1X9UA

Umecyanin from horse raddish- crystal structure of the reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MEDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Umecyanin
publication title Crystal Structures of Oxidized and Reduced Stellacyanin from Horseradish Roots
pubmed doi rcsb
source organism Armoracia rusticana
molecule tags Electron transport
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02298 Cu_bind_like Plastocyanin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1x9uA00
1E65A 2ZOOA 2I7SA 3X1FA 3AW5A 8PAZA 1NTDA 2BP0B 2FT6A 2HX7A 3BQVA 1OCZB 1OCCB 1SJMA 2B08A 3ERXA 9PCYA 3OM3B 2EILB 1HAUA 2XV0A 4AKPA 4BXSV 3AG2B 1J5DA 1KBWA 4DPCX 1URIA 1L9SA 1ET5A 5F7AA 3CVBA 3NP3A 2BWIA 2GI0A 4W9ZA 4M4RB 1E30A 3NJLA 3NSFA 5B7EA 1KGYE 1IBZA 3D12B 4A2FA 1BQRA 4UANA 1WAEA 3FPXA 1WS8A 3QJTB 1OF0A 1J9TA 4JHUA 2FTAA 3NSCA 3X1BA 1J9SA 1GS8A 4A66A 1M56B 4E9TA 1YLBB 1MDAA 2JFCA 4N4YB 1AS7A 1PZCA 1M57B 3QJUB 4WTQA 3FPYA 4DPBX 2W88A 4AI7A 4MFHA 1KCWA 2YAOA 1ET8A 4DP8X 2BO0A 1ZIAA 1RKRA 3NJJA 3QJVB 4N8UA 2GBAA 3WKQA 1IUZA 2VM3A 1MG3C 3GYRA 3WIAA 2AVFA 2CUAA 1JZEA 3WI9A 3FQ2A 3S8FB 3WNJA 3DTUB 1AZRA 3UAEA 4KNUA 4HHWA 1PF3A 5B3SB 2XV3A 1ETJA 2CALA 1OV8A 4F2EA 1GR7A 1SFDA 2TSBA 2QT6A 3NJNA 3T71A 1J5CA 5LDUA 4BK5C 1FWXA 2J57A 5TK4A 1KV7A 3WG7B 3WKPA 4L0PB 2VW7A 5A7EA 2VSKB 2J55A 1PNCA 5I5MA 1OCOB 3QPKA 1NIBA 1W6LA 2XU9A 2CJ3A 3QJSB 2I85A 1CURA 3EH5B 2IDQA 2AZAA 4YVUA 1JZGA 1EZLA 4P5RA 3FT0A 4PCYA 4ENZA 1ET7A 2UX7A 1W6WA 2WO2B 1ASOA 1PLCA 2QDVA 1SF3A 2PPAA 4DPAX 3EHBB 3TBBA 3IN0A 1KCBA 2AZUA 1L9QA 4GP4B 4GP8B 3WNIA 1ZDQA 2N0MA 4G72B 2XWZA 3FU7A 3QJRB 1GY2A 1A8ZA 3ZX1A 4A68A 5B7FA 4G71B 3N2JA 1AS6A 2FQEA 3OQRA 3V9CA 4E9WA 2PPCA 1NWOA 1SNRA 2QPDB 1TU2A 1DZ0A 3EH4B 1QNIA 1AIZA 3KW8A 1JZFA 4NERA 2GC7C 1A4BA 2A3TA 2E86A 3AG4B 4HHGA 1I53A 2UXVA 2J5WA 2BP8B 2BW5A 2WO3B 4GYBA 2YAHA 3FSVA 1ASQA 3NJIA 3CVCA 2VN3A 1PNDA 2Y1AA 4YSQA 1JVLA 2DYRB 3CZUB 1OE3A 1OCRB 3QQXA 3FQ1A 1E5YA 2HXAA 3NP4A 3X2QB 7PAZA 4WKXA 3EF4A 5B1BB 5I6PA 4BWWA 4E9RA 4A2GA 3T9WA 1QHQA 1CYWA 4G70B 3ABGA 4AX3A 2JKWA 2PCFA 1XB8A 2OV0A 4YSAA 1SDDB 3CG8A 1OOWA 2NRDA 1CUOA 3FS9A 3T6VA 3AG3B 4YSPA 2AANA 3N55A 1AAJA 2PP8A 1WA1X 2QDWA 4GP5B 4E9VA 2IDSA 2XXFA 2ZWNA 1L9RA 2R7EB 2X87A 1BEXA 1JXDA 1F56A 4YVNA 2DV6A 4UF7C 1PAZA 3S3CB 2CCWA 1XB6A 3IE9A 2XVBA 2I7OA 4YSCA 1N68A 4Q89A 3QJQB 1IKOP 1ZIBA 3X1GA 1JZHA 1X9RA 2IDUA 3TU6A 1KDIA 2FNWA 2UX6A 1SFHA 2OCCB 2HLEB 3PLYA 3EH3B 3KW7A 2IDFA 3L45A 3FU9A 3FSZA 4P5SA 2IAAC 3SQRA 1DYZA 3AY2A 4A2DA 1V10A 4DP1X 3ABKB 3IEAA 1BXUA 1T5KA 2PP7A 1ADWA 2UXTA 5I6OA 1NPNA 2BP0A 1TKWA 2H5UA 2Q9OA 1ILSA 2IWKA 2PPDA 1A3ZA 3CDZB 2R7EA 1RZPA 5D4IA 1SHXA 5AKRA 3PXLA 5D4JA 4YSUA 2W8CA 2Q5BA 2DWSA 5PAZA 4HCFA 4DP9X 4DP5X 2JXMA 2XYBA 4JKNA 1IC0A 4G7QB 2Y69B 1FFTB 1PZBA 2P80D 1NWPA 1PZAA 3NJGA 2HRHA 2WSDA 4W1TA 3X1NA 2FWLB 1EHKB 3AG1B 3TBCA 1A4CA 2J56A 3TA4D 3BVDB 3G5WA 4QLWA 1NIDA 2FQGA 1BQ5A 4F7KA 5AZUA 2YAMA 4DP4X 5PCYA 1BAWA 2HZHA 1NDTA 4DP6X 4YSRA 5TK2A 1GS7A 2XX1A 5D4HA 3UACA 2LLNA 3H4HA 1GW0A 2AFNA 4X4KA 3H4FA 4BDVB 1XMEB 1QLEB 4DP0X 4AKQA 4K9JA 3AZUA 3SBRA 1GS6X 5EHFA 1AS8A 3T6WA 3DKHA 1VLXA 1HAWA 3NJKA 2IH9A 4AZUA 2XLLA 1KBVA 1PLAA 2BZ7A 5F7BA 3NJMA 3V9EA 2PPFA 3OD3A 2X88A 4QKTA 4KOCA 4KO9A 1ID2A 3SBPA 1BXVA 3GXUB 3ABMB 4RH4A 4E9YA 1E67A 1B3IA 4A2EA 1CC3A 3PAZA 2BHFA 4FA7B 4BXVA 1MZYA 1N70A 2VMJA 2FJSA 3ZBMA 1R1CA 3ASOB 5ANHA 2MTAA 4ZK8A 2EIJB 2HRGA 1BXAA 2RACA 1JERA 2H3XC 4E9QA 1WS7A 3DIVA 2PPEA 3T6ZA 5I6NA 2OJ1A 1TEFA 3S3DB 2GIMA 4HZ1A 4YSTA 5FC9A 2XXGA 4YL4A 3UAAA 3PAVA 2TSAA 4G7SB 3ABLB 2BZCA 4NB7A 4YSDA 1JOIA 1PMYA 4CSZA 3FSWA 3X1EA 2FQDA 1BQKA 1ILUA 3ZDWA 1BYPA 5I6KA 3SBQA 3TASA 5I5JA 5IY5B 3CVDA 1ZV2A 2HX8A 3UADA 1SHWA 1NIEA 3S3BB 1BYOA 1AACA 4KOBA 3RYMA 2DY2A 5B1KA 2YQBA 3IBOA 2BP8A 3NSDA 5I5IA 1AR1B 2EINB 1FA4A 1XB3A 5I26A 4GXFA 2PCYA 3FSAA 1A4AA 1AZCA 2B3IA 3ASNB 1NIFA 1NZRA 2DYSB 1AQ8A 3FYIB 1GSKA 4TXVB 4E9SA 3GDCA 2GHZA 1GYCA 5E9NA 1TEGA 1AG6A 2YAEA 4BWUA 4G7RB 1SDDA 3FQYA 4YSOA 3ZIYA 3FYEB 3S8GB 1MZZA 2YAQA 1ZPUA 1WA0X 1AZBA 2EIKB 3NJHA 4KO6A 1V54B 1HFUA 1OE1A 2MRYA 2YXWA 1ASPA 1AOZA 2FT8A 3OMAB 4GY4A 1WA2X 2IDTA 3NYKA 4FAAB 1RCYA 2DWTA 5I6LA 2ZONA 4EF3A 5I28A 3NSYA 1JZJA 1NINA 4CSPA 2IWFA 3HB3B 1JZIA 1MG2C 3NT0A 3FU7B 3JTBA 3PPSA 2XX0A 3FU8A 1A65A 1M9WA 5B1JA 1GY1A 1NPJA 4HAKA 1PCSA 3IN2A 2QPEB 2H47C 6PCYA 4HCIA 5B1AB 3NJFA 4KO7A 7PCYA 2YAPA 1AANA 1L9OA 2VSMB 4E9XA 4DP2X 2XUWA 1J9QA 3OMNB 1RZQA 2VM4A 4KNSA 4YSSA 1ZDSA 3UGEA 2CBPA 1JVOA 2BWDA 2P80A 4HIPA 1PLBA 1AG0A 1KDJA 5B7MA 1E5ZA 3C75A 2YXVA 2GSMB 3MBWB 4F2FA 1AZUA 3U25A 1L9TA 2YARA 4HCGA 4KNTA 1NICA 4Q8BA 1JXFA 2FQFA 1SF5A 3CDZA 2PLTA 2YAFA 4PAZA 1UATA 5I6MA 1V55B 2VW6A 4A2HA 1JXGA 1X9UA 2BW4A 2CAKA 2HX9A 2UXGA 4BWTA 2GC4C 3T6XA 5AFAA 3PAUA 1PY0A 3JT2A 2FT7A 4HALA 1CYXA 2UXFA 3PCYA 4KO5A 4NAJA 2IWEA 2PP9A 4UAHA 3OMIB 1J9RA 2GB2A 6PAZA 1NIAA 4M3HA 1W8EA 2IH8A 2EIMB 2VW4A 2ZXWB 3H56A 2XV2A 4YSEA 4DP7X 3UABA 1KYAA 1IBYA 1AZNA 1L9PA 4AKOA 3HEIB 4JHVA 3MX0B 4A67A 5B1JC 1OE2A 4BDVA
