1X9UA

Umecyanin from horse raddish- crystal structure of the reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MEDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Oxidized and Reduced Stellacyanin from Horseradish Roots
pubmed doi rcsb
source organism Armoracia rusticana
molecule tags Electron transport
molecule keywords Umecyanin
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02298 Cu_bind_like Plastocyanin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1x9uA00
4HCFA 2Q5BA 2QT6A 3WI9A 1SF5A 2ZOOA 5I6PA 4G71B 2BWDA 2HX9A 3AG3B 2GC4C 4E9QA 4DP2X 3FSVA 3GYRA 4A66A 1PMYA 2VM3A 1JOIA 4BWUA 2YAMA 1ASPA 4DP8X 2W88A 2EILB 2OJ1A 1MZZA 5TK4A 2CALA 1AG0A 1URIA 1A3ZA 4KO7A 3QJTB 4RH4A 3FPYA 2XXGA 2XV3A 1J9QA 1L9QA 4KO9A 2PLTA 3CZUB 3H56A 4HZ1A 2GHZA 4G70B 2EINB 5FC9A 4E9SA 4A2FA 1RZQA 5B1JC 4CSPA 4E9VA 2H5UA 4A2DA 1BAWA 2DV6A 2IDFA 1FA4A 1HAUA 1CUOA 3EH5B 5I6OA 1JZGA 1E65A 2BP0B 2CUAA 3ZX1A 3FSWA 5D4HA 2FT6A 4BWWA 1A4BA 4FAAB 3ABGA 4GXFA 1WAEA 2GBAA 2ZONA 3QJVB 3CVDA 2I7SA 3DTUB 2J55A 1L9SA 2YXVA 1AOZA 1KCWA 4G7RB 2XVBA 1NPNA 1ILSA 2AFNA 3NT0A 4HCIA 3PXLA 1N70A 4JHVA 1QLEB 1JXDA 3TBCA 3CVCA 3GXUB 1XMEB 2XLLA 3HB3B 3MBWB 4YSDA 1BQRA 3IN0A 1NIEA 3HEIB 3X1GA 2AZUA 4CSZA 1J5CA 2QPDB 5F7AA 5F7BA 2EIJB 2XX1A 3AY2A 3ZBMA 4ENZA 3S3CB 1DZ0A 1M56B 4P5SA 1W6LA 4HIPA 1OF0A 3PAUA 7PAZA 4EF3A 1SF3A 1HAWA 2IDSA 2ZWNA 3TASA 1SJMA 1WS7A 9PCYA 4YSCA 4AZUA 1ASQA 1AG6A 1ET7A 5TK2A 4X4KA 2VMJA 2DY2A 3C75A 4UANA 1GS8A 3UABA 1BQKA 3NP4A 4YSRA 1R1CA 2BO0A 2PPCA 5B3SB 2YXWA 1NWPA 2BP8B 5PCYA 5I6KA 3EH4B 2XWZA 2P80A 3NSCA 4AX3A 1W6WA 2AZAA 2IDTA 3PCYA 1A8ZA 3PAZA 1PNDA 1NICA 8PAZA 4AKOA 2MRYA 4QKTA 5B1KA 2FJSA 3FPXA 1JZJA 3FU8A 3IE9A 3NJNA 1OCOB 4F7KA 4JKNA 4A2HA 2GIMA 3NSYA 1GY1A 4A67A 2XU9A 2FT8A 2IWEA 1JXGA 1WS8A 2LLNA 2DYRB 3MX0B 2PP7A 2VW4A 2IDUA 3U25A 4Q89A 1NIDA 1ZV2A 1PLBA 3KW8A 4HHWA 2PCFA 2UXGA 2YAOA 3WNJA 1NZRA 1BXUA 4TXVB 3OMIB 2QPEB 2XX0A 3NJHA 1OOWA 4BWTA 1BYPA 3ABKB 2JXMA 3IN2A 1ASOA 3NJJA 2YAPA 2J56A 3FYIB 2HRGA 1AZCA 4DPBX 3NJIA 3OMNB 4M4RB 3UAAA 2DWTA 2WO3B 1V10A 2FT7A 2CAKA 2R7EB 2QDWA 3SBPA 1L9RA 3RYMA 6PAZA 2VSMB 2EIMB 1L9TA 1ZIAA 1V54B 4G7SB 1PCSA 4HALA 2YQBA 5A7EA 1X9RA 1V55B 1MZYA 1A65A 2HZHA 4YVNA 1PLCA 5B1JA 1CYXA 3QJRB 2IH8A 4PCYA 4YSOA 1MG3C 3WNIA 4DP1X 1BEXA 1FWXA 4HCGA 2DYSB 3TA4D 1YLBB 1OE3A 2BZ7A 4K9JA 1GS7A 1A4CA 2B3IA 4N4YB 2HX8A 1KCBA 1XB8A 1NIBA 1GS6X 4JHUA 3FYEB 1MDAA 4L0PB 3NSFA 5I5JA 3AZUA 1TEGA 1NINA 1NIAA 3IEAA 4KNSA 2IWFA 2AANA 1W8EA 1EZLA 3EF4A 3T6XA 3FSZA 3T9WA 2JKWA 4PAZA 3OMAB 2WSDA 2XV0A 1CC3A 1JZHA 3T6VA 1HFUA 1JXFA 1PAZA 1WA2X 1J9TA 2R7EA 1IBZA 3CDZB 1BYOA 1AANA 2YAFA 1F56A 2P80D 2FQDA 4GP4B 1SNRA 2BHFA 3KW7A 1PNCA 4DP4X 2A3TA 2PP8A 2XV2A 1E67A 1AZUA 3AW5A 3FU7A 4UF7C 1PZAA 4GYBA 2JFCA 3FQYA 1T5KA 4MFHA 5IY5B 1AS7A 6PCYA 1PY0A 2IH9A 4M3HA 2PPAA 3UACA 4AKPA 1TEFA 3UAEA 2FQGA 4GY4A 1KDJA 2HX7A 2NRDA 3FS9A 2CJ3A 4UAHA 3NJGA 1QNIA 2UX7A 2YARA 5E9NA 4E9RA 1IBYA 2VM4A 5B1AB 1KBWA 1PF3A 3JT2A 1AACA 4HHGA 1ZPUA 3UADA 2FTAA 2I7OA 2UX6A 4G72B 4YSPA 3OQRA 1ZDSA 3FT0A 4YSQA 1M9WA 1MG2C 4YSAA 5D4JA 3WIAA 4YVUA 1L9OA 1GY2A 3PLYA 3OD3A 4GP5B 2CBPA 1GSKA 1KGYE 1CYWA 4BXSV 4A68A 1JERA 3AG2B 3IBOA 3QQXA 2EIKB 2BP8A 3OM3B 3X1FA 3UGEA 4F2FA 3FU9A 4BXVA 3G5WA 2QDVA 2YAQA 2XYBA 3ABMB 1JZEA 4NB7A 1J9SA 3DKHA 1ILUA 2B08A 2E86A 1NDTA 1XB6A 3N2JA 2RACA 4DP5X 3ASOB 1UATA 1AZNA 1AS6A 1X9UA 2GSMB 1NPJA 3S3BB 3H4FA 4NERA 1NTDA 1IKOP 2BW4A 3ASNB 1KBVA 5B1BB 3GDCA 1B3IA 2VW6A 5I6NA 1OCRB 2WO2B 4YSSA 4BDVB 2AVFA 5ANHA 3S3DB 3CG8A 4KOBA 4G7QB 4KO5A 4A2EA 3QJSB 5LDUA 2YAHA 3EHBB 3NJMA 1I53A 4BDVA 2ZXWB 3S8FB 1GYCA 1OCZB 2H47C 2X87A 4DP7X 3TU6A 5AKRA 1PZCA 1J9RA 3NYKA 3FSAA 4P5RA 4QLWA 4YSUA 3ABLB 1KV7A 4ZK8A 3WKPA 4E9WA 4KOCA 3V9EA 7PCYA 1VLXA 2J5WA 3QJQB 2IWKA 2FQEA 1RZPA 4Q8BA 1WA1X 2PCYA 1BQ5A 4AI7A 2FNWA 4E9XA 1XB3A 4GP8B 4E9YA 1GW0A 2OV0A 1SHXA 3AG4B 2MTAA 4DPCX 2I85A 1SDDB 4F2EA 2BP0A 3AG1B 1EHKB 2Y1AA 4HAKA 5I26A 1RKRA 2HLEB 3WG7B 4E9TA 5I6MA 1FFTB 1ET8A 1TKWA 1SHWA 4AKQA 4KNTA 2X88A 1AR1B 2UXVA 1KDIA 2UXTA 2Y69B 2IAAC 3SBQA 4YSEA 5I5IA 1OE1A 1TU2A 5PAZA 1JVLA 3X1EA 5B7MA 1DYZA 4WTQA 3T6WA 3DIVA 1IUZA 5I5MA 2GI0A 2TSBA 3NJLA 3QPKA 5AFAA 4NAJA 4N8UA 2OCCB 2W8CA 1ADWA 3NJKA 2H3XC 1BXVA 1SFDA 4A2GA 2CCWA 1AZRA 3ERXA 1E5ZA 1JVOA 1ID2A 1SDDA 1IC0A 2VN3A 2GB2A 2VSKB 3T71A 3CVBA 3T6ZA 2FQFA 5D4IA 2N0MA 1NWOA 2HRHA 1E30A 5AZUA 2DWSA 1NIFA 3SQRA 3BVDB 3D12B 1A4AA 3FU7B 3FQ2A 1BXAA 1AIZA 1PLAA 4WKXA 3WKQA 2VW7A 2IDQA 4DP0X 2HXAA 1OCCB 3PAVA 1RCYA 3PPSA 2BWIA 2XXFA 3L45A 1QHQA 1OE2A 4W1TA 2UXFA 1JZIA 1AAJA 3N55A 3EH3B 4DP9X 4YL4A 5I6LA 1SFHA 1AZBA 4DP6X 3NSDA 1PZBA 5B7EA 3JTBA 1OV8A 2PPFA 3BQVA 1GR7A 1E5YA 2Q9OA 4BK5C 3H4HA 1KYAA 3X1BA 3X2QB 2FWLB 2GC7C 1ETJA 3QJUB 4DPAX 2PP9A 3FQ1A 1ZDQA 4W9ZA 3ZDWA 1AQ8A 2PPDA 3NJFA 4YSTA 1JZFA 2BZCA 5EHFA 1M57B 2XUWA 3SBRA 4KNUA 1CURA 2YAEA 2PPEA 3V9CA 1ZIBA 2BW5A 5B7FA 3TBBA 4KO6A 1J5DA 3X1NA 3NP3A 4FA7B 3CDZA 1N68A 3S8GB 5I28A 2J57A 1ET5A 1WA0X 3ZIYA 1L9PA 1AS8A 2TSAA
