RD 3VFNB 1PKOA 3BPNB 3ARBB 4JM2B 3BAEL 4H1LH 5TE6L 1MAKA 2FR4A 3CLFH 4OCLC 3T0EB 4NPYB 4GRLC 4N90E 4YNYB 5C0IB 2GJZA 5EIQA 1A6UH 4Y2OA 1QKZL 2IADB 1R6VA 2DKSA 3EHBC 2WK2A 3O6FD 1QFWL 1RIUL 5DF0A 3UC0L 1IILE 1QZ1A 4HUUA 4U1SB 5EUKB 2YHGA 3X14B 3DV6A 4QCIB 1MJJB 5DZOA 2F54D 3R0NA 4X6DF 1G7LA 2ZCHH 3WKNA 1BBDL 1A4JA 3P77A 4L1DA 4M8QB 4POUB 1EAPB 4I4WB 5F3HA 3U9UA 1YEGH 3BZDA 1TJHH 1QLEH 2IALA 5C0AB 3TO2B 1X44A 1S8DB 4BH8A 3F6LA 3CDFA 1U0QA 4XCFL 2R2EB 4HS3B 4KI5C 3OG4B 1Z3GL 1XGTB 3ABZA 4URTB 2DBLH 5IHZA 3OAZH 4HIHB 4X8XA 1MFBL 2DL2A 1TJIL 5IT2H 5EORL 4JLRA 2JTDA 4OLEA 3IDNA 5T1LD 1FNSL 4Q2ZA 4WU7A 3VXRB 4YHIA 1AGCA 1ONQA 1DUZA 1HZHH 2AXFB 2F54E 5B38B 3GKWH 2ADJA 4LGRB 3SJVB 4YBHA 2R23A 3QDMB 2Y1VA 4JFFA 3V7MA 3QEUA 1GCFA 2ED9A 2JB6A 2X41A 4OQTL 4Y8AA 5GISL 3RQ3A 3WN5B 3IXTB 1FGNH 1QD0A 4PJIB 3AC0A 4M7LT 2UUDH 1RAMA 3S4SA 5D1ZD 4F15C 2Z92A 4R7NB 3QQ9C 4M61A 5E6YA 2BCKB 2IANB 5CLTA 1TJGL 4ZG1A 3JZ7A 2E27H 5I18L 35C8L 5DUML 4A6YB 3PIQA 3NFPB 3V7AG 4HV8B 3OXRA 2VXSH 4WFGD 4ERSH 5C0RL 1DBBH 2QKIA 1ZLVK 2FX7L 5I1GL 4DJMA 5I73C 2EIEA 1DL7H 5JDSB 4KI5F 3ZL4L 4ELMB 2F58L 1VESA 1DFBH 3QG7H 2YKLL 1K4DB 1ES0A 4N9GA 1KCLA 1OSZB 1MSPA 5I19L 4HXBL 1DANT 3D3VA 2YWZA 3TNMA 4KVNH 4XP6L 5LCVL 4FXKA 5GGSY 3GSRA 5J11C 4R90H 3QCUH 5JXED 2YUVA 3CFJB 3U4EB 3FB5A 1OT2A 2MSPA 4EQ3A 4X80L 1I7UB 2A6IB 1LO4L 3O4LD 5KSAB 4WFGE 4H1LA 3T77A 3DBXB 3RVWD 1UB6B 3S35H 1AR1C 4UQ2A 3ZKMD 2NW2A 2DQEL 2AXGA 5CBAB 1NGZA 4MZ3A 4J1UB 3VXSD 4R8WH 2VLRD 3P30H 4CJ0A 1R24A 4P99A 2HT4D 4CJ1A 3PGCA 3GJEA 4D0BB 1CVRA 2EKSB 1MHEB 5DJDA 3WS3A 1LO5A 4ZUWB 1XMWA 1QA9B 4Z76A 2LFGA 2WINB 5JXEA 5EO9B 5CINL 4A6YH 3O4LE 2JJTC 2EDOA 1YPZA 2MQ3A 