chains in the Genus database with same CATH superfamily
4LSRL 1DJIA 1SOKA 1P4LB 1B2YA 4AQOA 1FHGA 4OLXL 5KYXB 1NDGB 5E94A 3MUGB 4APQA 3NUKA 3SO5A 1H6TA 2B08A 1KYDA 2WW8A 2VN7A 4IMKC 1HT6A 4MB1A 4TLSA 1WUZA 1J5DA 1F42A 2EUXA 4UT6A 2V2XB 2EZ0C 4NQEB 1DEEB 1I8LA 4W9ZA 2D31B 3CSPA 5CIPB 1ZHNA 5BZXA 4EN3B 2JE8A 1BQRA 3IMTA 3RB7A 1WAEA 2MQ0A 1ITBB 4M6NL 4B6ZA 4JHUA 5DZAA 3QORD 1GS8A 1XZ0B 5LGKA 2EADA 1R0AH 4JFQA 4Z7OB 4I88A 2NNRA 4HIJA 1FO0B 2VN6A 2LFGA 4QOKE 5CHNB 3GSNB 3D69A 1KCWA 3FTSA 1ZWIB 4ODHL 2IALB 2ZKXA 3T2OA 1NBVH 4PS7A 4ZPTB 4WI3A 1MG3C 4PJAA 1HHJB 3RP1A 1IGFL 3NZHH 3Q1SH 3FO0L 1UA3A 5EORL 2FUTA 3I84A 2AXFB 1FL6A 2C7FA 4QRUA 3TEYA 1XCQB 4GW5B 2BSTA 4Z9KB 3QHTC 4F8OA 1L0XA 2ISDA 3LHPL 2HTLD 2Y06H 4HC1A 3OWEA 4H2CA 5DC4B 5ETUB 2VC2L 3AU0A 1HHGB 4F37F 1VIWA 3UPRB 4PB9H 5DURD 5G5DA 2APXA 3BXNA 2FO1A 1N0XH 4WWKA 5F72S 4LCWD 5FA3B 5CLYA 2V5TA 5LGJB 1DBAL 1S7SB 2BC4B 4ZZKA 4DVBA 1NGPH 2DQCH 3RWEB 3CK0H 2CJ3A 3GRWA 1I8KB 1X5YA 2I85A 2ED8A 3BP5A 1E3XA 3OC5A 4JDVB 4AYMC 3RVUC 1D9KD 1G6RL 4L5FH 2DBLH 5I74B 2OW7A 2DIAA 3ISRA 3VXQA 4OZFB 2FLRT 5GRWA 4OF8A 1NBZA 3QNYB 1QI4A 3FUNA 3WS3A 1PZ5B 4ZO7A 1SF3A 4R2GC 5DD0L 3VD1A 3Q44A 3KPNB 4H20H 4XOCA 3RWFB 3SGEH 5C0FA 5LJYH 3MNZB 4KKLD 1J8HA 3L9EA 3G5YB 4RAVA 1HCVA 4U3HA 4G7VL 2QHRL 2X4SB 2P7TA 3BKCL 4YHLH 1BVZA 2DMHA 5GS1B 4ALAL 3PL6A 2FQEA 1H3GA 1FRGL 2WJ5A 4LCCA 2GJ6D 3T0XA 2ZP9A 4Z7WE 2CO2A 5K1NA 3KPLB 3WKML 4GUPB 2YD9A 3BVNB 1FAIL 4QWWC 1O9WA 1NPUA 3V5DA 2Y7QA 1ZY9A 3A67H 4YXLH 3NJIA 5BUPA 2EVJA 1P4IL 2FJFA 1MFBH 4JFUA 4JHAL 5FFLA 5CN3A 4ZUWB 5T1KD 3CZUB 3VXMD 2VITA 4P5MB 4JREB 2OI9C 3A21A 4P9MH 5ESQB 1E6OL 2XIBA 4H2AA 1VGKB 3UYPA 3HR5A 4WTXA 2YZ1A 3BQUA 4L8SC 2N7AA 4PBXA 3IDJB 2OP4L 2B1OA 2WKLA 3VG0H 2ZUYA 3B6SB 1EZVY 3MBWA 3QEQE 1I8MB 1XB8A 4J3VA 4L29A 1QPPA 2O93L 4N8VA 4WY7H 4ZMZA 2X4NA 1WZLA 4Y88A 2NMSA 2QDWA 3PWVA 3QCUH 3AC0A 3Q3GA 1C16B 3RI5K 4MNQB 4ERSL 1JYXA 3TBTB 1W16A 5EC2B 1OAUH 4HIHB 1XIWA 1TJMA 4I9WD 1LXMA 2HVKA 4JPWH 3TPUA 3S3JA 4AYGA 4Q89A 3GBMH 2JXMB 5FHBH 2MPVA 3FQNA 5IZ7A 1N6QH 2PR9A 4NQEE 2AXGB 4JG0L 1N0LA 4U3CA 3RE0A 2LTQC 3ZRFC 5ITFA 1NFDA 3MGTB 1KDIA 4JANB 4XMLL 2A9NL 4LSTL 3WEBA 4LSVH 4J12A 4M5SA 1E50A 4ATTA 1J9CT 2PCPA 2GTWA 1OWWA 3QDGB 4Z7OE 4NCDA 3CXDH 3V6OE 1OP3H 1AD9A 4G8FA 4HLJA 1GZPB 2ZWSA 4AYFB 3CX5J 2ZUQB 4JQXC 2X4RA 2JKRM 3KJ4C 4QTIH 3ML8A 1P7KB 4WI8A 2X2UA 3U1SL 1HXKA 3QIWD 2AK4A 5J12C 1VZGA 4J4PA 4P2AA 5D6DC 2C3XA 3VNYA 1NC2B 1NCAH 2E7LA 3DBXB 2FH8A 5IMLA 2ZT9C 3SY6A 3DPBA 1DLHB 2BSDA 2D7TL 4LLDA 5L8KB 2Q76B 1ACYH 2P5WA 2X28A 3RWDA 3F00A 2R0WL 1OLZA 2XTSA 3VWKB 4X7EC 1T2JA 2OJZH 1AMXA 4APXA 3BGFC 4HK3N 2XIIA 3BZDA 2PO6B 4EIBA 4PB0L 4NQXA 4AVHA 1PEWA 3TESA 2Q5BA 1CXLA 2VDPH 4GXUM 2PXYD 5TDPA 1BD2A 4XCYA 2DW5A 5IG7B 1IC0A 3LS5L 4I2XA 3NMEA 2FO4B 4E36A 4IHOA 2LU7A 1L0QA 4Y5VB 1ETZA 1KPRA 3O8XB 5H37H 3O9WC 2I5YL 3TBVB 1Q9LB 1ZA6B 3G6JB 3ZT6A 3MRCB 3AG1B 4X5RA 1R5WA 3AUWB 3CBRA 4PWEA 5HXMA 1MW1A 3G5WA 4OGYH 5C0ND 4DP4X 5C0GB 1A4JB 4LLMB 2ZX5A 4N2FA 2GAZB 1TTCA 3DGGB 2WBJB 4M48L 4UNUA 3R8BB 1E9OB 1KGXA 3G04A 3F6IA 5GSVA 4FNQA 3IKKA 3B2UC 4UI2A 3UACA 2DM2A 4K3GA 5AW1B 3WEOA 1KELL 3VA6A 5KOMC 2NY2C 1G7PB 1TQTA 2EYRB 1U3HD 5JIIA 1EBAA 2VJ8A 2BZ7A 5F7BA 4HSAC 3UZEA 1JUFA 4N8PA 1QFWI 3QG7L 5DS1A 5FOJA 2Y4SA 4WW2F 3A6BL 2N01B 4RIRA 4BA8A 4RGOL 4MHHG 1O6TA 2PR4L 4KJPD 2EDWA 2ZOKA 4N0UB 4AQAB 3FTYA 3KL5A 2F61A 1BJ8A 3T4AB 5JHMA 5T1LA 3IXAA 1F4YH 2E3VA 3LNEA 3Q2NA 4CU7A 1CI5A 4XGZA 3Q8BA 5C2UB 1BV8A 1GOHA 4XE0A 3FL7A 3FCTB 5JYMA 2HKHL 1YY9C 3SYOA 3CZEA 1IFHL 5I66B 3SZKC 3P4OB 1GHFH 3QPQC 3M7FB 2VXVH 3MXVL 4LLYB 3PJNA 2YO3A 4TVPD 4L4VE 4D9QE 2NNAA 5FYKD 4JHWL 5D6CB 4HMDA 2BVTA 4WO4B 4TSAL 5EF1A 3WFBL 4UTCA 4XCNA 3L4ZA 1LEGB 2VUKA 2K0RA 5EOQH 1Q0EA 4G43B 1EANA 3C8HA 3SPIA 2HFEA 1ZANL 1MCPL 1LWJA 3FQ4A 2DEWX 1ORQB 5IFHL 3LRHA 2XY1A 1IC4L 4TSBH 2YEQA 3HMXA 5I6KA 1C9SA 1A6TB 3K6FA 3L9YA 1NDMB 1IKFL 2VDQB 4GQ9H 2WSPA 3RGVB 3RVWC 5BRZD 4G5ZL 5MEOB 5FM5M 4MAYC 2GHWB 1NMCC 4KZCA 1JN6A 1G7MB 5EU5A 1WZAA 3WDJA 1VZIA 1KJMB 3PWNA 3N85H 1WFTA 4R0LC 3FYIB 2O61B 3MLWL 4PJBF 3MREB 3BSZA 2K6ZA 4Y2DC 4YBQC 4ZMNA 3SDDA 2D7OA 3BUYB 3DUUA 3QDGE 1DUYA 2DQDH 3FC8A 4TL5A 4P5TA 2F6AA 4LVNC 2X9YA 2Z4QA 2NY7L 4AIOA 1UM5H 3EJJX 3WN5A 4R7VA 4AQEB 4B41A 1XHHA 3DX9B 1RVFH 3W2DL 2QGCA 1ZVHA 1R47A 2YXFA 3IETB 1TETL 2LQRA 4LEXL 3SDYL 2FVNA 3BEWB 2IOOA 1H0DA 5KUKA 2A6IA 4PW3A 2YGNA 4IU3B 4M5ZL 2XCMC 4YDVB 4JFOB 3T0AA 4JQVC 2IG2L 2P28B 4HWBA 4M8UA 4ODXB 1OD9A 2GY7B 3RX8A 5H35A 4W9EC 1I75A 4QOKD 3N40P 5LBGA 1O75A 3HE7B 2JELL 5EG6C 5IB4A 3GBNH 2VDMH 4XNMA 3UEZA 4K23H 3EDKA 5I18H 1R5VB 1TQCB 5MERA 1OW0A 2EVHA 4JS7A 3RIFK 4PY7B 1ZDSA 4LCYB 4N6QA 2HRPH 1JF1A 5EWIH 2P8MB 3G6JE 1AGEB 3LEVH 4ZAKD 3HVNA 3B7SA 3FCUB 2QJDA 2DM3A 1AQDB 2C1OB 3QXWA 4Y4FC 1JHTA 1NBYB 1JWMA 1NAML 2YXVA 1RMFL 4JY6B 5AAWA 4KXBA 5FYJH 4DGIL 3WKYA 1JXFA 2XKNB 4FN0A 2FK9A 3RPKA 4B3VA 4LU5H 3U4BH 3SGJA 2AEQL 2VO8A 4NC1C 1RHHB 4JKPH 4XO5A 2Q3XA 4OV6F 2A1WL 3T2PA 4Z3GA 4NZJA 2FGWL 3MBEB 2UXGA 4WI0B 5EO9B 2J6EL 3DX7A 2J5LC 4XMKH 4LFHG 4WJ5A 