chains in the Genus database with same CATH superfamily
4Z78A 1SEBB 1A47A 4H44C 3K4DA 5EUOA 5DJDA 1I85A 2BOCA 5AAWC 4HEME 3ZXAC 4PJ7E 5EU6B 1NFDE 3DHJA 3LH2H 3GYRA 4ZXBA 4PB9L 3HI5L 4YHML 1TETL 1IM3B 1XR8A 4GW1A 4KMTL 1MZZA 3WN5A 4X5XA 2J72A 4NAMA 4LLWA 1OP3H 4HGWA 2HUEA 3KLKA 3RE0A 3S5YA 2N1KA 5EPMB 3D08A 3EO9H 2AI0L 4H1LG 3SYQA 4IW4C 3KNBA 3ZTCC 4FCHA 3QS2A 3WFHA 4Y1AD 4MDIB 4UT9H 4YMPA 1UKTA 2G5BB 4MJIE 5IW6A 2WSKA 3WFEH 3KPSD 2BP5M 3TEWA 1VFAA 2EH7L 4A2DA 3CHSA 4K3JH 4HCRH 4KVCH 2AK4A 1FE8H 1W0VB 2JB5L 1LO4H 3B9DA 2EZ0C 3LJ3A 1XH3B 1W8NA 3IJEB 4OH2A 4Y9BA 3MMEA 4CJ0A 5B3JF 1KXQE 1NL0L 1DBAH 3H9YA 4GAJL 1FVEA 3BUBA 4L8SC 5I24A 1QTPA 2DM2A 3UBXG 5CBAA 4MA8H 4Y2DB 3VTTA 2CPUA 1I9JH 2XWDA 3CC1A 4GRMB 3CN3A 2AV7B 3N9GH 2DQHL 2ZONA 3G6JA 1BG1A 4X6CB 5IHZB 4EMZA 4N20A 2XIIA 2YGOA 2X4RA 1AD0B 2LVCA 2X09A 1U3HD 3A6CH 4BQ8A 3OGCB 1JZ2A 4YDKL 3DX9A 1CO1A 1JGDA 1NDGB 2APFA 5JLZB 5DS8B 4HCIA 3PXLA 2ZCLL 1L0QA 3STBA 4JCLA 3DVGB 4PCKA 4HF5H 2VJ0A 3L1OL 1BQHB 5IFAL 4HFWB 1D2PA 4ZUTB 1BECA 1RZFH 4LF3A 4RCAA 3GMLA 4QHUA 5GGVL 1NKRA 3MRRB 3WL9B 3FCTA 1H5BB 5I1DB 3JVFC 1FJ1A 4GMTL 3T3PB 2AGJL 2VSCA 1L3WA 3L3JA 4KROD 4I2XB 4M93B 3EOBB 3EW3B 4HIPA 5C70A 1HH9B 2QADD 2VDLL 1BVKB 1JGEA 4DVRL 5FXCH 2WANA 3QAQA 4MA3B 3UJJH 4LSPL 3HNSL 2O6PA 3B8SA 1JCKA 2NX5D 5JA9A 4O4YH 4I18C 4FYTA 4X80L 4YEFA 1H3PH 3MQIA 3LNFA 1PCXA 2B8OT 3VYOA 1EMTH 1BJ1J 1NWPA 2MCG1 3DSNB 3NCEB 2HVJB 4O5LH 4P23C 3D18A 5PCYA 4NQDD 2Y25A 2V9RA 2EDFA 3OF6A 4Y2DD 3T0ED 4NEHB 3Q06A 2CMRL 4HUUA 4PJ5E 4V33A 3QQ4B 5BZDA 2OJEB 1DCEA 4Y2LA 4UZUA 2OXGA 3BSGA 3A0OA 2OPCA 4JKNA 2K8MA 5D1XD 3MACL 4Y1AB 5D7SH 4P3CH 3LZOA 1JXGA 3LDBC 2R2CA 3MUJA 1ZANH 4PBXA 5L4JA 1EHAA 2OXHB 2VW4A 1YECL 4O58H 4JRYB 4QRRD 1VACA 4HEPA 5JO5A 1NCWH 2MWCA 4NKOA 4QGTA 1LEGB 4WI3A 5AW5B 3WDIA 5KSAB 3F5WA 3AFLA 3MLVL 2ICWJ 1R5IA 5EEWA 2FHBA 4ZAKD 3SDYH 4DTGH 1UWYA 1C5BH 2MCPH 4XX5A 3SDDD 5H35A 4OLWH 3QUXA 3K6SB 2JELH 3FU5A 3NJJA 4XBEH 3FYIB 2EEBA 2NMSA 5KG9B 4L1SA 4U49A 4Z7WF 1GTFA 3RI5F 1VGEL 2WTRB 4PUBH 2A6KB 4W70A 3FU3A 3GSVB 5J13B 4NZ8A 4EI0A 3SBPA 5BV7C 4G8FA 4W4NA 3VXPB 3HAEG 5EZJB 4B9CA 4G7SB 1PCSA 1TJGH 5JORA 2R69L 2WJ7A 3MV7E 4OBRA 4HJGB 1TEYA 3I9AA 1XZ0B 2ENJA 1RPKA 2OMWB 3PS6A 3ML8A 3D0LA 3Q48A 4P3DA 1ES0A 2ZWKA 4OFDA 5FX3A 4HCGA 1B2WL 2F53B 2ZCKH 5LB1A 4B9ZA 4R96A 4N5UA 3PHAA 3M86A 3WELA 5IJKC 1KB5B 3L81A 3WY4A 5FWRA 4UOW1 1AOHA 1OW0C 5DD5H 3S8WA 3RWDA 3H9SD 3V4PL 1KTBA 1MDAA 3DPBA 4CNIA 2VDOH 3CUPA 5MI0C 4HD9A 5IG7B 1FC1A 1P4BL 3US1A 4BZ2H 1OSEA 2W94A 4MTMA 1YEGL 2JKJA 4AYDC 2GSIA 4RGNC 2WYTA 2WXLA 1JRHI 3UZQB 2CKBA 4X6EA 3TH2T 4LEBA 5EEYA 1T04B 5EORL 4OCYH 2BS9A 4K3HA 3VDBA 4XBPA 1OLZA 4N3TA 2DEYX 5B39B 1RHHB 4N1EA 2A9CA 3JV5A 4XNYH 4EZMA 1H5BC 1T2XA 3Q9QA 1KBGL 4GP4B 5DZOA 1HZHL 3A67H 1RUPH 3BP6B 4W68A 1BFOA 3RIAF 2FH8A 2TRHA 2CO2A 5GGVY 1R3IL 3HC3H 1SQMA 4IMKA 5AYQA 4LLQA 1PZAA 3LKRB 1A7PH 3KPOA 3UTSD 3VFRB 2CHZA 1PY0A 2B59B 3F12A 3GLDA 1J10A 2AJYH 4L4TA 1JWUB 1DQQA 2GTZA 4ZUTA 3QYMA 4P04A 5I17A 1XAUA 2OMXB 4FFZH 2X0UA 2C9SA 4GY4A 3QEUB 3NEOA 3NTCH 4OZFG 4R3SB 2APVA 4U1NA 1T89C 1BBJB 3RURA 3MCG1 1BF5A 1INEH 5KJRL 1CLOH 1G7IB 5HSFA 3TF7C 3U83A 3BWUF 4N86A 4BZ1H 1QEWB 2VWEE 4KV5F 4MRCA 4LPWA 2O5ZL 2HP4A 1XR9B 2XTJB 3OQRA 5AKTA 5FECA 5ICXB 4WK4B 3ROOB 3O4LE 5EOCJ 1MJ8L 2YUVA 1BREA 5F1NA 4P9HC 2WVVB 4Z7WA 3DX6A 5BS0A 3A6OA 2RB8A 1FFRA 3FSOA 4BXSV 1GJIA 4HUWA 4WHYG 3MBEA 3FRPA 2EIKB 3OM3B 5D6CB 5C07D 4G5ZL 5JPMA 3D6GA 3UGEA 1V7ML 4I3RH 4F2FA 4OM1H 4UQ2A 4ERSL 5IW6B 3VNYA 5EN2A 5B38A 4D9RE 2EYTA 3WLWD 1QBAA 3QIWD 4GINA 1IC4H 3KL0A 1MXGA 2EICA 5EPMA 1NEZB 4MS8D 3QUXD 4X8GA 3ALPA 1M7DA 3QORA 5ANMA 1IGTB 5GSRA 5I0YA 4CN6A 1I9RL 1DDHB 1JHLH 3S3BB 4F27A 1KENH 1ZTMA 3AB0C 4MJ4A 5DMKB 3ASNB 4HUCA 1FAIL 4U1IB 2ZTBA 3VXME 4APQB 5KVGH 1LMIA 3H42H 1O6SB 1AMXA 4LSUL 3WJMA 3DX7B 4N6QA 3S0PA 1ZTXE 1OCRB 2P44B 1PG7X 5FWQA 5GQBA 3PV6B 5DWUH 3NOIA 1CURA 4HBQA 4YE4L 4G6JH 3K1DA 4LLMB 1WD9A 2D2CC 2DOCA 3AITA 4F9LC 3S4SA 3QORD 1T21A 5D1QB 5I0WA 1E3ZA 4OIAA 3ILPA 1U41A 3UTQA 1ZVNA 4JJHA 1HHJA 3PWVB 1VFOA 2V8MA 3QUZC 4TPRL 3P4NB 4G9FA 3WE6A 5EU3B 5FDWA 3CHQA 1X44A 4Q8BA 1CXLA 3QG6B 4S1DC 2E7HA 3QZNA 4OSUH 2VERN 5ENWB 1ZE3H 3W38A 1LWHA 5E08H 5DD3H 5FA3A 1BWMA 3PPEA 1SYVB 1USQA 5CUSH 3FOLA 4QXUH 2WQ8A 3QUYC 4IU3A 1HH6B 3QJHB 1DFXA 3RAJL 1RURL 1T2QH 4OCWL 4FXKA 1V3LA 4Z7VB 3T8VA 3JYCA 4EEEA 1AFVH 1KDIA 1TZIB 2X4TB 3WN6A 1T6VN 4KJQC 3L4XA 3KMDA 3T8XB 2KLSA 4ZTEA 1NLBH 2J6WA 1YY8A 3CLWA 3G5XA 5CGYC 3O2DA 2ZXEB 3X1EA 5ISZD 1MNNA 3IXTB 1IUZA 2TSBA 1NCIA 4G2AA 2C3GA 2QVIA 4MB1A 5ADPH 2HT3C 4RFEB 1F6FB 4LCYB 5E2JA 5F3HB 4YHMH 4KI5F 3BPCB 2B9AA 4NQTA 4Q0XL 3ZYIA 3H2PA 4QAMB 1LP9E 3UBFA 3A22A 4Q6IC 3NGBC 3QFJB 5FUZH 4FMKA 3TJEH 4GW4B 4BKSC 1A0QL 2RD0A 1QLFB 4XMVA 1ND0B 2QKIC 3QDGA 3BLKA 2VLME 3VD1A 2PW2B 1CMOA 1A4AA 3FB8A 5C2BH 1AIZA 4KI5C 1KB9K 2BWQA 1JPST 5KANI 5EOQH 5LBGA 1W72H 3KM2A 3QWQB 3E8VA 5EBLB 5D71H 1BD2D 43C9B 4DGUA 3RFZC 4GKNB 4IRSA 1MHHA 2YC1B 1OSZA 3BW9B 1RIUL 3PWNB 4R0LA 3T77A 4YXHH 4FG0A 4PLKD 5SWSE 4TTGA 1X4YA 4ZTOL 3WJMB 1CL7I 1GJUA 1UWXK 