1X9UA

Umecyanin from horse raddish- crystal structure of the reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
b'MEDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Umecyanin
publication title Crystal Structures of Oxidized and Reduced Stellacyanin from Horseradish Roots
pubmed doi rcsb
source organism Armoracia rusticana
molecule tags Electron transport
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02298 Cu_bind_like Plastocyanin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1x9uA00
1AAJA 2YQBA 4W9ZA 2PCYA 4KO5A 3OM3B 1AG6A 1L9SA 2GSMB 2HXAA 4DP8X 2BO0A 3BQVA 3NT0A 3FS9A 1MG2C 4KNTA 3WNIA 1NPJA 7PCYA 4WKXA 5PCYA 3NJFA 1XB3A 4HIPA 3AY2A 2XUWA 3GYRA 3TBBA 4A68A 2FT7A 1OCRB 3ERXA 3N55A 2YAQA 1A4AA 2BWIA 1KDIA 3D12B 2CALA 1PCSA 3HEIB 5B1BB 5B3SB 1DZ0A 4DP7X 3AW5A 1GYCA 1ID2A 1IBZA 2PLTA 2J55A 3FPYA 3QPKA 3ZX1A 1E5YA 2XV0A 2P80A 1A65A 1OE2A 4E9TA 1AQ8A 3EH3B 1L9TA 2RACA 1VLXA 3GDCA 4A2HA 2PPDA 1ZIAA 3CVCA 3NJKA 1FWXA 4BWWA 2IWFA 2HX8A 2XWZA 2UXFA 1ASQA 2CJ3A 4N4YB 4YSCA 1SDDB 2IDFA 2XU9A 1CC3A 3TASA 1AACA 1NTDA 3FU9A 3SBPA 3FU8A 1TEGA 4E9YA 5B7EA 3AZUA 1IUZA 4UAHA 1GY1A 1SHWA 1NZRA 4E9VA 2JXMA 1NWOA 3ABGA 1PNCA 2XV3A 2Q5BA 3X1NA 1A3ZA 4DP2X 4KNUA 2BZ7A 1AOZA 3OMAB 2HZHA 1GR7A 3N2JA 1SDDA 1HAWA 1KDJA 2XXFA 3CDZA 4YSQA 2B3IA 4E9WA 4A2FA 2XVBA 1SHXA 1RZQA 3HB3B 4BDVB 4QLWA 7PAZA 2CAKA 5LDUA 1SNRA 5EHFA 1OCCB 3QQXA 3ABLB 1XMEB 4DP4X 2GC7C 3PXLA 3NYKA 1W8EA 1A4BA 1JVLA 2OV0A 2IH8A 1JXFA 1E65A 1N70A 3WG7B 2PP8A 2DWTA 4Q8BA 2YXWA 5ANHA 1ASPA 2VSKB 1OE1A 1SF3A 1V54B 2TSBA 2YAMA 3FU7A 8PAZA 3NSYA 3U25A 2MTAA 2YAHA 3KW7A 1L9QA 3EHBB 2Q9OA 3TU6A 3DKHA 1OV8A 3CZUB 3EH4B 4BDVA 4DP0X 1BYOA 1AS7A 4KNSA 1BEXA 2EIKB 4GP8B 1J9TA 1BYPA 1GW0A 3ZDWA 5I6KA 5A7EA 4YSEA 2J5WA 4KO9A 2IWKA 3H4FA 4FA7B 4DP6X 2P80D 1OCOB 1AZNA 4YSTA 1NIEA 5D4HA 5I5IA 2UX7A 1JVOA 3FQ1A 1BQ5A 4NB7A 1KBWA 5I28A 2IAAC 2GI0A 2FWLB 1GSKA 1ADWA 3S3BB 4DPAX 3PLYA 1IC0A 2FNWA 2QPEB 1ZV2A 2VW4A 2W8CA 3FSZA 4GYBA 1I53A 4HCFA 5I6MA 1JZJA 3TBCA 4PCYA 3FYIB 4KO7A 4F7KA 2Y69B 