5GRUH 4U3SA 3T6XA 3AM8C 2C3HA 3BVVA 4ELMA 4N0UE 3E38A 3K2IA 3ISYA 4KO5A 5AVRB 1RIUL 2BSEA 4ADGA 2AJUH 4C4UA 2X5PA 4R4BB 1B9KA 4MMYA 4UTAA 5C07A 5C3LD 1J9RA 3GKZA 4G9FD 5E4AA 1CDBA 3L3HA 4P46C 4WTZG 1NBQA 5I0YA 4P2QB 4ZD3H 4YHOL 1XSKA 3OXRA 5L9DH 4ZTPH 3WFCH 4IBWA 5KYUB 1AZNA 3NCEB 4W70A 3N1PC 4FFVD 3ZLQC 5HVHC 5AW2B 3FCBA 1NCTA 3HNSH 3U9PH 3W0WA 4RQQA 4M6OH 1IGML 1JGIA 1YMME 1INQA 5BO1H 2NY6C 1MOEA 1OCZB 2AXJA 1IC5H 3TIEA 1NGQH 1Y0LB 2JKTM 1FYTE 4WNQA 4X9BA 4XP6H 5HP5A 5M7QA 1G7IB 4P04A 3VFPA 3P9MB 1KBWA 2CR6A 5DHYB 1RUPL 1JTTA 4AG4H 3NJLA 2ZX8A 2IBZX 2VN5A 1GSMA 4QHMB 4CC0A 3FN0L 3CFKA 5IQOA 4QO1A 2XRAH 5I1KL 1WCBA 1F18A 3LDBC 3NIFB 4HPOL 4AMKL 1HSAA 5JIKA 4MS8C 3QEQD 32C2A 4GBXD 4I87A 3IRPX 3LYRA 4WUUE 1XGYH 3AQXA 4PJAF 5F97E 1N2RA 1NCBH 1BG9A 3QQ3A 2VL5B 5BV7L 5ECJE 2XTJB 3IVKA 4QHKI 5IFJA 1TVBB 2DN7A 1IEBB 3QCVH 4N8UA 3ZT5A 5KVGH 3LVTA 1CGYA 2EE2A 2O5ZH 2XWJA 3HS9A 2OX5A 3O41A 4Z5RA 1MY5A 1P2CA 4Y5YB 2B5IB 5DMKA 1PY9A 2CUAA 4UM8A 3UG5A 1CDJA 1GAFL 1AR1D 5C0DB 2VXQL 1HHHB 1CFVL 4NQED 3BH8B 4FQHB 2YD8A 4HZAA 1S9VA 3UPAA 2LLGA 4O9HL 1QA9A 3OKOB 4EN3D 1OO2A 2XV3A 3ULUC 4TSCL 4HXAH 3NCJL 4J3BA 4FXGB 1IKNC 2YC1A 5D1QD 5DHMC 3M7OA 3ZDYB 5EEWA 3MJ7B 5DEGA 3ARDD 2Z93B 5EN3A 3X17A 2VW7A 4PMFA 5CGMA 1CE1L 1GC1L 2WWNA 1SXCA 2WD0A 2Y1ZA 5LCVA 3WFEL 4QUOA 4EI5C 3QPKA 1JXKA 4UIKL 3VFNA 3FQTB 1MCJA 3TXAA 1MHCB 1R3JA 3SPGA 2ALWA 1LVEA 3OKKB 3HG5A 1KYUA 3T65A 2VDLH 3F5WA 3V2AR 3HAEH 2ZSWB 5CINH 4P5RA 3GMQB 4L9LC 4C54A 2N59A 1UXWA 2FD6L 3NGBB 4BZ2L 1R3KA 4UINH 1NSNH 4Y2NA 4FZ8L 4XCFL 1CGXA 5ALCL 3ZY7A 5I1AB 4GKNA 4KQ4H 3ETTA 5B3NA 2J44A 2L8AA 2XZAH 4G72B 3UTQA 3ZKMD 1U8IB 1P53A 3JTSA 4HLZG 5CGYC 4A37A 1GGCH 5ISZB 3MV7B 2H9GB 3BP7A 1MWOA 1AXTH 3V9CA 2A73B 2EXTA 1F3DJ 2CO3A 1DVFB 1ZV5A 1DZ0A 1CS6A 2QBWA 4JKLA 1DQML 4LVHB 2E86A 1D6VL 3VSTA 3QJHA 4XO8A 2OYLA 4DGWC 2VR8A 2YAHA 4OBRA 4YFLI 3PGCA 4GG6B 4OF0A 3IJEA 5IBLD 3CVCA 3DRTA 4OI8A 3B2VH 3BOVA 3U6XS 1CB4A 5GPRA 5I1GH 1IM3D 1MJJA 5J1SC 5GRZA 5BZWA 4P2QE 2VLRD 4K3HA 1RUAH 1JGDA 3TIDA 4NHCL 1X5XA 1FVCB 3HPLB 5EZLA 4GEIA 1WZ1L 2H32B 3FRPA 2AQPA 1HXMA 1MFVA 5BOPA 3ARGA 5HHMB 1HYSD 4OB5L 1FL5B 5DSCA 5EOCL 5F7YC 1V27A 2ZXCA 1NFDF 4UF7C 1ACXA 4L0YA 2X9WA 4K5OA 4XO3A 4KTEL 5I1LB 1TF4A 3BAEL 3LN5A 2WNWA 4IKJA 3WNPA 5C9JA 3CDYA 3Q5YA 3P3YA 3QIBA 3K91A 4PJGB 3C60D 4XP9L 2OZ4L 2X4UA 4YL9A 3RLSA 3S5LG 3WTXA 2F8VA 2OTWB 3GXTA 2OCCB 3NIFE 3GMLB 1JNNH 4MSWA 5D7JD 1ZEAH 3N3EA 4ZOAA 5B38G 1Q9KB 3TN0D 3QDMB 5IKCA 3K46A 3FB6B 1QNZH 1LNUB 1QFWM 4U7KA 1PCXA 3UJIH 4MJ2A 2XVKA 2ICWJ 1KCSL 2Q7YB 4HCRA 1V10A 3LNFA 2XTJE 4JO5A 3FUDA 3EJZC 1AFVH 1RUQL 4PJ6A 1N4XL 1QFUH 4MNQD 5GIRB 3PHOB 1QBAA 1S3KL 1M71B 3D48R 5IMMA 1T5KA 3A23A 3KLLA 4R26L 2X53A 4UNIA 5EIIG 4OLVL 5IWLC 2K45A 3VRLE 5DEFA 3NBNA 5ICZB 3FKUS 3KS0J 5A2IH 1MN4A 2KH2B 1RSYA 4LLQB 4WWNA 1QAWA 4X7TA 4YEEA 3VA2C 3QULB 2OSWA 3EBHA 1YMHB 5DVOA 2B1HL 2R7EA 5JPNB 1FFRA 2WTRB 4UDTA 3WGVB 4OAWB 4CN1A 3HN8A 4FQPA 3FUFA 4YSUA 2PYFB 4CN4A 1QLEL 4PV8B 3I6GB 3QUXB 3QVAA 3ZDYE 1EWHA 2XYBA 5EU4B 1SZNA 2WANA 5F44A 3CVHA 5DHDA 2YBGA 3WCYA 2QVTA 3ZE2B 4L8BB 3LH9A 2WK2A 5C0RL 1CGSH 2G9KA 3HZYA 4MD0B 3TVMC 2EE0A 2VR6A 3CH8A 1PZAA 4Y9EA 2AP2A 4PREA 5H8DA 5JPMC 1DSYA 1BF5A 1IEHA 2JB6A 1TFPA 2BNQB 2IFFH 5TGBA 5E9DB 3SDCB 1W0WB 3LRSA 3FZUD 1XXDC 3QG6A 4XOEA 2EC9U 4J3XA 1QRNB 5IT2H 2QADB 3SQOH 4WEBH 2EIZA 1NFIA 3WFZA 4YSRA 2H1PL 3MCKB 3QAZB 1GS7A 1YNKL 5EC1B 2PO6D 2OL3A 3BW9A 4S2SB 4XNAA 2CJSA 2LGNA 4OV5B 1GIGL 1PZ3A 3HLAA 2MPAH 5TF1L 3QJFA 1HINL 2X42A 3KM1A 1UKQA 3K1KC 4J3OC 4MCZA 5D70H 5MP6L 1A02N 3RKDC 3MV7E 1SDYA 1QMUA 1HZHH 4D0DA 4O2CB 3WTYA 4P2OC 3W82A 5CKAA 1DQKA 4GS7B 2AABL 2WBJD 1T0PB 3QFGA 4IJ3C 4NWUL 5FK9B 5KS9B 4EJ1C 3DXAD 4YNYA 3S8WA 4XMXA 4GG6E 3QAQA 4D8PB 2RACA 4HU2A 1JWUB 1KXTB 2OJ1A 1TEFA 3FCSA 5TE4H 2GEQA 3WXWL 5FLVA 1NUFA 3AGVA 3HN3A 4IRSA 3ZOAA 5FC9A 4DGVH 5AVUB 3LRGA 2BZCA 2NLJB 5GZNA 2Z6FA 4PLJD 5DUJA 2WBKA 3QR2A 1P1ZB 2UVFA 3K6DA 4PJXB 5EBLA 4QNPF 3T8VA 4S0HA 3RZCA 3BYYA 4L2LA 5HHME 3W11D 4DN3L 1GJWA 1U30A 4F5CA 4YDLB 4G6KL 4X6DB 2DWEB 2JJUA 3VWJA 5KBDA 4GLRI 4AV0A 1BZ9B 1H5BA 3QXAB 4I77H 3T1FA 1BYOA 1KCKA 1R24B 4E0RB 1EV2E 1A2YB 2CDEA 1WCQA 3FRUA 1USQA 4MMXB 1N7MH 4KRMB 1N9PA 1XXFC 4ZFQA 4PJ8B 3QW9A 4TNEA 4PJDB 3VXTA 2Z31C 4PJGE 5HDBF 4UCFA 1LD9A 2P47B 1NAKH 2MIZA 3F7KA 3V4LA 1YEKL 2DYSB 4OCSL 1M9SA 4QCIA 1GSKA 2GK0A 5FGBA 1XL4A 4HKXB 5JOPD 1WHOA 2YBRB 3V4PA 4O4YL 3WY2A 3BVTA 5KYYA 3QDME 3UC0H 3V10A 2SEBB 3MRLA 1MLBB 5IV2B 3N43B 2F1EA 4JN2A 5T5FA 3E2HB 4AT6B 2YAQA 1GCFA 2ZKMX 1OAXL 1UKSA 3L3GA 4OH2A 2WZ5A 1CD1A 1FN4A 3FTUA 1P5UC 3GPEA 4GMTH 1UZ6F 4U2YA 1JNLH 4MCNA 1R0AL 4WZ9A 4FNSA 3IJYB 3ARVA 2WLMA 1OGTB 3QIUC 5I8CB 1OT2A 3LPPA 5DZLA 4TRPH 5DLMH 5HGAA 2D7MA 1IE5A 1F3RB 2ADJB 4LHUB 4L8DA 4UQDA 4KDTA 1NBVL 1VACA 4FQXC 3PPSA 3L3JB 2XX0A 5KG9B 1M9WA 4YAQA 5C0JA 1MQ8A 1P84K 3QEUB 3NZHL 4KRPD 5KWYC 1I8IA 4HGWA 1TR7A 4LGPB 3GSWB 4J6RL 1A6VH 1J0JA 5E1HB 4KO7A 35C8H 3ZE2E 2A74C 4JFWA 3OMNB 4V1DB 1QFHA 4M00A 4F8TA 2ODIA 1Z3RA 4ZFZA 3CLFH 4PB9L 4B0MM 4X7FC 5ESVA 4FYRA 1V7ML 