1X9QA

4m5.3 anti-fluorescein single chain antibody fragment (scfv)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
255
structure length
231
Chain Sequence
SDVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPKVLIYKVSNRVSGVPDRFSGSGSGTDFTLKINRVEAEDLGVYFCSQSTHVPWTFGGGTKLEKDGGVKLDETGGGLVQPGGAMKLSCVTSGFTFGHYWMNWVRQSPEKGLEWVAQFRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGMEYLGQGTSVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4m5.3 anti-fluorescein single chain antibody fragment
publication title Substantial energetic improvement with minimal structural perturbation in a high affinity mutant antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 64
structure length 231
sequence length 255
ec nomenclature
pdb deposition date 2004-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x9qA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x9qA02
2VTFA 4QO1A 5E6IC 4PJGE 4WO4C 4X4XA 3L7FB 1K8DB 5GHWL 5F44A 3QZWA 2EIDA 5HD8D 1NAMA 2DF3A 1LO2L 1RD6A 1DBAH 3VWJA 2HFFA 5I30L 1IAII 4OSUL 5I1KL 4N5EC 2EXWD 4K7FB 2FHBA 5KS9B 5F7LB 3NZ8A 2NZ9C 2QKIA 3F8UB 4N90E 1P4LA 3F6LA 3VD7A 4YHNB 1EEYB 3I02A 5TF1H 3HE7D 1I7RA 3DI3B 4UOJA 5KANI 2XZCL 3HUJB 3N1QC 5TDPB 3HS0B 5JHDE 4ZXBD 3G08A 3STLB 5HYIA 4XVUC 4D3CH 1E27B 2WK2A 3ARFB 4IEFB 3A67H 5C0IA 1I7TA 2FO1A 1IGYA 3EO1B 3A6OA 2CRIA 3FO2B 4JO1L 1YQ2A 2ESVA 2DIBA 3U2SA 1PW3A 4OCNC 4ZS7H 5GSVB 5ICXA 5BS0E 2CLVB 4GKOA 1ZT7A 4I18B 5ETUA 2A9NH 4IRJB 5HDBE 5L7XH 3HZYA 4JN1H 4FQCH 3AXLA 1WFTA 3EOYG 1MFAL 3VFNA 1VDGA 1NCWL 3H3PL 1A22B 1WGOA 4P23C 3TYFB 1QSFD 4Y8AA 4DGIL 5IMKB 2RQ8A 4JHAH 4PP1C 5L88L 3RI5F 3HAEA 3VH8A 4KC3B 5ABDE 5IESH 1U3HA 3S34L 2NLJB 3IVKB 1JYNA 3FO1B 3OBAA 4X7DC 5DC9B 3IDGA 4P5TA 3WV0A 1JGUL 1AXTL 4DVBA 1FO0B 3S37L 5K9JH 2W9EL 4CU6A 5CGMA 4L29B 4PB9H 3V9FA 3ZSTA 5CILH 2V2TA 4PJ8A 5DRWA 2FLBT 4R4FL 5DGRA 4RBPK 4WFED 1T6WA 2V5MA 4PJHB 3OZ9L 1RZKC 2WUCH 2GUOB 1XR9B 3STZB 2VDQL 4C57C 5IK3A 2Y6SD 1HQ4B 4UUJB 3LEXB 1BD2E 2YD4A 4O58H 1X6NA 1QA9A 5DJYA 4OGYH 4GS7C 4Z77B 1FZKB 1NUFA 2X4TA 1BP3B 3H42L 4R7DB 2J8UA 3ZKNC 1QFPA 4DFHA 2CXKA 4AEIH 3TVMB 3PWVB 3ZKQD 4M93B 5ISZE 3HNTL 1CGWA 5KVGL 2JCCA 4KV5F 1VEOA 5FKAB 2EC9T 4LCUA 4NPYB 4KTYA 4DAGL 4ZO9A 4DGVH 4PGBA 1XGRA 3ARGA 1DQQB 4YBLC 5FCUL 1X4YA 5E8OB 2GW5A 3K4ZA 1F90L 4QY8B 5E1HB 4G3YL 5C9JB 5D71H 4ZAKD 4P2QD 3D2UB 3R06B 5DZLA 2DN7A 1OSZA 2XRAH 5DHVH 4ZNEE 5DK2A 1QNZH 4UNUA 3WJJA 2OTWA 5GIRA 3T3PF 4WI8A 4MXVE 3TNMB 4HX1A 1CGSH 4K7PY 3MRDB 5ADPL 3TNNA 4LCYA 4EKXA 1NFIA 1J1XL 3ZT7A 1LWRA 1R0AL 2HVJB 3I50L 2A6JA 5DI8B 2NY1B 4ELMF 4JHAL 4WHYG 4EUPB 4L4TD 1IVLA 4PRHE 4I0PC 3QQ9D 2X7LA 3VGAB 3PIQB 3JWDL 5DJDB 1IEHA 3KR3H 1OTUC 3QIUB 1T5WA 5EC1A 5LBSH 5L2JA 2I60H 3NVQA 2ITCB 1L7IH 1VERA 2Q6WA 5KAQF 2PO6A 2Y5TB 4FFWD 4JGMA 2Q76A 3MJ6A 4Z7WE 2BMKB 2WUCL 5C0JB 1G9NH 1RI8A 2ADGA 3MUGB 2A83B 5JZ7D 3BAEH 5D1XB 5CBEB 4TTDC 4M1CD 3QG7H 1YEFL 3G5VB 5EBMB 3QUYB 2EYRB 4M7JH 2MQ3A 4Y5XC 3DSFH 2A6KB 5HGHA 1HIML 2HVKB 4YUEL 2X4UA 5IIEA 1KB5L 5A2LH 3TLRA 3ZE1E 2GSGB 5B3JF 4LHUG 3MGOA 1FGNH 2VLJA 1IM3A 3TGXA 1TZIB 1TQCB 4UI2A 3CMOH 4Z7NF 5MI0C 3UPRB 4H1LA 5IFHL 4P99A 3PGFL 1WLHA 2WZPD 2XV6B 1MCRA 1S9VB 2F5BL 3H9SD 4IOIB 4X7FC 2PKDA 2YMXH 5GGVH 4OM0L 2PTUA 5BV7L 1Z9LA 3AY4A 5SV4A 5D7IF 3W9EA 1R5WA 2BP3A 1NGWA 4AEHH 2CRMA 3TBWB 2YPVL 3BN3B 3RI5K 1ZEAH 4H26B 1HXYB 5EC2B 4MQSB 1AIFA 3QNXB 3VXMA 2PXYD 5EU6B 4ETQA 5I18H 4HV8B 1HH9A 1T3FA 3WDHA 2ZSVA 5TPWL 2GJ6B 3KPRE 2OR9L 5GGTL 1WZ1L 5DD6A 3DGGA 4XXDB 3WLWC 4QRUB 2EDHA 1IAKA 3I9GL 5E6IA 5TE4H 1VFBA 4WO4A 2OTUA 2C7UA 2AQ1A 1PD6A 1MFDL 5B21A 1A6TB 4M6OH 1XF3A 4QCIA 5JQHC 1GZQB 2PETA 2Y06L 3S88H 5FK9A 5EORH 1VCAA 5T5FH 1FVEA 3DUUA 3FCTA 4JFFE 1PKOA 3B6SB 4U31A 3MUY1 1F6LL 3OAUH 1KFAH 4XCNB 5IW1A 1FBIH 5C0RH 3MOBH 5FOBA 2IH3B 2XTJB 4KXZH 1CFVL 4R90L 2D0FA 2O5YH 5D7JC 4JFEE 4OBRA 3IRPX 5E5MB 5HHOD 4JREB 3MMEB 2X9WA 2R15A 4ZUSB 3ES6A 1A6VL 1KXTB 4Y4FD 1NAMH 1ZTXL 3FRUB 4MGXA 3IT8D 2BVQA 2EIZB 1SBSH 4BSWB 3QO0A 2WIIB 3KLDA 3ZDZF 4NFDA 4WWID 1XT5A 3G9AB 2ZPKL 4JY4A 3RGVD 3QDME 1WFNA 4F8TA 4NN5B 1H5BC 1U8LA 1ZSDB 2XKUA 4ALAL 4Y89A 4G9FE 5CJOH 1BMGA 1Z9SA 2BRRL 3TBVB 3ECBB 1RIHL 1FH5L 2LAAA 5F9WB 3A6BL 5DJCA 4P23A 3ZHDA 4JFXA 3E1F1 1PX4A 3I6KA 3RVTD 5J9PB 4OZFB 3ULVH 1BQHB 4F2MB 4FTVA 5T3XD 5IR1B 5H8DA 4JLRA 1YA5A 3PQYD 2YKLH 3GIVA 4OCMC 1XF2B 4RX4A 2VZ3A 3HR6A 4NQUA 2H1PH 3QEQA 4PJDA 4YFDB 4QXUH 4JFZL 3V52L 2V9RA 3AMKA 1HQRB 2ILLA 3KYMA 2NX5A 5FA4B 1M1SA 1MVUA 1E28A 1FE8H 2X4NB 3QZWG 1D5MB 5HI5D 2BVUA 1L0XA 1MLCA 2H2PD 4XBPA 1AGEA 2XQYK 1A7OL 4P5KB 5IVXA 3U36B 2EDNA 2F74B 3AAZA 3HAEH 1UZ8A 2BXZA 2GY7B 3LKSA 3H9HB 2P5WD 2EKSA 3B83A 4HS8L 2FX9L 3U82B 1IBGH 4JRYB 5C7XH 1I9JL 2R69H 3DYMA 5IHBA 4L3EE 3HPJA 3IDXL 1OQOA 3L3HA 4UIKL 2YEZA 4RIRA 1QSED 5CLTA 4B53A 4Y19B 2AJUH 4ONFL 4P4KB 1AGDA 5D5MB 4BA8A 2YWYA 3V5DB 3OAUL 1S78D 4PYGA 4M1GL 3U46B 5D2LA 3U4BL 2MCPH 1KN4L 2GITA 4LARH 3VU2A 4IDJL 4TQEL 2O5YL 2ZZUT 1ZA3A 1RUKH 5EIVA 4Y1AD 5SX5H 3BD4A 1CD9B 4WFFE 3REVB 1J8HA 1EVTC 1QBAA 4PTUA 3FZUD 5ICZB 3PWNA 1NAML 2YRLA 1QR1A 2GT9A 3B8YA 4HJ0C 1ZVSA 2X4SB 2OI9B 