2HX9A 1SJMA 3IN0A 2QDVA 1A8ZA 4BWTA 1BXUA 1PLCA 3NSFA 5I6OA 1PZCA 2YAEA 2ZXWB 3IBOA 1X9RA 2EIMB 1L9OA 1HAUA 1JZIA 3AG1B 4YL4A 2N0MA 2VN3A 1W6LA 5B7FA 3T6WA 1PAZA 3SQRA 9PCYA 4BWUA 3T71A 2HLEB 3X1BA 1PZAA 1TEFA 2FQGA 1NINA 1WA2X 4P5RA 3IE9A 4UANA 1NWPA 2IWEA 3QJRB 1A4CA 1BAWA 1MZYA 4ENZA 4X4KA 1QNIA 4TXVB 1J5CA 1L9RA 3NP3A 1WS7A 1WA0X 2AANA 4JHUA 3FPXA 1W6WA 1JZHA 5F7AA 4E9SA 1JXGA 1NIFA 1AIZA 1PY0A 2BWDA 1AS6A 1F56A 1JZFA 1CUOA 1PNDA 4HHWA 3NJHA 4AZUA 2DY2A 5F7BA 2BW4A 3S8FB 4G72B 4KOBA 4A66A 2BHFA 4HALA 2QPDB 4MFHA 1AZCA 4YSPA 3IN2A 5I6NA 2E86A 3WKQA 1IBYA 1BQKA 1RKRA 4YVUA 1UATA 3NSDA 3IEAA 3T6ZA 3QJVB 1WS8A 5I5MA 2VW7A 5I6LA 3PPSA 4N8UA 1PLBA 2HRHA 2YARA 3C75A 5B7MA 1CYWA 2GB2A 4L0PB 2EILB 5TK4A 1BQRA 1HFUA 1GS8A 1BXVA 1CYXA 4A67A 3NSCA 1OCZB 3H56A 3QJSB 1RCYA 4G7RB 5I26A 1E30A 3X1GA 4DPCX 1PLAA 2JFCA 2UX6A 2XV2A 4HCIA 2BP0B 2R7EB 3QJUB 4HCGA 4ZK8A 1AZBA 1B3IA 1R1CA 1TKWA 1KV7A 1TU2A 4DPBX 1MG3C 1PMYA 2AVFA 1KGYE 4AKOA 3FQ2A 3X1EA 3NJGA 3T6VA 3PAZA 2YAOA 2A3TA 1JERA 1QLEB 4CSPA 2YXVA 4FAAB 3OMIB 3PCYA 2BP8B 2GBAA 1NPNA 2X87A 4G7QB 4M4RB 5D4IA 3TA4D 4AX3A 2AFNA 2J56A 2FT8A 3PAUA 2EINB 4E9RA 1NIDA 4W1TA 1V55B 3ASOB 1KYAA 3MX0B 1AG0A 2R7EA 2EIJB 1M9WA 3NJLA 4P5SA 3WI9A 1WA1X 6PCYA 5D4JA 2FJSA 2LLNA 1PF3A 2AZAA 1ET8A 3S3CB 1ILUA 2FT6A 1AS8A 2ZONA 2IDTA 2PPEA 2IDQA 2NRDA 3NP4A 2VW6A 2XLLA 2BP8A 3NJMA 2ZWNA 2HRGA 1SF5A 1YLBB 5I6PA 2I7OA 2XX1A 4EF3A 4JKNA 3H4HA 1IKOP 4YSRA 3ABKB 2Y1AA 2UXVA 3QJQB 5TK2A 1WAEA 2OCCB 4DP1X 4F2FA 1QHQA 4GXFA 3WIAA 1NIAA 2YAPA 2UXGA 3FYEB 6PAZA 3AG3B 1ZIBA 1L9PA 2OJ1A 1ET5A 1X9UA 4BK5C 4HHGA 4GP5B 2GHZA 1GS6X 1M57B 4RH4A 2DWSA 5AZUA 4CSZA 4M3HA 1ILSA 2FQDA 4NAJA 5B1JC 4G7SB 4F2EA 4AI7A 1JZGA 2X88A 3RYMA 1MZZA 1J9SA 2BW5A 5IY5B 3L45A 4WTQA 1NDTA 2XYBA 3ASNB 4GP4B 4HZ1A 2JKWA 1AANA 3T6XA 5B1AB 3NJJA 1GS7A 1N68A 2AZUA 4G70B 3X1FA 1NICA 4K9JA 3UGEA 4HAKA 1J5DA 3FSVA 3FQYA 1ZPUA 3WNJA 2PPFA 4YSDA 3OQRA 2J57A 1OOWA 5B1KA 1OF0A 2BZCA 4Q89A 2QT6A 2PCFA 5B1JA 3V9EA 3CDZB 4A2GA 2CUAA 3ZIYA 1M56B 1ETJA 3NJNA 3SBRA 3NJIA 