2J21A 3AACA 1U9KA 4M9PA 3EH3B 4Z3HA 5ILTH 1I7TB 1I9JL 1BOGB 1EJOL 5IW1A 5ACMA 3A6CL 3NSDA 5JQ6L 4FE9A 1SXNA 3BP4B 4PBDA 1DJXA 3UERA 3TS8A 3QEQE 2B4CL 3WTXA 1FYHB 5D7LA 3ZSSA 1RZKH 1BM3L 3X2QB 1NKGA 5JW4N 4IS6A 4ZX3A 2I5YL 4Z0XB 4JFEA 3VGEA 1J87A 5AENA 4OIFA 3AQXA 2PPDA 1A2YB 1RZKC 4JRYD 1FH2A 1KPUB 5F89B 2NY2B 2D7PA 2YAEA 3V9CA 2PWDA 2W9LA 2YD1A 2FYYB 4RAVB 4MB3A 4JFUA 4OUUA 5G4MA 5SWSD 1QP1A 1TYJA 4TLSA 1N68A 4OUOA 2FIKA 1QFHA 3DX8A 5C0FA 2VO8A 5DJ2A 3S8GB 4WI0A 4ZI8A 3QNYB 3NFNB 1L9PA 4MLSA 2ZX7A 4OV5B 2BVYA 4JPSA 5FFLA 3CE1A 2UZPA 1LWJA 3I2CL 4WHDA 4G71B 2WM0A 2GSGB 4JPWH 4YFDB 3RVXC 4IIQB 2RMNA 1JNLH 3JTTB 2AQ1A 4D9LL 5IHLB 2VM3A 5L0QB 1P4IL 3L3OA 3GRWH 1TCRA 1CU4H 1TJIL 2OMXA 2VOTA 3WKYA 4JFZL 4PJBE 4Z0XA 1QPPA 4FQ1H 5KSBF 2E76C 1DBBH 4NQQA 2B59A 2DQCL 2NX5B 2H1PL 5EU4B 3WYRA 4QOKB 1UJTA 1ZK9A 1AGEB 3DOIA 2VJ8A 4HZ1A 4XVJL 4G70B 5CCJA 1KJ2H 3FTYA 5E94A 3DV6B 4KRMB 4UQCA 4K3EH 3MLXH 1JWMA 5ECJE 4E0RA 2R2EA 4PY7A 4IKJA 4FYQA 1K4DB 4IOFC 4PJCE 3B9EA 1H15B 5K1JA 5DHVA 1DQVA 1MRCL 43C9A 5LGJA 4LOFA 1B90A 2VR4A 2FECL 2JK5A 5I71C 4U6HB 2EDMA 3DROA 1BBDL 3VXNA 5KVGE 1NC4B 4XC3L 3CVDA 4Q56A 4UMSA 2JLLA 2NY3C 5ISZA 4Z5RA 3PWPB 1DBML 3BWUC 2XVBA 1NPNA 4NZUL 2QPUA 5GRUL 1R24B 3CDFA 5FYLD 2BZDA 1UYWL 4LARH 1MH5B 1F4WH 4PB9H 3GXUB 4G9DB 1XSKA 3TZVB 3K5SA 1X5MA 4KK6D 4HWBA 2DQGH 4OLXH 3GBLA 4XAKD 3FH8A 3S37X 2BP3A 4FZ8L 3NEEA 1RJYA 2C4FU 3OLGA 3TURA 3HE7D 3M17A 2NY6D 3T4YB 3U0TA 2NZ9D 3QDJE 1RUMH 4FI7A 1F58L 1W6LA 4DP5X 4IGBD 7PAZA 4TVSa 2QZQA 2Y06L 1J0IA 1E3FA 2QPSA 2Z3FA 4N2DA 5FLUA 2DBLL 1RL1A 3NIDB 4LEXL 2D0FA 3C5ZC 1ET7A 3SDXA 4HFUH 3WIIH 1AIFA 2ITFA 4X8XA 2AJUH 1VPOH 2CA4A 1I7ZB 2HT2D 4YSRA 4EUPH 2AQRA 4PJ5A 5T3ZH 4AH2B 5FYJE 2BIQA 2BVUA 4IBQA 4ELDA 3ARDA 3BXNA 3MOAH 3ENEA 4OCNC 2G30A 4GQQA 5C07E 2G75A 5D4QA 1ML0A 1A8ZA 5LO7A 1PG7W 1LQBC 1ZVHA 1T4WA 2R9HC 2ZAGA 4JRYA 4BQCA 4F7KA 5EU5B 3UZVB 4I0PD 2VDOB 3LZLA 3WHXB 3WXWH 5IIEB 2AJVL 1XGPB 2HRLA 4NO3B 4A67A 3VA6A 4AEEA 3H53A 3S9DB 5KSBA 4NZUH 1ZHBA 3AT8A 4GI8A 1KEGL 1R5VB 4X9FA 5A2KH 4I18A 1NMBL 5IVZB 1T66C 1NDMA 3FRUA 2P47B 1UB5B 4JG5A 1BXUA 1A1OB 3B1TA 4PG9B 2AJYL 1BLIA 5K5YA 1TJHL 3WUZA 4FNRA 3JWNG 1E90A 2H2PD 1NEUA 4N6RA 4Y4HA 5IQNA 1UM4H 2IANB 2JXMA 3DO7B 2YAPA 4FNQA 2ZX6A 2J56A 1F41A 3VRLF 2YQ2A 4GNKB 2Y3AA 4EN3B 5K9QI 4OGYH 1JIBA 2VQ1A 4JAMA 4MAYC 4NDMA 3HMXH 5T5NG 2BHZA 2A74C 4MJ6B 5HYFA 3GMNA 5CZVL 3IFNL 3KWXA 2YD2A 3VGBA 5LGHL 3CCHB 2W07B 3JZYA 4NNPL 4QTIL 1H19A 4EIBA 1S7WB 1U92A 3W11D 3FTGA 3TM6A 3AREC 4B60A 4LB8A 4ZS6D 3LIZA 1E4XL 1TFHA 4PYHA 5H4YA 3MRLA 3OKNA 1QSFA 2BERA 5F9JA 2CU9A 3QJRB 5J6HA 4YDIH 3L6FA 5DEJA 4UIKH 1ZLEA 3P4MB 1QR1A 3MRRA 4C47A 1WC7A 3NA9L 1P53A 4J1UA 5C92A 3FC8A 1N7MH 3SPGA 3LHAA 4JFYA 3GMMB 1PKQB 4NLHA 4CADA 1Y1DA 3FHQA 4GFTB 4N9GA 5CINL 4O58L 3PUCA 3ZUNC 1ZSDB 2Y6SD 3AZUA 3MLXL 1TEGA 3BC9A 4LKCB 1G84A 1LO0L 2WKOF 3MA9L 2ATPB 4EOWH 4UB0H 2YPLD 3GZPA 2AANA 3QEQD 1T7YA 4QRFA 4LCWE 4WI6A 3BJLA 4OAWB 3VWKA 3VXMD 3T6QC 5CJQH 1G9MC 3G6JB 5C0RL 3UBHA 1VGEH 4M8VA 3W0WD 1AE6L 3FB5A 3RBGA 3TZVC 4X4XA 1UH4A 3VX0A 3D3VB 2FK9A 4HSQA 3DTDA 1PQZA 2XPGB 4Y1TA 2R7EA 5TTRA 5IVXA 2FEDD 3N0AA 2V2WB 4G1EB 4ZX4A 3DC0A 1F56A 5GHWH 3U9PL 1E2WA 3N43B 4YHNA 1E5AA 1IGCL 2UY6B 1NFDA 4N26A 1U8NB 1YYLL 1FQ9C 3QW9A 2PP8A 2N01B 3LX9A 2FCBA 4LHUG 2VRAA 2X6BA 4JFSA 1YNKL 2HTKC 3DRTB 3OKEB 1QUPA 3U0WL 3MUY1 5GRWA 2K45A 5D93C 2IH9A 4XCEB 3U46B 2CCLA 2PPAA 1KLUB 5DJ6B 2OMUB 1XR8B 2JJTC 3IF1A 4A7VA 1LILA 3UAEA 4O2FA 4L37B 1FI8C 2IV9A 3P0YL 2E5EA 5I1LB 3VYPA 3J07A 2MEJB 5C08D 4IEFB 4FNPA 1IBFA 5HYQA 4NO3A 2GHWB 3RBSA 4FFZA 2JI3A 1TSRA 5JW4Q 3O6LH 2DMKA 3HE7C 3FO9B 1Z5YD 2JKSA 4G72B 4OKVB 5DWPA 1YRKA 4M1GH 3HHMA 1YQVL 2HJKA 5E8PA 5J1AA 3ZR5A 4HKBA 1U8MB 2VABA 1MG2C 3NJVA 5L9DH 3WIAA 1CICD 1EEZA 3BP7B 4PV8B 2CM5A 2PW1A 3PLYA 3QNYA 4WUKL 2CBPA 3GM8A 1PL3A 2DQIL 4TULL 4NXSA 1N5YL 4FLRA 1S3KH 1FFOA 1J8RA 3DTXA 5HPMB 1FV1A 3VAEA 5AQ0A 4OJCA 1K6QL 3ZZQA 3TOPA 1JK9B 3GSNL 5EOCH 2NY0D 4B9FA 1M6UA 4NUMA 4LHUB 1T6WA 3S96A 4RGNE 3G04A 1NAMA 4AQZA 4MXQD 2FO8A 4K2UL 3RDTB 4ETQB 2F8XC 1QSFE 1CLCA 5H2BA 3BAEL 1NBYB 3PP4H 4K5NA 3R0MA 3DYOA 3K81A 5KSAA 1CGYA 3U2IA 1WITA 3L5IA 2BFGA 5D71L 1DQMH 5IB1A 1AZZC 3PFUA 4OIBA 5DMGC 1CYGA 2NY1B 5I75C 1HHHA 4AYGA 2VISB 5I6NA 3ESUF 3O2DH 4GSQA 5DUPH 4ICWA 3OAYK 3T4YA 4YSSA 4ONFL 1N12A 1T0NA 1OT1A 4NQEA 5ANHA 2IG2L 1WFJA 4UQ3B 3S3DB 2YAHA 1F1AA 3EGDA 4P4KC 2WZPD 3VD7A 3TYFB 5HYJB 1AO7D 1UCBL 3VJ6A 3TPKA 3VI4B 3ZGIA 3X13A 5BZDB 3AT9A 1GKEA 3KWWB 4TSAH 1A7QH 3HPLA 5DGRA 1MHHB 2YC1A 3HG4A 3VGGA 4UOJA 3WKPA 7PCYA 4MQ7A 4OLUH 4LSRL 5CD3A 3MNDA 1PD0A 2VN5A 1FFNB 5DJ8A 4NZFA 4MXVE 3BVNA 4O2FB 4PVNA 1NUFA 1XFPA 1JN6B 4J7RA 4CBPA 2F1BA 2Y4SA 1JWSB 5DC0A 3I74A 5KTEL 1I9RH 4C56D 1KIPA 1NGXA 1MRFL 1XF5B 1JFQH 3IKKA 3S34H 2HAZA 4GRLD 2FX7L 3SDAC 2A0LC 1HCVA 2HMIC 1U3JA 2D31A 2X44D 5A43C 4YSEA 5I5IA 4I2XA 1OE1A 1P7KA 3SE3A 1JVLA 1IL1B 4GQRA 4XC1H 5B7MA 2BM3A 2KZWA 4LVNC 2VDPH 4AT6A 5GISL 2X4TA 1TMCB 2NY4C 3OHXC 4HUKB 2OCCB 3B2UD 4X5LA 1E6JH 5FKPA 5LXGL 4HJ1A 4XMZA 3NJKA 2K70A 