3O45A 3PL6B 2P4AB 3JUYA 4NQDD 3NIGE 2H32B 3BMVA 4DCQB 1HHJB 5I1DA 3RWCA 3LKPB 3KPNB 7CGTA 3HAEG 3OAZK 4X5XA 3VH8G 2QQKL 4Q2ZB 3SDDB 4NC1C 3HMXH 4FP8L 4K3JH 4HFUL 3T0EE 3LEYL 1GZPB 4J4PC 1QBMH 2BSTB 1LNUA 4I0PA 5D70L 1NCDH 1ZLVK 1EV2E 1KXVC 1G0XA 2BNQA 2MNUA 5EZJB 3RVWD 3QUMB 1BJ1J 4JR9L 1CGVA 1F3RB 3T2NL 4FXLA 4I4WA 3I3DA 4L4VE 4YQXH 5C0FB 1UB5A 4KI5D 5GJTH 1MREH 3UDWC 3SDAD 1AE6L 3MJGX 4IMLB 4GXVL 3UTQB 1OGAB 3IDNA 4RQQB 2W9DH 1DLHB 3O3DA 1P5UA 4U3XA 3SDYH 3BMWA 4YIQB 1JZ6A 3AFLA 1QO3B 3MXVL 5LGKA 1J8KA 4U1IA 2WLYA 2ZUXA 2V17H 1D6EB 1IEAB 2CK2A 5EOQL 3P73A 4MNHB 3FQRA 3GMRB 2N7BA 3MLTB 3HR5B 3NABL 4QWWC 3WFCL 1ZHLA 5ILTL 2IGFH 5AG8A 1KCSL 3X12A 5AD0A 1NCAH 4XCEB 1A3QA 4Y5XA 3UMTA 3FFCD 4I48A 5A16A 1AO7D 4ZDHB 3K3QA 4TSAH 5J3HC 3ZHLA 4MZ2A 2DQIL 2WQ8A 2AK4E 3D0VB 1YNTB 3MRMA 4PGDB 1ZWIA 1QZ1A 3MRRA 3DVNA 3RWIA 3CLFH 3FHQA 5KSBF 1JMXA 3WNMA 3CJJA 1CD0A 4HKJB 4WWKC 1OT2A 5DJ2B 5FYKD 2JLLA 3ZO0A 4GMSH 4J12A 1WISA 1M6OA 3BZEA 2DTSA 2NY0D 1A6AB 1FL3A 4NM8H 1R3IH 3QRFM 4WUKL 4MLIA 4LQFH 4Z7UA 1IAOB 2WWKO 5D7LE 5C9KA 5IEKB 4TVPD 4ZPVA 4HKZB 2XWJA 4KQ4H 5H2BA 4MNGB 3NBNA 1Q94B 2LTQB 5C0BD 5F7KC 2VITA 2IANB 5EO1B 2IADB 1I8MA 3QXDA 4XCFH 3MCLL 4EOWH 4KHXL 2DQJL 1KJMA 2CLRB 4PY7A 4NRZB 1UYWL 3HG1D 4YFEA 4HF5L 5FGBC 4UV4H 1I1AB 4XNYL 4KHTH 1PG7X 2AEIT 5E8EB 4MDIB 1NCDL 3BPLC 1INQA 2Z4QB 1T1ZA 1BBDL 1KTDA 5JIHA 1MUJA 1QHPA 5ESAB 5E99L 4C56E 4FXKB 4O2FB 4POZC 3BVNB 5I15H 4XZUB 1LK3L 1KNOA 3Q1SH 4HZLB 4L8DA 2IAMB 5I1JL 5HHNB 3N9GH 5D7JA 1R3HA 2DICA 1MEXH 1G7JA 3U30B 3T8XA 4CVZA 1H3GA 3GMOB 4WU7A 4Y0GA 1CI5A 5GRZA 4JQXC 3ZTJH 3AREB 5DDHB 4JDZB 4G5ZH 4PJBB 2XPGA 3VJ6B 4YHZH 2X1OA 1TENA 2IGFL 4QRPB 1TPXB 4RWYH 4O2EB 1MNUL 1G6VK 1H5BA 1JPSL 4H1LG 2DAVA 2D7PA 4XVSH 5F1NA 5EOTB 1J0HA 1T0NA 3HRZA 1IGJB 5BS0D 3LV3B 2BNRA 1N59B 2GCYB 3ZE2F 12E8H 4X6CB 2NXZB 5F7DA 1ZVHA 1KLGA 2FX8H 2GFBA 3KYNB 3PP3H 1TZGH 4X7SL 3LIZH 1L4IA 1RK1A 3I6LD 1FHGA 4OZGF 5E00A 4GMSL 3V7MA 1I1YA 4JG1H 3BN9C 1A9EB 3HRPA 1XMWA 4JDVB 1IM9B 2OXHA 3VI3F 4PJEE 5BXFA 5CEXA 2VABA 5CEZL 2D7OA 4GMTH 4QHKJ 3NFNA 3QDHA 3FB7B 3QEUA 4PG2C 4HW6A 3EYSL 1RJZA 4Z9KB 3ZTJG 1FDLL 4PJ7E 5AYUL 5JPNB 4P2RB 2P1YA 3R1GL 2R8SL 4EQ2A 1L6XA 3MGTA 3MJ7A 4K9EL 4D0CB 5DVKA 1KTLA 3X14A 4MCZB 1L9MA 1YEEH 4CU7A 2XQBL 2WSKA 2EDJA 3LRSA 3EUUA 1Q0XL 4QRRA 1QYGL 4URTB 1OAQH 1DTUA 4KRPB 4NNYA 5T1MA 3V0VA 1EMTL 4JPIB 5HJ3A 5B4MD 1D5ZA 3WFDH 3HC0A 1T2JA 3D39B 2VXQH 3HNVH 5E08L 3O2DA 1PKQB 1FO0L 1MPAL 3KPOA 4F7TB 1R3JA 1YN7B 4NKIL 1RZKH 4P9MH 1RZGA 1PY9A 3V6FB 3EJJX 3CFEB 2R1XA 4JFOA 5B22A 3O3BA 1VGEL 2LQRA 3MLUL 3PHOB 4UQ2A 3HUJE 4OCWL 3WCYA 2WBKA 1MIMH 4QHNB 4GQ9L 5DHVB 4ZFZB 3EYFB 4TTGA 4LVOC 5A2KH 2F5AL 3W0WE 4F7MB 1CN4A 3VXTB 4CVXB 5GRVL 2D7TL 5JMOC 4NP4H 4QF1B 3UX9B 4DKFH 1ZHNA 4LCIH 4YHKH 4M5YH 3EOAB 5DMIL 1MIEH 3BO8B 4Q6IB 3BKJH 4U6VL 2YUZA 3MV8D 1TETL 1ES0A 1NC2A 1IGCH 2OK0L 2D03H 4Y16B 5D72L 4LCWB 5ELIA 4WUUD 4J4PA 4DKAA 2FD6L 4NQXB 1B9ZA 1CD1A 2A9MH 4ZUTA 1KB9J 1L6ZA 2QLVB 2UUDH 2NQCA 3QIWB 1HI6A 1F00I 3H6JA 4NSKB 3VXRE 4JG1L 4YPGA 2LVEA 4CW1B 1C1EL 3B2VH 2ITDB 3MLVH 3RDTD 4I5BB 1W0YT 3DX7A 3RWJB 3BH8A 2NTFA 5DJAA 4BM7A 1FNGB 3UDWA 1ZGLA 1UZ6F 3QWRA 4BH7B 4JAMA 4HPYL 3AU1A 1E6OH 3WDIA 5I6XB 3DSNA 2GAZB 3GSQB 1A7NH 1QQDA 3O6MH 1UH2A 5FYJL 4H88L 3RWHB 4PJHE 5IWLC 4LNRA 3O6FC 4O02H 1H0DB 3BIAX 1BIIB 4RMQA 1AGCA 1NGPH 3AB0B 1RJCA 3WIIH 5C0GA 2PF6A 5F3BB 5I0ZA 5HYSB 5IFAH 1J0IA 3TO4C 2CPCA 4YDIH 2DQUH 4P48A 1IZJA 4LLYB 5E1AB 1Q1JH 3O6LL 4F7CA 2C26A 4NQCD 2Q8AL 1URLA 4QXGL 3ZYIA 4O51B 4WI7A 4S0SD 1UKSA 4W6WB 3G04B 3S98A 3U0WH 3U0PA 4PJ5B 4WWKA 4PD4K 1SY6L 2IMNA 5I9QC 1AFVL 2AJXH 3CK0H 3CSBA 1D5IH 4NJ9H 5K59E 4PRIA 3UTPD 5ICYB 2FGZA 5J6GA 3ULUC 4U1SB 5ACLA 1JF1A 3L3OA 4JPKH 5ID0A 2PR4H 3BIKA 5CLWA 2IF7A 5H37G 1K3ZA 1AD0A 4QHKI 3IFPB 4UAOC 2FX7H 5FIEA 3U7YH 2VZVA 5BW7C 3NN8A 1S7RB 4O4YL 1NC4D 4I13B 5IHLB 4PGEA 1VFAB 3BP5A 4OD3L 4RAUB 1P4IH 4Z8FL 3QCVH 4XPGL 4JPVL 3T1WA 1OTTD 2BHUA 3WIHL 5AWNH 2E6QA 3D3VD 3E6HA 2Q8BH 5IG7A 2Z91A 5BZDA 5FGBA 4PREB 1DP0A 2AEPH 2AK1L 1YEJH 4G6MH 3A6CL 2DLTA 1G7IB 1EXUA 4JFHD 3RVVD 1LEIB 3GFUA 2HN7B 2VKXA 3G6DL 3MBXH 3B2VL 1T66D 2BOCB 2WW8A 2FJHB 3L9RB 5MENB 4U1KB 3T4AB 4N0CD 3EFFA 2CXGA 3SDCD 1IKNC 2FWOB 1LGVA 3GKWL 2HTLC 1MCPH 1WFOA 3LPGA 4RFOL 4P2CG 4Q9RL 1WITA 1EO8H 4K71C 5ESQB 1EO5A 1MFEH 4LASH 3QZWB 1JZ4A 3WO4C 4JQXA 1WTLA 4C59B 2X89D 2VLRB 2W60A 3IAGC 4UBDC 3WIIL 5IFAL 5HDLA 1I7UA 1ROWA 1NMCC 3EDFA 5H94A 3D18B 4LLWA 3BZ4A 4NN6C 4KJYB 3IFLH 4IS6A 4LIQL 1RULH 4ZFFA 4JB9L 1EAPB 5DUML 4UDTB 4EI6A 3V4UL 2F53B 4S2SB 2P8PA 1BZ7A 5EDXA 3DO3A 4B50A 1TTFA 1IGYB 2B5IC 3GI8H 4PBWD 3FMGL 4DK3A 1EEQA 1MAMH 1MCEA 5I1HL 1EVUA 3JUZA 3RL1A 3RWFA 3BISA 3VI4F 1X5LA 3ARBC 4PG2A 4YDKH 1FPTL 3AXLB 3HC3L 2BC4A 1RFDL 3DJ9A 3V95A 2BFVL 3TFKD 4YK4B 5EU6E 4ELMA 3UXFA 4FQQA 3ZYZA 4YO0B 1WC7B 5FF6A 2GJ6E 1EFXA 1RZIA 1DLFH 5DD1H 2J8OA 2YPLA 5DF0A 5HDQH 3VH8B 3U6RA 5DSCB 1VEPA 4JANA 5I8CB 3Q6GH 4AEEA 3DIFA 2N1KA 4BSJA 3CAFA 3OWEA 1P7QD 5GGSY 3S4SB 1EK3A 2NTSP 1MFCL 3TT1H 3W11C 1ACYH 5JOPD 2SEBA 4XP1L 2V2TB 3NCJH 5HVHC 4DUWA 1KJVB 1G6RB 1HWGB 3QUZC 1XGYL 