3C60B 3I84A 3U30C 1N0XL 5DHYA 3MZTA 1QR1A 1FNEA 1T04A 4ZSOB 1KPUB 1S78C 1JTTA 3VXSE 5ETUA 5FM4A 3ZE2F 3VXSA 5T1KD 2VDLH 5DJXA 4OBRA 3U2SA 2VLRE 4XBGA 1KPVB 4JO3H 3EJZD 4OIIL 3KPNB 3VH8B 4W6WB 4L3ED 2DQCL 2J1KA 4QT5B 2VLJE 1G1CA 2O26U 3KXFD 3ORJA 1QBLH 3O8XB 5FUOL 1OP5K 3VFNA 3ARBA 4JM2A 3R06B 2VB5A 2EKJA 3BGAA 1OAZH 3DMMD 3QULB 4Z7WF 4K3DH 4NPYA 4Z18A 4YNYA 4OCSL 4F7TB 3M1BB 1IGML 1P5VA 2EDJA 3UCRA 1SEQL 1EJOL 1HCVA 5FOJA 4JAMB 4M62L 4NNXA 2FX9L 2AI0L 1S9WA 4U1SA 3MLTB 4L3EE 1H9VA 3X14A 3ME0A 4UT6H 3TH4T 4QCIA 4LIQH 1UKSA 4NQDB 4F7MB 3QDMD 4Y5XB 3RKDC 3KXFE 3FO0H 4M8QA 4I4WA 4Z7NF 4N0FB 1MQKH 1YNTB 3TO2A 4LP5A 3M8OH 2NXYD 4UAOC 5C0DA 4H0IA 1RU9L 4OLZH 4JB9H 2BNQB 2R2EA 3RX5A 2O5YH 1XGTA 3DMMA 2VDMH 4GUPB 4PJDB 3ARYA 3B9VA 2DBJA 1KYOK 1N7MH 1CGVA 2VZOA 3DXAB 5DHXB 1NCBL 4O2EB 3V4PL 1MNUL 4PUBL 2VTFA 3OKMB 3WFZA 5JDJA 3EYVB 1HYRC 3LPFA 1NLDL 3MV9B 3SJVA 3BEVB 3QDMA 1UXSB 5D96C 1M7XA 1JF5A 3BXNB 5LJYH 5C6PB 1BQLL 3IXTA 1HI6B 3MXWH 4FFYH 1T0MB 4PJIA 4EDWH 3TFKC 4TSCL 4GO6B 4ZDHA 3S97C 4HUVB 1J1XH 1GGUA 3GSVA 2IQ9H 3S7GA 2BCKA 3FN0L 4JDTH 2IANA 4M6AA 2AS5M 2VC2H 5JXAH 4FN0A 3IRZA 4A6YA 3NFPA 3QJFB 4NBZB 4HV8A 4M6NL 5EU3B 4KV5E 1BJMA 1MF2H 3IDYC 1OLLA 3L5XL 4XPAH 1EUUA 4I3SL 3BQUD 1EERB 2DLEA 5JDSA 3PXHA 1LDSA 5BW7C 1UM5H 3VWJB 3SDAB 2DM4A 1WIUA 1NBVL 2FEEI 1OSZA 4G80B 4G6AD 1QFPA 4PGDA 5CD5C 1IGTA 1FC1A 3O6KH 5L7XH 5DRWA 1K9TA 4MA8H 3U0WH 2J88L 4KK9D 3LKRB 4OZGE 4XVTL 4WUKH 3ZE1F 1VERA 2OXHA 3U4AA 2YUZA 5BVPH 3CFJA 2VNCA 1TDQA 3U4EA 4QYOB 5D7LB 4Z7OE 3V6BR 1IAIL 4BJLA 1I7UA 3HZYB 5DQJB 3DBXA 1UB6A 4WUUD 1DVFD 4LSTL 1NGPL 1ZE3C 3VFPB 4PY7B 5CBAA 2A38A 4J1UA 3LIZH 3GI9L 5GGRB 4M7KH 3LHPH 