1BXVA 3BVWA 3GHBL 4KROB 2CA3A 2CWRA 3BUYA 2BRRL 4LEEA 2VSKB 3T71A 1P7QB 4F57L 3OGCA 3ESOA 5C0JA 4PM1A 5E2WL 2BOLA 4HZLA 4DGVH 4FQJL 8CGTA 3DRQA 3JWOH 5IHZA 2N0KA 2FEEI 3ZSTA 2NY7H 4XXDA 4R2GC 5DJ2B 2WZ0A 4IK6A 3IJYB 2W92A 2IFGA 3P4NA 3G6DH 3QO0A 5F96H 5F7EL 5IV2B 5D70L 1EO8L 2GCYA 3FDWA 1PW3A 2CUHA 1NAML 2R4RL 1W0VA 4K8RH 4DEUA 1UZGA 4JO4L 1JDDA 1QHQA 4YLBA 3V7AG 4Z7OE 3D4GA 3UTTA 3FTVA 2FEDC 3MRFB 3IM1A 5L7XH 3Q5YA 5FPIA 4AMKH 1SJXA 5D1XC 4V2CB 1GGCL 2KT6A 5JHDB 2MHAA 3L7FA 2J88H 3LZFL 4U1IA 1ETJA 4HPYH 2JCCB 4ZT1A 3DXAA 3NCWA 4I0KA 3IU3B 3RU8H 3ILQD 3PGCB 2WIIB 1AR1C 4UDTA 5TE6H 1XCTA 2OJZL 4V1DE 4KRPB 1FL6B 1J8KA 2FE0A 3WFDH 3BW9A 2WBXA 3T77B 2YA0A 5BOJA 5B7FA 4J3XA 5JUEH 2DS4A 2P48B 1ZT7A 5KBMA 4PW4A 2VDRH 1A9BB 1QNZL 4MKMA 3OKMB 4YHPB 1NBVL 4HFUL 3HAEB 1W0YT 4PD4J 3ZIYA 2Q8AL 4Y5VA 3P54A 4JL2A 4NWUL 4XNXL 1FNSL 2QT6A 4XP9L 4HBCH 3IJYA 2J73A 3UZVA 4TSCH 3RWFA 1KF9B 4F2ME 4DKDC 1DJIA 5KVEE 4WV1C 5E8NB 2ORBH 4LLVB 3ISRA 4JO2L 2SODB 3HKFA 4KKAD 1DANT 3QUZB 1HZHH 1TTFA 3EADA 5I76A 1OGAE 2GFBA 3M1OA 4M5YH 2SEBB 3IGKA 4YE0A 2WXOA 3TLRA 2NSMA 1HDMB 4A2FA 3S5LG 4WRLA 4JRXB 1AY1H 2ICEA 3F64A 2EVJA 1I7ZA 1MXDA 4HKZA 3GSUA 2Q87A 5ACLA 4BFKA 3E8UH 1A6WL 4P2OB 3MNMA 2ZICA 3EDDA 3MRIA 4X6DA 3VFSA 6FABL 4AYMC 4Y9GA 2YMTA 3CN0A 4OCRH 3BIKA 3W56A 4F80A 4G82A 1ZEAL 5GJTL 3RWHB 1BXXA 4KK8C 4MMXC 1A4KB 1BD2E 4K9EL 1E4KA 2CLRB 2LVEA 3OLEA 5JIMA 2RAMA 5GZOA 4ORGB 5J5EA 5HDBF 3CJJA 3MUZ1 5IM7A 5BOPA 2YXVA 3UBGA 4G9FB 4MQXD 3S5LA 1KC5H 4MGXA 3QIWA 1N70A 2J7LA 5HHXL 1K8IA 3NN8A 1DE4B 4QRBA 4HC1A 2IFFH 3ULUL 5HHOB 1AQDB 2Y07L 2F8OA 1DSFH 4N24A 4XODA 2Z4TA 2P24B 5CJOL 3KYKH 2EIJB 5TFSL 3FK3A 4XO4A 1JF6A 3RWDB 2OCFD 5DJAB 3TJHC 1M56B 4QRRA 3U1SH 3KE0A 1D5MB 3WOVA 3HZVB 4UQ3A 2JK5B 2X1XR 4P57B 1U93A 4M62H 4R7NA 2JF1A 2LAGB 1UVQA 3TEXA 3DXAE 3HG3A 3SKMA 4JDVA 1PBYA 4U1LA 4JQVA 3C75A 3BN9D 3OL2A 4P9HH 1YMME 2GJ6A 2OYPA 5GS0L 3D34A 3DGGB 4XC3H 2H32H 3ZE2B 5H8DA 4PGEA 4KHTH 1XEDA 2CDEA 3G6DL 4A04A 4MKTA 2FBOJ 4Z95H 4RDQF 5CFAA 4JQIH 5BS0B 2DWEA 2HPOA 5FEBA 1XF4B 2AQTA 1IARB 4PJXE 4S2SA 4S0SD 3FN0H 1JFHA 1MFMA 2PTTB 3JWDH 4LEOB 4NC1C 3ZHFA 3LZQA 2UVFA 3ZHNA 1S6NA 2BSCA 2R4RH 3I6KB 3M8OL 1F3DJ 1JUFB 3F84A 4ZOBA 3ULUF 4KTEH 1FNAA 4O2EB 5SV3A 1EK3A 3SHSA 5IT2H 1UH2A 5L2KD 1VACB 5JYLA 4YHLL 3APDA 3QUHA 3VA2C 4AITA 2I9LB 1IGIH 2IDUA 4XNAA 2P8PA 3GBNH 3OZLA 2CLZA 2NCMA 3LV3A 2J6EH 2GK0B 5FFOA 3HUJF 2FLMA 4F93B 1PJWA 3P3RA 2A83B 3ZDZB 1LNUA 4Z7WE 4KJPC 3GXFA 4AQ1A 3Q05A 2DWXA 1KCRH 2DLFL 3BZEB 4UM8B 2BNQB 4CKQA 2XWRA 3S37L 4Q6IB 1KELH 3NFPB 5TQ2L 4EJ1C 3U0WH 2JKNA 2DN7A 3ZKQD 1SXAA 3FONA 2WKOA 4Y4KB 1B3JA 2FWOA 3MLTA 3MKGA 4ZUVB 3KPLA 3U9UB 2Z8RA 4DPBX 5DJYA 1NANH 5DR5H 3PIQA 1DBJL 3MLPA 2XBTA 1L7TL 1EANA 1S7XA 2GG1A 3BLPX 3DSNA 5EC2B 3VXUA 1ZJBA 1YQ2A 2WP3T 3WIHH 2J20A 1EAPA 4S10A 2XN1A 3BZ5A 4JW3A 4NZDA 4H5SA 4Z18A 1D7BA 1IAOB 2DQCH 2RGSA 2VLKB 1U93B 4EI5C 1UZ6F 2K0RA 2ZOLA 2EYSB 1PLCA 4KZDL 2OA9A 1E8ZA 2F19H 1KIRA 2QMKA 3N9GL 3DX1A 4NPKA 4YLQT 1BEXA 5F1KC 3D09A 3FTUA 4A55A 1TZ8A 1JGEB 3SY0B 4CGUB 4RNRB 5CIPH 1JI2A 5HJ3A 1I7RB 1NIBA 5CN1A 3V5KA 5J06A 1N0XH 1OT2A 5IHUH 2ARJB 4BCXA 1KB5A 2Z4QA 3V2AR 2L7QA 3D85D 5IQ7H 3QFJA 4DGIH 4HG4J 1BZ8A 4MD0B 2AK1L 1BEYL 2A9DA 4JFOB 3RRQA 1ZLSL 1WISA 1JZ4A 1OAQL 3ULUC 3HKZA 3B6SA 3BAEH 5HGHA 3N91A 3L3GB 1A6ZB 4GMSH 5ACZB 2WSDA 3I6SA 4JPVH 3WDHA 3SGJC 2E27L 4HLZG 4KRNA 3VFSB 3LQZA 5D5MB 5DVMA 2X0VA 5DVLA 5JOFB 4QCIB 3S48A 2KKQA 3WTVA 3QVAA 1GCFA 1YY9D 2A6KA 2QSTA 2HVKB 3DSFL 1RZJC 4I9XA 4UQAA 2CXGA 5BV7B 4U0RC 2A3TA 4FG6C 3O4OB 4JHZA 4MNGE 3SCMA 3L5WB 4AEIL 3HS0C 3CCHA 2VLKE 2Z8SA 4FXKB 2P4AB 1SY6L 1QI5A 5E6IA 1B2YA 3LVTA 4BM7A 4HSCX 3M1CA 3VQ2C 2UWEE 2G60L 3ZDXE 4CVZA 4YDIL 1C5DB 2WJ5A 2V7HB 3QDJB 5EU6E 3VD4A 5BMFL 4ZO6A 2BNRA 2P5WA 2ICCA 3C5ZA 1G6VK 4IOIA 1F6AA 5GS0D 3HA0A 2OXHA 2PTUA 5CKAA 4LFHG 4UB0L 2A99A 1T83A 1J9CT 5IVZA 1LO0H 4LMQE 4H4NA 3SDCC 3BE1L 1ZPUA 3T0WA 4PG2A 4BFOA 3IU4H 4R7DA 3BSZH 4YSQA 4H8HA 5D8JH 2OK0H 2Y36H 4MJIB 1OZTG 4FJ6A 5CR8A 4HUUB 3CN4A 3UP1A 3SGKA 1E9OB 3EBIA 3IMVA 4NN6C 1KGYE 3ARGB 4A7TA 3SSGA 5DGQA 4BSJA 1IEHA 4XAWH 3V79C 2GY5A 3QZWB 2W0LA 4IRZH 2WO4A 4HWEH 3O4LA 3WEAA 1ACYH 3ETSA 2OL3L 1PZ3A 2F1AA 3KDPB 3L3KA 4XP5H 1BZ7A 4CVZB 4ZFQA 1BV8A 5D55A 2XIDA 5I1GL 3CSFA 3FB6A 1KCSL 5E7BA 1XGQB 4MLIA 4XPGH 5F7YC 5LCVL 4YE4H 3FB7B 1U8JB 5LNEA 1UB6B 3B9KA 3QDJA 4GO8A 4MYWB 4ADJA 5GGTH 2QLYA 1XCQA 3F05A 3MRFA 3COOA 2NW3B 3KPRE 4H88L 1B3IA 2YPLE 1KCSH 3HJ0A 1INQB 4OFYA 4PJXF 4ZPTB 5C8JA 3EDJA 3UH8A 5I1DA 4N3UA 3V0WL 2X2YA 4DW2L 2AVFA 4UV4H 2Q8BH 2NCEA 1BZOA 4BDVA 4XWOD 4V1DA 4NKMB 3BIBX 3RKDD 3PDOB 3HLAA 2DTSA 3O2WH 4P5MA 5JOFA 2LLLA 2Q2LA 4MD0A 4KTGA 3UJTH 2DTML 4PCTA 5FO2A 3WY1A 1DUZB 4HH8A 3QCUH 1K5NB 1CI5A 2WINB 4HWBH 1HSBB 1CFMA 3L3GA 2A4ZA 1WZMA 2P5PA 4KAQH 2HT3D 4KZCA 5E1HB 4DUWA 4IBSA 3DO4A 4JHAH 2AMGA 4YPGB 1N7ML 4AQAB 5BZZA 1MH5A 2XVGA 3L5XL 4GP8B 1CFSA 5CXPA 3HFMH 4XN1A 1YHPA 32C2A 5DTFA 1DLFH 3MCLL 3QP3A 3SD2A 4Z7NF 5MEND 4HXAL 4ABVA 4QWWC 4ZFZB 4E9TA 4M7ZC 4WTXA 1IL1A 4FQJH 4PJGE 2NLJA 1QHOA 