2DQDH 2VH5H 5JW5B 4N9GB 2J5LB 1SQ2N 2IH1A 2DQHH 3ME0A 4PJ9D 5IK3B 5KSVA 3MV7A 4HUUA 1J18A 1Y6NR 3S7GA 1DVFD 3B8SA 3QJFB 2FEDC 1I9RL 4QT5A 2QQNL 2OLDA 5IEHA 3T0BA 2EO1A 3VXUA 3FTGA 5KVEL 5JTWA 5DO2C 4WFFD 3IDJB 4GG6B 4JM2D 1P6FA 1HINL 2PCPA 2OMBA 2HT3D 2OMNA 1JZ8A 1VADA 2G60H 3O2DH 1JPTH 1HYSC 4WEMB 4QXTA 1HILB 5C8JB 3IRZA 4LDEB 4JO2L 3CVIL 3MNZA 4F7EA 4F8QA 1RULL 1W0WA 4H25B 2RAMA 4GW1B 1XGRB 4NQSA 2MQ0A 1REIA 3ARGB 4U1LB 4UV7L 4D0DB 2AABL 4TSBL 3GSRB 4CJ1A 1KC5H 1OSZB 3O3AB 1MCWW 1J0KA 1DFBH 5A3IC 4ZUWB 4P9HC 4HIEA 1CFNB 3M17A 2ZP0T 3O3EB 1NEUA 4U3HA 3Q48A 1NFIB 4XMKL 3PGCA 4X6BB 2ZUYA 4WHCA 4ENED 2ZSWA 5TJWK 1XGTB 3VRJA 3HI6H 1DEEB 3G6JA 4FQXD 1A6WH 4YBHA 1IC4H 4E41D 2OQJA 1VHPA 5IWLA 4B7IA 3O6FA 4UT7H 1IQDA 3LZFH 3RTQB 1MCOL 3QNYA 3NACL 5J89A 1U8MB 3BD5A 1G1CA 1JHLH 3NCBB 4XMLL 4XC1H 1N6QH 2FR4A 3KPSB 5EC1B 3JV4A 4HEPG 3QAZB 5HYJA 3TO4A 3DV6A 1QFUL 4JRYE 3VWJD 4RGNB 1F3DH 5BOZG 3VFSB 3KHOA 5FYLL 4DWHA 4OT1H 1KLUB 3VDBA 2DTMH 4OD2B 4Y19E 3CSGA 4UU9B 1FVDA 3K2UL 3VGGA 4RFEA 4HWNA 2HA1A 4I3GA 4B41A 3Q5OA 2XXMB 1FYTA 2ADGB 4NOBA 1I3RA 4RFNC 1E6JL 1N5AA 4XBGA 1NEZA 2HG5A 1UJTA 2EE3A 3P4OA 2E8YA 3MJ9A 5F1KC 1TXKA 4MNQD 1OARH 4WY7H 4AY0A 1JCKA 4IIQC 4FMKA 3IGAA 5KTEL 4HUXB 4ODUA 1MJUH 3SCMC 4JJHA 5IIEB 5GRJL 5BW7A 2J1KA 1YDPA 2VLJB 4JY5H 3P40A 4OLVH 2HTKD 5E8PB 2H3NA 5SWSA 5D1QC 1P1ZB 2YUXA 3QXVA 3K1KC 4L1DA 4CUCA 3AS2A 3C08L 2UZXB 4GRLB 3V0AC 3OGCA 5F6IB 1ED3B 4I77H 2JIXA 2EYSA 1FAKT 3W9EB 4OKDA 1U3HD 2K1MA 2LV4A 4C55A 2V2XB 3C6LD 3PJSA 3MNWA 1HH9B 4P5TD 1SJVA 1KJ3L 1YMMD 4U1MA 1A4JB 5DWUH 5D6DC 1JMZA 1MI5D 2ZUUA 3W9DA 1LO0H 4NO3A 4WW1B 1IKNA 5T1DH 4OCXL 1S7QB 5KZCB 5AZEH 1UT9A 1N8ZB 2UYLA 4GAJH 3HI6L 4ZUUB 3MTRA 4OIBA 3SKOA 5HPOA 2FZ3A 4NOFA 4NQVB 3KPQB 3LOWA 3C09C 2C7UB 5JHLH 5LGJB 4WI3A 4X7EC 5TGBB 1SMAA 3JV6B 1MHCA 1YPZA 3HZVA 1S7WA 3SGKC 3IKCB 1KIRB 3FCTB 3SJVB 4F3FB 1NMBH 1RU9H 2NY7H 4LLVB 4X0KA 3VCLA 1RIVH 1I7ZA 3QEGL 3CUPB 4GRWH 1KCLA 1HXMB 3C5ZB 4OT1L 4CL7A 2ZUQB 2VJXA 1JGDB 3TPUA 1JRHL 2A77L 4EN3C 4MA7H 4J6RH 4OCYH 3L5WA 2NY4B 5GS0C 2V6HA 4HUWA 4WW2F 5I8KH 1KSRA 2X42A 3GSOA 4NN7C 4G6JL 5ITBL 4PJCF 3MROA 1VSCA 4XI5D 1A2YB 5JPMA 1BFVL 1T1WB 4NKOA 1OARL 1PDKA 1DJSA 3V0WL 1QUNA 2EYTB 3ARBA 4HGWA 5F9OH 2EXYC 4YAQA 4Z7QE 1JK8B 3C9NB 5ESVB 1SYVB 4P23B 4YHYB 1AKJB 5EU7E 3CH8A 2C1PA 1MF2L 4NGHH 4F15B 5BO1L 2ICWA 1MRFL 4M00A 4JQVC 2DI9A 1DBJH 3MLRH 3KYKH 4OZHA 4CBPA 1XR8A 3C5SA 4CGTA 1QLRA 2IJ0C 1BX2B 4U4BA 5FEBA 4YHPA 1FORL 3GMMB 3L5HA 3ZE0F 2D9CA 5I75B 3KXFB 2Z31B 4OGXL 2C3XA 3KYMB 2NX5B 1RZFH 2I9LB 1BQLH 3QIBB 3QUZA 3CFCL 2B4CC 4JG0L 2CRYA 1LO0L 5JUEH 5DUBA 5AZEL 5IVXB 3IAPA 5E2WL 3LKSB 4GLRI 1FQ9C 1PLGL 1JPST 3FQUA 3BI9X 1C7TA 1C5DA 4H20L 5JO5B 3GK8H 5IHZB 5F21B 1NDGB 3L3HB 4PJBE 4NUJB 3ARFD 1OP5H 4PJIB 1QPPA 2HP4A 4H0IA 4KUZL 5EZLA 1Z5LA 5CEZD 5IGXH 3FJTA 4YHMH 4WFGD 4N8CL 3VFOA 5GISL 4UTAL 3PNWA 5C6TH 1UWEH 1QOKA 2X1WL 4YDVB 3L3GA 3DROA 5J4MA 2AKRA 3WN5C 1A6ZA 3KPPB 3WE6B 3OKEB 5FDWB 4U3CA 4V1DB 3GBNL 1A02N 1CFQA 1U0QA 1JPGA 1E4WL 4P4RB 1UJ3C 1IL1B 3O45B 5CP7B 5IB4A 1HSBB 4FFVC 3UJIH 5T3ZH 1OTSC 4M7ZC 3DUSB 1QEWB 4KTDH 3RU8H 1T2QL 5EBWB 3WDJA 2RCSH 1S7TA 4PRPA 5INCB 4X5XB 2QV2A 4K7PX 2DLGA 3RZCB 4GAYA 2XQYG 3X3GH 3DUHA 4M7KL 4PR5B 4CN6A 4PBVC 5B38B 2P7TA 2ED8A 3ROLB 2O61B 1LNUB 4I0PB 1INDL 2V2WA 3MLYH 4KI5F 5LKNA 3BH9B 2H9GB 4WO4D 4XP4L 4BQ8A 4JFDB 4XP5H 3TV3L 4J8RA 3PWPA 2AJVH 4DN3H 1K4CA 5BJTB 3MLZH 1T5XA 3W81A 2YC1B 3NFPB 3D39E 4QNPE 1ZAGA 2H8PA 2NZ9D 3OKMA 2EE6A 1PKQE 1YQVL 2EEDA 5DJ6A 1MCFA 3BKML 4Y4KA 1IKFL 1IC7H 1L0QA 3P30L 3WIFB 1MFBL 3D69B 2FL5B 2WINA 5HI4D 1RZ7L 1QLEL 4M6MH 4LPUA 1ZHLB 3HE7C 3WFEL 4XVUD 4FQLL 4WGWB 5GXBB 3FO0L 3W39A 2WMPA 3F65A 1GC1L 1JI2A 5DLMH 4LLUA 1U8PB 2O5ZH 4IIQA 2W91A 4X6DF 4QTHA 1BFOA 5FA3B 5JDSA 3SCMA 1NCNA 4XPAH 3KAAA 3F12B 2VXSH 1SJEB 1SVCP 3MRRB 1UXSA 1FNEB 3DVNB 5MI0B 4YXHH 3RWIB 1CXLA 1N4XL 2ZNWA 5D1QA 4LSVH 4R4ND 3WD5L 1ONQB 1S9WA 3WFHB 1AHWB 3BXNA 5FYJD 2V5SA 3FB5A 1FL3B 4LCWE 3ULUH 2CJUH 4GXUM 1QRNE 3MJ9H 4AL8L 2DYPA 1FC1A 9CGTA 3FO9B 3BW9B 4RX4D 4KK9C 3O4LA 2UZIL 1A3RL 1KF9B 1YNLH 3QPXL 4KMTH 5D6DA 3OXRA 3BWAA 1I8IB 1FFOB 4UT9H 5FECB 2ATKA 3QIUD 3SBWC 2E7LC 4PY7B 3ZKMD 4PJGF 1CLCA 1PEWA 4GW4A 3GMLA 4HJGB 1YEGL 3QDGB 4ONHB 1IEBA 1V5JA 1A64A 1JTOA 1P9MC 3CX5J 4RDQF 3IJYB 4CDGC 1KGCE 1S7SB 3SE8L 4GT7A 3SGKA 4B5EA 4I9WD 5IB2B 2Y6SC 4S1SL 5CWSB 5IB1A 3FN0H 1T7ZA 1U6AL 2XA8H 4G7YL 3K4AA 3BDYH 1Z0MA 3IETB 4HHAB 1WCBA 1UACH 5D1XD 4R96A 3RPIB 5ANMB 4E0RB 4LPYA 1EJOH 3ZKND 3O3UN 4PJAF 2DWEA 1JWUB 5JW4Q 5EU5B 1KBGH 1NEZG 4EN3A 4P46B 3UJTL 2RGSA 3MREA 1YUHA 3MJ8B 1CT8A 5DVOA 1IC7L 4KFZC 3VA6A 2PYFA 3FOLA 4EIGB 2QR0B 4PJ5E 5BCAA 5HYEA 2FIKA 5IQ7L 4K8RH 3MRGA 3BP4B 5GS1C 5DLML 1Y6MR 5HDBF 1EEUA 3QR2A 2Q86A 3EOBB 1ZHKA 1T0NB 4HWBL 1XCQA 5D96C 3TP4A 5CJQL 1S8DB 4TOYH 4AG4L 3TT3L 2DWDA 5EUKA 3GI9H 5DJZB 1TVHA 3KWWA 1FN4A 1QSZA 2XG5A 4ORZC 1KCUL 4JQVA 4K3EH 1OW0C 4YGVA 1QFWM 4IRSC 4HIJB 3ZKSD 3VDAA 1H8NA 4QRQB 4JCLA 1XH3B 3T3ME 1UWXH 4OF7A 5C0EB 2N7AA 1FFNB 1N7MH 3QQ9C 1M05A 1SJHB 3SDXB 1CU4H 2YSSB 1S5IH 4KMQA 1CLYH 5JORA 3TO2B 1I3UA 