2EQDA 4BGDA 4ONHA 5D1ZD 5E9DE 1N0XL 2RTTA 4X9HA 5KSAA 5IM7A 5KW9H 1QRNE 3T5WA 3T09A 3VB9A 2WLZA 2GSMB 4PMEA 2AXWA 1U3JA 2D9QB 3CK0L 4Q8BA 3OF6D 1BECA 4TNWF 5A2AA 5HSFA 4QF1B 5AYUL 1NEPA 2YAFA 4GAYA 1GA2A 1S5HB 4XPAL 5GJSH 1QI5A 3BIBX 3N6YA 4LLVB 5BRQA 3X12B 2DBLL 1O6VA 2N56A 1Z9PA 4M7ZC 3RDTB 3S36X 3D3VD 4FX5A 1Z1WA 4BE5A 4LNVA 2NW3B 1L7TH 1XR9B 3BWAA 5HHOA 5F6HI 4F7CB 3CHXA 2ADGA 2UZXA 1XDTT 4R90H 1HHKB 2WAQA 1FZOB 4JFPB 4U1KA 1KLFA 2BINA 4Z7QF 3V6FA 4FHJA 4ZPVA 1IAOB 1S8DA 3OZ9H 1QZNA 4FXKA 1EVUA 3VD9A 1W8EA 2EIMB 2O5NA 5CCHE 3FTXA 3SCMB 5AZEL 3ZRCC 5KS9E 1QEWA 5A1AA 1RZFL 3HZKB 3GRWL 1VRSA 3WE6B 4KUCD 2Q6WA 5I71C 2X44D 1B0RA 2WLLA 4PGCB 3RWIB 3X11A 1LP9A 5DZVA 2FJHA 3BT2L 1U9KA 3LN9A 3IMVA 4Y0GA 1GYAA 3MBED 4J5VA 3A67L 4YXLL 4DGYL 4EUPH 5DJ6A 1DQLH 1XT5A 1MLCA 5AW4B 2DQJH 2GPZA 2Y3NA 3ETBF 4PJXE 1J0KA 2B15A 1RI8A 1HL9A 1F2QA 1M6UA 4XXCC 2XV0A 4CDGC 5DD5H 5HGGS 2VERA 3QYNA 4ANWA 1L9SA 4P5KB 2AQ2A 2R1XA 4X6DE 1RZKL 1JP5A 1SLXA 3VG0L 5DO2D 1IBZA 1GJUA 1A1OA 2ALAA 2KMWA 4P2QD 4BA0A 5JLZA 1KT2A 4J3UA 4MA7L 3NPSB 4WY7L 3OLIA 3QDJE 4K15A 3D2UD 4F92B 4PJDE 5HI4D 4N3TA 3B3IA 3B5TA 1BJ1H 1U95B 2VDNH 3HJ0A 5KYWB 1OAUL 3RWGA 3GHEL 1MFNA 4JPWL 4X80H 4Y2OB 4MB4A 5DS8B 2EVIA 4YE4L 3GBML 4IBSA 4N0CC 1U8QA 4DCQB 4YDMA 1E9PB 2IOIA 4HFUL 3F05A 3WFHB 4WK2B 5A2CA 3QUKA 5F3FA 1OALA 1XGUB 1WE5A 1AP2B 1I9RH 3GSRA 1PF3A 4LSVL 1EDYA 5EBGA 5DJDB 3KDMA 2F08A 1F58L 2NY4C 4EDWL 5BPPA 5E8NB 3O4LB 4NRXB 1ECZA 3GJEB 3PHQA 5T3ZE 3U36A 1XGQB 3DV4A 1X5ZA 1ZVSB 4Y89A 4WFEE 4F15C 1JZ6A 4DJMA 5C0IA 1E28A 3FB7B 1DE4A 4HHAB 4N8VG 3EDEA 1YEFH 4NUMA 2W91A 4RGND 1RQ5A 1BZ7B 1G7QA 1HHIA 2W9EH 3EW3B 3QJSB 3GMNB 2A9MH 4AQ1B 1ACYL 5EBMA 3NFNB 2WQUA 5H2BA 4N2MA 4JRXB 5GGVH 2OJZL 2DM4A 3B2PA 5DO8A 3GNMH 4V1DE 1UUSA 1IT9H 1LO5B 1IAKA 3WY4A 1WC7A 4J3TA 3LQZB 2RAMA 5TQ0H 5JW4R 2VC2B 3L3DB 5SV3A 3SDAB 2YPKB 3MRPB 1N3NB 1CWVA 3TYFA 3K71A 3T2NH 3SDXA 3VQ2C 1ZSDA 2VZVA 3LIZH 1E4KC 4WW1B 3CDFA 1JZ8A 4Y4KB 2YPVH 4G71B 3WOVA 3N2JA 4NDMB 4OGYL 2A99A 3OAWA 3VVWA 3MRIA 2CH8A 1K72A 3APNA 4OGQC 4KK8D 3ZSTA 3HG4A 3KLKA 1QBML 4N28A 3UTZB 2APFA 3OR7A 4O5LL 2C7UB 4X5QA 5L2JA 1IRAY 5D93B 3O11B 1MNUH 2YJQA 4N2KA 1I7RB 4UMSA 5EDXA 3T3MF 3LJ3A 3SJVB 3I3DA 3ZYZA 1PYWB 1QBBA 1BAFH 4UT9A 4DZ8A 1Q8MA 4BWWA 5J7CC 4NPJA 1MHHB 4Y4HA 5I1CH 3BPCA 3PV7A 4U1SA 4M61A 5ISZD 1AO7B 1T89A 4WHTB 1F4YL 3ESPA 3TO4A 3O6MH 1HZKA 2XG4A 2EEXA 4IBZA 5KBNC 5F7FA 1UJ3C 3Q0HA 4U6HB 4CBZA 3D05A 4DO4A 4YHYC 3M46A 5CCKH 4YLCA 4ES8A 1BQHG 1NLDH 2VXTH 2XKSA 1JNHB 4MDIB 5FKPA 2BLFA 3LEXB 3PYCA 1YJDL 2WC7A 3OJDB 1NCIA 2K8MA 5FXCH 2GSIB 1ID5I 2XTLA 1MAKA 4X98A 4FRWA 4CSTA 1U8CB 4NKOA 1WG3A 3JWNH 5B22A 2CRYA 1BBJB 2CU9A 2KKQA 3PLYA 4XOAA 4DKDC 1N64L 4HH9A 3BD4A 4KY2A 1QLFA 1FBIH 2UZIH 3EJYC 1EMTH 4HMEA 3DSNA 1J1OH 5EU3A 1NGYA 2J8UA 1H9DA 4I1RA 1S9XA 2XVLA 2DM7A 4GQ9L 1V8HA 2B0SL 2Y36H 5C0AA 3RTQD 1ADWA 5D1XA 4HOXA 4HSQA 5LBSH 3TGXA 1TKWA 3KBHE 1QVOA 2AJ3A 2OW6A 3BCFA 5CBEA 3L54A 1YUHB 5E2JA 5DFVD 2F54D 1EGJH 3N85L 3IDYC 5FYKH 3N04A 1URLA 4N2GA 2D0FA 3OMZA 4NPYB 4Y7MA 3ROLB 1U8KA 3DTXA 1BFOA 2ZAIA 3RFZB 2C5DC 4I0PA 2JQMA 2P9RA 4POYA 3SPCA 5H4YA 3O4LE 3VFUB 5FR3A 1J1PH 4U6VH 5C09A 1BMWA 4JDEB 4JY5H 3S36L 3HMXL 5IJCC 3W56A 3DPDA 5CJOH 3O6FA 1QW8A 5KBKA 3CFEA 4BFIA 2HRHA 5GZOD 3X1NA 4C83B 2GITB 5AAMC 2ZOLB 2GK2A 4LNRA 4HS6A 2V17H 2ZXBA 3VFOB 1J1XL 4PLKD 3RZWA 4QHNA 4QRPA 5CD3A 4FLQA 4IMKA 1A6ZA 3O0RL 4JRXE 2BY1A 4K73A 2EYTB 3CPLB 2VDML 3F8UB 5DRWA 1GMEA 2BXYA 2E7BA 2DPKA 4K23L 4OFYD 4UQ2B 5I18L 1OP5K 2D8KA 1AQKH 4MJ5B 2HJKA 5MHSE 2NTFA 2DRUA 2WSKA 3A0OA 3R1GL 4XPBL 3NDYE 2HRPL 5EWIL 3EOAA 3N42F 5IW1B 3F7PC 3B8SA 3HLKA 3BE1L 3LEVL 2K7QA 5LLIC 4XCEB 3UCQA 1L6XA 2IV8A 2BNQD 5E9DD 3SDCD 3SBPA 1UJTA 3ZO9A 2NDFA 4PGJA 2HRLA 1CLZH 3CFJA 4AL8H 5E70A 2CHNA 2QADD 3RPBA 3R19A 2J1KA 5E6UB 4LU5L 2EXWD 1EX0A 5LAXA 5I0XA 1KCLA 3QWOB 3FOMA 4FTVB 3ASOB 4HG4K 3DO7B 1KFAL 1BXAA 4L2YA 5I75B 1W9XA 3SJVE 3DIVA 1NOAA 2WMPB 3IBEA 1JV2A 2JIXA 5LXGL 3VRIA 4MX7A 1XGPB 3MSPA 4XMKL 1ERNA 5F0PB 4AL8C 3C5ZB 3FTZA 3PAVA 3ZJAA 4PY8J 3IMUA 5JZ7C 1O0VA 2CLZB 5KEZA 3Q05A 1JOIA 2FEEI 3F3HA 3L9RA 4W9JC 3V0AC 1AO7E 1PSKH 2AJUL 2G9HA 2YOCA 3M1OA 4BKTC 5BOZG 5AVTB 4YS4A 2C9AA 2G4EA 5L9DL 4RFOH 3PGFH 2XWDA 4ZTPL 2R69H 5GSRB 4ZNEE 1DQVA 2YK1H 4HS8H 5BUGA 4KOBA 2EXYC 3LTVA 5F3HA 3T0ED 4K0OA 1OZUA 1FVDA 2DY2A 3I2CH 4NSKA 3U9PL 4AIEA 4YHPB 2MCPH 3DK2A 5BO1L 5E5RB 1VFOA 5HYJB 3OAYK 5JDSA 3L3KA 3ATAA 3DX8A 3GC3A 5CP7A 5T1MA 4FFZH 3WLBB 4F2MB 2V2TA 2L7QA 3GHBH 1U0QA 1PZUB 4MDJA 1KB5A 1DO6A 2WWMC 3DDFA 4X0KB 5GGUB 1NCCH 4UTAL 1UH2A 2YEVB 3LKSB 2AV7A 3NJVA 1UD4A 2XRAL 5I9QB 4ZO8A 5FCSH 1MEXL 5FIEA 2ZP8A 4WI4A 3GLAA 1XGYL 5F9AC 3P40A 3QBTB 5F3BB 4RRPA 3BZ4A 1HIMH 2FT8A 4LDCA 3UIZA 1F4XH 1VZHA 1AOZA 4O2FB 2DQEH 1FNHA 4L3EA 3B7UX 5I6LA 4PJIB 3NOIA 3ARBC 1VFBB 3K6IA 1MG2C 1OT4A 2O5ZL 3LSOB 4XPTL 2Q86B 3ASWA 4JO1H 1JZDC 2GI7A 4IBQA 1A65A 3SOTA 2Z1KA 5AENA 2VDKH 4L8SA 1FL3A 2VRAA 4U6XA 3BZEA 2BPBA 3NJFA 4C59B 1FG9C 1QEXA 1PG7W 2DJ4A 1X4XA 4KK9D 3APCA 3IF1B 3C12A 2EABA 4E42A 1KIPB 4U4BA 