1I7RA 2VLKA 4OZHE 1OGSA 1ORQA 1KPRB 1AR1B 1DFBL 4PB0L 4OJEH 2AJ3B 4N8CL 1V7NH 2DQMA 3H9SE 1IKFL 2GIXA 5C08B 1OL0A 2FVNA 3H9HA 1RHHA 3F83A 1M2OA 3CLEH 1RZGB 3KDMB 2ZOLB 4NWUH 4XNXH 1E40A 1VF5C 4NAQA 2H4EA 1S9YA 4N8UA 1EUTA 5L8LB 2VR8A 2W8CA 3MR9B 2EE9A 3AT0A 4XGZB 3ECVA 3FQRB 4W9FC 5E56A 4R7XA 4ZAKA 1Z5HA 2WAQA 2Z93A 5F70A 3ERXA 4H88H 3NVQA 4ACTA 2BNQA 3WXWL 1X9LA 2B39A 4J3WA 3MRKB 2GB2A 5DJDB 4BFBD 4G6AC 2R15A 4F58H 2AJXL 2P28B 4LNVA 1KXTA 2Y22A 4CKVX 2FWOB 3MLTB 4LQ1A 3U9UA 2DWSA 1IIIA 3RU8L 1BZDA 3D12B 3O6KH 4K0OA 5KJRH 3ZE1E 3WMQA 1HSBA 2G0LA 1F97A 2ZKXA 1WBZA 1HOEA 4R26H 3O6FA 3KEHA 3NFNA 1WAAA 4P23B 3ZZSA 1RCYA 5AVUB 4D3CL 4TVPD 4AJVA 4CADB 5CCKH 1FHGA 4PRPE 3AVEA 2C3WA 4U3XA 4QD2E 4HPOH 5CP7B 5DSCB 4E41D 4OIIH 5I6LA 1AZBA 1G7HA 3GWJA 4CDGC 3MHZA 3G5ZA 2PPFA 2XOTA 3A67L 3BQVA 3IPFA 2X4SA 3EOAB 4H1LB 2Q9OA 4NNXB 3WS6C 5JIIA 2PR4H 3WFBL 4X7TA 2AERT 3E1ZA 1LO2H 4KC3B 1SPDA 5CILL 3RHWK 4GW5A 4M5ZL 2CJTA 2BZCA 3QNXA 3LIZH 1FFOB 3RZCB 3VQLA 1HOCA 4JY6A 4B9GA 4PY8J 3TVMC 4OZIE 1H8SA 3BKYL 4RVBA 3R06B 4HF5L 3K6DA 5CGMA 5HTSA 4FMFA 3VCLB 1UOWA 2ZF9A 1U3HC 5I28A 2NY1C 2W60B 5I75B 3GMOA 3R4RA 4O02H 2HH0H 3H85A 5FB8A 1BF2A 1LHZA 1HWWA 2PWFA 2B4CH 2Q3ZA 3MNZB 4GEIA 2EKJA 4DUXA 3FQ4A 5KSBE 2HX9A 2GC4C 1Z5LB 1EERB 1MCKA 4RWYH 4X99B 4PRPB 5L4IA 4Y9EA 2WZAA 5TGBB 3L4VA 5TK4A 3U36B 3IPEA 4FQ2H 2Y6TE 3KGRA 2CDFA 4C58B 4M00A 2FBJH 1F6AB 3WLWC 2D9QB 5HHOA 3RZCD 2XV3A 1CFTA 4BV1A 2QV4A 1RU9H 4PJEB 1A3RH 1ADQH 2BNRB 2K9UA 4D7BA 5C7XL 4H40A 1R6VA 3R18A 3EDFA 4XPFL 4B27A 1OAXL 1UWFA 4QUOA 5BO1L 4N5ED 3MO1B 4P2OA 2V2WA 1T2QL 2NLJB 2Z7WA 2K3HA 1QTYT 3OHXA 1FIGL 1CUOA 2UZYB 4RIRB 1JSYA 2EDBA 5C09A 2VDNH 5IOPA 1E65A 1MELA 4LMQI 5HDOA 4DSYA 3VXUE 4ADGA 5EF1A 1G6RH 4N0CC 2CHDA 2SEBA 4XWOC 4P46C 2B7DT 3MLZL 1GMEA 3FOMB 3QJVB 4YPGA 4NJAH 1BQUA 3QUZA 4Z3IA 4K23L 2BIHA 4JFZH 2ZXQA 4KUZH 4HKZB 1TUPA 1BVNT 5FA3B 3ATBA 4WUKH 1IZJA 1DUZA 4F1ZA 4WNJA 2XYCA 3U0PA 4HOWA 3DHUA 1HTYA 2IQAB 1HXMA 3MBWB 3IN0A 1WWAX 4QYOA 4Y1AE 3P9LA 4O02L 4JLRA 3K3QA 2EKSA 3KPSE 5JQHC 4G6ML 2ARJA 2XX1A 3QK0A 3NJXA 1WFIA 3S3CB 5FM5M 1Y0LA 5HJ3B 3RGVD 3UPCA 3Q8CA 3TN0B 2GYSA 4ZOEA 1YMMA 1X5JA 5F7KC 1DEEB 2J6EA 5ESVA 4ZD3L 6CGTA 1TIUA 5HYSG 3VVWA 3QAZC 5E6SB 1BMWA 5DQ9B 2BDNH 1OQXA 3LS4L 4UV7L 5JQ6H 4MB4A 3MLSL 1Q9OA 3Q8EA 3VSTA 3REVB 15C8L 2WAHA 3IU3A 5H4ZA 2QBWA 3VE0B 1CG9B 3QEHB 4I77L 1DLHA 2AAAA 3TT1H 2VQ1B 2WLJA 4OCRL 4QO1B 1T80A 2YRZA 3ZE0B 2YXWA 3LN5A 1EZVX 2AJZB 4NCDA 1J12A 1GL4B 1HZKA 3W57A 3GSRB 3VGDA 1DN0B 4AUUA 1UXSA 3CPLB 5BRZD 2P80A 1KB5L 3GIVB 2CLVB 3PDGA 4B5EA 4TLTA 3UMTA 2N7BA 4ZG1A 4YX2L 4HJJL 1E27B 2Y07H 2KPNA 2EUWA 1DQKA 2KHAA 1X7QA 3ARQA 2A9NL 3F7YA 3QCVL 4FLSA 3UC0L 4XX1E 3ARTA 4A2HA 3RWEB 4Y4HC 1CE1L 2FT8A 5KVEL 2MOVA 4MA7L 4NS0A 1Q94B 1ZGLA 3KW8A 4YBLC 1CXEA 1ZLVH 4WO4C 4WAFA 4Z8FL 3WNJA 1MY5A 2ZF8A 1BZ9A 1SM3H 4N22A 2XWJB 3GTVA 2QPEB 3ARYA 3NJHA 1ZS2A 2NDGA 5F44A 4FFVC 4NENB 4ZW3A 5DF0A 2A9ML 3N43F 1L9NA 4RZCB 5CEXB 2XWTA 1DBAL 2K6WA 2EE3A 3DRQB 2X2IA 5MHSE 1FE8L 3ALXA 4OV6F 4M4RB 3T8MA 1RK1A 3LQAL 2ZCHH 3LDBB 4JMNA 1P7QA 1YNTA 4BQ6A 2DQ6A 2WO3B 3EGXB 5JHLH 1M05B 1WAPA 1VAHA 5AKSA 2OP4L 3MRNA 4H8WC 1VRSA 4OLZH 4Z3GA 4LHUD 3C08L 4UTBH 4X6DE 1C12A 1ZIAA 5KYUB 1Z3RA 4HALA 3WV0A 3MZTA 1DVZA 1J0ZA 1UGNA 1XF5A 4U1LB 1MZYA 4IKKA 3RPBA 1JYNA 3V7AE 5C9JA 5FYJH 1ETZA 3UTTE 5C09B 2WNWA 3V8CA 3WXVH 2J43A 2DICA 1UEMA 1VEPA 4RWYL 3MUUA 3AY4C 2QQNL 3VG0L 4F7TA 4Y8DC 1GS7A 5HYSA 1GXEA 2DQDH 5DHYA 3NCCB 1A6WH 4CJ1A 1QSEE 3QDHA 4LVHC 3O8XB 3BGMB 4WTZA 3TZVA 4EZLA 3H1ZA 2Z0BA 4Q97A 3FJTA 1I9IL 4G8EA 4YBQC 1EO8H 3MCYA 1NIAA 1UZ8B 5D7HA 3V7MA 1RQ5A 4CNIB 4TQEH 3BWZA 2Q20A 1JN6A 5CIPA 5E6RB 4OZGE 2XTJE 4TUJB 5F71A 3EUUA 3U4KA 2JJSA 4HKJB 1T5XB 4KV5E 4EO5A 3G5VB 2WQRA 3HW7A 4RISH 1FFPA 1D6VH 1BD2B 9CGTA 4JM2C 2XWBB 4NRZB 1TOXA 2D9CA 2ZUVA 3LZRA 1H15A 2KLTA 3GKZA 4JNXA 3Q44A 4N0UA 4IRZA 2CRYA 4M6OH 3K6FA 3O4OC 1I3RA 4IRSD 1UWXH 1WLHA 4TUKL 3LEVL 3AGVA 4PV9A 1U6AL 3MV9D 3AW5A 4GKLA 4LOEA 2OFQA 1BFSA 5EO9B 4G80A 1RIVL 5D72L 1AS7A 1A7RL 3O9WC 4HIIA 3SE8L 5T5FL 4U4IA 2V5YA 3SOBL 1WK0A 5CZRA 4HWEL 2GT9A 4YK4B 1UTDA 3LYRA 2YSSB 3UIZA 2YBGA 4MZ2A 3LV3B 4NP9A 5D7LD 5CEXA 4C8XA 4HXAH 2X4SB 2FJGB 3EOAA 2NXYB 3HZMB 3RJQB 2UX7A 3HOGA 1GCYA 4TVPL 4X6CF 4DGIL 2BJML 3KS0J 1G7HB 3BN3B 1WDAA 1UKQA 4NPJA 1INDL 5IUCA 1DJYA 5JO5B 1XGTB 4UOZA 2R1YA 1KJMA 2B1OA 5GGTL 5ITFB 4DPRA 3NDYE 1A6PA 4HUNB 5FYJU 4Y5XB 3T1WA 4JY5L 4YVUA 3Q13A 4JO2H 5D1ZC 4GO6B 5TF1H 1D5XB 1GY2A 1M2VB 4TVPH 5DEFB 4XN4A 2VMCA 5SWSA 1ZHKA 4PV8A 1JV2A 3DETC 3I6GB 1UASA 3S35L 3TT3H 3V4LA 2DM4A 4HJUA 2XTLA 3UL4A 2BP8A 4PD4K 2XWCA 1R17A 2W65B 1EJ6A 3ABMB 1WT5C 1Y1UA 4XCEA 1S8DA 1WBXA 3IDYC 5IMKA 4LSVL 1ZEAH 1OGTB 4OR1A 4MSWA 2B08A 4GI6A 4JG1H 4M9OA 4JO3H 2V8LA 4Z7VE 6FABH 2OTUB 3MZGB 3JWNC 1MLCB 1SVZA 2WTOA 4ACPA 1UATA 4ZFOB 1T1ZA 1U8NA 3K0YA 1TQTA 2GBVA 2Y5QA 1SJHB 2WPGA 3EHBD 3H4FA 5DJ6A 4HT1L 4PCSA 5JHDA 3MCLH 4KKAC 1FO0H 3QQDA 4G5AA 1NBCA 3HI1A 4NO2B 5DD0H 2BCMA 1XGRA 2I07B 4JFXB 5C08A 1YDPA 4D2NA 1AGDB 4A39A 3GUFA 2ED6A 4U1JB 4ALAC 