3X2QB 1J9RA 4GY4A 3CG8A 1V10A 4AKQA 1AR1B 2PPAA 4E9XA 1JXDA 3DTUB 3UADA 4DP9X 2VMJA 3CVDA 4BXSV 3SBQA 2CBPA 1T5KA 3OD3A 2XXGA 3ZBMA 4QKTA 1RZPA 4UF7C 2PP9A 2WO3B 3FU7B 3AG4B 1KCWA 2GIMA 4KOCA 1ZDSA 3JTBA 1PZBA 1XB6A 2W88A 4AKPA 3FSAA 5PAZA 3UABA 4G71B 4YVNA 2I85A 2DYRB 2HX7A 3EH5B 3PAVA 3BVDB 2H5UA 2H47C 1AZUA 2GC4C 2UXTA 3QJTB 4KO6A 1JOIA 2ZOOA 1URIA 3OMNB 4PAZA 2IDUA 1KBVA 2VM4A 1MDAA 2YAFA 1KCBA 3EF4A 1J9QA 3JT2A 1E67A 3S3DB 1E5ZA 3UAEA 3DIVA 4DP5X 3KW8A 4A2EA 2FQEA 1SFDA 2IDSA 3AG2B 3UACA 1FA4A 2FTAA 2WO2B 2DV6A 5AKRA 3WKPA 1ET7A 1JZEA 3ABMB 2CCWA 1XB8A 2PP7A 1FFTB 1BXAA 5I5JA 3S8GB 3UAAA 2BP0A 1AZRA 1EHKB 4BXVA 1NIBA 1EZLA 2DYSB 2WSDA 4YSOA 2FQFA 4A2DA 3GXUB 1GY2A 3FT0A 5E9NA 3MBWB 3G5WA 5AFAA 4YSUA 3T9WA 3CVBA 5FC9A 2B08A 1DYZA 2MRYA 1ZDQA 2PPCA 4NERA 2IH9A 2QDWA 4E9QA 1OE3A 2TSAA 2VM3A 2H3XC 4YSAA 3V9CA 4JHVA 4YSSA 1ASOA 1CURA 2VSMB 3FSWA 2I7SA 1SFHA 2XX0A
chains in the Genus database with same CATH superfamily
3B2MA 2Y22A 1NM9A 4XNBA 1J7VR 1WBYB 5IESL 2AABH 3C60D 3KBEA 3BQVA 3TVMA 3P2TA 1NCAH 1H6FA 1Q0XL 1Y0LA 4QHLB 2DAVA 2CO7B 2WQRA 4Z76B 2ZG3A 4PU2A 3WNIA 3KCPB 4IU3B 3N43F 3NIGF 4WKXA 4H25A 4HW6A 3TV3L 4PJAB 5E94B 3IPEA 3F7YB 3W0WB 3RDTB 1WEJH 4CVZA 3F64A 1I8LA 4IOFD 4AIZB 4DKTA 2LE9A 2B4CL 3KE0A 1C8PA 5TF1L 1AP2B 1U92A 1NANI 1OW0C 5FYJL 2X4RB 4JUSA 4G5ZH 4Z7OF 4LPWA 4XO4A 3LKNA 1CZ8H 2W80C 4M5YH 3JV4A 1KWGA 1N2RA 1A65A 3QWOB 3PAYA 4P2RA 1WFTA 1T0NA 4A2HA 3CVCA 3NCXA 3OLIA 2HN7A 1Q0YH 3FTGB 4LHJB 3SY0A 3N50A 3GUTB 2H41A 4AZ8B 2VDMB 4OIBA 1BMGA 1CF8H 3DX6B 3I50H 4DZBB 1YCSA 4JRYA 4U31A 1UT1A 5BW7A 4IHOB 3L95A 5D93C 4NKIH 4X5XA 4B27A 2AV1A 1NL0L 2CDFA 3EYQC 1C16A 2V3DA 4N0UB 3M88A 4XE0A 3HZYB 3KLDA 4E9VA 1FFQA 1QZ1A 1R47A 1W15A 3IT8D 3T4AA 3CFDA 2GABA 1OAXH 2J20A 4HIEA 3X1NA 5CJQH 4ZFFB 1DSFL 3N04A 3T0EB 5IEHA 2J6EH 2PMZA 3MBED 1DL7L 1I7UA 4LP4A 1FYTA 3L3OA 1SDDA 1HAWA 4QRQA 3QORC 5TE7L 4JFEA 4XN7A 2F58H 1I8MA 1T83A 1Z3RA 1CXHA 3C6SA 5I9QC 3EO1B 2ZSWB 4FA8A 1XR8A 4WIQA 1DVZA 4OV5B 4EUPB 1NBZA 3PHQA 4IOSD 3SE3C 1T5XB 4RGMC 