3B5HA 3VDCA 3L4XA 3QR0A 4A6YH 1GXEA 3AVEA 3JV4A 3T8XB 4TMPA 4AUUA 4DO6A 3BPNC 2A6JB 5E00A 1OP9A 4MAUH 4A38A 5G4OA 5L0QB 3IPBA 3MRGB 1F41A 1B2WL 2LU3A 3ZSSA 4P23A 3VXRB 4ECNA 4HIEB 3WTUA 3DX0A 3CXHK 4JQIH 2FQFA 3QFJD 4LRNH 3HW7A 4HJEA 4NNPH 5I6MA 2CG9X 1W0VA 1OM9A 3QZOA 1E27B 3RI5F 5CINL 1QTYT 3PWLA 1BVKB 2WB7A 4JLRB 1PEZA 4WFFE 4YH6A 4V1DD 4X2UA 3NEEA 3QUYD 4UINL 5EH1A 1LDSA 1HQ4A 4PN6A 1GGUA 4JQXA 2YMOA 4QRSB 4PR5B 5FWQA 3PAUA 4KQ4L 5T5NF 1CDUA 1KTJA 3PCYA 2XZAL 3TWCH 5D6DA 3LKOA 1YHPA 3GSNH 1LP9F 4KKAC 4P2RB 1P5VB 2IH8A 2FBJH 3DVGB 3R06B 1NAMB 4ABUA 1GGCL 3VXSA 4WDIA 4ZYKB 2Q8BH 1U8OB 2RD0A 3QYMA 1AXTL 4H8WH 4IJTA 4FTVE 2NYKA 1U2CA 5C6WH 4JY4A 2BZDA 3EF7A 2HMIC 2I9TA 1XFPA 4OGXH 4P3WA 5JW5A 5C0BE 3MR9B 3ZKND 1HXYA 2VR5A 3V6OC 2MHAA 4FNLL 3S35H 4YK4B 4DWHA 3J7HA 4BCZA 4PJHA 1MJUH 1ZV9A 1PD0A 4FQQB 4BSVA 3DX4A 4Z77B 5LG6A 1SJMA 3TZVB 1CFMA 1XSJA 1ORSB 3O9WA 2IGTA 3FU5A 2J88L 2OJEB 1JG9A 4PRIA 1E40A 2QEJA 3P2BA 1RUAL 2F0CA 3ML9A 3VGDA 5K33A 2W92A 4X4ME 3QQ9D 1WS8A 3M86A 3IKCA 1I4FA 1WITA 3ZGIA 5E8OA 4UV7L 1FJ1B 2OMYB 3OHXB 4HV8A 2ZG1A 3AS1A 3ECBA 2FWUA 5DJAA 5H37A 1ZT1B 2Y5QA 4A66A 1RK7A 1PKQB 2MQCA 4K3EL 4E9TA 5EU7E 4RGMB 2K4WA 2QSCH 2X38A 3G6DH 5ID1B 4K3JL 2CJTA 4LAQL 4WTQA 1UCBL 1JIBA 2BY3A 3FT3A 5HYJE 4AI7A 5K9QI 2R2BB 2CSPA 2FL5B 4OZFH 4BFEA 3QJVB 4JFYA 3QPXH 5DZOA 3X14A 4AMXA 3MDJA 3NACL 4DKTA 8CGTA 1S3RA 3ZU8A 2GABA 2ZTBA 4HOMA 4ABQA 1TZHB 1XH1A 2R1YA 3FUIA 1DFBL 3GMMB 5F9JA 3N44B 4UOZA 4GFTB 4K5MA 5I74C 3VSUA 5FA4A 3V4VA 4QRQB 4Z78A 2CBMA 5B3SB 1JNNL 4CW1A 5CD5C 5J13C 3ETBJ 3V0WH 1H3XA 1RK0A 1WWBX 4OIAA 1B90A 1FFQA 5HD8C 1ONQA 1SFDA 3FF8A 4D9RD 4UWQB 4U3XA 4NKQB 2KERA 1YN6B 1AFVL 2QT6A 3K72A 3LQAC 3LS4L 1QQDB 4PJIE 1QFUL 5IMOA 4BFOA 1DQIA 2VLME 2EYSA 4UTBH 2Z91A 4NZUL 4NZTH 4JHBA 3V6ZA 2EKSA 5BV7B 1FVEA 2HT2C 4HISA 3FRPG 4FNPA 3GI8L 5J3HC 4M7JH 2P5EA 4MASA 2WXMA 4GJTB 2WZ6A 3ZVVA 5G2NA 3DVFA 2J43A 3PABB 2UY6A 4IEFA 4G6FB 3EH5B 3CCHA 3QR1A 3O3UN 3P0YH 4L1DA 1EEUA 3S48A 5IB5B 1EZLA 4DERA 3SDXF 3UAJC 5EBWA 5GHWL 1IEAB 3QHZH 3TNNB 5ESAB 3EFDL 3KGSA 4NC0B 3IWUA 2IADB 4JFDE 1ZT7A 4BELD 3Q5OA 1CG9B 2BIOA 4U1MA 3ZKXB 2WVSA 3EYVB 1CGSL 1PY4A 3LRLA 1U8MA 3LZRA 4LEEA 4MAYA 1PL3A 2ICWB 3FQWB 3O3AA 3ARXA 4R8WH 4KY1H 4S0SD 1AMYA 4WU5B 1EJOH 1FPTL 2IFFL 1WRFA 1UT1A 3TPKA 2X09A 3HS0C 4GG8A 2YOAA 4R0LA 3VDBA 4WI7A 5DJXB 4Y2DA 2X70B 2HJFB 5IT2L 4R7DB 4RISH 3VFMA 4WJKB 3SQOL 2QPDB 3WUWA 3E0GA 3GB7B 3P77B 4L8CB 1ZLVH 1CLOH 3MLTB 4RZCB 2BH0A 4H5SB 4I3RL 2CIKA 3HR6A 1ED3A 5SV4A 4ZUUB 2WXJA 2A9CA 4P8QA 4Z0XA 3PQYB 2VN3A 2V33A 4YSQA 5BJTB 5MHSD 5D70L 1F00I 4R7NA 3BAWA 4N2HA 3QFDA 4P2RE 3GIZH 3HE6C 4LLAA 4JQVA 4PGEB 6TAAA 4L9DA 1UADC 1M1XA 1KZYA 1ZLEA 4Y4KD 1WT5C 3WLWD 1SDDB 1YAZA 1HZHL 2XBZA 4A7UA 3TP4A 5EEXA 1EHNA 2HH0L 3K5SA 4I7ZC 25C8H 4NYLB 1BIIA 2VAAA 1EBPA 3DIFB 1E2VA 3ZE1F 1MFUA 2ZUQC 4PWKA 3U6RB 4GXVH 5KSUA 2QR0B 1WQVT 1T6VN 1XB6A 3S6CA 4TQEH 1A7PL 1SLVA 3SIKA 3HS8A 12E8H 1FC2D 1XGRB 3EJSA 2W60A 4JJOA 4ESKA 4GAJH 1JFHA 3DARA 1DHKA 1XR8B 3WNKA 2J8UF 2Q1EA 2NY3B 4P0DA 3TA3B 1R33A 4YPGA 3VWKC 4Y4FA 3A4EA 4PG9B 1T1WA 2UX6A 2PO6C 4E41B 5L2KB 3QXTA 3EH3B 3MLSL 5AL0A 3VRJB 1TQVA 1D5BA 1PKQE 2BS8A 4XI5C 3ESNA 4H0GA 4Y19D 2V2WA 3RIFF 4JRLA 5C97A 2FBOJ 4MXVF 2A6DA 4XRCB 4DK3A 2YGVA 2X1WL 4Y5VC 1FFNA 4XNQA 3O8XC 2Q10A 3SN6N 4MMZA 3IEAA 3HC3H 1N7ML 4JMNA 4GSDL 4PRHA 3CWGA 1X7QA 3L4YA 3FFCB 1F11B 3BN3B 3KWXA 3BAKA 2FLBT 3LZLA 3P2DA 4NN7B 3L5JA 3AM8A 2WZ0A 5B38B 1DJYA 2JB5H 2JJSC 4ZQTA 4ILDA 5JW4N 3HG1A 3UC0L 4QY8B 5BRPA 1THCA 2Y5EA 5JW3H 2CBOA 4GO9A 4X8CA 4G9DB 2FWOA 5IB3B 3P69A 4GKSB 5EIIB 3FT2B 2ENYA 1T7VA 1ZD6A 4PRNB 3GRBA 5BS0A 2HTKC 5HDOA 3E1ZA 1NWPA 4XNUL 4WW2B 2CO6B 4P57A 4W1TA 3OKEA 4TRPL 4U05A 1CVSC 5DLML 4F9PC 3MA7A 5F96H 1A4CA 5FYJU 4LLWA 3TA4D 3TBCA 4HWZA 1D7FA 4N85A 1QZ1A 4N5UA 2XA8H 3UTSD 2VIRA 1QKZH 4ZFFB 3JWDC 2NSXA 3OLEA 1DANU 3FO2B 4U1IB 3ILQD 4TYUA 4XVOA 3VFTB 1K5NB 4JFXA 2L0DA 3RWHB 1N5YH 1OTSD 2G60H 1SDAB 4NRYB 1A6VL 1B0IA 1QI3A 1LWRA 5E99H 2XN2A 4FGMA 5HPMA 1QLEB 4NC2B 3H1ZA 4YHKL 2A6KA 2WGNB 3GEWB 4ICWA 4WO4C 3CLFL 2YJLA 4HUWA 2VDQH 4EDXB 4M5YH 2YSSB 2QQKH 4NHUB 5IHWA 1RLWA 4OTXH 1D5MA 4KQ3H 3NZUA 5KW9L 4J23A 3U0WH 3KPSA 1EXUB 4OCYL 2WN2A 4RWYH 4OKVB 1H8NA 2X2YA 1B3IA 3E6FA 3HHRB 4A2EA 1A4KB 3LOWA 4GKZB 1AGFA 3MXWH 1N70A 4PJ9D 4Z7UB 1W91A 3DMMC 3RGVC 4BKLB 2NNCA 4NN6B 4BJLA 2NUPA 2HRGA 1X5AA 3IU3B 3PQYE 1AQHA 2H3XC 3RPIA 3T6ZA 4C4KO 1IKNA 1NC4A 3TEZA 5F0LB 4CMMA 2AEPH 2YKKA 2ATPB 4CVZB 1L7TL 4WFFD 4JJ5B 4UOJA 3CC5B 2E56A 4G7YL 3VMPA 4KI5D 1S9WB 1AE6H 1TJIL 1P4UA 3T4YB 1WK0A 4N2CA 1IZJA 1FIGL 1QP1A 3M88A 1RK1B 2BVYA 3BLPX 1QSVA 1NL0H 3JZYA 3N1QC 4GRLB 4S1SH 4EI5A 1CBVH 1ILUA 4XZUB 4F3FB 5JIHA 4Z7NF 1HOEA 3IXTB 2AQQA 5JO5B 5E0FA 2IQAA 4M1GH 4WHYG 1FG2A 1Z3GH 3RYMA 3UTPD 4AM0A 5I15L 3RG1C 5TE7H 2KDGA 4FTVD 3QEGH 5F7DA 1CGTA 3RX5A 4C4BA 3NSDA 2BP8A 5DD6A 5BXFB 1I7TA 4MA3B 4XWGH 4YXKH 4AIZB 3ULVC 8FABB 1YQVH 4LPTA 3MJ6A 4QRRD 1OARL 4YJZL 1RU9L 1DQLL 3BZFA 3OXSA 3HE7C 1Q94A 1AQ8A 1SN0A 1UC6A 2JNZA 4BRJA 1J18A 4E41E 5L2KE 4AM0Q 3LZPA 