4HEPG 2ZXWB 4BSVB 3DX4A 1QABA 1HHKA 5IB4A 1HYSD 2XPGA 3NYKA 4YSUA 3BH8A 3FN9A 4ZFZA 1O7SA 3FU6A 4RQQB 5JXAL 3K46A 2VKXA 4MB5A 4PGDA 2EZ0D 5DVPA 2ERJB 2HT4D 1JPGB 3LNEA 3Q9PA 3LZPA 3UEZA 1PKQA 1RZPA 5IK3B 1AHMA 5E1GA 2CJUH 3PGDA 1GC1H 4Q4IA 5IMLB 2FNWA 3KXFD 5DO2D 1LO5A 5D7SL 5JXED 5DEZA 2H2SC 1Y18A 5LBSA 4AV4A 5IB3B 4OQ1A 1A6AB 3FT2B 4WHTA 1EHKB 3BRDA 2VXTH 4NT6A 3FOMA 5HJDA 4Z7OF 4M1DL 2E75C 5IHUL 2VE6B 3MRLB 4XH2A 5CAYB 2VM9A 4AKQA 4P9ML 1DVQA 4NQDE 4NKMA 3T8XA 1NA8A 2FJHB 2UXTA 1XCXA 3DMMA 1WC7B 3GS7A 3PWUB 1OO2A 3VTAA 1BSIA 5DD1L 3V52H 1QFWH 4PLJD 4LASH 1TU2A 3IE4A 3V4UH 1EMTL 2VZOA 3L3HB 5ESQB 3WLBB 2FLBT 4XNDA 5BUGA 4HUXA 3HR6A 3PABB 3PJSB 6TAAA 2FJFB 4XPAL 2YD6A 2J1ZA 3NCXA 4D0DB 2RALA 1ANUA 1QX1A 1JP5A 2ZWYA 4PRIA 1CICA 4J5VA 2EO9A 3RVWD 2VAJA 3D33A 4NRXA 4DK3A 5HHPA 4PJCF 1QKZH 1U21A 2W38A 3DBXA 4PRPA 4EN3A 4AEHL 4H0IA 1ZANL 4PJAE 4KI5E 2BOCB 2E9WA 5I30H 2COQA 2IPTH 2ZXCA 3LNIA 5KSUA 1PLGH 2EIEA 4NP4H 2HXAA 2WGXA 2EUZA 2DIBA 4LVEA 2K4WA 3LXBA 2XXFA 4BGLA 1CTMA 3TNMA 2CR6A 4K8RC 4C4KT 3B2MA 2PXYD 4Y16B 2AABH 3CMOH 4QHLA 3PQYB 3GI8L 3H6JA 4F9LA 4B0MB 4CVWA 3Q2NA 1A1MA 1BQLL 5K9KB 2ADGB 1I8LA 2K78A 1E4XI 4H26A 4IGBB 5J6GB 5KS9B 5F9OL 1GR7A 4L1LA 1QI3A 1Z9SB 2IAND 3DX0A 1U8OB 4NJAL 5E2UL 5F8RC 2DQTH 3IGFA 4KZDH 1GPOH 3D52A 1NFIB 4HDIA 1CZ8L 1D9KC 4KKCC 1YNLL 5FAAA 1UA6H 3UZEA 2D3LA 1SMDA 4K5PA 4N0YL 4Y2NA 3UAJD 5IT2L 5ESQA 3KGTA 1MUJA 2X6AA 2KS0A 5FGBC 4ODTL 3Q01A 5HGAB 2AV1B 4KXZH 2OZ4L 3H3BC 4ODXB 4WUUE 2BXYA 4GKOA 5IROA 3RWIA 1ZAGA 1U3YA 3EJZD 3KPTA 3ULVE 3U2JA 2JI2A 4P49A 1HS6A 3BH9B 4G42B 4J8RB 5AB9A 3P11L 4KK9D 3LQZB 1KIQA 3ULSB 4NZJA 4J6RL 3HS0A 3FT4B 2VUYA 3HN5A 3IBOA 3QULA 5BRQA 1DQDH 3HHSB 1EEZB 4ZNEE 3JWDC 2EYRB 4KK8D 1LEKB 5DVNA 4KBPA 3BWAA 4LKXB 4AZ8A 3VWJC 1A7QL 2K4AA 4B0MM 1PMYA 1Q0XL 2AK4D 4LGRB 4OIIL 1ZXKA 3RTQD 4OU3A 4DP8X 1CXFA 5T8IA 1PZ2A 4HPOL 1U91B 1PIGA 4BKTC 3ZL4H 2F7OA 2WQVA 4Y19A 4LSSH 1ZWIB 1KUMA 2WVTA 5DMIL 1A3ZA 1QLEL 2NY0C 3GI9H 5E24E 1T0PB 1FL3A 1U8CB 3UYPB 1NLBL 3ARXA 4U1HA 4Q9QL 2GHZA 3B37A 4MXQC 4ZZKA 5LWYL 1N6QL 1OAUH 1IU1A 1NOLA 4X6DF 2F2HA 5D1XB 1F42A 4F15C 5JXEA 4GQPH 4WCYH 4M1CC 4WKZB 3Q6GH 3HBPA 3OX8A 2P5EE 1TZGL 3QSKB 4HJJH 3BGMA 2R0KL 4G43B 2EXTA 4L0ZA 2C9XA 5JDSB 3EH5B 5GGTA 1G4RA 1JD9A 1MW0A 2A1WH 3TV8A 4IMKC 1J5OH 2WLIA 2LV4A 5JXAH 2ITCB 3US9A 4KKZA 1YNLH 5DHVB 4AE1A 4GKZB 4UT6H 3QFDB 4NKDA 5I9QC 2NY5C 4EIUA 3MNVA 4V2BA 3TPUA 4G8GD 3UO1L 1PIFA 5C0NC 1L9SA 3ZRFC 1JWMB 3PIQB 1TENA 4WO4B 2X89D 4X6CE 1AGBB 4R97C 1QLEB 4YHIB 4XO8A 4MAUH 4I0PC 2XG4B 2Y7NA 4JANA 3FAWA 4DZ8B 5I1CH 5EU4A 3HHSA 3Q43A 4QF1A 3RVXD 3W81A 5E2WH 4DGVL 4C59B 4B9IA 1N5AA 3B8YA 5CJQL 3WE1A 2YD7A 5GRYA 4ZODA 4JFVA 2LAAA 2PCXA 2P8PB 4LRNL 3FF8A 4UILL 4NZRL 3CN2A 1OW0A 2WXPA 4ZQTA 5E4OA 5IB1B 4AWJC 5D7LE 5GRUH 2H1XA 3SYCA 4I9WD 2A0LD 2J4WL 2JJUA 1HL8A 2F74A 5F89A 3VD9A 5AWNH 1OTSC 2FJGA 3KBPA 2GAZB 1Z0NA 3GSWA 3ECWA 5T1LD 3GSVA 4NN7C 5DQJB 5AKVA 3B2VH 3GLEA 3SB3A 5CEZH 1TTUA 4KX9A 1T1YA 2Z35A 2QEJA 2ODIA 3GJEB 3RPKA 4B96A 2P1YA 5JHLA 1TZGH 1P5UA 1EXUB 1RZ8A 4MMXB 4UTBA 5E00A 4AX3A 1ID5I 5T3XE 1D6EB 2IDTA 4QHLB 1LO2L 4PJGA 1GOGA 3TNMB 3GM0A 1CTNA 5T1KA 4U6YB 3POCA 3ZHKA 1G0XA 1SDYA 4N0FA 3C5XA 3K72A 4DKEL 3MBEC 3C87A 4I9WE 3MRHA 1E28A 3REVA 4S0HA 2AXGB 2PP7A 4L3CA 1GA2A 3OKOA 4X4MA 4EXPX 1FG2B 4J3SA 4FG4A 4HHWA 1ZCRA 1AO7B 1MVUB 3MLVH 2UXGA 3GEFA 4HKXA 5ESVB 1NCWL 2MKWA 2NUTB 4AE0A 4TXVB 5EBLA 4XCCL 2WWMD 5JW3H 2BSBA 1P7BA 2LW3A 3O6ML 4CRPA 1IKFH 4FADA 2PXYA 5IVOA 3IN2A 3ULVL 3AROA 4U33A 1K8IB 3NN8B 2FJFA 4DK5A 2HRGA 1I9EA 1IFRA 2ZYIA 4FQXC 2HG5A 2UY6A 1SRDA 5JZ7C 5IQOA 4M6ML 2ZP9A 2QR0B 1V10A 4UI2A 4K2UH 4JPIA 4AYBA 2R7EB 3WAKA 2C9VA 5IVXB 1VKXA 5K9JH 3DOSB 3OR7A 4QAWA 2L0DA 5AW8B 1OTUD 1X6LA 4NM8H 2OW6A 4K71B 4Z7VA 3DJZA 1ODUA 3KGSA 2Z31A 2P52A 3UG3A 3MRIB 4X6DB 4OLXL 4F15B 4FNLL 4PGCB 2R1XA 3EJRA 4X7EC 1M1XA 4XP4H 3LRSA 1H5BA 4K7PX 3RPIA 1UT1A 2J1KA 3BDBA 4I1NB 4WFHE 2EIBA 4ZTPH 1GGCH 3QRLA 4G7VL 1FNSH 3E38A 5BUAA 3ES6A 3L9BA 2D3JA 1Y6KR 3M17B 3NSFA 4POZD 5F9DC 2EIZA 2G5UA 3WHE0 4ZMNA 3IAPA 4L29A 4C4BA 4F8QA 2Y06H 1I8LC 4L1HA 3FUNA 4RQQA 3OPZL 4DKEH 5D1QA 1W8EA 4MCZA 4HIXL 2CGRH 3FTZA 1ZGLB 5FYLL 4XOBA 3GIZH 1I1AA 1QWNA 4XPHL 2AV7A 3A6BH 3HMWL 4KTYA 3PWPA 3ATAA 4PGDB 4PVMA 3FTGB 1D3CA 5GGQL 3ILPB 3UTQB 5H94B 1GZHA 4AV5A 3VXNB 5HD8C 1N59B 4LAQH 2EYSA 3S4SB 2AXGA 3R8BB 3GKWL 4QMEA 5DI8B 4CILA 1BLNB 4W9GC 5BMFH 1GYVA 3K72B 1BPVA 2GTQA 1RUAH 4KI5D 4O9HL 4Q6KA 5F0JB 4DP4X 4U6YA 2F5AH 4W6XB 4XC1L 1A7PL 2XBDA 4NI6A 5EBWB 1ZMYA 5IHWA 1JDCA 2MPVA 1XEUA 3TH3T 1R9FA 4MNQB 4MD5A 3KPNB 4HS3B 1HCZA 2QGEA 5FYKL 3GZQA 1TEFA 3KCWA 4GBXD 4BBWA 4N8VB 4QKXB 4FP8H 3FS9A 4J2QA 4L3AA 5EZLB 4K5OA 3VRIB 1JV2B 2Y23A 2ZD0A 1Q9OB 3AUWB 1QNIA 4KDTA 1CWVA 1GJWA 1W15A 3WUWA 1D5XA 5CBEB 2VM4A 2YJLA 1Z0MA 4TOYL 5BZWB 3IDGB 2F7PA 3D4ZA 2UX6A 2V2XB 4PJHA 5EC1A 4YOKA 2E7CA 3GHEL 5K39B 1T03L 1KJMB 2AEIT 3UTSA 3HNVH 2B77A 5D4JA 4M4PA 3VQ1C 3NQKA 4OZFH 4PJ9B 5HHVH 2OSXA 4G8IB 4WI0B 4UM9A 2FGWL 3L9EA 3MROA 1DCLA 1JNLL 5EO1B 2ID5A 2FIKB 3DX8B 4LSPH 