2MCMA 4RNRA 4NC2B 2NXYB 5D7LE 3VG0L 1XTMA 2JELH 3GBDA 5KSBB 3VQ1C 3QYNA 1AYRA 3NSXA 5JHMA 2ENJA 4TQIA 4AH2B 2YRLA 3BFQG 5ANHA 1G7IB 2GQHA 1ASPA 3BPOB 5LBSH 3TVMD 4U1KA 5C92A 2TSBA 4FNLL 3ARBB 3DO4A 5GS0C 4B5ZA 3JWNC 5C0BE 4P9HH 3RY4A 1QHPA 3V6BR 5FGRA 5C0DB 5IBTL 2DQUL 1DQQB 4NNPH 4P57B 1DQML 3O11A 4L8SC 4GP8B 3RBGA 3CBJB 4G43B 3V5HA 2VQ4A 3E80A 5TJWK 4YSEA 4FJYA 3AS1A 1XCWA 3BP4A 4DSYA 1QKZL 4TQPA 1PSKL 1G7MB 4RA3A 3N1QC 3OC8A 5M94B 4N3UA 2AI0H 2FWOB 4W9EC 4FABH 2ZG2A 1AZNA 5KSUA 4P2RD 3VMNA 4C57C 2BVOA 4HPHA 1NIEA 5EWIH 3V0FA 1PU0A 5LXVA 4L9LB 1JVOA 4RISL 4JUTA 3U83A 2ZP0T 3KPNA 3DBXA 1FSKB 3TJEL 2B1AL 2XN1A 3PL6B 2GBTA 5KVEH 2VLKE 3K8LA 4J3BA 3DIDA 4HWBH 4JRYD 2FNWA 5E0QA 3QNYB 4G6FB 3FSZA 1P69B 3H42H 2Q8AH 2NTSP 1UKTA 3BT2H 1NEZA 1A8ZA 2V7NB 3D69A 1UXLA 3DVGB 2WD0A 1L6ZA 1PZCA 2MNJB 1AXSB 2BP3A 4UNTA 2I60H 3IBOA 4MYPA 1K9TA 2YD0A 2AQ2A 3ROLA 5A6IA 2A0LD 1BF8A 2O5YH 1JFQL 3MRCA 4YDJA 3WIFB 5L7XH 2EO1A 2FBJH 5E9DB 1BD2E 3D4CA 3I9IA 4R3SB 3D5OF 3DTDA 4V33A 3H7BB 3MLVL 5HYFA 2BHZA 4GO9A 5ICZB 1ROCA 1P9MC 4HKBB 5GIRB 4JFED 1EEQA 3L6FA 4UANA 5DJDB 2OZ4L 3L5IA 1L9RA 2JJTA 1OF2A 1M7IB 2Z4QA 4R4NC 4AUJA 5LHDA 8FABA 1A2YB 3DX7A 2DJ4A 4KX7A 4Q0XL 1GRWA 4TF4A 5I1GL 4ZMYA 1KGIA 3TBTA 1NFDE 4NUGH 3NJHA 3U1PA 1ZGLA 5HJ3A 3BO8B 1D5BA 3CU7A 1X4ZA 1W8OA 3PXHA 5DURD 4H2CA 1EHLL 2QPDB 3QULA 3HHMA 1XVSA 4IIQA 5EO0A 3WKQA 1BXXA 1IBYA 1PDKA 1H8NA 2C4FU 3A47A 2BM3A 3EO9H 3SYOA 5CCGE 3NACL 4LPUA 3ZHKA 2NUPA 3IF1A 4KMLB 1R5VB 5DJ2B 1A6ZB 4N8UA 4AJ0A 5A2JH 4XN2A 4I2XE 4EEEA 5CEZD 5ID0A 3C9NA 3L4TA 1KC5H 4PJIB 3DXAB 5GGQH 1BVNP 2F18A 2V5RA 4UBDD 4TNFA 4DCQA 5J1TC 5DJ0B 5DK2A 3FUNA 1QX1A 3QPQD 3K0YA 3HI1A 3K72A 4KVNH 5HHVH 1CYXA 2LGNA 2QMJA 3HBQA 3NSCA 2AXWA 3WTUA 4QRTB 2G60L 4JRLA 4WEUD 1IO4C 4NBXB 1Y7VA 3HS8A 4OCMC 4AT6A 3EYVB 1YMMA 1R6VA 2R0ZL 2JCWA 1MOEA 2W92A 3QDJA 3D18A 1OGTB 3WN5B 2XV2A 2CGRH 2BP0B 1CVSC 3HI5H 1CYGA 4HS8L 1K8DA 3BEVA 1KYFA 5EO9A 4R7VA 1XZWA 5CP7B 3HUJE 4HQQL 1TKWA 3LEYL 1MG3C 4NPYB 4Q4EA 4P4RA 4AEIH 1ZHLA 5DUBB 1S3KL 4HXAL 1YSOA 4XXCC 1QRNB 