4M7LT 2X1PA 5MENE 1GGCL 5I1AA 3MO1A 1XEDA 4GXUN 3JZ7A 3OKDA 1TCRB 1JNJA 1CVSC 1K2DA 3HC4H 3JTSA 4K07A 1V7MH 2VIRB 1K8IB 4DKDC 3T4YB 4NHUB 2NY2B 2XTJD 4AIXA 3QG6B 4NT6B 2IQ9H 4FFWC 1FZMA 2RIKA 4QRRB 5D6CA 3OB0H 3BT2H 3O8XB 4NNYB 3U9PH 3V0VB 5IQ9B 4ZQKA 2PYEB 5HJ3B 2VLRE 3GO1H 3NIFE 3BRFA 5JZ7C 4Y7MA 3LEVH 5GSRA 2DLIA 5DD5H 4H0GA 4E9LA 5HGGS 4EQ3A 1KBGL 5E2VL 1G6RL 2JJVA 2XZQH 3Q2CA 4Q0XH 4NWTH 1B3JA 3WN5A 2F53E 4Z76A 1EHNA 1DBKH 4M8QA 1LVEA 3TYGL 3F5WB 3ULVE 2I5YH 2DJ4A 1UJ3A 2ZCHH 2BY2A 4F7PB 4MXVF 5E9DB 5F7YC 2F54A 1JGVL 2GIYA 1WBXB 1XF5A 2VDOH 3TF7C 5E8NB 2ESVE 1SEQH 4NQEB 3MRPA 1F3DJ 1ZHBA 5A2JH 1MQKL 2AI0L 1OAYH 1HOCB 2RFXA 4OZ4B 4NKMB 1ZT4A 2VDNH 5JXAH 1IGMH 2G2RA 1AJ7H 1A1MB 3MA7A 1C8PA 1VFUA 4FS0A 1KJ2A 1M71B 3BPOC 3ARYA 1B6DA 1PYWA 2NW3B 3TCXA 4UNTA 3CU1A 5FV2A 5DJAB 1J05A 1C5BH 4HT1L 5TFSH 4MWFA 4HXAL 4ETYA 1ZGLB 1GJIA 1SM3H 3LMJL 1S5IL 1F8TH 1OCWL 3K7UA 4JRYD 4OAWB 5DURD 1X7QA 4Z7WF 5INDB 1F4WH 3EJYD 2P8MA 5KN5A 1PG7L 3TJHC 2EDLA 2R0ZH 1QVOA 5HVWA 4XCYA 4JO3H 3SHSA 1G7MB 3TBYA 5LXGL 3WL9B 5I74C 4CAGA 4HBCL 3T2PA 2R4SH 4N8VA 1AGCB 2XT1B 1OM3L 3HE7A 2JB5L 1MJJB 3EYUL 4JO4H 3BT2L 5F1OB 2R56L 1OPGL 4YEEA 3W5MA 1U92B 4Y4FC 3KJ6H 4GG6E 1M7DB 5CMAB 5DD0H 4G80A 2AXFB 4UT6H 1CYGA 4FQJL 3SKNA 5HPMB 1KEMH 3PUCA 2C1OB 3MBEB 4MJ5B 5SWZB 2QQLH 3G6AA 3U0PB 4X80H 4QRSB 4U1GC 35C8L 4Z95H 1KULA 3EFDL 3T0AA 2AW2A 2YWZA 3QFJB 1MHPH 4O5LL 5J6GB 3FB8B 4RWHA 2COQA 2R1YB 5ITFB 3RAJL 3IF1B 1QSFA 3TA3B 3GJFH 2P46B 3ZZ1A 1TJIL 3RVTC 1V3MA 2EZ0D 5BQ7A 1IFHH 2BRQA 4UB0H 1R5IB 1N0XL 3SKJL 1D9KB 2VDOL 2DQEL 1KEGL 2XN9A 4JPWH 3O2VH 4H5SA 1RK0A 3UJJH 1HZHH 5GGRB 1MH5B 5FYLD 2ZOLA 4APQB 3SBWA 1FCCA 2ZJSL 2E7LA 4KDWA 4XP6H 4MD0B 1IGML 3W5NA 2WBWB 2NR6D 1Y0LA 1OGAD 1P9MA 4M62L 3WYRA 3IFNL 4LP5A 3MRFA 2P47B 3CFDB 1UKTA 2NY5H 5C0CB 4P9HL 2P49B 4OLXL 5D7SL 1QBLL 4KDTC 5BVJB 4AMKL 1CK0L 1I3GH 3KPSE 3GUTB 3QH3A 4KTEL 3MXWL 4GRWB 4RGNE 1CBVH 1U8NB 1IGIL 4NHCH 2EDXA 3OV6A 5LQBH 2D0HA 1QPXA 2BVTA 2VL5A 2FO4A 3GSUA 4LLMA 1ND0B 4R26H 3V79C 4EEEA 1DQDH 2MQCA 2FJFB 3T65B 3UTTB 1DQMH 1E4XL 1S78C 4O2CA 1Q0YH 5DMKA 5TE7H 1JBJA 4MXWL 1F97A 4NUGL 3CDCA 3IXTB 4AH2A 1BGXH 4KAQH 2A73B 3D25B 4JO4L 3VMOA 3QULB 5GS1A 4FZEH 1DDHA 5CD3A 1GSMA 3FZUC 4ISVB 3GNMH 1IT9L 4P2QA 4WW2B 5DMGD 4HCRL 2Q7NA 4FQ1H 2NY6C 1N2RA 3ZLQC 2VR5A 4F58L 5HGBA 2DOCA 1KPVB 3L3DA 4QHLA 1N5YH 3H7BB 1BLNA 1SYSA 1KEML 2CD0A 2VLJE 2P8PB 3DETC 3FONB 5GS0H 4X6EA 1FIEA 1OAKH 3RY4A 2QQLL 1JRHI 2YXMA 3OMZA 1RZ8A 3JTTA 4GG8A 4JVUA 5GGUA 5TDOB 2IAND 3TIEA 4Z95L 1T03H 1CDGA 2HJFB 1NC2D 5IROC 4HG4J 1JGEB 1RIUL 1OW0A 4KQ3H 2VSCA 4IRSA 2CIKB 3NFSH 4PGJA 1ZOXA 5J1AA 3ZTNL 5KSUA 3F7YB 4JKPH 3LQMA 5C09B 4Z0XB 1I1AD 3RHWF 3WEXA 4L4TA 2CUIA 1F4YH 1U36A 4GUPA 1NLDH 2W1NA 1CTOA 5GPRA 1WAAE 2VDMH 3VXME 1LD9B 3QXAB 3RVWC 5ALCL 4G8IA 1RZJC 4S0TD 2V7NA 3PDOA 3BGFC 3E0GA 3QWRD 1GIGL 1RZIB 5C2BH 1FSKB 3IAQA 4HIXH 3T77A 5LJYH 4KI5C 1OSPL 2CDEA 4XNUL 3V6OC 2YPLB 3SDAC 1ZK9A 3U6RB 4RSVA 5I76B 2Y07L 3ZT5A 2E7CA 5E0QA 3UBXB 1A1NA 2XI9A 3BKCH 3P4MA 4PV8B 3SY0A 4HC1L 3IU4L 1RMFH 4DUXA 1EHAA 4MHHG 2Z93A 4KK8D 5HHPA 1LE9A 2B4CH 4LSUL 3DX8B 4U6TA 5EH1A 1BPVA 3B9KB 2IH1B 4KJQD 4QRPD 5JQ6L 5DRZA 1Z3GH 4R7NA 4X9BA 1A4KA 1OOAA 1LO5A 3HLAA 3M1BB 1INEH 2FLRT 5JA8B 4DTGL 2DQGL 4HUUB 3BOVA 2O93L 2X4OA 2HH0L 3U1SL 5GGVY 2H2SC 1YN6B 3MFFA 3QI9B 4XVTL 1UXWA 4OUUA 3NIGF 2XG4A 2BHYA 1RV6X 3VFMB 4FNLH 4PRID 4D9LH 4PTTB 3SO3B 2NW2B 1M7IA 1WWWX 1T0MA 1KACB 3H9SA 5KW9H 4IDLA 2NY0C 3PHQA 2C3VA 1BJMA 1IM9D 4Q9CA 3CCHB 4XNXL 1A7BA 3WHE1 5EO0B 1X5HA 3FL7A 5TF0A 2X2YA 1J1PL 1GVIA 3S3JA 2VLKB 4P5MA 4FFZH 3GSXB 4XVJL 4LSQH 3QQ3B 4WI9A 2AJYH 4OUOA 4Z78B 4RISL 1JWMA 3EYQC 4FTVE 1A14H 1YEIL 3BKYL 1T7WA 4P2RD 4X8JA 3HTLX 1P69B 2YUVA 4QHUB 3CLEH 1J1OL 1NGQL 1U8OB 1U95B 1MRDH 1TJGH 4CADA 4WFHE 3QEQE 4XC3L 5C3TA 1K6QH 5J12C 3QXWA 3KXFE 4KGJA 2ZSWB 2P45B 2NX5E 1QFHA 2V9TA 4MYWB 5BMFH 2BVOA 5CUSL 5DS8A 2OQJB 1KPUA 2YXFA 3H0TB 4HH9A 1MCKA 1IQDB 3V4VL 5IVXE 5ERWA 5BRZD 1J10A 2VR9A 1UA6L 8CGTA 5J13B 5GGQH 3PDGA 1KJ2H 2BSRA 3HFML 1IC5H 4GRMA 2OL3A 3IS1X 2VXUL 4OCRL 4XPFL 5HHOA 2AQ3A 1QLFA 2ED9A 5EA0L 4Y4FA 1L7TL 1HHHB 3K46A 5L2KD 3BZFB 2X9YA 5TH2A 4GOSA 2E27H 1SEBB 4PJIE 5HGAA 4BH8B 3FB6A 1FVDB 1H3WM 2WUBH 3M07A 5DQJA 2XKNA 4NO0B 3SKMA 1UFUA 1OWWA 5IHUL 1IJ9A 2Y25A 4PRNA 4GBXB 4LBEB 1FAIH 1IGFL 1NEZB 3NIDE 4FFYH 1TTGA 4ODTH 3O11A 1J8HE 3OKKA 4LU5H 5GRUL 3RX8A 3DX9B 1AI1L 2DDQH 3IGAB 3BN9D 4ODUB 4WEBH 1FL5A 1H9VA 4FQHA 4PGCA 1XCTA 4JJ5A 3A0OA 3QUXD 4DOHB 3WLBB 3VFGL 3PQYA 3UTSB 1VGKB 1S3KL 3CXHK 3CVHA 5I1CL 1B4JH 3RHWK 4A6YA 2CKBA 5DEFA 4IOSD 1QKZH 4FFZL 2CMRH 4R97C 3X3FH 5EZIH 5KSAB 4YHOH 2AERT 1NLBL 3LN4A 4M6NH 3O4OC 4W68A 1F42A 2BNQE 1Q9OA 4X5WB 5ID1B 2EEAA 3N85H 1YYLL 4LSPH 4KDTA 2CUMA 3HI1B 1Z9OA 2CRZA 5AEAA 2P5WA 4E5XA 2OTPA 2R1WA 3MRNA 4U1MB 1CF8L 2FGWL 3W9DB 4NO3B 5I17B 1D5BA 4PY8J 1AY1H 1CLZH 3MRIA 3JWOL 1EZVY 4N8VG 2DD8L 3UP1A 2AEQH 3LPWA 1RVFL 4UILH 4KZDH 3NCEB 1QSEA 2GJZB 4MX7B 2A74A 3WXVL 3AS3A 1MHCB 3MV7D 5C07B 4XTRC 1UCTA 3WSQH 3WXWL 1GL4B 3PWJB 4GFTB 3IDMB 2AJZA 4Y1AA 3VXUD 5JHDB 4CNIA 3Q5TA 4G8GA 2OBGA 