1FZKB 4D0BA 3UMTA 4HJ0D 1JL8A 3MLZL 2BVQB 2L0DA 3WEXB 4ZUWA 4RIRB 1QA9A 1C5CH 2WINA 5EO9A 1T5XA 5F7NC 2YZ1A 1ITCA 3O8XD 5J1TC 3KYAA 3NFSH 4WGVB 4UOW0 5FKAA 1FC2D 1KJMB 3C60A 12E8L 4WUUE 1RUAH 4WUUA 3RDTB 3DRQA 1JGVH 4BH7B 3BD4A 3DHJA 3GFUA 3IDIB 4BZYA 1OY3B 4PJXE 4IEFB 4ZSOA 1R3LB 4CMHB 1V3MA 2E7CA 4OLVH 1WT5A 5EZIH 1KPUA 4G6FB 3H42L 2QADD 1AXSA 1GGIH 5E2WH 2ADFL 2R56H 4TQEL 2ADIB 1KPVA 3MCKB 3VH8A 2B2XH 3KPNA 5CEYB 4LGSB 3U36B 1JNLH 1G7QB 2X4NB 4XNMB 4QT5A 3GSQB 2JCCF 6FABH 4JVWA 3VGBA 5HY9B 1RIVL 1RUQL 2NTSP 2ZKHH 4KK8D 4R2GB 1FZOB 1S7RB 4Y19D 2E7HA 3O8XA 4PS4H 1AY1H 1DBML 3VD9A 3RUGE 3R06A 4LCIH 4X5XB 3JWOH 5D7JD 3QEQD 4V2BA 3QULA 4L4VB 5ILTL 3H8NA 4OZHB 3WFCH 1Q94A 2X05A 4F7TA 2XIDA 3M1BA 4OF5A 1BF8A 1C5BH 2C26A 3QDHA 3O6ML 3DI2B 5LBSH 3UYRH 4F2MA 3MV7D 1IKFH 3OF6D 1KF9B 4Q6YA 1D5MB 1DSFH 1TVBB 4NUGL 2FJFB 3MV9D 4NQDA 2NXZD 4LMQE 3V9FA 4TRPH 5FGBC 1XGYL 5D2LF 4N0FA 5EA0L 1JHLL 2WWKT 2CDGB 5AYUL 4M7ZB 1YNTA 2QJDA 4Y19E 2R15A 3FZUC 2BNQA 3QEQE 2EC8A 2VDQL 3QEQA 3QT2A 4XCCH 4Y2DD 4GUPA 4PJDA 1DEEB 1XGRB 2IJ0C 2IWGA 3MV7E 3DXAA 3DVNB 3WE6B 5FV2A 1Z6JT 2QHLA 4O2EA 5D5MB 2FH8A 3DETC 1RUPL 4ZAKB 3EYVA 3MV9A 4S1RH 1OTTC 1ZVSB 3BEVA 4XPFL 1UXSA 5J12B 1CXFA 2WW8A 3QH3B 3BXNA 3DPBA 5C0GB 4KK5C 2Z8SA 1HI6A 3N1PC 4KRPD 1T0MA 1EDQA 1PG7L 5C08D 2UVEA 4IRSD 4HUVA 4X6CB 3VDCA 3KYMA 1G9MH 4PRHE 4WTWA 4NZRL 4PFEA 3GBNL 5EUOE 4LARL 1ZVYA 2WQRA 4AIZA 3JXAA 1DQDL 4HWZB 5B4MC 4PJCB 3C08H 1GOGA 1AE6H 3QJFA 4M4RA 4D0CB 3TEUA 3IDGB 5ALBH 1OB1A 4RFOH 5DK3A 3D9AH 1LDPH 4R7DB 3STLB 3VFMB 3RPIB 3ZYOA 3R8BB 4MAUH 2ICEB 3VWJA 1KIUA 4M1CC 3SDAA 2FB4H 1AGDB 4G80A 3ROOB 4C56D 1NSNL 5C08A 3VXQA 4IRSA 1IE5A 3ALWA 