5TDNB 5LQBH 2Z7YA 4Y16A 5K59F 1HWGB 1EJFA 1RSFA 1SZNA 4G6KH 4QEGA 2W9DH 4RZCA 1MREH 4YHZL 2GVYA 2GT9A 5DF0A 4XMVA 5AAWC 5C09E 3U0WH 1YG9A 3BDYH 3U2SA 3PWVA 2R56L 3FSOA 2A73A 2VAAB 1DLHB 3O3AA 4HSQA 4WHDA 4Y88A 5EU5B 3WO4C 3A6CL 2ZCLH 4W9DC 3ZE2E 3F65A 3RWIB 3B2DC 5JQHC 1Q1JL 1DJZA 1W0VA 3MRHA 3MRRB 3OWRA 5D4JA 4Z7NB 5DMYA 2LLNA 4POZD 4V1DB 2BVPB 4MX7A 1PLGL 1RHFA 2AJZA 2HH0H 4KXZI 3K1KC 1V5JA 3S5LA 3MV8B 4BIKA 4RMTA 1H5BC 3FO2B 1UZ8B 4GQRA 4GW1A 1K2DB 4XC1H 2HPTA 1HN1A 4JM2A 4OM0H 4PGBB 4IOIB 4R7DA 4UAOB 3IFLH 1EDQA 4LLQB 1FYTE 1MWAL 4UT9A 3E8UL 1DR9A 5ENWB 5EO1A 3DV6A 3H4HA 1G1CA 4S1DC 5L0QB 1JZ7A 1CFVL 1QWUA 5D7EA 4PHXA 1G6RH 4RFOL 5GQBA 3VAEA 3V8CA 2DTML 3JTSB 5JQ6L 4IRJB 1IQDB 2VYRE 5GJSL 5CCKH 1BZ7B 2CNZA 4M5ZH 1QHQA 5KZCD 4JJ5A 3RVTC 1WFIA 5AVQB 3P9WB 4K8RC 4C56B 5EUKB 1XF3A 4X0KA 3Q5TA 5IT2H 4TTDC 2F5BH 5JDSB 4X5WA 5H2BB 4HHGA 3QDGE 4ZOBA 4X2UA 1WZLA 5EZOH 4AYID 3OX8B 4JM2F 4JG1H 4Y9CA 1YEHL 4F2EA 1HILB 3KVDD 5IB1B 5EPMA 1E9QB 4UDUA 4X9FA 4NCC2 3LRGA 4AQEA 2DLGA 1LEKA 1KGUA 4MGXA 5DRWB 2FGWL 3K6OA 1NH6A 4G1EB 4WI2A 5ADPL 4TUOA 5KWYC 5L9DH 1OWRM 5F6HI 4CC1A 1J5HA 2LTQC 1YMMD 4IS6A 3QDJD 5ECJE 2P28B 1SXCA 4QXGH 2X12A 2BLFA 4FZ8L 3HR6A 3HMXA 5FOBB 4L4VB 1SN2A 1HQ4B 4I8DA 4GPVA 5C3TA 1QZNA 5IK3A 4NCC1 5E5MA 1ZANL 4PQXA 4DHLA 2KI6A 4PRHA 1NCIA 3CZGA 1TQWA 2BVTA 2JKXA 2B7DT 2V17L 3OJDB 1R46A 2JTDA 4I77L 4N2IA 4P99A 4Y16D 5C9JA 2ZOTA 2Z31C 4M61A 5DD0H 4ES9A 1HCYA 5FUCC 4M7KL 4DUWA 4X5LA 2XWXA 5EBLB 4KAQL 3CG8A 2JCCA 4WJKB 1HXMA 4NRZB 3KL5A 2NXZB 3RIFK 1FDLL 4WUUE 3RL1A 4K2UL 1SBSL 3GBML 1DQJB 1CLVA 1AO7A 2J3SA 3ZR6A 4Q6KA 2PP9A 3O3DB 3BLPX 3I02B 3GXPA 1XB6A 1RXLA 3UC0H 2XACC 4XHJC 5G4MA 3BP5A 5F44A 3EDJA 2B59A 1MJUL 3T08A 3MLTB 4FLRA 4JM2D 1GJIA 2UZYA 2ZE0A 1UB5B 4XNYH 1JNLL 2UXTA 1HHHA 1RJZA 1XF2A 4Y4HA 2WXJA 4I3RL 6CGTA 2R23B 1FZJA 2VDOH 2R0LH 1MVFA 4MDJB 2WUCL 4Y5YB 5D8JH 1SFDA 5HHXH 3IJEB 3I3DA 4S1QL 2JCCF 1MIML 3GQFA 4O2CB 3GHEH 2DV6A 3MRPA 3ECBA 5AKRA 2ODIA 3B1UA 5LAXA 4N2GA 4O4YL 2ITEA 3SPVA 4PJGB 5AW3B 3FO1B 5DD3H 2YPLB 3NOIA 