1IC7H 3QQXA 5G2NA 4ENEC 5F7HA 1IC5H 4RAVA 3ZTNH 2MQCA 2WWKT 5B38G 2QDVA 4PJ5B 2DWEB 3V0HA 4IRJC 3RA7H 3BZFA 3HE6C 4HIIB 2DQUL 2VXUL 1CXIA 1OGPA 1UACH 2VLLB 4UNIA 5F7MC 3WO4B 1QYGL 5I15L 3MUHL 2VDNL 1A2YA 3UTOA 3DGGA 4WUUD 1AGBA 4RAUA 1M1SA 2UY7A 1AS6A 3BCDA 3SJVB 4EXKA 1KWGA 3ZQWA 4ONHA 2V7NA 2ZXGA 1EFXA 5I17B 3ULVD 1HX0A 2R29H 4NERA 1HINH 8FABB 2R56H 2VXSH 4UQBA 4FS0A 5E1IA 5IOPB 4WI8A 5EO9A 2IPTL 2ZCLH 3SDDB 2DW5A 2NY4D 1HIMH 5EOCL 1HHGA 1NMCC 1PZDA 2DMHA 3QZOA 2R23B 5CLTA 3CFKA 1OCZB 2H47C 1OTTD 1C5CL 3H7BB 4KJWD 4DP7X 1QLRB 2F54A 3L3DA 4P5RA 5CSBA 4QLWA 5A1AA 4XI5C 5AW3B 4TUJA 3SE3C 2ERJC 5E9DA 1AGCA 2ZKHL 5B39A 2OKMA 2PMZA 3TP4A 3JVGC 2XKSA 5BVPL 3SPVB 1T04A 3D05A 1BFTA 1AE6H 2OX5B 1IAKA 4UYQA 4PS3A 3ZGHA 5L2JB 5ID0B 3PHOB 5AZ2H 3UZQA 1SYSA 2O6DA 2V33A 1B4JH 1XCWA 3MLWL 4FYRA 4NN6B 5HDQH 4JFDE 3E7JA 2YLHA 3IJHB 2H0FA 3MNZA 4PRHD 4GH7B 5IGXL 2MTAA 2E47A 4WZ9A 2P43B 2EDOA 4MCYB 4Z7OB 4YNYB 4D0BA 2HFEA 1LEKA 1C1EH 4KRLB 2R2BA 1SHWA 4OM0H 4TRPL 1OSPH 5C0AE 1KTDB 3J8F7 1MN4A 3MV8E 4ISVA 4WNQA 1Q1JL 2AEPL 1KT2A 3RA7L 3VD0A 4JG0L 2R0LL 3PDOA 2OL3B 3ARUA 4ZMVA 4XMLL 2ITDB 3T6WA 2BCKB 2MCAA 5E2TH 5TE4L 4X83A 3QPKA 1I1YB 2EVFA 1GAFH 5DYFA 1B0RB 4XNUH 5H2BB 3LXAA 2W80C 4JZJA 4YO0B 1DVFC 4W6YB 1NCDL 1BA9A 1CQYA 3DVNA 2FZ3B 4RFNB 4HDIB 5TPWH 1TQSA 2HRHA 3DBSA 1WP6A 3BUDA 1T20A 1XGQA 2C3HA 4R90L 3RWFB 4H26B 5GGQH 3N85H 4FZEH 2X4UB 3WKQA 3WS3A 1RXLA 3LN4A 5ICYB 1JYWA 2FYYA 3IDYB 1WEJL 1UGKA 1RJCA 2FUQA 2YN3A 2BWIA 1VFBB 2XV6B 4YHPA 1I8MA 3VFGL 2XXMB 3ROLA 1E9OA 3D85B 5CILH 4DP9X 1UOVA 1BZQK 4OCXH 5AW6B 3L2NA 3FUEA 3U4AA 3V4VL 1DN0A 2JKRM 4BELD 4LHQB 2D8KA 2OXGB 4MA1B 2ICWI 1YAZA 2GQHA 3WHE1 4RRPM 1CDGA 2J5LC 4ZX6A 5DUBB 3ILDA 4NGHL 1IAII 1IBHA 2EDWA 4LASL 5HDWA 3TO4A 4BFIB 1CD8A 5IJVA 3QRGH 5IJKA 1UXSB 3II2A 4Q7DA 4W9ZA 3V5DB 3DECA 4OKDA 4HYTB 5KYWB 1E4XH 5C09D 3I85A 4GG8B 2NUPA 3SBRA 3TTYA 3UAFA 2B3RA 3PHQB 2B5IC 3FFDA 4CDHA 3ZVVA 2G2RB 5G5DA 2KLRA 4PQXA 3WLBA 1K9TA 1RY7B 2DLEA 4G1EA 1DJSA 3X1NA 4IBWA 3FB8B 4IJTA 3HS9A 3EO9L 3TA3B 1PQZB 1TVHA 2BLFA 3SGEI 2WVVA 3T4AC 3VVVA 1LMKA 5HVHC 2EACA 2C34A 3LSOB 2GTWA 4H2AA 1KLGA 4NYLB 2IPKA 2YWZA 5EEZA 3OV6A 1WFNA 4Z3TA 2DTMH 4PGBB 4AQAA 3H3PH 3ME0B 3Q2CA 3FCGA 3L3JB 1B6DA 1FF5A 2VC2B 1NDGA 5JLZA 2IH1A 5E9DD 1G7IA 5GZND 4NUPA 3I9GL 2HWZL 3IMSA 3SKOB 3FNKA 2BNRD 3IB4A 4PJDF 1CJYA 5EEXA 3FXIC 2IQAA 2OS7A 3MBWA 1SLXA 3CFIC 4KO9A 5EBMB 3ZKMC 2NTSP 2VR6A 4G6FB 3CQQA 1P1ZB 4TNVF 3DVGA 2EINB 3OF6D 2X1WL 2VZ1A 4J12A 3MRMA 2CH8A 4DH2A 1TZAA 2BVEA 1DFBH 4PB0H 5HI5D 2EXYC 4CSPA 3B7RL 1JS4A 5CEYB 1FA4A 5HHMB 3OKNB 5HGBB 3RGVC 5I6OA 2NXZB 3ZX1A 4JKKA 4XP6H 1B0WA 3ABGA 1PG7H 1P9MC 1SEQH 4N2MA 4X4ZA 2QVMA 3LVEA 1OD9A 3CQFA 2CD0A 2OMYB 1BJ8A 5F8QC 5FYKE 1S5IH 1JMZA 2I7SA 1YPZB 2VZUA 1KCWA 1NAMH 1D5ZA 1NCAL 2VLJB 1DQIA 1F13A 4G7RB 4BFIA 2VDLH 2KBGA 1E4WH 1NBZB 4WW2B 5IQ9A 2YRPA 4UT6A 3NSJA 4BQBA 2O72A 5I1EH 4MAYB 1J8SA 1UA3A 5E1QA 4CA4A 1A8JH 2WWKO 1J0JA 2C7FA 2VQTA 3OJDB 2WK2A 4GRWH 3HB3B 4WO0A 1BQRA 1T1WA 2X7LA 1KTLA 2A4CA 1LYQA 2YGQA 2CHXA 3DUUB 2CDFB 2YZ1A 2Q6WA 3EJYD 3WNKA 3DPBB 1UB5A 1U4EA 2Y2WA 5CGYD 3TN0D 4WGKA 2YRLA 1XH1A 2Y7SA 1OAUL 1BIHA 1A1NA 2VDQB 3RUGB 3EGDB 3L7EA 4GRWF 3ZDZE 4BZ2L 4APQA 2DYPD 4Z7IA 1LNUB 4AQ1B 2WLMA 4H2CA 5I23A 2V5MA 3BVXA 4YC2B 1UENA 1FP5A 1MQKL 4C83B 9PCYA 4N0FB 3VH8G 4WFFD 4NN7B 1M7DB 5ANMB 1Z7JA 2DQFB 4ODUA 2NNCA 2AQPA 2EDYA 2VMJA 2VIRB 2ZOTA 3GRGA 5AB2A 4H8PA 5T1MB 5J9PA 1D6EA 1JPSL 2BO0A 1R3KB 4X5RA 1CGXA 4L1DA 1YEJL 2AEWA 4YO0A 3DARA 1EXUA 4R8WH 4EPSA 4XNYL 1JGVL 5EH1A 5KOMC 1RI8A 2YXFA 2HKHL 4AH2A 1OM9A 4DN4L 2BHYA 4X2UA 4P46A 4FZEL 4MA7H 4PRHB 3LKQA 3PCYA 5EU7C 1A7OL 1L4IA 2VLJE 4L4VA 1NICA 1IM9D 3CZNA 4MQXC 1V5JA 4MCMA 4XP1H 4L8SA 1ETA1 3II3A 2ETWA 3HVDA 5J11C 1TQBC 1E2ZA 3IE9A 4Z7VF 3LH9A 3NSYA 5F0MB 4OI8A 3U6RB 1GY1A 1KCUL 2XU9A 4LCUA 1G94A 2HYMA 3CDGB 2JJSC 5CP7A 4IMLB 5HGHB 3FL7A 3U25A 2HJKB 4KKRA 2VDKB 5C0GA 1H8LA 3A4AA 4LSRH 2NPLX 4UOW0 4P57A 3JV4A 2O61A 4OZ4A 5LAXA 1F90H 3OMIB 1IQDA 4RA0C 4M6NL 4WFED 4NI3A 4WV1B 1A1NB 3VFWB 4YWGL 5LBSH 4ABQA 1IAIH 4L37A 1HT6A 1QSFD 1GZPA 2GJZB 4GMTH 2X9XA 2J2ZA 4KDTC 1S9VB 1KXTB 2LQRA 4F8OA 3UC0H 1KGCE 2DWTA 3KWUA 5J57B 5A16B 3MRKA 2L7UA 4YX2H 1QLRA 2F54B 3EBAA 3SE6A 3TPUB 3MLUL 4H8WH 3VDCA 5AYTA 2BIMA 4TM9A 4GKZA 3AADB 3D9AL 4XBPB 2ILLA 1HEHC 4ELMB 3LAFA 1SJVA 1KPRA 2JQZA 3GI9L 5LJYH 5IM7B 4I1PA 4E5XG 4U3SB 2YPLA 1OHQA 1EAPB 3SGKC 2H7WA 2ISDA 1QZ1A 3H2WA 3IT8D 4N2IA 4XVSH 4X7SL 1YLBB 5D7KE 3SGDH 1K6QH 2H2PC 5DFVC 5TJWK 2BH0A 4EUPG 4NLAA 1O9VA 2WB1A 5KVFH 3HG1A 1X6NA 4M1DH 5C6TL 5CS7A 5JNYB 4LOVA 2C9QA 5L6YL 5J11B 5LAXB 2IADA 5CKGA 1FZOB 3EH1A 4N9GB 1PKQE 4DFHA 2GFBB 3GC3A 3M1BB 4KJPD 2X2JA 2CHWA 3S97C 4DHLA 4WW2C 5D7KD 1HE7A 1NGPL 1MCOH 4PAZA 5AW7B 2E7LC 4OV5A 3O2DL 4PJEF 4OZGF 4HC1H 4TPRH 4NWTH 4Z7UF 3UTSB 2J25A 3G6AB 1ONQB 4OZIB 1Y6MR 3BX7C 2A5UA 3BH9A 3FO0L 4G42A 4J8RA 4PJHF 4WTWA 4ANXA 5LQBL 1U8JA 1GGYA 3V6OE 2RCSH 2VMDA 2H0JA 4P46B 4DO4A 3BYYA 5BVPH 1S7RB 4PJXA 4AYSA 4QRUA 1QZNA 1FGVL 1X5KA 2ZKHH 5EF0A 1G7PB 3MV8A 4MFHA 