1MCOH 4LPCA 3MYZA 3CXDH 2V2WB 5INDB 1RUKH 5CWSB 3SCMC 2VIRB 5FHAL 3JUYA 3KLHC 3D39B 3WNNA 2G5BB 3PQYE 1JHTB 4M7LL 3LH2L 4QYOA 1RULH 2VLMD 3HZYA 1FGVL 5HHVH 4WWKC 5DQJA 4QHUB 4E5XB 1I9JL 3L5HA 4FQLH 1CXKA 1AD0B 1GVIA 4WU5B 4IMKA 2OX5A 5CZXC 4HIXL 5GGRA 2DQTL 3WUWB 4GFTB 4C56A 4IS6A 1JPTL 2VUYA 4FQ1H 4ZUSB 4KMQA 3TIEB 1FZKA 4RA0C 2BVQA 3WEXA 4XB7A 4ODWB 4LSUL 4RIRA 5HDQL 4TYUA 5FXCH 4F57H 3P40A 2B1AL 2Z31D 4HQQL 3RWEB 4EEEA 2VLME 1M1SA 4M6OL 1CICC 2E8ZA 4DW2H 4JFZL 5IGXH 1D5XB 2JJSA 1KJMA 1UWEH 4BH7A 3RDTA 3H0TA 2ERJC 4LRNH 3IDIA 5K93A 1R3LA 5F93C 2EDEA 2YRZA 5IOPA 4PJ7E 3W39B 5CMAA 4G6MH 3N1FC 5CEYA 4TPRL 1DQML 1AGBB 2VDPL 3U4BH 2X4NA 1J0IA 1BX2B 4XNMA 1NL0H 5T33H 4NC1C 2A0LD 4K8RL 5EWIH 4MA1B 2WUBL 4GBXC 2Z31A 4ZOCA 1XIWB 3AS0A 2CLZB 1FZOA 1S7RA 4XVSH 4S1QH 5DJ0B 1FVDB 3ARQA 4X5XA 5JZ7D 2MPAH 1MFEH 2A9NL 4L4VA 3WKML 2EDHA 4RSVA 3RL2B 3ARGD 4JFDD 4FZ8L 4OZHA 5C3LD 4QOKE 8FABB 4POZC 2APBA 1D5MA 4IIQB 5KJRH 4KDVA 3GK8H 3IS1X 4I5BA 3B43A 1MCRA 1UM6L 4ZAKD 2ITDB 1H5BC 2DM2A 3BYTA 5IF0B 1CDYA 5KBNC 4XHJD 2ZPKL 4GG8B 3ZKND 2I24N 2YPLD 2CDGA 4FFWC 1RURL 3T8XB 3OJ2C 5C09B 4EDXB 5AYQA 5C0BB 3LQAC 2DWEB 4Y16C 5IB2B 4HGMA 3LCYA 1UA6H 4X0KA 5DR5H 4MJ5B 4JFDE 1G84A 1XGRA 3ARGA 3ARTA 1ZK9A 4OTXL 2WMPA 1V05A 3WE6A 5BV7B 5HI3C 3TNNB 3C2AL 1HYSC 5D5MA 3VXMD 4YHZL 1VFMA 1WTLA 5DMKB 4S1SH 4ZAKA 4ZO8A 5BS0B 3E3QE 1ZVSA 4BM7A 3CH8A 1WWCA 1YY9C 2YPLE 4WW1B 1T20B 5C0GA 1CT8B 4K3JH 4NZTH 3RA7H 3ZHDA 4QEGA 1P6AB 1C1EL 1HNGA 2Q7YB 3VFUB 3WFHB 1PG7X 5JW5B 1U2CA 4X6CA 4DQOL 3HE7C 1ZS8B 4H8WH 4GXVH 1WICA 5CLWA 1BVKB 5IVXB 5IFJB 4GXUN 3CLFL 4XVUC 4HWZA 3HZKB 4KY1L 4PJCA 1WSST 1OAUH 3UAJC 3VXME 1UEMA 5KSBF 3VXOB 