3Q9PA 3IGAA 5IROC 3VFPA 4PI0A 3EHBC 3ULSA 3QZBA 1OPGL 1OPOA 4XI5C 4S0SD 1KBBA 1T1WA 2G75B 1MFCL 3O9WB 5T3ZE 4RMSA 3IDJB 2EABA 5E08H 2DEYX 2N7AA 1MFDL 3CLEL 1U3ZA 4P2OC 1S9VB 1CL7H 3LKPB 2YKLH 1DQLL 5KG9A 4JDEB 2AXFB 4KRPC 2QVIA 1RJLA 4N2KA 5ILTH 3B6SA 3L17A 3T0WA 1CLOL 4K0OA 3CVIH 4FFZH 3V0EA 4NUJA 1FG2A 1K4DA 1EIBA 4AW4A 4N5ED 1JPEA 3B2VH 2KYIA 3W9DB 4AL8L 2IMNA 2VQ1A 1E6OH 3VXPA 1AZVA 1QLEH 1ZOXA 3SKOA 4PRHD 3RA7L 3T04D 3G5XA 1MCRA 4MKTA 4PJ8B 5AOIA 1MFAL 3JT0A 1IBFA 3JWDH 3WFHA 5EF3A 2YGNA 4O02B 5HPMA 3AT0A 1P5UA 4YDZA 2JI1A 2QVMA 5JOPD 3DROA 2FT7A 3ERXA 5DUPH 2P5PA 3VGFA 2J7LA 2EC9T 1GTNA 2K9UA 1AO7D 1UJ3B 3ZSTA 4BHUI 2EH8H 3PHSA 4XPGL 1TTUA 2RAMA 2VJXA 2G5UA 3FRUB 1QSFE 2MIZA 4OZGE 2A77L 3I2CL 3I75A 4ZUUB 1TVBB 3M7OA 3D1MC 4J4PA 3GZQA 2EO7A 1WIOA 1BVNT 2W94A 2ZUQB 5G55A 2FX7L 5H4YA 5AB0A 2ZD0A 4OIFA 1WHPA 4Y4HD 1OP4A 1DBAH 3IMUA 1OGSA 5E8EA 5EU6D 5D6DC 5EC1A 3ROOA 3SO5A 1NM4A 4GJTB 1GGCH 4MJ6A 5B1CA 5JPNA 3QAQA 5SWSA 5B3JE 2I07B 5CEXB 4WFFD 3TN0C 1NBVH 3W82A 1HH9B 1D5MB 3QXDB 1NZRA 2F53A 5CMAB 3MFFB 3OXRB 1XCTA 3ABGA 3EJTA 4G8GE 3V6ZA 1U8JA 1E3FA 2MQ3A 2R69A 1MHHA 5CINH 3SPJA 4AEFA 4K9EH 4AMXA 2ALAA 15C8L 2BDNH 2WNWA 1GR7A 2WTPA 1WCQA 1QSEE 3MRFA 5CU9A 3JV0A 2D2OA 1U9KA 5E6SB 4HOMA 5DSCB 1QI3A 1KJMB 2QHRL 3FT9A 3HBZA 4QLWA 2ETWA 4OCSL 2ENYA 3H8NA 5HYSB 1A47A 1XFPA 2DS4A 1TUPA 1BFVH 4C58B 1DBBL 1VF5C 5FO7A 1A9BB 4P5TB 2OV0A 3ESOA 4ZTPH 4PVBA 2ZUXA 4XBEH 1CGUA 1OSPL 1JG9A 1BQSA 3B37A 4NKOA 2ED9A 1TSRA 4F37F 4Q8BA 1LK3L 4TUUA 5J6HB 3OZKA 1RZ8A 4EUPG 2JKRM 5HGBB 2CJUH 1F8TL 3FU7A 3KYNB 4KKBC 4DETA 2WLKA 1HINH 4GH7B 1KTDA 3TU6A 5CEYB 5I73C 1INDH 1T5WA 1W0YT 4IDLA 3CFJB 2Y7QB 3C12A 3LNGA 5DQJB 3WD5H 5JZ7D 3B5TA 3VM5A 3FQRA 2XIDA 4H13C 1J9TA 2BNRA 3EKCA 5ALCH 3KJ6L 2ICWJ 2Q0ZX 5E4EB 1ACCA 4OFYA 1ZS2A 4KMTH 5F97E 5FWRA 1CS6A 5C0JA 4AXWA 4HBCL 1GPOL 1PYWA 5J6SA 3GBLA 1A7PL 1DVQA 4CVWA 4J4PD 5JIMA 1ICTA 1FVEB 2A6KB 5I1JL 1T7XA 5K69A 4ELMA 1ZA3B 3SE6A 3ZE0B 2X9ZA 1BQ5A 2ZF9A 4LCYA 3RILA 1FGNL 1MEXH 2UY6B 2VXVL 5DJYA 3WOVA 5HVHB 1E4XI 3BEWB 