5DD5L 4H8VA 2AI0H 4U1NB 3BEVB 1MAMH 2YAEA 3HI5H 5EFIB 3MRQA 3ARFB 1TQCC 4MJIA 4Y8AA 3HIZA 3I3BA 2CDGA 1TJHH 4OY9A 5KVDH 4WHCA 2FEDC 4PIBA 5ILTH 3A5VA 4X9FA 4PRPB 3EIFA 1W8OA 4NPKA 2Q87A 3REWA 3S9DB 2ZYSA 1ZPUA 4LBEB 1VKXB 1K8DA 1WISA 5JORA 3FQRB 3BD5A 2ED6A 2L04A 1MRFH 5EZOH 4AV5A 4FEIA 5TDNA 2ZYHA 43CAB 3FFCE 5AB9A 2BOBB 3GSQB 2VDNL 1UT9A 4L4TA 4EF3A 5I28A 2CGYA 1JZJA 3H8NA 2J20A 1JZIA 3SE8H 5HYJD 2QGBA 5DJ8B 4ODUA 1M1SA 5T5NG 3WIFA 1T5XB 2R4SH 2C1PB 3LRMA 1XF5B 3IN2A 3DURA 1OPGL 1CDYA 1T7ZA 4LRIC 5K9KB 3L3IA 3FUEA 4OLWL 4YDJB 1I9RL 3BGAA 3JWOC 3UG4A 3IDGB 4TLTA 5LKNA 1RZQA 3SSGA 5F9OH 1AY1H 2F1BA 2OKMA 3MTRA 2ESVB 2X7LA 5B21A 2ZXDA 4GRWF 4IOSD 2BMKA 3SKUD 1UWXH 3ZDXF 1AG0A 3KBPA 3VXNA 4MTMA 3DV6B 3B9DA 3C5JB 3KLHD 3CDGA 2X4QA 1E5ZA 3QHFH 1YEFL 2C3VA 3JUYA 4K7PX 4HPHA 3R7RA 2B59A 1UOKA 4U33A 2QTEA 1B4TA 1NICA 2QV2A 3K5RA 3RWCA 2W9EL 2X10A 2A9ML 3FU0A 3EXLA 3D0LA 3U7YL 1A9VA 3VGEA 5GGVL 3K6OA 5CBAB 1V55B 3GNML 4JG1H 4N2DA 1EHAA 1IT9L 1Q1JL 2VW6A 1U8LA 2CA4A 2GY5A 4BFRA 1HCYA 1JXGA 2W9DH 2QTVA 1G9NL 1IB5A 2VQ1A 5TQ0L 2BRRH 2BX5A 3A3YB 1OB0A 3IGAB 2P26A 1UD3A 3ARYA 1FZMA 5AAPA 4A55A 3UBXI 4BZ1L 2APVA 4RESB 3T2NL 3PNRB 5IWLA 3KE0A 3LIZL 1N8OE 3OR6B 3OJ2C 2X3BA 5E03A 4H25B 5KSBF 3TT1H 2Z7WA 2V3EA 3D69B 3TCLA 3VXRD 3QWRD 4RAUA 2YPVL 3IFOA 5KVEH 4PJHF 3WTVA 1OLLA 4XBPB 4Z7UE 3I6SA 1HTYA 3KHQA 3R4RA 1NCNA 3ZPDA 2XNAA 4Z7VA 3MX0B 4A67A 3A4FA 2OMWA 4GSUA 1EJFA 2XTJC 4AJ0A 4BFJA 1E5AA 4V33A 5CM1A 2NT0A 1MNUL 4N68A 4W4NA 2BP0B 1GGBL 4AXWA 2LVCA 1TZGL 3TVMA 3G9AB 5JDJA 2GG1A 3PJLA 5K39A 1S78D 5HI3D 4Y5YC 2QMJA 1BAFL 2EILB 1SMDA 2YGQA 4BXSV 5JPMA 3MLXH 4ZXBA 3DOIA 1MCSA 2BVPB 3K4DA 1MWAH 1URIA 1DTUA 1V3KA 2WKOA 3BXNB 2DLHA 3EBAA 3H9SA 4KK5D 2ZOWA 4WWKB 4DCQA 2CGRL 2HLAB 5L7XH 5F1NA 4LIQH 2LAGB 5EN2A 1M3IA 1QG3A 3TH3T 1UEMA 4Y16B 4DVBB 1EVTC 4KAQH 2FTAA 5B8CB 1ZLWK 1I1AC 2ADYA 2D73A 3LPGA 4ZMAT 1MDAA 2JFCA 2OMTB 4LFHD 3BP5B 4M7LL 1D5ZB 1XEUA 1TXKA 3L6FB 2R4RL 3MC0A 3C8DA 4W9KC 4LCIH 1I1YA 1EPFA 4UIMB 1RKRA 1NLDL 2IANA 4NKDA 1G5GA 1LO4H 1NBZB 3QQDB 4LKXA 3GI9H 5F7LB 3WKQA 5J1TC 3WS3B 3VB8A 5BZDA 3VXUB 5KJ7E 4NQUA 2DMCA 1CE6A 3AWFA 1MHEA 1QPKA 3HRZC 1RUKL 1HS6A 4X50A 2XXMB 1MIEH 3UO8B 4PRPE 1T5WA 4P2OA 2AJYL 1XWVA 5IOPA 3HNTL 1B88A 1FBIL 2UZIL 3NGBC 2DS4A 3PL6B 1J1OL 4XPGL 4KX7A 4QIRA 5FHAL 3OKNB 2DTMH 4F58H 1IAIL 2TSBA 3MHZA 1XEDA 1YDPB 3G7TA 1AGBA 1S7TB 3LKPB 4EI6A 4IS6B 5CEYA 3S35X 2Y36L 4P49A 1C08B 4H8PA 4M4RA 43C9B 3ZRSA 1DDHA 2UUDH 1E4XI 3BI9X 4TNVK 2MCAA 1T1ZA 4PV1C 2FYVA 3QNZB 4TVPL 3GJFB 2Y7QB 2QPUA 4DZBA 4KMTH 2WIIB 5FYKL 5HYQB 4U7MA 4Y1AB 1KG0A 1R5IA 5E56A 3IJSB 4B9IA 3NA4A 1DVFC 2OR9H 2NDGA 2E4TA 3KL3A 3LNIA 4LVHC 3UYPB 2G5RA 3DETD 3OKMA 1J1PL 2ESVE 3WJMA 1WIPA 3MOAL 4N0FA 4N8VB 1HWHB 5DK0B 4ONFL 5CJOL 5IVOA 2PPAA 1NBCA 1CZ8L 4DEPC 1YC7A 4WTWA 1WGOA 1S46A 2DLGA 2E9IA 2Z31A 1ZLSH 3CTTA 1QABA 1U8JA 2V17L 3FU7A 2IBZY 2BFVH 2WLHA 3VXOA 5FECA 5EU6A 1A66A 1HSBA 2ZWZA 2AMUA 4G8EA 4NQDB 2WUBH 3KVQA 5I1DB 4F37K 4X5PA 3TPUB 3IDIB 4G6FD 1SNRA 3JTTA 4OFKA 1LE5A 1BVLB 1N0LB 5C8JA 1E8ZA 1ZSHA 4DNLA 1S7VA 5BW7C 2BNUA 2WYTA 3H2QA 3BFWA 4CUCA 5IEHA 3AXIA 2B4CH 4DF9A 1IVLA 2DICA 4NZ8A 4WUKL 1A9BA 2PCPB 2XWEA 1ASQA 2GTWB 1P5UA 1SXSA 4OVUA 2Y1AA 1RP8A 4GRMB 1NKGA 1AD9B 4G8FB 2NTSP 3CU1A 1K6QH 5D7KE 3NP4A 4L05A 2YMXH 5DEZA 1JVKA 4PJ5A 1YC8A 4G70B 5C3TA 3H7BA 3ZQXA 4FQXA 5I1JH 2OV0A 1XGTA 3FT4A 4CKVX 3POHA 3MKGA 1VADA 2QPSA 2A9BA 1HU8A 1WH0A 2B9AA 3DPBB 2C9UA 1ZTXH 4G8GD 3B9KB 1KC5H 2HSIA 3FN3A 3KPRA 1JXDA 2VABA 2A74A 4NCC1 3JZ7A 2NSMA 4DETA 2QLVB 3C9NA 4NQXB 4NQSB 4W93A 3MRHA 4C47A 4YSCA 1P7QA 2JI1A 3PQYD 4WHDA 3QJQB 5HGBB 4BYHA 4YBLB 1X9RA 3FFDA 2Z4TA 5DK3A 5SX5K 4Q2ZA 3HZMB 3RVXC 2EDBA 1PSKL 5HPOA 2HLEB 3EGXA 3GGWB 4DH2A 5F7MC 5DI8B 1R5WB 2IO5A 3KW7A 2IDFA 1UEYA 5B4MD 3L5WA 3QUXC 4G42A 2IJ0C 1Y18B 4PS3A 5AWNH 4ZW6A 1QOKA 3BISA 5FO8B 4WFGD 4KX9A 4RFOL 3PGFL 5ANMB 2J1WA 2IAAC 2R69L 1BQHB 1DYZA 1DLFH 2YK1L 4Z95H 1M6OA 3TWYA 2OFQA 1H3PH 5CO1A 4J8RA 5CU9A 5E6IC 3C5SB 4HZLA 1U42A 1F13A 2ZX6A 3I2CL 3MLZH 2Z92A 3GSUA 2BFGA 2VLJB 1EAPA 2OSLA 1LEKA 2R1WA 3VXUE 2MCPL 1JWSA 2PYEA 4MYPA 4U6YB 5I8KH 1SVBA 2G2RA 4A2LA 1F4WH 1G0YR 4ZX3A 3DA0A 4AEEA 4I5BA 3B56A 2QADC 4D9LH 2PPDA 4FFZL 1L5GA 2NYYD 3BIKA 3CDZB 2A5UA 3QAZC 1JUFB 5MI0B 1OM3L 4E41D 5L2KD 1EO8L 1NCCL 4DPRA 1YA5A 5E08H 4M9OA 4YQXL 2ZOKB 3SGDH 3FBKA 4NUPA 3BQUC 3U46B 2IH3B 5T1LB 3MRFA 5DK2A 4CRPA 2Y7SA 4JFFB 1HIML 1FCCA 4M1CD 3AS2A 4NN5B 2DQEL 3WMPA 2R8SH 3OSKA 3FFCD 2ZG2A 4Y1AE 2H3NB 5FOBA 3U4EA 2YAMA 3QI9B 5EUOB 4XXCA 3MRKB 2F53A 2ZP0T 3CIAA 4GS7C 3V0IA 2X6MA 3CHSA 3IU4H 4NQQA 3U30B 2VDKL 1D9KA 4NM8H 3ZKQD 2XX1A 2Y1YA 3QXDA 3FQUB 2APSA 4K3DH 4AH2A 2LLNA 5CEZD 4MKMA 3H4HA 1GW0A 1A9EA 4WI5A 3BYTA 1HC1A 4OFDA 4DP0X 1AXSB 1FFOB 1SEQH 1VPOL 1H15A 1A7QH 4RMUA 1K3ZA 4A6YL 5GGRA 2P52A 2WM0A 3DX6B 4FOMA 4KJQD 2FAUA 3HI6H 3PFQA 4OLZL 4X99A 3TBYA 4YE0A 4DKFL 4NQDE 2IH1B 5GS0D 4PHZA 2WZPA 1PG7X 1KPVA 5D7HA 2YR3A 1JN6B 5EU5B 3ULUF 5KJ4A 3T3PF 3TV3H 3AAZB 5HJ3A 4X6EB 3PWNB 2AQ3A 2E9GA 3S88L 4C56A 1W0YT 2VDMB 4Q58C 