4YDKH 4D0CA 5JTWA 5J56B 1AGFB 1A5FH 1MJ8H 3IDGA 1NH6A 4EN3B 3SKNB 2YPVH 4RZCB 1DANU 4R7DA 3STLA 2XYCA 1NFDF 5GGVL 2ICEA 3UXFA 4Q97A 3CU1A 2ZCHL 3MACH 4XBPA 3IU3B 5KVEH 1AGDA 3ROOA 4MCYB 4WV1B 2FECI 5IWLC 3OSKA 5D7SH 4YHNB 2F53D 2V2WA 4WRLA 5INDA 5CWSA 5E8OB 2DI9A 3LEVL 2P49B 3W11D 3D39A 2DBLL 4GH7B 2G5BA 3BGMB 1JHTA 3O4OB 4ONHB 3RVVC 3QUZD 5IT2L 3EOTH 4PJHF 2FNBA 1ORQB 3GSOB 1JFQH 2QV2A 1NUNB 3HS0B 5LGHH 5DFVD 4G7YH 1YY8A 5GRJH 7FABH 4QHUA 3QJHB 3C6LD 4E5XA 5KVFL 4AH2B 4IOFD 3OBAA 3A67H 2C3GA 1HZHL 3KPSD 4TSAL 1A9BB 3GKWL 4WU5A 1UKQA 2EC9T 5FYLH 2OLDA 3WUWA 2D0HA 4JHWL 2K9UA 4ZUSA 4G5ZH 2UWEE 2F53E 2VDNL 2BRQA 1EHXA 4RGMC 2F53A 3FMGH 2XWBB 4ODWA 4DUVA 4RFEB 1HEZB 5BRZB 1J11A 3RWEA 4C54A 4MGXA 3CH1B 4YHKH 3QUZA 4JFEE 1NGQH 1D5XA 5EOCL 5AWNH 3CPLA 4HSQA 3ZSTA 2YXFA 4UNVA 3MGTB 3PGFH 4RWYL 2VXSL 4YFLF 4ERSL 2LAGB 3KPSE 4PJFF 3EDEA 1DBBL 3C09B 3BGFC 5LWYH 4J2XA 2QQNH 3BE1H 3W39A 1DL7L 4U49A 4OZFB 1YECL 5M94B 1AGBA 4DKFH 4DVRL 1BX2A 4WFED 5KS9E 4H20H 3RGVC 2I5YL 4QTHA 1JGUH 3T65B 1PW3A 4GKNB 5FUZL 5GPRA 4Z7UE 5FGSA 2H6PB 3TO4C 1XIWA 3SDXE 5I1HH 2EEBA 1D9KB 3QCUL 1FVDA 3T08A 4U1NA 3LD8C 3EYOB 3EYFB 1PBYA 2PR4H 4JCMA 1WBZB 1RMFH 3RL2A 3RJDA 1CDUA 4UUJA 3BD3A 4ODXA 4BQCA 1EO7A 2HMIC 3LRSB 8FABA 2D03H 3QHZL 4NP4H 4IIQA 2DF3A 4ENED 1FLRL 2CGRH 4GAJL 3BSZH 4WFEE 2ZG3A 2ITDA 2SEBB 4R8WL 1N5YH 5IF0A 3W82A 3P30L 1CK0H 1XF1A 3PABB 4GG8A 5MERB 2A6JA 1Y6MR 1YYLH 3T8XA 5C09A 4EDXA 5FYLD 2DWEA 5C3TA 2PN5A 4XAKD 1G7MB 3ES6B 5JO5A 2HT2D 3MTRA 2R1YB 4U3CA 1FFQA 4CVWA 1FCGA 1B0GB 5GGUB 5DD5H 5BO1L 2JKXA 3QAZC 3W5NA 1QFOA 2BP3A 3GIVB 1KG0A 2K7QA 1EXUB 3NPSC 4MJ5A 1L4IA 4QXTB 3QHTC 3GI8L 3UJJL 5FO7B 4OIAA 