4JR9L 3MLUL 4LSQH 1SY6A 2FAUA 4CMMB 2HLFD 4O2FA 1CTMA 4UM8B 3S3BB 2HG5A 1JPSL 4XB8A 1MY7A 3QO1A 4GYBA 1OXYA 1M6OB 5SWSD 3S35X 1U3HA 4HH8A 3NAAL 1W72A 2HX9A 2V7HA 5I5RA 4LLWB 2NYKA 3LVTA 2ZICA 3VTAA 3C6LB 5CUSH 2YAEA 3LZFH 4LE8A 5T1LB 4UU9B 3HLAB 3GSNL 2ZPKL 4DAGH 4PGJA 4KY1H 3QCUL 3B5GA 3S88H 1GCYA 2WOYA 1EXUB 1F2XK 3R06B 2HLEB 4YHKL 1EGJL 4HKJA 3KPQB 2BY1A 1BQLH 3QA3A 1B88A 5EOQH 2KLRA 2H8PB 4BQBA 1BLIA 3FTXA 4OLUL 5CBAA 2EE3A 1CD8A 1ITCA 5HYJB 2B4CC 2PCXA 4HIJA 4J8RB 1LNUB 1ZVNA 2YPKB 3V5KA 1IAIL 5D2NC 2R59A 4DERA 2VABB 4YR6B 2BNQA 1P6FA 1UXSB 4PBVC 4Y8DC 5DLLA 1F4YH 4N9OB 1QVOA 1PNDA 5LGHH 3TA3B 3MLYH 4NNXA 5FYLD 2DLTA 2FJFA 3QEUA 3WGUB 1ONQB 2DY2A 5I0WA 2ICWB 1D6VL 1SQ2N 5IJBC 2YN5A 1BP3B 4WNQB 3EBIA 3CBRA 4ODHL 1X5LA 4KOBA 5IV2B 2FUQA 1I85A 4PRPB 4JFQA 1GZPA 1J1OH 3L5WB 4YSPA 3IN2A 1YN6A 1VZGA 5C0IB 1G5GA 2DQEL 4APQB 1JDCA 4NO0B 4YQXL 2B1OA 4XXWA 4WLCA 3QUMB 3QJZA 1N64L 4Y2OA 1LDPH 4LU5L 4X7EC 2C9UA 4KQ4L 1HSAA 4Y19A 4Z7QE 4F93B 1F4XH 4LVHC 4WEEA 1VRSA 4LIQE 4F15C 1EEYB 4GAAA 1YEKL 2VXQL 2WBKA 3CFNA 4YDVA 3VXTA 3CXHK 4PLKC 4IMKA 1X5GA 3OR7B 5IJKC 3PGDB 1X7TA 1INQA 1I8AA 4FZEH 1HHJA 1HI6A 5HHNA 3MJ9A 3QIUC 3WTVA 4PS8A 2APXA 5B3NA 4HH9A 5DMKA 1BAFH 4WFGE 3BDXA 4XP1L 1IILE 1U3HD 2YZ1A 1KIPB 3W39B 3RZWA 2DM4A 2JB6B 2B16A 4F7EA 4JJOA 4YPGB 5D9SB 5FCUL 5BV7L 3SY6A 4HZLB 3IKKA 1FNGA 3FBQA 3FT4B 4P46A 3FQ2A 5BJTB 3PAZA 3WKML 4J7RA 1UM6L 1AE6H 3X13B 1KPUA 3OMIB 3DARA 2XQBL 2BP8B 2OMUA 3NUKA 4LLDA 3OSVA 5E7FA 2A5UA 4FQ1L 1JIBA 4TPRH 5I8EA 3CE1A 2FH8A 4I4WA 3WIHH 3LKQB 5AYUH 1KYAA 3F5WB 1KIUA 1IGIL 1NGPL 3QQ9D 4HFWA 1M9WA 2G2RB 3S7GA 2IPUG 5CD5C 2DBLL 2VJ0A 3L9RB 2F53E 1MCCA 5KVGL 2FJSA 1JYVA 3KG5A 1ET8A 3NZHH 3TF4A 2IOMA 3KPRA 3GMMB 5J89A 3ZKXC 4O58H 3AQYA 2FR4A 5GS0H 1TFHA 2EIZB 3JWNH 3WY2A 3NP4A 4AGOA 4QTIH 2G0KA 4FXKA 1LO4L 3EFFA 4XP4L 1T66D 4X7FC 4M1GL 3PFQA 2GK2A 4MQ7B 4P3CL 3VGGA 4G8AC 1M2VA 3O6MH 4R8WH 1LQSR 3GSXB 2UXVA 2AK4A 5C0BB 2FLMA 1VACB 1BFOA 3S96A 1U30A 4NJ9L 1ID5I 1FH2A 3OAUH 2DQHH 5K5YA 3CK0L 3EYSH 4MZRA 1J8KA 2P8PA 1WZKA 