5EN3A 3LH2L 4IBUA 5G5DB 3V5HB 3CPLA 3CGTA 3ZTNL 3QJZA 5E6YA 35C8H 1DUYB 2HX7A 4GAGL 2ZKMX 2E9IA 2QFRA 3GXMA 5DYOB 1NUGA 5D7LB 3CBRA 2DL9A 5I15H 1MHPL 3IJ7A 3WO3B 2YARA 4FEMA 1C08B 2CUMA 5BPPA 4GW1B 5SX4H 3CXHK 3NPSC 4RLDA 3IDNA 1MRFH 3FRUB 3VE0A 3ZYZA 4JJ5A 4P2CG 2Q3AA 2B1HH 2BIIA 4NHUB 1FVCB 2BNRE 3L7EB 2D7MA 3TNNA 5LNDA 3TN0C 5KJ4A 1D5MA 3CFUA 5E6UB 3B7YA 5DA4A 1XTMA 3OZKA 3AREB 3C60D 3IDXL 3QWOA 1JPSH 5LG6A 1JZDC 1NGYB 3IFOB 3ARGA 5DS2A 2NTFA 5J7CC 2F53D 2RA1A 4A6YB 3C09C 1U3ZA 2VNCA 1NMAH 4HGMA 4J3OH 4QY8B 4XCNA 3LD8C 1TKWB 4BRVA 2ENYA 2G2PA 4A68A 4PSRA 4RRPG 3EFOA 3EJUA 5E5MB 5DJCA 2MOQA 3D69B 1EHLL 1KFAL 2AF2A 2GCYB 3GINA 3WSQL 3HC0B 3HZ3A 5IQ9B 2CRZA 1FYTA 2CO7B 2ED8A 3FFCA 1A21A 3KR3L 4YHKL 5IROC 4U0RB 1YPZA 1XV8A 3RQ3A 1D5BB 3L13A 3VG9B 1QW9A 1DJWA 3MOBL 1NDTA 1XB6A 4I3SH 5EZPA 2RACA 3QNFA 4PJGF 1AZNA 3QQ3B 3SYAA 2C3VA 3VFPB 1AHWB 1EA9C 2CCVA 4JJOA 1H3UA 2WLKA 3L17A 5INDA 4FABL 1KBVA 4I1RA 3SDXB 1X7TA 2WWNA 1DQML 1TU2B 1CICC 4YHYB 2EAEA 1OEZW 3U7WL 4LPCA 3O3BA 4QHUB 3MRMB 1S9WB 4WJG3 1PFCA 2E7MA 2IANE 1ZVYA 1I1FA 2QR0A 1JG9A 3FH5A 2YO3A 5I1HH 3Q1SH 4KOCA 1EEUA 1JJUA 2XQYK 5KS9F 3VSQA 2PR9A 1V27A 2NYZA 4OZGA 5DK0B 1NMBH 3SKUD 3RX9A 1WA1X 2F68X 5E8DL 1XB3A 4NYLA 3K1KC 3NFSL 1G7QB 1WUNT 2IALA 3AQYA 1JBJA 1KIRB 1RKRA 5L2JA 2AITA 5DU7A 1E28B 2QADC 4YIQA 1ZA6A 5AD0B 3B7TA 5HXMA 1AGDA 2G60H 3CSPA 3OJ2C 5KW9H 4P5KB 3CVHB 2NUPB 5CU5A 5PAZA 3L5XH 3V0IA 1KULA 1S7XB 4RMWA 4WTQA 4E0RB 2WIIA 4NHUA 3TJHD 3UDWA 3ATFA 3CXDH 1HHGB 1UM5H 2AAVA 4X5XB 5T5FH 5K33A 4GG6E 3VRLE 1DDHA 1P5UB 3QE5A 3STLA 3G6JE 2MHAB 3L7FB 4BK4A 5DYOA 8FABA 4HQQH 3C6EA 1CT8A 2C26A 1RUAL 4I8DA 2FQFA 1RP9A 1YEFH 3VFVA 5B3JE 4X7TB 2WXGA 1YUKB 1Q9KA 1INDH 3ATEA 3UAJC 3F01A 4DJMA 3ILQC 1R47A 1HJCA 3FU0A 2H3NB 3L1OH 4FLHA 3S4SG 2WUCH 2YR3A 3FQ2A 1BXAA 3PXJA 3QDMA 2W0KA 5DZJA 1JV5B 4S1RH 1UYWH 4LARL 4XCCH 4WU5A 3DXAD 5DEFA 5AALA 5HDQL 1TDQA 3VXRA 1NSNH 5C7ZA 1E4KC 3EJZC 2D4FA 1H0DA 3F7RA 3QWRD 4NZTL 3OC5A 3QIBC 1T1XB 3S35H 4OUUB 3G6AA 4PMEA 1AAJA 1MCBA 2GJ6D 3BJ91 4MQTB 4M43H 1AC0A 1NEPA 3EKCA 1NGQH 1F6LL 2VABB 1IFHL 4N8VG 3ELAT 2WD0A 4JANB 1NSNL 2V2XA 3PGFH 1TNMA 1ZTXH 5INCB 2Q8BL 3IMUA 1MFBL 1QSEB 4AIOA 5I6XB 1HU8A 1ZDQA 2FSEA 4A63A 4JDVB 2IPUK 1MCIA 3E2HB 2C7UA 4MXVF 4ONGL 4PGEB 3WO4C 2GIYA 2PF6A 4LLQB 1M57B 2GJ6E 3IDUA 4L3EA 5D7IA 3BAKA 3BPLB 3ARFB 2ADFL 4LZKA 3WCYA 3T65A 3BMVA 4N2HA 2EP6A 2VGLM 4QRAA 1UM6L 2VZTA 4Q74A 4UM9D 4PRPD 1U8LB 3SBWC 4X9HA 1A3QA 5C0DB 1ET5A 4XHQA 5DC9B 1NFDB 3LEVH 1QBML 2WYIA 4GAAA 4R4NC 3SDXF 4L8DA 4BSWA 4HCFA 2Q5BA 1YJDH 2EO1A 5ADOL 1SF5A 5F9OH 2YEZB 3QI9D 5D1ZA 4OCXL 1F11A 2YAMA 4TSCL 3S7GA 2QSCL 5CP3H 3FB5B 3GRBA 2ZOKA 1IEBA 4FFWC 4PJFF 2HLFC 4JN1H 2FO4B 4JDEB 5I66B 4QXWA 3CUPB 1I1AB 3DK0A 2R27A 1E5BA 1OAQH 4TNWF 5F7UA 1J9QA 4NQCD 4TUOA 4YQXH 2HFGL 5DHDA 1EZUA 1IGYB 4GO9A 4KKBC 3VJ6B 3AXHA 5HYSB 5LXVA 1H3GA 2ZE0A 2NT1A 4XPBL 5JHLL 1T0NB 2YGPA 5GRJH 2NY7L 1DBMH 4AG4H 4FTDA 5AZ2L 4HV8A 4F33A 3SCMD 3UO1H 4GT7A 3QBTB 2H41A 2E8YA 3FFOA 1HAUA 3K8MA 3X3GL 1R0AL 4U05A 1G7LA 1S7VA 3QPQD 1QTSA 1Q72H 3BYTA 5I1GH 5T3XH 4BWWA 1QO3A 1TFPA 1A6UL 4LCCB 3NIDF 2V7NB 1SY6H 3ZMRA 4LPYA 4UNUA 1PY4A 2XQYA 1KTKE 1HH6A 2ZZUT 3DMMC 3G04B 3QJHA 4N1CA 5EIIG 3C2SA 4DGYL 2YPVA 4HCRL 2KDGA 3DTUB 2EEAA 5BO1H 3LKQB 5DUML 3DVFA 1P4LA 4LLVA 3QRFM 1U92B 5CFHA 3MODL 3VMNA 4K3DL 3MN8A 3QG6A 1KZYA 3TBCA 1Z9SA 4JPIB 1MEXL 1XMEB 4W4OA 3PP3K 4JQVC 3FB6B 3O11B 12E8L 1S9XA 1AD9B 3S3SA 1H3XA 3VU2A 3IU4L 1SUJA 3NCYS 4XHJD 5K9KA 4P59H 2C1PB 1UA7A 1LK2B 1JZ3A 2HLAB 1BZ9B 5T1MA 3HG1E 5J9PB 4Y19D 5D2LF 4MDRA 3QUMH 3ZHDA 3G9AB 2O6FA 3SDCA 1Q94A 5HYJE 2AJSL 1OF0A 1IFGA 2BVTA 3ZKNC 4PJHB 3NCJL 1SUHA 4DK6A 2IDSA 1BZEA 4Y1AA 4HKXB 1NGYA 4JRXD 5CINH 3EXLA 1QSZA 2VH5L 2ZYSA 1PKOA 1O6SA 5I1LA 3ML9A 2JVUA 4MAYD 2VQUA 2AC0A 1ZRUA 4XOEA 3CQPA 3NP4A 3R1GL 3CZJA 3DXAB 2WWOA 3ZYJA 3PWPD 3ZDYF 4PRIB 1IEAA 1V3MA 1RK7A 4BH8B 5A6LA 3D5OF 1IO4C 1EDQA 4XN5A 4Z76B 1I7UB 1BFVH 2G75B 1AKJB 4K94L 5B38B 2E7DA 3AU1B 3NSCA 4PR5B 3UTTB 1HCYA 1RZ8B 4MMXA 1TYRA 4YHNB 1BLNA 3FQTA 3PAZA 4JEGB 8PAZA 3B4NA 2MRYA 4PIRF 5DURD 2XA8H 1S7RA 1MOEA 3RHWF 4APQC 1XWVA 3VD2A 2Z0UA 2QHRL 5KBLA 3DMMB 3BFQG 3PWUA 3CXFA 5CZXD 3KCPB 4N2FA 3OAWA 1DEEA 2VN6A 3ULVH 1RU9L 3MRQA 4KQ3H 4OFPA 4QCIA 5DZAA 4N0RA 3UTZA 4EDXB 2CXKA 1A6TA 3EOBA 3CWGA 1TPXC 4JPKH 4OAWA 1ZV2A 3VWKB 3W5NA 4I0CC 1WHPA 4MCZB 2CQVA 1Y18B 3L8QA 3PGFL 3QUZD 3TO4D 3WL9A 5IB3A 2EKSB 4GRLB 4IGBC 3TXAA 1N0LB 3BAIA 3QPXH 1AR1D 2ENPA 4MX7B 4RFOH 3V0JA 3IFPB 4UZSA 2DQEL 1IJNA 4JFOA 4U1KB 5C3TA 4KJYA 3F3HA 4DCQB 1FZOA 3TWCL 3IKCB 5KUMA 1D9KD 5GZOC 1HKLL 5FIEA 1KENL 1LO3L 4X6BB 5D2NC 2IFFL 4HHAA 4DETA 1GW6A 2XG4A 2CAKA 2K1MA 4MDJB 4MJ5A 2QDWA 1UM6H 6PAZA 1JGUH 2H0EA 3MV11 4IBLT 4JFFA 4NN5C 1FL5B 3WIHL 1IBGL 4MCNA 4KU1A 2YQBA 2RTTA 4Y2DA 1UCTA 1X9RA 5IFHH 1TG8A 3X14A 1UG9A 4F5CA 2FHFA 4F2MB 2D3VA 5I1AB 3WIHA 1WAAE 1CYXA 1XH3A 1ZK5A 2W07A 3WIFA 1RVFH 1P7KB 2BFVH 4L3ED 3ARGD 2EDNA 1QSED 5D1ZI 4KRPC 4FQCL 5IVNA 2BZ7A 1AQHA 2JCCE 3TIDB 2DQTL 4N2GA 2BS71 3PQYE 3NZ8B 1KIPB 4JY5H