2NY1D 3HLAA 4NSKB 4G8IA 4DK6A 4O00A 3G6DH 1NUDA 3TNNA 3MLXL 3VRLF 1VCAA 4M93C 2EH8L 3BIKA 2GSIB 4OZFH 2EE2A 5HHOB 2H41A 4FQXB 2VDLL 3DURB 5DMKA 4FQHB 1U3JA 1R3IH 1CFSB 5BS0A 4JO3L 2EYTB 1INEH 2CR3A 5DA0B 1T20A 1QFWM 1N4XL 1CT8A 4XAKE 2EECA 4X6FB 5BXFA 5D8JL 5TDNB 2AAVA 3VFUA 2Q7YA 4LCCB 3WFHA 1BEYH 1NAKH 2IAMC 1QBLL 5IQ7L 5JW5A 2X1WL 1WAAE 2FZ3B 1ZS8A 5LQBL 5IVXA 2HAZA 1BVKA 1G9NH 4CMMB 2FO1A 1FBIH 4K3DL 1IEBB 2HP4A 5F7EH 4F7EB 5E9DB 2C1OB 5CKAA 4YPGB 1ACYH 3VXOA 4HK3N 1UCBL 5I2IA 1G9EA 3V5HB 1AGFA 4WTXA 4NRYA 3SKNA 5CBEB 4RZCA 2Y6SD 2X40A 5JMRA 4UT6L 4X6BB 5C0CB 3O2DH 1QYGL 4PG2A 3IU3A 4YXKH 2ILLA 1RVFL 4MCYA 4Y7MA 4WV1A 3QHFH 2FD6H 4P59L 4XH2B 3VD7A 3FN9A 6CGTA 3MLYH 1Q38A 3M8OL 3SGKA 3PWUB 2IGFH 5DRNB 4JB9L 4NN5B 2O5YL 4L4JA 5DD1H 5DUBB 1KEMH 1VEMA 1LWRA 1UG9A 2CUIA 2VDML 4ONHA 4XNYH 4F58L 2JB5H 3OKLB 3I02A 1ORQA 1N7ML 1LP9B 3GSOA 3UTZB 2E7LA 2AJSL 3QJHA 4Z95H 1YMMB 4AH2A 4AENB 4XVJH 5SX4I 4AY0A 3SE8L 3GSUB 5BOPA 1A9BA 3CFDB 3CMOH 1JTPA 4D3CH 2AK1L 2VRAA 3HI1A 3HB3C 4R0LB 4RNRA 4S1DC 2M2DA 2GIYA 2XWBA 1I3GH 2OI9B 4EDWL 1K3IA 1IAKB 4OCWH 4J7RA 4UT9H 1QSZA 5DEFA 1IRAY 2WUCH 4RFEA 3RZCB 1J1XL 1HEZA 2HFGH 4JPWH 5BRZA 4YR6B 2IQ9L 4JDTL 4OZIB 3GHBL 5I1EH 5JXAL 2D9QB 1LO2L 3ZE0F 5F1SA 3WO4C 3L3DB 2LU4A 3MGTA 4G6JH 4JPKH 4JY5H 3SE4A 3VWKD 1MF2L 4LVNB 2VR4A 4U0RC 4XPAL 1ZXQA 3VMNA 4OZFA 4ESKA 3JWNC 1UM5L 2XTJB 4P9HC 2M1KA 5SV4A 5CJXA 1Y6NR 2DM3A 3T65A 1VFOA 2FIKB 4GKNA 3LDBB 5CSGA 4MA8L 5HHMD 3U0WL 3RIFF 1KIPB 3QDGD 1KN2H 4Z0BH 3NACH 1K4CA 2IMNA 1BAFL 1D9KA 2BY0A 2VDOH 4F7CB 1E4KA 3EYOA 1GGBH 3EYFA 2VLJB 3HPLB 1BECA 5DD3H 1K8DA 1VENA 1SBSH 1WBZA 1GJIA 4YO0B 4LCWD 3VWKA 5D7IF 4LNVA 3LRSA 