4QT5B 2YD5A 5DJCB 1T1XA 5KBLA 1H8SA 2MTAA 4MMXC 4OU3A 3M17A 4GI8A 3SDDB 5L4IA 3WJJC 1DUYB 4PJ8C 4YHIB 3GSOA 5I6NA 4GT7A 2Z4QB 1U2HA 1Z9SA 5GRJL 5ECGA 4BKSC 1P7HL 4MD4A 5E1IA 2JKXA 5E6YA 3T0WA 3R18A 3FONB 1IGTA 2JK5A 3ABLB 2KPNA 3MNMA 5MEND 1TYEB 5LNDA 2H1LM 3TWCL 5CILH 4QJ3B 5E6SB 5T3ZH 1BQKA 2PTUA 4JDTH 1NM4A 4FMKA 1D2OA 1I3RA 2Q8BL 3GXPA 1JPFB 1E2ZA 2BJMH 1OIOA 3ILPA 4HPYL 4MXQD 4RDQF 4PRBA 5IB4B 5JR1H 4R96A 4D7BA 1RZIA 4OGXL 4AY0A 3U2SA 2A9DA 1J12A 2X89A 1GH7A 1NGWA 1X5LA 3RWJA 3S35L 3S2AA 5ABAA 4KXCA 3S4SA 2EE3A 5KVMC 4XE5B 3UL4A 3NCFB 3MUJA 4HKZB 3MRMA 5JHDD 3LPOA 3WUZA 3UMTA 2CK0L 3NRFA 4MQ7A 3EXJA 4IGBD 4F9LC 1JF1B 1V3JA 1EJ6A 4ZT1A 1E4KA 1Z9MA 2BWQA 2IAMB 4FHBD 1WBYB 5IROD 3I6KA 1E42A 4RX4D 5F1OB 3HN5A 1HWWA 4GRLD 4R4NC 4ZUTA 1Q0YH 5ANME 3UZEC 1BEYH 2A0LC 2C3GA 1MZZA 2WXNA 1RPKA 1RXLA 4F91B 2UY7A 2VLJE 5I8EA 2JKJA 1TTAA 1JFQH 3V0VA 5DMYA 2QSCL 3G6DL 2MRYA 1ASPA 5E1AB 5A2KH 1WFJA 1M7IA 4AUYA 4PI2A 4L48A 4TTDD 2TRHA 3L95A 3S34L 4LASL 3IK2A 5ACLA 4CSPA 2HPOA 2ZXQA 2PWGA 4MKTA 3B1UA 1BM3L 3QZWG 1K4CA 4X6BB 5D7LB 3FXIC 3GKWH 1YNLL 4NNXB 2YD7A 4RETB 3TBSB 4FQCH 4GSXA 1Z6JT 2FHCA 4HUKB 1XSIA 1QX1A 2FE0A 2NXZD 4M03A 1AANA 5C07B 3RDTC 4IK7A 2DQUH 5IHHA 3L3HB 2WAHA 3O2WL 4PRPD 1F6AA 2PW2A 1JPSL 2WLJA 3CUPA 4GOSA 4JFFE 2EIEA 3IB4A 1UJ3A 2EC8A 5BMFH 2OXGA 3I9PA 4UTBL 4XVSH 4NZTL 2G0KA 5GGTH 1P6WA 2QKIC 5EUOE 4D7PA 3DROA 3C75A 5AW7B 4U1HB 4RQQB 4M7JL 2NUTB 5A6MA 3IFLH 5F88B 3SCMC 5DGRA 4KNTA 2DMBA 4XMPL 4JM4L 5LB1A 1SF5A 1P69B 3TIEB 4PBDA 1OQXA 4IOFC 3BN9C 2XN9D 5D2NC 2VN4A 4EN2A 5D71H 1OTUD 5ADPH 1S7XB 2CKBH 3HG2A 4HIXL 5T1DH 3QHZL 2VLLB 3SE9H 4I1NB 3ECWA 4A2HA 4WSGA 3CFKB 1VCAA 1P1VA 3M8OL 4IKKA 4P5TC 2JI2A 1WCBB 4KDWA 4PJ7E 4HKBA 2B2XH 2ESVD 32C2B 3BKJL 2XJKA 3NQKA 1N2RB 4KH9A 3QQ3B 4Z7VF 4R8WL 4KY1L 4JRWA 4DO5A 3MFFB 1EJOL 2ZAGA 4LSRH 4QTHB 3GO1H 2AQNA 2NQCA 1OPOA 3HPJA 4OLXH 5FF6B 5IGXH 1KZQA 3NPSC 5FGCB 4Z5RB 2PW1B 4APQD 2R15A 3DRQA 1WWWX 1IBYA 1VEOA 1ZHLB 4RISL 5DD1H 4PRDA 5DMKB 4UM8B 4UU9B 1XCTB 2HFFA 1Q4NX 5J9PB 3A47A 5LBSA 1CLOL 2WKOF 4BH8A 1MFMA 3TJEL 3HAEB 1UXSA 3PDOB 1S9VB 1EGJA 1G43A 1QA9B 2ZKHL 3QUGA 2Y6SC 3CFBB 4M6NH 3IFNH 2YC1B 2JKSA 3HHSA 2JCCA 1HAUA 4WI9A 1QO3A 2RB8A 5DEGB 5AAMA 3RU8H 3IDNA 3KYOB 4Y2LA 5HHQB 1MCKA 2ITDA 4LARL 2VZOA 3WD5H 3FPXA 4ODHH 1D6EA 1MF2H 5EO0A 4N0YH 4J3OF 2JCWA 1NCGA 4KXZI 3RURA 1R3JB 3MROA 4N8CL 4PTUA 1FGVH 1EERB 3FO0H 5EORH 3NVQA 4J8QA 2XWBA 4KTGA 4WGVB 4TQEL 2VDRB 5INDA 2FECL 3BVWA 2J6WA 2EDLA 4ZUSA 2KDYA 4PPTA 3DWTA 4JM2B 1P0SE 4KWUA 4GAJL 4XTRD 3WUWG 1R3KB 2VC2H 5AL8A 1RY7B 5AW6B 3WIHA 1AJ7H 3F6JA 4WWKD 4JUTA 4NO0B 2CHDA 3MV01 4FQIH 1WP6A 2ERJB 3VQMA 4JFTA 4Y16D 2CALA 4NUJA 1O7DC 2DQFA 4XN8A 1K5WA 5E2WH 1NJ9A 3SDAC 2AEWA 4H88L 4KROD 1KV7A 4K2UL 1HI6A 4EPSA 5F9DC 1GGYA 3VD5A 1N26A 3QJHB 2JQAA 5I5MA 5K9OA 3GXMA 4BGLA 4P99A 3PGCB 2MKLC 5D7LE 2OYKA 3ZT7A 1GZQA 2VLKE 3NFSL 1RZ8A 4HUUA 3HRPA 3F58H 5C07E 1Z5LA 4KKCC 2Q7AA 3WFDH 1J8HD 1U91B 5JW3L 3RVTD 4FI8A 1JGDB 1W6WA 3HB3D 3OGCA 5AZ2H 4X8JB 3F7VA 3STZB 1N6UA 3PL6D 3QDAA 2FIKA 3JYBA 4ALAH 3FRPB 4XT1C 1IIKA 3HC2A 4ZAKA 1SN5A 3OZKA 2X4TA 3ARGB 3EHBB 1FNSH 3ULSB 3VQLA 4Z7AA 3IN0A 2D3NA 2EO1A 1MVFA 4KZEH 1MCCA 3OKLA 1KN2H 4QDGA 4EE2A 3EOBB 3WKMH 3V5KA 2NR6C 3D39B 2ED7A 5F96L 1OEZW 2XA8L 5B3JF 5FDWA 5L4MA 5FCUL 1LM8V 4FKHA 1PQZA 2RFXA 2V5MA 2V8LA 4ZMPA 2WYIA 4HJ1A 1I8UA 3MRNA 1ZPLA 4ACPA 3BWUC 4TQIA 4ZUVB 3KW8A 3EFFB 3Q6FA 1E6OH 1N5YL 2GC7C 3OAUL 5IQ7L 4OD3H 5DRXB 4ZX6A 2EICA 3KH4A 1JHLH 2OMZA 2WZAA 2OP4H 5EPMA 3ZN6A 5A3IC 1ITCA 2C8NA 3R0NA 3ES6B 3FSVA 5CMAA 4QR7A 1KPUA 5E1QA 2H6OA 4FL4B 1NLBH 3QC6X 1FNFA 2VDQL 5SWZB 4M5YL 2HXAA 2ZIDA 1BGXH 4OTXL 3BHBA 3MNDA 4H8UA 2DQHL 4LP5A 4A2GA 1MCQA 4OZHB 3ARBA 1HX0A 3T9WA 4ERSH 2GUOA 4POZD 3D33A 2PCFA 3IE4A 1XIWD 3DBSA 3ZL2A 4OZIB 4MS6A 5JHLL 4IIQC 1HE8A 4M8QA 3TOPA 3TF7C 3E6HB 3J2PA 4GP5B 4OLUH 2PTTB 4X7TB 5IJBC 3REVA 4JG0H 4E9VA 2NQ3A 4Z7WA 2R7EB 3HBGA 1YEEL 2X87A 1GPOH 4UDTB 1F56A 1G87A 3LV3A 3OZLA 3D1MC 4W9FC 4ACTA 4XOBA 1XTLA 4W81A 2A9NH 1GMIA 4D0BA 3EZ8A 2AEPL 4NRZA 3QUMA 5FFOA 1EXGA 4HP5A 2XWRA 1XZWA 3HZYB 5SWSB 4JO3H 4NO3A 4ISVB 2HJLB 2A7BA 1KIQB 1RHFA 5FPIA 3FH7A 4PREB 2Q20A 2WXHA 2AK4D 5FFGA 4O02L 2WCGA 4J4PD 4Q7DA 1OAKL 5TGBB 2AJZB 2HAZA 2RQEA 3FU9A 2YZ8A 2CDFA 2WGXA 3FSZA 4ZTOH 4M1GL 2OCJA 2P5WD 4JGJA 3B9KD 4RFEA 1DBML 4AZ8A 2EIZB 1NFIB 3RILA 5TE7L 1IQWH 1UB5A 3ABKB 1I9JL 3L8QA 2AXHA 3QEGL 1IM9A 4XWGL 5KYXA 3D8MA 2OL3B 1EHXA 2G5BB 1CTMA 2O5YH 4PB0H 1YQVL 4FADA 1BD2D 2H5UA 3CHQA 4JQIA 2BHUA 5FLUA 4X4XB 3C09B 4X42A 3I75A 4WAFA 5FS5A 1H3UA 2IOMA 1KBGH 4ANKA 3QJFB 1G4MA 1S7UA 4MCZB 1DEEA 5BQ7B 2D31A 1G0XA 5CIPA 3BWZA 3OQ3B 3HI5L 1SPDA 2GUYA 3BFQG 5KVDL 3TNMB 1MRDH 4DP9X 1XZ0A 3TJPA 1P84J 2XKUA 4YHNB 1FO0A 5EZOL 1L9MA 3V6OA 4QYOB 5AOLA 5HYSB 4Y7OC 1A25A 4X5XB 3GSNA 2UV3A 2FWLB 3PPEA 1ZWIA 5BQDA 1EFQA 2CK2A 2IALA 1RERA 2GJZA 3P30L 2J56A 4EQ3A 1D5IH 2QQLH 1J7VR 3CN1A 3FCSB 3H9YA 5IOKA 1HHJA 5SX4H 4IRSB 4J39A 2LR4A 4AEIL 2W65B 2AXFA 4D2NA 4KFMA 3VFRA 1XCQA 4GW5A 1OGPA 5HBBA 1DQQB 3LKNB 4AYID 3LKQB 