4QYOB 5BOPA 4R3SA 5LGHL 1EHXA 1MWAA 3VG9C 4L5FH 4L8BA 5HHXL 1ZV5A 4X4YA 3NAAL 4JZOA 5T33H 4G42B 5IBTH 3O6KH 1ORQB 5CS7A 3MRBB 2VQ1B 1UWGH 4L9DA 4XX1G 5IROA 4PJEF 2X5PA 2ICWJ 1AC0A 5ACMA 4Z7UE 4KKBC 1VKXB 1ZANH 3OKLA 3EAKA 1WT5C 4HKXB 5D7KE 3J8F7 2GEEA 3MLWH 5DRNA 5E2UL 1HH6A 5T1LA 4PJ7F 3L7EA 3P9LA 4QLRA 5HDOA 3S8WA 3RDTC 3PP4L 3HKFA 1YY9D 1EFQA 5MEND 1HYRC 3HZKA 3ZT6A 3JSSA 3V6OA 3ZL4H 4F33B 2ICWB 2QEJA 3SDAA 1GAFH 3X3FL 4OZHB 3WHE0 5DEZA 2L4OA 4YXKH 3V4PL 4D9RD 3QSKB 1N3NB 2XICA 2NYYC 5DVNA 5DTFB 1RURH 3VXPB 4OCSL 4M61A 5J6HB 3DO7A 1NJ9A 1JF6A 4IHOA 5HVHB 4ODVH 1C16A 2KH2B 1BVZA 3SE9H 3QRGH 3OXSB 5HYJD 1N26A 2IBGA 4MB3A 4Z7VB 3BEVA 4RMVA 2P24B 1UB6A 1AY1L 3VFVA 2ZUTA 3NA9L 5EU4B 4F57H 2AEQL 5IVOA 3EGSB 4CN1A 5KVMC 1C5CL 3FFCA 3HUJF 1AO7A 2M26A 2ZCKL 3OAYH 4TULH 2IPTH 5GS3A 3KVQA 3VXSB 5ISZB 4PIRF 1MRCL 3MA9L 5JIPA 2C4FT 5CINL 4X6DA 5D2NC 5CBAB 3L5XH 4ERSL 1H3PL 4UTBH 4AM0B 2APWA 3PNWB 4KKAD 3RWGB 4KZEL 5F88B 5C2UB 2MCG1 1NGYA 4EBQL 2BNRE 3GKZA 2NPLX 3FOMB 4ODXA 5L0QC 1CL7L 1G0DA 3VXQA 3QNZA 3QT2A 4NO5A 5C0BA 3AROA 4KDVA 2MPAH 1OF2B 1BOGA 1RUML 4I2XB 1H15A 3HG1A 1OTTC 3D0LB 2VUYA 1AGFB 5GRWA 4X99A 1G7PB 3GSNL 4PRHB 3MNVB 5FHBL 5KG9A 2BOBB 4MD5B 3C2AH 2Z8SA 7FABH 4D8PB 3MX0A 3RVVC 3P9MA 3SDXE 2QADB 4CU8A 1T66C 4PJHF 1KCVH 3L3JA 2MMXA 3VXNA 1R3KB 2HTLD 4N0CC 3V8OA 1YMHB 4ODWA 2YK1H 2V2WB 3EOTL 3BE1H 3MLSL 1GPOL 4ORGA 2B2XH 1BHGA 3IXAB 3LN5A 4J8RB 4YHLH 3PWPB 4Z7WB 3GRWA 1CE6B 4GKZA 4HUMB 4UOW1 3T0DA 2AV1B 4QRRE 4PD4J 1PSKH 3C87A 4PJAA 2B0SL 4G9DB 1BZ9A 1A7RH 4KVCH 2QSQA 2VLMD 4LLQB 3VW3H 4OLUH 3S5LB 3OPZL 3L3IA 3RPKA 4Y4KB 5BV7C 4EI5B 4S1QH 2ICEA 4XP9H 3LKOB 4Q9BA 5J1TC 5K59F 1E0OB 4OJFL 3QISA 4RFNB 5KVFL 5BS0A 4WNQB 2IPUK 2OL3H 2P5EB 3RZWA 2ED7A 3GJFB 1FZJB 2APBA 4WI2A 4OIAA 5IB5A 4L9LC 1R5VA 2J88L 3ROOB 3CXDH 2B1AH 4HWZB 3OKYA 5MERA 2AXJA 5E6YA 2ATPB 1A0QL 4UTBL 2Q3AA 4MAUH 3HE6C 5ACZB 4U6XB 4G7VH 3ARBD 2VDKL 4NQEE 3U7WL 2IBZX 1EH9A 3HI5H 4S11A 2NNAB 4LRNH 1NMAL 4OTXL 3BQUB 2Y7QB 4NC1E 4ZFGH 5EIIA 4XCCH 3U4AA 5CZVH 1NFKA 5T1KB 2OX5A 3TFKC 4MDJB 1BZQK 2DYPB 4XPTH 5FDYA 1ZS8A 2VNCA 4J1UA 3E2HB 1OP9A 2I07A 2FSEA 5T3XH 3QDJB 3L3KA 4K7PH 3ZSSA 1LILA 4Q6YA 4YE4L 3RTQD 1UCBH 4M48L 2R29H 5CSGA 5C08B 3OXRB 1BD2A 2OSLB 4U0RB 1MHEB 1RJLB 1R24A 4OLZH 3VWKB 3CVHH 5CGYC 1NL0H 3WHXA 4NYLA 1DE4B 3QO1B 1DSFL 3QWOA 3UO1L 4YHIA 2C4XA 3QUZD 4A6YH 3C60B 3PABB 2CKBH 5IKCB 2YRPA 3AGVA 1FV1B 3F7VA 4JRXB 2HWZH 3HNSL 25C8H 6FABL 2YD2A 2C9AA 2YK1L 3C2SA 3IS0X 2DBLL 4U2ZA 5JW3L 3L6FA 1AGBA 3FAXA 2ENYA 1P2CA 1IMHC 2BNUB 1DN2A 2Y72A 1ZLUK 1S7UB 1NUGA 2BSED 3CDFA 5EBLA 3LH2H 3Q5YA 1DBMH 1FJ1B 5CHNA 4YR6A 43CAA 1JFQL 3IJHA 4FABH 3CFIC 1MY7A 1BAFL 4JM2C 1HYSD 4AT6A 3RQ3A 2HT3C 2DM2A 4U1JA 1GGUA 5DJXA 5J56B 1QFWH 2KQMA 3F7RA 3ULSB 3DXAD 4U6HB 2PYFB 5SWZE 3QBTB 4ZPTB 4NN7B 4LDOB 4LSRL 4MQTB 4LGPB 5DVMA 3GHBL 3LRHA 1YEDA 3RIFF 1E4XI 3MRGB 3LS5H 3FQXB 5FHAL 4XNMB 5DYOB 3BFOA 3KLAB 4LEXH 15C8L 5DK3A 4GRLD 1WT5A 3BP7B 3CXDL 2Q86B 2JJUA 3H9ZA 3T0EC 2J4WH 3MOAH 5HGDA 3RY6C 1MWAH 1D5XB 1FVCA 2DWDB 2DL9A 3RDTA 2Q3ZA 2AAVA 5I1EL 3QCTL 3KHQA 4LPCA 5IJKC 1IGTA 3T0XA 2X4QB 2DLEA 1NANI 3Q3GB 3TN0B 2FBOJ 1BF2A 2IC2A 3MODH 2W0KA 4NZDA 4UQ3A 5C0CE 1ZLSH 2EIBA 4HIIA 5I1LB 1UCBL 4QGTA 3PGDA 1JWSB 1JPFA 1YZZA 4X6FA 5L8JB 1R3LA 1RZJH 3CX2A 2G75B 3OKDB 4GRWE 4PV9A 4GSDH 1EO7A 4L3EB 4NZJA 3SJVD 3O0RL 4PRBA 1FL6A 4BSVB 5LAXA 3C5ZD 1GGBL 2G9HA 4NQCA 5EFIB 1NSNL 3VFPB 2VDRH 3UTTE 1FZMB 3FT2A 2RJMA 3T09A 2H26B 2HJLB 4M43H 5D2NA 3D85B 1KOAA 4Z5RA 4NRXA 2V7HB 5GZOD 1LHZA 5F3HA 3KPLA 1X5ZA 5GSRB 1Q9LA 4UOW0 1PEZA 1A7PL 3MRCA 4BZ2L 1KPRA 4KU1A 4DVRL 2YPKA 1MCSA 5JOFA 3VXOA 4NWUH 4NZUL 2OZ4H 3R4DA 4Y4HC 4HK3N 4QXWA 4X9GA 1NC4A 3KDMA 4S1RL 1T7VA 1D6VH 4NO2B 4HIHB 4HUNB 4OB5H 4G8EA 1AKJD 2F54B 1O0VA 1T22A 3D3VA 3KPRA 4MJ6B 4N0UA 4PUBL 1G7LB 1II4E 1HHIA 5FYKH 3B4NA 2I9TB 3LD8B 1G84A 4D9QE 4NIKB 5C09E 3MYJB 5ADOH 3PXHA 5IV2B 3MRPB 1G9MH 3VA2C 4OLYL 1U8JA 1KENH 2Z8WC 4R8WL 2QSCH 4TUKH 2RFXB 4TVPH 5I1IH 5DZOA 2F58H 1ZT4B 4ELME 5CP3A 3V5KA 2YA1A 1QACA 3C6LC 4L4VB 1OLZA 5JIKA 4MHHI 1FRGL 1U58B 4G8FB 3P77B 3MRQA 2YPLE 2Q87A 1YYMH 3TZVB 1KJ2B 4JFQA 1FZOA 4RRPA 4Y5VC 4X7TB 3NGBC 1KB5A 1BM3H 4JM4L 1XGUA 2ZCLH 1A5FL 3MV9D 4LF3B 4NZTH 4JFEA 2A38A 3K8MA 2XWTB 1QP1A 4MCYB 5DFVD 2X89A 5L6YH 1YEHH 5KN5B 3SGEI 3VMPA 4ODHL 5HHVH 5SWQA 4ZG1A 4E42B 4EN3D 2IWGA 3BPNC 2BZDA 2X09A 4QHMB 3IU3A 3TIDA 4N8VB 3QDMA 4WDIA 4XRCB 3QHFH 5IJVA 4YNYB 2YD5A 4OD1L 4CDHA 3IFOB 3GRWH 3RA7L 4GQPH 4ZXBB 3OKOB 5GGTA 2CDFA 4L9LA 4M43L 3QPQC 4V1DD 4PRDA 3N1GC 2ZKHH 5T3ZE 1I8KA 1OAXH 3P0YH 5F7MC 4WHDA 2VDLH 4TSCH 4MXQD 3HE6A 4LSTH 5ALBH 3HN3A 2PW1B 1DUYA 3RIFK 1EHLL 3CSYA 1NDMB 1PVHA 2EXYD 5K9KB 1U8HB 1UM6H 1NBVL 4L8SC 1AXSA 2F19H 1U93B 3MLXL 4K3DL 4M5ZL 3C8KB 2UZYB 4XAWL 1KELL 1NBZB 2XWBA 3CD4A 3U9UB 3RKDD 4X8XA 3GM8A 4IJ3C 3RNKB 5E2TL 1FP5A 5BQ7B 3CZFA 3QJHA 1FFPA 2IPKA 2DQFA 3UZQA 4RDQG 1CD8A 1F6AB 1U8QB 2EC9U 4HEME 5EUOA 1BF8A 4ONGL 4C58B 4FOMA 5GHWH 4EZMA 4JFDD 4OFPA 4MZ3A 3BHBA 1LO2H 1A6UL 1P7QA 4XGZB 32C2B 1ZGLP 2QSCL 5I30H 3BP6A 4OSUH 5I1KH 3BGMA 3I2CH 4TUOB 4C56B 