1JHKH 2ZWLT 1RJLB 5IQ9B 3FQXB 5HGAB 2OMNA 3S36L 2JK5B 4P23C 2SEBA 3QP3A 1SJVA 3OAZK 4I0CC 4JKMA 4UB0L 3PABA 5MERA 3LHPL 3THML 5HHME 4N0UB 1FSKB 1ZMYA 4X7CC 1YEKL 3QDGE 3HG1B 3O2DA 3BMWA 1XR8A 1G7MA 3ES6A 2R1YA 1B0GA 4LLDB 5GGUA 3DROB 4NIKB 4C57C 1UZ8B 1FHGA 3GIVA 1EXUA 3O11B 5I75C 3PL6D 2HKHL 3NFSL 4QXTA 1AR2A 4X6DB 4NO5B 4LCWE 3S5LG 1D6EB 1MAML 4MS8D 4NSKA 1JGVL 5CZKA 1IC1A 5EZIL 4Q6IA 5HHOA 1TTFA 4FQXA 2UUDK 3DURA 4YDLC 1GGIL 5E2WL 5AG8A 5FUCE 1XH3B 4FQHA 4LASH 2R56L 4JJ5A 1JYVA 1RJCA 2CRIA 2PW2B 3QSKB 2EYTA 3Q48A 2B2XL 2ZNWA 1A7QH 1JNLL 4QRRD 1H0DA 2VISB 5DVLA 4AYFA 3L7FB 4HBCL 4BKLB 1D5BB 2HWZL 5TDNA 2BVUA 2BNRE 4LCCA 3L95B 1KGCD 2XKNB 1W0WB 2ZKHL 2P5WB 1L9NA 5F21B 4UU9B 4TTDD 1OW0C 2C5DC 2FZ3A 5DMIL 1AY1L 3PL6A 4CMMA 1MI5E 1XCQB 3MRPB 5IMKA 4HWBL 5J6HB 1OCWH 1IEBA 5DT1H 1WLHA 4DKAA 2P45B 4F7EA 2IG2H 2C1OA 5IB1B 2DJSA 1YQ2A 4KKAC 5LBSL 3H3PH 3UYRL 3V5HA 3IFLH 5DFTA 3AAZB 1PKQB 2XQBH 3HFMH 1A1NB 3HC0B 2ICWB 4QRRE 3TBWB 3B8SA 1IZJA 4FP8H 5C0CA 4MJIB 3HUJE 4TRPL 3TA3B 5M95B 2V5YA 2GFBB 1LNUB 3ETBF 2DAVA 4JO4H 1YYMH 1I8IB 1IGCL 4KZDH 3PWUA 2Q3AA 5CSZB 5DRNA 1T1YB 1FDLL 5EU6D 1Q9WB 5I74C 3QUMB 4P5KB 5DUBA 4K94C 5T5FH 1WISA 2GY5A 3RVXC 5K9JH 4ZUVB 3SDCD 3OKLA 1JPGB 1EIBA 5CJOH 3L3KB 3UTZA 1LP9A 3BDYH 4EI5B 2V5RA 3GZKA 1YMMA 5AD0B 4AENA 4P2OD 1B0RB 1ZT7B 4U1IB 4U6TA 2FBOJ 3GSUA 2ICWI 3B9AA 3AREC 4K7PY 4PJEE 3CFDA 4X4YA 3PP4H 5IBTL 1A4KB 3QYCA 3BW9B 1H8NA 4R0LA 3SKJH 2C3WA 1DQTA 3CX5J 1IAKA 4LCUB 4G9FB 2AABL 5EU6E 3RZCA 4NNYB 4NWTH 4P3DA 2J5LB 4HIEB 1G9ML 3VRJB 4YR6A 4J23A 1BVLB 5JIHA 4GKZB 3SDCA 4OZIA 4GMSH 3LEYL 1JWUB 1MRDL 1YQVH 1A3RL 4M4PA 1LGVA 4OUUB 3C08L 1KCUL 4PRPD 3G5XB 1AE6L<