1ESOA 3FH5A 1RZJH 1WO2A 4X4KA 2PR4H 3GSVA 4RDQG 4PD4K 3SBRA 3L7FB 5E8PB 5T1LD 5F9OL 1AY1L 1A6AA 3VWJB 1VDGA 2VXUH 2R2EB 4PGZA 3C5ZC 1H5BB 15C8H 1R3LB 4K5PA 1HEJC 3T1FB 1SBSH 3D39E 2CDEB 5FA3A 4JFFD 3SB3A 5CR8A 5LGJA 4IM8A 4FE9A 1KXQE 1S7SA 2HLFC 4IRJB 4FCAA 4XMZA 4X5WB 3P3SA 2X2IA 3VXPA 4KOCA 3D0VB 1VF5C 3P1VA 1TZ8A 1BXVA 4Q4IA 4PJFA 5IQ7H 1I8KA 3MXVH 2BK8A 3L1GA 4CVXB 3APDA 2F1AA 5IB2A 2CIIB 3C6EA 1A8JH 2GK0B 4OCMC 3WFBH 1ZLUK 1Z32X 4FYTA 3JV6B 5IFAL 1V5JA 1HEZB 4K9EH 3VTMA 2X2HA 4JG1L 4OZFA 3FULA 3MRLB 2DD8L 1PZ5A 4JN2B 5SWZE 3BRGC 3KPNA 3RWFA 4B7LA 5DWPA 3L3GB 3MNZA 5DDHA 1CD1B 3GXNA 2ZWLT 4MXWH 2QL1A 4OZHE 4CVUA 2YEZB 1IKFH 4IKNA 5AB1A 3G5YA 3E3QE 4Z3HA 3QGVA 5ICUA 1Z5YD 2HFGL 4AGLA 2X4SA 4OZIE 3FSWA 3B5GA 3B7TA 2FQDA 2H0PA 4G5ZH 4F7TB 3MV8E 3ESUF 4HJ0D 3GMRA 5FM4A 4L8DB 5KVEL 1SYVB 1T66C 3TASA 5I9QC 3CVDA 2HX8A 3KPLA 1SHWA 3MLWH 1NCDH 3MLYH 4WEUD 4GUPA 3UAJA 3RY5A 1RULH 3ARWA 3D25B 3SDDD 2O6PA 4E2OA 4OQTH 1EZUA 4CADA 3UIYA 3EDDA 3QCTL 2FBRA 1GL4B 1MREH 3MJGX 4NENA 5SWSE 4P5MA 2B14A 5ESQA 4L4VA 4ZFZB 4LMQE 3W2DH 4P3DA 3VU2A 4OUUB 4B60A 1VGKA 2A4EA 4M7LT 4ONHB 5DURB 1MWAL 3IDJA 1IX2A 2F5BL 3B6SA 1I8MA 2V4LA 4OFVA 4KRLB 4LCWB 1ADQH 1LO0H 5L7XL 4JN1L 4LIQL 2IG2H 3FH8A 5DMGD 4PSPA 3S8GB 1UA6L 5DJ2B 1HKLH 1WUNT 3UGXA 2BDNH 2ZX9A 4JGMA 5FAAA 1C16A 1U92A 1G9MH 3FT1A 4UUJA 2K78A 4GAYB 4HIHA 4W9HC 3OB0K 4ETQB 1RCYA 4RMTA 3UTTA 4LCIL 1CXIA 3HMWH 2ADFL 3VG9C 4N5EC 2DQMA 4XXDB 4QXUH 2XN0A 5CZVH 3LY6A 1H6FA 1LO2H 4EUPB 1ANUA 1ZGLB 4YWGH 3HE6A 5L8JB 1VGEL 5HHOB 4BCYA 1OZTG 2QPEB 2VR3A 3MGTA 4JANA 4S10A 1RPUA 2ADGB 2UZXB 3O45A 1WT5A 4U1KB 2OXHB 1HDMA 4IRZA 5C0EB 4ZPVB 3QDGA 1IGIL 4I9XA 2XUWA 3L7EA 2AV1B 2WP3T 4G6JL 1GZPA 4AYFA 4DGIH 1QEWB 1YNTB 3C6SB 2GJ6B 1AYRA 4F58L 1P7KA 2Q6WB 4KVPA 3QARA 4U49A 3VFSB 5KZCB 2WLLB 1GGIH 2R29A 2VDNB 1NC2A 3GUTB 3DBXA 4J7RA 1DDTA 3CXFA 1FSKC 1NOFA 2Q76A 2YARA 3LPWA 3TCTA 5DJ6B 3DJ9A 1MLCB 3VWKA 5DQJB 3QRLA 2APWA 3WAJA 1MW3A 3MLUL 5T1KB 2E7MA 2PO6A 3COOA 4X6CB 2OR9L 5J11B 2BSED 4CN6A 4F5CE 3FO9A 4KUZH 4MYWB 5C07D 3ZL1A 4J3OG 1BQLL 3MRJB 3CMOL 4CJ0A 5JLZB 1O7VA 3TEWA 3B34A 4Y5VA 1H9VA 3O8XA 1OGAA 3TZVC 1R46A 2BIIA 1Q9LA 1CYXA 1F3DH 3MRCA 3WDHA 3B3IB 3MA9L 1EHLL 2HN7A 2Y07H 1ZLSL 3W0WD 1IFGA 5JYLA 2ZG3A 1A4JA 2JJSA 2XV2A 2VZSA 1U41A 3H56A 2WUBL 1CFNB 2KI6A 3DGGA 4UQ9A 1Q90A 3OHXC 4RVBA 2CE6A 3U0TA 1E2WA 2NX5B 3L5HA 1P9MC 2JCCF 3PG2A 4RGMC 4FLSA 1C5BH 1I82A 3H0TB 4OZGE 4PSRA 1RUPH 2B4CL 2E6JA 4F33B 2YA1A 4WNJA 3B37A 4R97B 1G7PA 3B9VA 4ZW5A 2YN3A 3MJ9A 4KJWC 3KDMB 4XNBA 4N87A 5I1KH 2CQVA 4HPOH 4TUOB 4AMKH 4TNWK 1KIRB 3U0PB 3PHQB 2XPGA 4ZSOE 1LTXA 3M1BB 3EBIA 3DV4B 2YMXL 2FDBP 4F9PA 1ET5A 4AQAA 4N0UA 5BV7H 1E4JA 4QRTA 4B7IA 3QIWB 3LHAA 3D12B 1BLIA 4IDJH 2HT4C 3MYZA 3OC8A 3CFDA 3UZQB 4YFLF 1YEDB 1M56B 4JB9H 4UQBA 1ZTXL 3FCTA 2BY2A 5GGSA 5H2BB 1GAFH 5HI5C 5D96B 2VXQH 1BOGA 2CJUL 2KZKA 3WEXB 4LLYA 5GS2D 2DQ6A 2YAOA 5I6XB 3L4UA 2CA3A 1IAKB 3O81A 3EG9B 5D6CA 4WO4A 1WC7B 1AKJB 4LPYA 3ZIMA 2PXYB 4HDIB 4TSCH 2WUCL 3NCJH 1YMMA 4PGBA 3WHXB 1LEGA 2X6UA 2Z34A 1JF5A 3P3RA 1XD1A 5CP3H 5AG9A 4LCWE 4CMHB 3QZBA 1FYTA 5D7IB 3WYRA 3HG0A 2M8XA 4B95C 1ZSDB 1UT2A 2ZPKL 4F7MB 1HJBC 2XOTA 1BVNP 1F3JA 3D0AA 1CE1H 2WLIB 1A6TA 5AWNL 1NDMA 3WFEH 3MRIB 5CLZA 3ZDZB 3RGVA 1DLFL 3ZKXC 4K8RD 4TNGA 3EGSB 1ZK9A 2VNCA 5MEOA 1WD9A 4WUUA 3RUGB 1FWXA 1XH3A 3CD4A 3WG7B 3MLZL 1RV6X 3VNZA 5I8KL 3CZFB 1GC1C 4CDHA 2ZXGA 3X13A 2FD6H 2Z0UA 4BZ2H 4CC1A 3MREA 4XH2A 2XU9A 2GEEA 4XCFH 3IJHB 4D9LL 1AOHA 3L16A 3BUYA 5CLTA 1YEJH 2DQTL 4DZ8B 3J27A 4NO0D 4LOEA 1E5UI 2NY0C 1LE9A 1G7LB 4G3YH 2OMVB 3WJLC 4ENZA 5JQ6H 4Y4HB 4AQEA 2GJ6E 5KJRH 4H0LC 2ITCA 1UOWA 5KAQF 3IETA 4BRVA 4XP5H 2D0HA 1T6BX 3BEWA 3P4LA 1YPZB 2ZOUA 5DC2A 5I2IB 4UILH 4BQCA 4S0TD 2WWOA 3BPLB 3G5VB 4IU3A 1OAQL 4JFOA 1L9QA 4KTYA 1OAYH 3DJRA 2WLNA 1IC7H 4HEPG 3U7WL 4G1EB 2XPYA 5DVLA 2R8SL 1D6VH 2XETA 3HE7A 4LPVA 5D4QA 3BSGA 3RFRA 4R4FL 3OF6A 3MMEB 4X6CE 2NT1A 4ZFOA 3IU4L 3K8LA 4X98B 4NM8L 5DZ9A 1R5VA 2KZ1B 4K3DL 1PBYA 1MIMH 3GBDA 3KLAA 4HT1L 3EO1B 1L3NA 1PS3A 4HH9B 4LCYA 3C6LC 4NHCH 2IXQB 5E4OA 2F7PA 1UUNA 1QLFB 2P8MA 1AGEA 3DSNB 5EU3B 1NGYB 2J8UB 3ARGD 3EHBD 5IB1B 4CL7A 5AUMB 2NY3C 4HG4J 1WIUA 3NPZB 1J11A 3TA3C 1AQDA 2AEOA 3DUHA 3HI6L 4OB5H 4X8GA 2C1OA 4Z7WF 5I6PA 4HUCA 1NBYA 4I9WE 4MZRA 5BRZB 2ZJSH 1G9EA 3DECA 1DEDA 1TKWB 2NX5E 1QVOB 2AJ3B 1I1FB 4ZQKA 3TV3L 2XKNA 4XAKE 1EO5A 3BAEH 2YQ2A 3FS9A 3AG3B 4YSPA 2B39A 3H7LA 4LRIA 5JHAA 1WYJA 3QIBD 1A0QL 1U8KB 3DTXB 2Y7OA 1BFOB 3TT3H 1EXHA 3HBZA 4OIBA 3RL2A 1RHHA 5AB2A 2H2PC 5CEZH 3DYPA 3FU3A 4XPFH 2XG5B 5FGSA 4WI0A 5CKGA 2OTPA 3NZ8A 3PXHA 2DL9A 1SMAA 3KWWB 4NO2B 2IDCA 3Q2VA 2EEFA 2R83A 1KCSH 3S7GA 4WGKA 3QNFA 3TU6A 3CGTA 1N4XH 3N5AA 1UD2A 1S3KH 3MRBB 1XF3A 4HX1A 5GS0H 4P2QA 3L45A 1ES0A 4LNRB 2W81C 3WSQH 1KTLA 3HFML 2OMXB 2HVJA 5KYUA 5IK3B 4QRPB 5CR1A 5CD3B 5J6SA 2GTZB 4LEOA 4M02A 1A6ZB 4I0CC 4Q4EA 1TTGA 5E5MB 4AVIA 5JR1L 2GQHA 5DRWB 1KXHA 1WWAX 2IQ9H 1R9FA 5FV2A 1MDTA 4X4YA 3K81A 2R39A 1YCSA 2EEAA 3EDFA 2RIKA 1EA9C 2XBDA 4XN9A 1Y0LA 5D7IE 5A7BA 1G7IA 3MV9A 3P9MA