3G6JE 5CAYB 2VZOA 5IFJA 4FXGA 4WV1B 2VZ1A 3V6ZB 1WIUA 4NJAL 1S7XB 4JZJC 1UG9A 1PG7W 3KNBA 2YBRB 5D93B 2EDEA 2XZCH 5I73B 2EICA 5I8EB 2KKQA 5EN2B 3TH3T 3LKRB 5JR1L 2X4PB 4H8WC 3GSUB 4BQ6A 4JM2A 4K23L 1IQWH 1JHKL 4DGYL 1IZKA 1CXKA 2W65A 3ARFC 4JO1H 2PW2A 2G5BA 2GKIA 5IOPB 3TBSB 4PRAA 2CSPA 4LHJB 1FYTE 1T21A 4OM1L 4Y88A 3FQTA 3E6FB 3O81A 4GKSA 3REWA 4AH2B 1MFAH 5IMLA 1NCWH 2YD8A 4PLOB 3ULUE 1T1XB 4I18C 4IRJC 4YFLF 5KJRL 2I24N 4DGIH 2ZKHL 4Z7QF 4ZAKB 5L88H 1KG0A 4K9EC 1CLOL 3T0EA 3FN9A 4M03A 5FUZL 4XPHL 3N1FC 3RY6A 3MSPA 4RA3A 3S34H 3UTSE 3EDDA 1F45A 3EZJB 4JHWL 5DJ0B 1T6VN 3JTTB 4GG8B 5GGUB 2CO7B 1B0WA 1UGNA 3IJSB 1JGUH 1AXTH 3TIEB 1A1OB 5SWSE 3CDGB 3S37H 1GGIL 4NKDA 2Z35B 5IJKA 2VSDA 2JJSC 3BSZH 1AD9B 3OX8A 1NCUA 3NPSB 3UEZA 1C08B 1F2QA 1NAKL 3RUGB 43C9A 5J1AB 2ICES 4NC0B 5ENWB 4U1NA 1WEJL 2VXTH 3QDGD 1G7QB 3OZ9H 4E41A 4HUVA 8FABA 1H3TA 1NUNB 3RBGA 2VDQH 2BVYA 1T7XA 3GMPB 5E95B 1JZ3A 2A6DB 3UTZB 2JTDA 2NXYB 1OAZL 1XIWB 2V7NB 1LEGA 2XNAB 4OV5B 1NCBL 5HHME 3H42H 1UM5L 5E8DH 3LSOB 3I2CL 4O9HL 4WTZA 3VGHA 4N9OB 2D7QA 2HKFL 3KGRA 4P46D 5DK0A 3HNTH 5KVGH 4FQPA 4PJBF 1YPZE 4DQOH 4NQTA 5F8RC 1MJ7L 1VPOL 5C07E 3DLQR 4DAGH 5HHPB 4TPRL 1HK6A 5HI4C 5FCUH 2FJGB 3GM0A 1QG3A 1F90H 4G3YH 2R0LL 4MNQA 5DRZB 4MD4B 4X6CF 1A4KB 3GHEL 3W0WB 1IQWL 5D7LA 1RHHA 3FFDB 4Y4HA 3G5ZA 3TCLA 4P49A 5ADPH 3DRTA 3EO0A 1CGYA 2A6IA 3WNPA 3DMMB 1J1XH 5I66B 1ETZB 3U4EA 2JELL 5IM7B 3PG2A 4XB8A 4XHJD 1R0AH 4JFYA 4R4NC 4MQ7B 1BVKA 3I50H 5CCKL 3MCKB 2MHAA 4YXLL 5GGRY 3PHQB 3LVEA 1DQLL 3QFDA 1HDMA 3QUKA 2ADJA 4XAKE 4KK9D 4MJIB 3VXRB 4KKLC 5SX4I 3BRDA 2NY1C 4MSWA 2XN9D 4R6UA 2ADIB 5TE6L 1LE5B 3DRQB 4LSDA 2L0DA 3BPCA 3JWDH 1NPUA 3C6LA 3DHJA 2PXYB 3VGAC 5L9DL 4JKKA 5C0AD 1YMMA 1CL7I 1MI5A 2HLAB 2K9UA 3BSZL 3QIUC 4Y5VA 3ZKMC 5IMMA 4OZHE 4JQIL 4OI9A 2VXTL 3O41B 4CADB 1ZLWK 3ILPA 4QNPF 1MJ8L 1KLFA 3L95A 5FO7A 2A0LC 3NPZB 1HN1A 2R2EA 1HKFA 2RR3A 5CSZA 2OYPA 2WP3O 1FG9C 2PYED 2WV3A 4Z7VE 4XPBL 1YEFH 1X5IA 5DS8B 2QJDA 4AIZA 3PWLA 4AEFA 4WHYH 2CQVA 1V3LA 4LMQE 5D1XC 1PZUB 4FHBD 5E8DL 3O9WB 4X98A 1HIMH 4YUEH 3DBXB 3SQBA 4PG9A 2OL3B 1KB5H 5CEYB 5CIPA 3VXSE 1S5HA 4UZGA 3ARTA 5B8CB 5HHOB 1CXFA 4JFPB 4DQOL 3QWQB 1XGPA 2R23B 4Y4FB 4ZD3H 1MLBB 2BDNL 2R2BB 5IFHH 3RWEB 4PJFB 3PGFH 1CE1L 1TQCC 1NBQA 4HLZG 1JGLL 5F89A 2F5BH 3CFJA 5E9DD 1V7NL 2BSSA 2AXGB 1JN6B 4OM0H 3I75A 3RGVB 5BV7H 4I3RL 4MS8D 4L8SA 4N0FB 2AQ2A 4PJEA 2FBJL 2YPVH 5FKPB 3QEHB 1J87A 3O11B 3OKNB 1OP3K 1YY8B 5IB3B 4HDIA 2X70B 3Q6FA 5F72S 3X13A 5TPWH 2OR9H 4LVNC 3I84A 5GGTH 1WZ1H 4QGYA 4IRSD 2W0FB 4LPWA 4RGMB 3HCVB 4I2XE 4TUJB 5B39B 4JZNB 4PJ7A 3I9GH 2F8OA 4OZIB 5K33A 1PGRB 3PQYB 1PZ5A 4LDLB 3RIAF 1MFDH 3VRIB 5DR5L 4X9HA 3S96A 4PJXB 1I85C 2Y06H 4PRPE 5AZ2L 3OHXB 4HS3A 2MWCA 4RRPG 4Z0BL 3O2WL 4A6YB 1K8DA 2Y4SA 3G5XA 2DKSA 2VC2L 4CN4A 3UPCA 3TBTB 2HFGL 3EYVB 3WS3B 4LLDB 1DN0B 1T1YB 1XF1A 3DVGB 4K7FA 1JP5A 1X4ZA 5CJXC 5KS9A 1CFVH 4R90H 4JDTL 4JZJA 2L7JA 1I4FB 5JW4M 4WTXA 3VFRB 3PWPE 5D8JL 3WKML 2UWEB 2LABA 4FA8A 4YHNA 2XTJC 3ILQD 1A6VH 1EEYA 1IILE 3AS0A 1D5BB 1NBYB 2I26N 4DW2L 5AG9A 3LY6A 1ZTXH 4XNQA 4JREC 4ONOA 2KDGA 3ARDB 3HUJA 5TDPA 3HS0A 3STLA 3HPLB 1ITCA 4JN2B 1K9TA 2APTA 1E27A 3ARFA 2ZPKH 4JKLA 2CK0L 1YEKL 3EO1A 3MRLB 4ALAH 3RWDB 3BRGC 3FO2A 1W72B 3VFWB 2BRRH 1DBBL 4NN5C 1S9YB 1RIHH 1FH5H 5GSVA 4MJ2A 1CR9L 3A6BH 4I18A 4IRJA 1WTGT 2P5EE 2P8LB 1BOYA 3QFJD 2QBWA 4ZD3L 5F9WC 1YNKL 3TYFA 5CKGA 5K93A 5FB8B 3GMNB 2XZZA 4NQDB 5IMKA 2R0KL 2J2ZA 2AJ3B 1D9KD 2BVEA 2NLJA 4JFZH 3V52H 3FO1A 2JJSA 2XFXB 1T89C 3T3MF 2IEPA 1FO0A 2D0GA 5IMOB 4QOKD 2GTWB 1P6AB 5JLZB 2VXVL 3OKLB 1TDQA 3PHSA 1A7OH 1U8KB 3O4LE 3QDJE 1HH6B 3BGAA 5DEGB 2GUOA 1XR9A 2VLLB 3STZA 4EIZC 5C08E 1HQ4A 1OGTA 3LEXA 4UUJA 4HS8H 2FX9H 4OQTL 3BEWB 1I9JH 2FB4L 2FECL 4UINL 1CS6A 5LCVL 4L3CA 4LKCA 3IDXH 1ACZA 5AYQA 2CIIB 2DMBA 4RMRA 4BFEA 4UIKH 5I16B 3TJHD 4Z77A 1FZKA 4JRXE 2X6MA 4ONFH 3CDYA 3EJYC 4U6YB 5MHSD 3RJDA 4R7DA 5FYKU 3PXJA 4M1GH 3U4BH 2GY5A 3TEUA 1KN4H 3KPMB 1J0JA 4P4KC 3NIFF 3PWVA 4IDJH 4TQEH 4P59H 2HJKB 2O26U 3LS4L 1ZA6B 4ZSOB 3B2UC 3W2DL 4MJ4A 5FKAA 3BEVB 4KPHH 3VFVB 3B5TA 4JKWA 4K2UL 1DQQA 1KTRL 5E8OA 2OP4L 1KIQA 3UYRL 4HJJL 2CDGB 4WTWA 3ULVF 5JW4N 3I6GB 4YJZL 4PS4L 5FGCB 1X5XA 1R6VA 3D2UA 3R06A 1Q9KB 2JF1A 3D1MC 1UQSB 2OI9C 3E3QC 3PL6C 5AUMB 5IF0B 3HB3C 4HPOL 4ZYKB 1OAUH 1P84J 4Y2DB 3TNMA 2QQKH 1Q72L 3MRDA 1X5YA 3R0MA 1GXEA 4FP8H 5C0DB 1N6VA 4HFUH 2VZTA 3LEYH 3SDDC 4CMMB 2HVJA 2N56A 2YA2A 3AMLA 5D70H 1NGYB 5DI8A 2EZ0C 4EUPA 1BWWA 1AQKL 4JR9H 1NGXB 3GSVA 3T2NH 3C6SA 1UM4H 4DEPB 5J8OA 4G6AD 3ZDYE 2BJML 4S1DC 3RIAK 3PIQA 3ARRA 1AE6H 1QFWI 3QIUA 4GXVH 1WBZB 1H15B 1QTYT 2ITCA 3U7AA 4NRYA 5JNYB 3MXVH 2NR6C 1KB9K 1J0ZA 2Y5TA 4PLKD 5MEPB 1KV3A 3SGDH 2DKUA 4DN4L 1WCQA 1SY6A 4WTZG 5EOQH 2YN3A 1F11A 3HA0A 3STBA 2BMKA 1BBJB 3QP3A 3NABH 3WFCH 5C0JA 5J57B 3PDDA 3L3JB 5ILTH 1KCSH 3MUGA 2GTZB 2A83A 1F4AA 5JDJA 2F8VA 4ODWB 5D1XA 1CTNA 5CBEA 4D0BB 3FHAA 3BUYB 4NZRL 5D1ZB 5EBMA 5F6HJ 3UZVB 2EYRA 2VAAB 4HQQL 3S35L 2DQIH 2HVKA 4GG6F 5J0BA 4FQIL 1V05A 2GSGA 4P59L 3QI9D 1BZ9B 3WIHA 1HNGA 3WO3B 1TZIA 2RBLA 3FT3A 5DJ8B 4G8GD 3UPRA 3T1FB 2X1QA 4KPHL 5EOCL 3L3IB 1UH3A 4WUKH 3M45A 2ICEB 2VOTA 4HKBB 2NY6D 1S9VA 4M02A 5KBNC 2J6EL 4IOIA 4JY6B 3DETD 3UAJD 5DMGC 3CFBB 4R0LC 1NFDA 1TNMA 3TBWA 1QHOA 2VLKD 3MCLH 1OAUL 2LTQC 4KHXH 2DQJH 5EC2A 3QNXA 4ZFOB 5EU6A 4HV8A 1S9XB 1UYWH 4C83B 2F54E 4HF5H 5I2IA 1RUQL 2GJ6A 5F93C 1NCCL 4XNYH 4LQ1A 5EU7C 1X3DA 2Z92B 4QRUA 1I85A 4WI5A 5JXED 1WBYB 1KCKA 1I1AC 5T1LD 3B5GA 1I8LC 1BBDH 1IAIL 1A6TA 1GZQA 1UM4L 4LNVA 1AQDB 5E99H 3TM6A 5EO9B 2MJWA 3MRKB 2FH6A 1TMCB 1LK3H 5CJXA 2I07B 2VMFA 4R2GB 3B6SA 4HK0A 5I1JH 1MELA 3L3KB 4ODSH 5FUCE 3OB8A 5J1SC 1LDPH 4H0HB 5K9QG 4EVNB 1CXIA 5E5MA 3GMQA 3U30C 4ZUSA 4Z7OE 3INUH 1CZ8L 1EZVX 4KK8C 3FRUA 2EIZA 1MNUH 4BSWA 5J11B 1JPSH 4YDJB 2Q7YB 4M4RA 2WIIA 2IPUG 4KJQC 4NO0D 1TPXC 2GK0B 5D9SB 1JNHB 2H2SD 1FNLA 1ZSDA 4GKNB 1K4DA 4RAVB 3NCFB 3FKUS 3TBVA 1CICB 1BVLB 4HGMA 1Q9WB 3ECBA 4X7SH 1A7QL 4LLAA 2NXZC 3IJHB 2IFFL 2DS4A 4J3XA 5J9PA 4OZFA 4YLQT 3LDBB 4Q9QL 4S10A 3DTXA 1BQHA 4U1JB 4F2MA 5DQ9B 5IR1A 2EDQA 3ARQA 5HHQB 4I0KA 3L5IA 5CEZH 5I19L 4J3OC 2MFNA 1XF2A 1GOFA 5E4EC 3EYSH 1T89A 1LP9B 3MV8B 1BREA 4P3WA 2CLZB 3EYQD 3FRPA 3EBAA 1FDLH 1QSFE 5AYUH 4XH2B 4GLRH 4WUUB 1HQRA 3R1GH 4H1LH 5FA4A 5DD3L 2R8SH 5FO9B 1WAAF 4HS6A 2X4NA 1D5MA 4K9EH 1DCLA 2E7BA 1B2WL 4MAYB 5HGDB 2J8HA 3LKNB 3RDTB 4P5KA 5HYQB 2XQBH 4JCMA 3QHZL 3U36A 2F74A 1Q0XH 5CSBA 1MOEA 1QYGH 3LQZB 1RHFA 3H9HA 1EMTH 3B3IB 2PTTB 1I9IL 1DL7L 1IGTB 3KLHD 4JRYA 1PQZA 5E08H 5F6HI 3JVGC 2AGJL 1FO0H 1MPAH 4BK4A 4WFEE 3LKQB 3OJMB 3NH7L 3HZMB 4NKIH 4Y19A 3R8BB 2DMKA 2IQAA 4P4KA 4N90D 4ODSL 5D5MA 5SX5K 3V5DA 5I8OL 1LO4L 1KIPB 4HIIB 4PFEA 1VGEH 1OB1B 3U46A 1DUZB 3MLUH 4FG6D 1LDPL 3QA3B 1ZT1B 1JPFB 4OCWH 5I0DA 4W6YB 3FQWB 3M8OL 3MGAA 1GGTA 4GQ9H 1JE6A 5JHDD 4Y5YB 4GAFB 3RKPA 3INUL 3REVA 5ICZA 4LHQB 5LAXB 2PUQT 1JNLL 2F5AH 4HLJA 4NQCB 2X4SA 3PL6A 1JZ5A 4P3CL 4AENA 2D7TH 2H32A 4DCQA 1HHJA 4XNZB 2R39A 5FGSA 4W70A 5DMIH 4Z5RB 3KJ4B 4U6VH 3LKPA 1TETH 3DYOA 2OJZL 1T7YA 2OK0H 5D72H 3GB7A 2AV7B 4Q6IC 2D7NA 2FD6H 1T04B 4Q2ZA 3CC5B 3SDDA 3TWCL 1HEZA 4NCC2 3MRCB 4P2QE 4H8WL 2W92A 4Y16C 4HMCA 1GZPA 1C1EH 4RMTA 2BSTA 3VXOB 4WCYL 2IALB 1F58L 3EHBD 3QUXC 3GGWB 5EZJA 1CFTA 3IDYB 2BCKB 4HPYH 4G8EB 3WFBL 4JKMA 3MRHB 4N0UB 3RUGE 1HHIB 1F2XK 4IMLA 5FYJH 4H88H 3UTQA 1OGAA 4P2OB 4L4TE 3L1OL 5I6XC 1A3LL 1DLHA 1ORSB 2VE6B 4YIQA 1QO3A 2K3TA 4EUPH 1BD2D 4DZBB 1IEAA 5IVXF 2R0WL 4MNHA 1GC1C 2FATH 4MQXD 5EPMA 2R2HB 2WIMA 1CFBA 3VFTA 3AB0C 3SDCB 5DRXB 3O6LH 4KK5D 1OT1A 4Q97A 2CGRL 2Q8AH 4QXGH 4XCEA 5IW3A 1OQXA 4LSSL 4IRZL 5IP4A 4ZDHA 2DQTL 4RMSA 4XTRD 3ZKXC 1XZ0B 5ISZD 2DQCL 4PJIF 4PP2A 1RJYA 1KN2L 4PGDA 1SY6H 5F1IB 1AFVH 4AJ0A 2QSVA 3JV0A 4K94L 1AP2B 4LKXB 3WUWA 5DJ2A 5SWQB 2GJJA 2E9IA 1SVZA 3H3KA 4IOFD 3J7HA 1UVQB 1A6AA 3NIDF 2D31B 1IAOA 1SMOA 2J7LA 5IEKA 2YZ1A 4R0LA 5HYFA 4HKZA 4MNGA 4OLWL 4O4YH 1BEYL 1Q94A 2ARJA 4NFBA 2R4RL 4OD3H 2IANA 3VDCA 2B8OT 4YH6A 4EUPG 2DB8A 3DVIA 4XPGH 4Z8FH 4JPVH 3I3EA 5EO1A 3WIHH 2IADA 2IMMA 4KRLB 4KKBD 5IW6B 4DJMA 2AK1H 2CLRA 1QRNB 3A6CH 1A9BB 2B7DT 3H9SE 4LHUB 4NRZA 4FQ2L 2YD3A 5C0NC 1FG2B 4MJIE 1I1AA 4HFWB 3LHPH 5FO8B 1NGZA 5E8EA 1I8LA 4PRHD 4R4BB 3G6DH 4P57B 4EDWH 4MDIA 1TZHB 1QFOA 2Z4QA 1S7VB 3PF2A 4LAQL 1YY9C 3GKWH 1H3VA 5ESAA 4TRPL 5H37H 4O2FA 4KWUA 3D6GA 2E6PA 4OFDA 3BVNA 4RFOH 4XZUA 4Q9RH 4HZLA 2NYYD 3GSWB 4HGKC 3RGHA 4M7LH 5HHNA 3SEPA 3BHBB 2OJEA 2VQUA 1ERNA 1FCGA 1LEKB 4JDZA 2FATL 4AYFA 3B9EA 5IFJB 4OKVB 4I1NB 4QRPA 1T4KA 4WJ5A 4LIQH 4PJ9B 4JB9H 5DUMH 3LAFA 3PP3K 3V4UH 4QTIL 1W8OA 1U3ZA 3DWTA 5HHOE 1DVFB 4L1HA 1T80A 3RVUD 1IGJA 3OJDB 5HVGB 3LV3A 3C5JB 2GCYA 2N4IA 3CH1B 3IB4A 4X6CA 3OR6B 1U2HA 3KYNA 4JM2B 4PJFE 5CJBA 5I71B 2WBJD 4I3SL 2VDPL 3FMGH 2PW2B 2G5BB 3MRJA 5I1HH 4CJ0A 3FT4B 1G7HB 1MQ8A 2GSIB 2W0PA 1CFSB 4UDUB 4OI8A 1A9EA 4JDVA 4KKAC 1IM9A 1RUPH 4X4ZA 1FPTH 4EDXB 3OG6B 3HC3H 3IDUA 1RFDH 2BFVH 3MACL 3BQUD 3FB7A 2EH7L 1P5VA 3T2QA 3KYOB 2A1WL 4MA3B 4YK4C 3KPRD 5T3XE 4P2RA 4OZIE 3PQYE 4NM4L 2HFTA 4D0CA 4PJXE 3LHPL 4MCZA 3BYTA 1MFCH 4EDWL 3SPVA 3SQOL 4U1HB 3VWKD 3TC9A 4XP1H 4NDMB 1Y18A 4LVHB 3WNOA 3JVGA 1K5NB 2HYMA 1XGYH 3C60D 4JPIA 4FQXB 3VFUB 4XXCC 4JFFD 1TJHL 3D39A 2BVPB 4LK4A 4L8CB 1GHFL 1JF5A 5BRZA 1YN7A 2J5LC 4M1DL 4X4XB 2UWEE 1I9RH 2P5WE 2QQNH 4M7LL 4JFED 3V6FA 5A43C 1NAMB 3T2OA 5A2IH 5EZOL 2Y36L 3PHOA 3VWJB 5KVEH 2HFFB 3GIZL 1HINH 1N64L 1X44A 5L2KA 1QSEE 3NZ8B 5DHVA 4A2MA 2YS4A 2QKIB 5DK0B 3EYFA 3N06B 2D4DA 3TJEL 1P4LB 3PV6A 4DKEL 2QHRL 3QDMD 4JO2H 1FLRL 4KRNA 3CGTA 3CVIH 3I02B 4F7MA 3EO9L 4JE4B 4OZFG 3VXTA 4CVXA 1I7RB 4G9FD 4UIMA 1BQHG 4QF1A 4Y1AE 3NOIA 3NCCB 3G08B 3EOAA 2YRZA 3BO8A 4Q6IA 2X44D 4UV7H 4ZODA 2AABH 3SOBL 4TSBH 1UEMA 2UUDK 5C0IB 1I7TB 4Y16A 4LCWA 4L4JA 3K74B 5HI3C 3HE6D 4NQDE 2APXA 3FRPG 2ESVB 3U2SB 4NSKA 3QUXA 5ICXB 2ZUWA 3DRTB 1ZT7B 5ETUB 4CW1A 5LWYL 4G6FB 2ITDA 1RUPL 4XMKH 3HZYB 5H35A 4I5BA 3VFNB 3ET9F 1DANT 3EJZC 1FNGA 3X11A 2MHAB 2ADFL 4BH7A 3QFDB 4KI1A 3SDXF 2EE9A 3HAEB 2GAZA 3GSQA 5GJSL 3TN0D 3NZHL 4MSWB 4RMWA 3QQNA 1MCOH 3NACH 4LP4A 2R9HD 1U3HB 3RWHA 1ITBB 4XWOD 4XMLH 3CNKA 3BPCB 1H0DA 1LO3L 4ZTPL 5CGYD 3IDGB 4P5TB 1BIIA 3RTQC 1QFUH 4DVBB 4GAGL 3VRLF 3T0VA 4KI5E 3V6OE 5FYLH 4MA8L 5HYSA 3QAZC 4L3ED 4PJ8B 5DRWB 4RGNC 1CDIA 4LLYA 3K2UH 5E1AA 2ZOKA 5KVDH 1DQTA 4O51A 1ADQL 2M2DA 2C5DC 4RBPH 4YC2B 5FO7B 3G04A 1E6JH 2B1HH 4YX2L 3I3BA 1NKOA 4ZSOE 5C6PB 1QA9B 3D85D 5DJYB 1WWCA 2X4TB 5ICYA 2EECA 2J8UB 5KTEH 3FFCE 4NKQB 4U1SA 1AO7E 3GDBA 5FGCE 1ZMYA 5IT2L 5GRJH 1J5OL 2JCCB 3IFPA 4KH2A 4LCUB 3THML 1F02I 1X4XA 4PGBB 2XXCB 5EWIL 2AS5M 1EGJL 3Q0HA 1FIGL 3F62A 1S7RA 3F58L 1FNSL 3C08H 4FZ8L 1CIDA 5FYKE 1WQVT 1VFAA 4RAUA 5D7IA 4ZTOL 4PLNC 3T0ED 1KYOK 4PREA 5DK2B 4GRLC 4TVPE 2ZWLT 1CGXA 2OTWB 5GIRB 4KKCC 1G7IA 5F6IC 3EDJA 4NCDA 4HX1B 5C0BE 4GJTB 1LEIA 2HN7A 1KJ3H 3TNNB 4LCYB 3Q6FB 1AC6A 3E8UH 3RFZC 4L4VD 3L9RA 4F37F 5MENA 4OCXH 4U1KA 3T4AA 1WZMA 5DUPL 4HULB 3HG1E 3RY5A 4KROB 4YDLB 2A6JB 2EDWA 2ZUSA 1PZ5B 4ZFOL 2X7LB 4HS3B 4QRTA 2DI7A 2OXGA 3ESVF 5ESQA 4K55A 5A2FA 4KRMB 3G5XB 4PYHA 1T5WB 4G6KL 5L2JB 1WV7T 4CMHB 2HRPL 3QEGH 3QUML 2VLRA 2Q6WB 4HWBA 2AJSL 2PO6B 1JRHH 2A77H 4JZJB 2L7UA 2Q76B 3D18A 3CX5K 3C5ZC 5KVDL 3WUWG 2ZUQC 4KJYA 5GS2D 3VGFA 2AK4D 1EAPA 3MQIA 4PJAE 4UDTA 4XNQB 4G6JH 2F53A 2NY4C 5ITBH 4S2SA 5B3NA 4YWGL 3UC0L 2B1HL 3UPAA 3SGDI 1BFVH 3EDKA 5GZOC 3OL2A 3ETBF 3V0WH 5HGHB 1B0RA 5D7LD 2X4UB 3K2MC 4Y4HD 3MGOB 4XWGL 1IM3B 1U3JA 4RCAA 4H1LB 4OF5A 2FHCA 1B6UA 1MF2H 3RJQB 5BO1H 3I6LE 1MRFH 4YHYC 2X1XR 4YO0A 1WC7A 4MA1B 1T20A 4F15C 3F7QA 5DSCA 1FORH 1R5WB 1NGWB 5I8CA 3S36L 4LEOA 4OGXH 3OR7A 1AIFB 3VXMB 4ETQB 2IG2H 1T3FB 2QL1A 3S4SA 1HSAA 5F7HA 1JHTA 5K9QI 4XT1C 2NY3B 1Z9MA 2ZSVB 3CFCH 5I1GL 5I75C 4JG0H 3E8UL 4XXCA 2Z31C 3DURA 5DD6B 4C56D 3DGGB 2EH8L 1KJVA 1KCRH 1G6RA 1IAKB 3QIBC 5JW5A 4N9GA 5DQDL 5E2WH 5E6IB 1VFBB 4GRWF 4WO4B 4PB0H 1PLGH 2OTUB 1OGTB 1XF3B 4QCIB 4RA0C 4H20H 2CUHA 5FK9B 4L3CB 4LKCB 3QJFA 4KVNH 4F9PC 1FVEB 3DUUB 3U48A 1DBAL 4KUZH 5DFVC 2VYRE 3IDJA 4GG6A 2HMID 3K8KA 5IW1B 4N8CH 5FOBB 1KTKE 5GISH 4UTAH 5FYJU 2Y5EA 3VMNA 1HILA 5C8JA 3ES6B 4KUCF 3MCG1 3GBNH 3QPQD 4H25A 5TF1L 1X5KA 4GW1A 4LFHG 1E4WH 3HMXA 2BVQB 3V7AG 3QO0B 4U1LA 1KIQB 1M4KA 1P4BH 4D3CL 4D0DA 3GSRA 4JY4B 1CGUA 3A67L 3O3AA 4MXQC 1T2QH 1U8LB 4OFKA 4ZUWA 1CFNA 4ZS7L 4WGVB 3O3EA 1LP9E 5DJCB 2A9NL 3MV8E 5D4QA 5L7XL 3CFKA 4JN1L 4FQCL 4JFXB 4M7KH 3NCYP 3I6KB 4X6BA 3RZCC 4WUUE 3BDBA 1XGTA 4FTVB 1INDH 1RUAH 3RKDC 1DEEA 4JLRB 3GIVB 4XP4H 4F37K 1PX3A 1WUNT 3GSVB 4XMPH 1X5GA 3TV3H 3C6SB 3VD5A 3QEQB 3ORJA 3RTQA 1NUDA 5IESL 1U8MA 4PJDB 2NXYD 5ECJE 1XIWD 4J23A 4ZOBA 3KPSA 2IG2L 1E28B 1MVUB 5K9JL 1AR2A 3VFSA 4NRYB 1MLCB 5TDNA 1YQVH 4XBPB 1J11A 1KLUA 3VGEA 3BKMH 2YHGA 4PB9L 1AGEB 5CILL 5SV3A 5E24E 4OD2A 1KCRL 4LGSB 1IKFH 3WFZA 4UU9A 1HE7A 3AAZB 3P30H 1MFBH 1UZ8B 1F11B 4PB0L 1RZ7H 1QLEH 2EKSB 3WFEH 4FQLH 4GS7B 3FO0H 2FDBP 1GC1H 3HPJB 4O58L 4KVNL 2YEZB 1J12A 4RIRB 4OGYL 1AGDB 4NQCE 3W0WD 5KSBA 5D2LB 4HUXA 2GITB 1N4XH 4AEIL 3DXAA 4FN0A 5D2NE 1ZA3B 5CD5C 3WD5H 5T5NF 1ZGLM 3FT3B 4IRJD 2EDRA 3DMMD 4YBLB 1J8HB 4PTUB 5E8PA 4D2NA 3UTPE 4DGVL 5M95B 3PWNB 1QR1B 1P1ZA 2GT9B 1ZVSB 4AL8H 4PPTA 1AHWC 2DLHA 3OSKA 4GRLA 1P4BL 5D71L 4MJID 3VXRD 5I1DB 1ED3A 2UZIH 3RX7A 2XRAL 1A3RH 1NFDB 3RWCB 1QNZL 3QPXH 1MCIA 2V2XA 4LVNB 1WAAA 3JWOC 1CGSL 5DA4A 1V3JA 1I1RA 1FFQA 1A4JA 5I2IB 1P7HL 3TH4T 3D3VE 1YEGH 4N0UE 4WW1A 4XB7A 2VZUA 3OAZH 1S7QA 1N8ZA 1C12A 5KAQG 4ZUUA 1RUAL 4KK6D 1AXIB 4JFHE 3SE8H 4JGJA 2J12B 5HYSG 5C70A 4NQVA 3KPQA 2BNQB 5LGJA 3G6JF 4XMPL 4S1SH 5TGBA 1U6AH 4G7YH 3JV6A 4I4WB 1ZLVH 1UB5B 3IKCA 1KIRA 4HH8A 2FRGP 3KR3L 5LBSL 5GQBA 3SJVA 1B0GA 3IDNB 4HK0B 4HCRA 4F3FA 4LLVA 2I60L 1L7IL 3CUPA 3O3DB 3UJTH 5HY9A 1HXMA 3O9WD 3C5ZA 4U1IB 1JGDA 5A40E 4P46C 3TVMD 3P73B 3EW3B 3FQRB 3GMQB 5IQ7H 4FRWA 1XF4A 1G9NL 1PFCA 3X12B 3MPCA 4X4MA 5AD0B 3BAEL 1A2YA 4Y5XB 3CMGA 1T1WA 3QG7L 4I48B 5A16B 4MB5A 3CIQA 4HWBH 5AAMA 3ULUF 3D2UD 4M7JL 5CJQH 3DSFL 3MRMB 4AG4H 3TT3H 1ZWIB 2EYTA 4NBZB 1K4DB 1JK8A 3C9NA 4IMKC 4OZGA 1FGNL 5ESVA 1SYVA 3CMOL 1KCUH 1M6OB 4XHJC 3BZEB 1AKJA 3DTXB 5J7CC 4Z7UB 3B43A 4KKLD 4MMXC 3AS1A 4ZPVB 2NY1D 2XWJB 4HC1A 5H2BB 2YMXL 1UC6A 5GGVL 3MUJA 2VITB 4EXPX 1BX2A 1VA9A 3GMMA 1GGCH 1AR1D 4AEHL 1I8MB 3QXDB 2DL2A 3KXFA 1ZEAL 2Z31A 3OF6D 1KJMB 5I18L 4HG4K 2I9LA 4HS6B 3QIBA 5EUOE 1F3JA 4OFIA 1INQB 4OGAD 5CFHA 5TE4L 3MV9A 2A0LD 1T1ZB 2NY2C 1KTDB 4M6OL 4F9PA 1OP5K 1MUJB 1T83C 3S88L 4OFYA 5DURB 5JOPE 4HWUA 5JO5A 1PQZB 3O8XC 3ARDD 1YPZF 5EORL 4O00A 5IHZA 5JA9A 1NDGA 5T5FL 3T0WA 1KNOB 4K3HA 4L8DB 4ZS6D 2DJSA 4NUJA 4PJIA 2IQAB 2NCMA 3QUYD 1K3IA 5E2VH 4PLJD 5D7JB 3VG0H 1G6RH 1KFAL 2YD9A 1R3HB 1FBIL 5C0RL 3MOBL 5FOJA 2FIRT 1G7JB 1MHHA 3T8XB 4CVZB 3TYGH 1DQJA 2C3WA 4WU7B 1HCFX 4YDVA 3RL2A 4Q74A 1F5WA 3KPPA 1MCCA 3WE6A 3OKEA 5FDWA 2XPGB 4V1DA 5L8LB 1JGVH 2VERN 4P4RA 1IL1A 1CDYA 1SBSL 5CP7A 1H5BB 1HSBA 3EKCA 4AENB 2VO5A 5F9JA 3WNLA 3QDAA 5F1NB 3DUSA 1JZ2A 3HRZB 2VR4A 2Y23A 2BNRB 1MQKH 2AI0H 1QEWA 4MS8C 5EBWA 5DFWH 2ZG1A 5CJOL 5F7DB 2GFBB 1KLGB 5INCA 2HT2C 3GB7B 3PWUA 3RZCA 5EU6D 1RK1B 1HEZB 5E00B 5FM8A 2GJ6D 4PR5A 1I1YB 3ULVL 3UYOD 3S4SG 2B20A 5B38A 3RNQA 4WENB 3ROLA 2O61A 3B9DA 4U7KA 5BXFB 5CEXB 2VABB 3BH9A 2H9GA 2YKLL 3NFNB 4HT1H 4HXAH 3QEUB 4JFDA 1CFTB 4OZHF 1RJZB 2H1PL 3LMJH 1OCWH 5BJTA 4HMDA 4QXUL 3PV7A 1PG7H 2KZ1B