4YMPA 5IB4B 2APFA 4Y19D 1U8CB 2EYRB 4W4OC 2YLHA 4Y2DA 1TITA 2PO6B 5FYLE 1KSRA 3UBXI 2Y7MA 3WIIL 5AZUA 1FIEA 4CSZA 1CXKA 5ES4B 4ZMOA 5GRUH 1QTYT 3Q05A 1IFHH 1GKOA 3FL7A 4WV1C 4NWUL 4W68A 2L7QA 3DPBA 3UTZB 3KXFD 2WXMA 4Z8FL 2H45A 2XJLA 1JV5A 2ZXGA 4L48A 3SKUD 3QHTC 5ISZE 3A67L 3HZ3A 4JREC 1GZHA 3P77A 4BFNA 2QKIB 4LARL 2VLKB 5K9QI 3T6XA 5B1AB 2BNRE 2PWEA 4LDEB 4G70B 1Z1WA 4LCUB 1CCZA 4DKFL 1XCQA 3PGFH 5IHZA 1LTXA 4CNIB 3T65B 3MYZA 5HGDB 3K4AA 3W5NA 5K39A 1MI5E 2PPFA 2DJMA 1KULA 2WO4A 3NFSL 2PYEE 2L7JA 4OZ4B 4Y9EA 5G2NA 3VXMA 4P46D 3SQOH 1SGKA 3GKWL 3ZRFC 4ELME 5L6YH 1MF2L 2Y7OA 3FH7A 2AEQL 3L3KB 3CVHB 5BS0A 12E8L 2IFFL 5A2FA 5TDPB 5MP6L 1BD2B 3KPLB 2MPAH 4G6AD 3RWFB 2B2XL 3BUYB 3DMMB 3V0DA 5F3BB 1IE5A 4NZFA 3CSYA 4JQXC 5EFIA 4I88A 1N7ML 1UENA 1KF9B 1PKQA 4E42A 4A04A 2V2TA 5LWYL 2XVLA 2ZYRA 4MJJA 4DP9X 2CLVB 1T5KA 3ALPA 4UT6A 3DOHA 4JDVB 1BWMA 4DO6A 1C5DB 2GIMA 4KKRA 4XWGL 3Q1SL 4MRCA 3KPRD 4G71B 4TVUA 3EH5B 1T7YA 1LDSA 4KVCH 1RUPL 4Z1PA 2VDQL 2VDKH 4JQIA 1NBQA 3O6FC 1NFDB 4FULA 4ONHB 3QRGL 4OGXH 4WWPA 3MBEB 3MNVB 2Z35B 1OAZH 1U95B 5I1KH 1J9QA 4GS7B 4Z3FA 5J13B 5IOPA 4AYDC 3GMOA 1UWXK 3B2UC 1D3CA 4G7VH 1RU9H 2ZCHH 2EYSA 2FTAA 3D7PA 3LIZH 3MA9L 3BWSA 4FFWD 3ABMB 1C7SA 3UZEA 4LEXL 2OX5B 2BNQE 2YMOA 4X8JA 1R75A 2E9WA 1IGJB 4Z7OB 1NDGB 2XSKA 2GCYA 4KTEH 3HW7A 4Y2DD 5CLYA 1NKRA 4ADGA 1I1CA 1IM3A 4JHAL 5MEPB 2AQ3A 5JIKA 4YXKH 4KDVA 4BXVA 1EZLA 3MZTA 3QIBA 3JTTB 5DVKA 1WZMA 5HDWA 2FQFA 3TVMB 3BC9A 2BIIA 1Y0LB 5FUZH 1ZA6A 3G5VA 1JK9A 4ERSH 1JNHA 4JW3A 3T6QC 1BVOA 5C97A 4JO1L 1DBKL 2EE0A 3CC5A 3KPOB 1HS6A 1BVZA 3GK8H 4LSPL 4XO3A 2EZ0C 2ICWI 1PFCA 4JHVA 4FQLH 2UY7A 4PG2A 3ZGIA 3AXIA 1MNNA 4KQ3H 1G7JA 1MFEL 2DQCL 3LKNB 4D8PA 1N2RB 3VXMD 1ORSA 1YYLH 1AG6A 2DQIL 4KDTA 4XWOD 1T0NB 4K73A 4ONFH 4WW2A 4K23L 4QRFA 2HN7B 3VFTA 3SD2A 3UTTA 1NGQH 2E56A 5DA4A 5BCAA 3SY0B 4G83A 1KLUA 2NZ9C 4JDZA 1DEEA 1AQMA 5KYNA 3TBBA 4ZW5A 1HL4A 1KYUA 3LCYA 4JFSA 5C0FA 3L95B 5C09B 1DEDA 4X5XB 5DUMH 3EJPA 1OVZA 1C8QA 3AW5A 4DIXA 2OQJA 3QPKA 1IBZA 2PLTA 3AU1A 4OGAD 2AV1B 4MD5A 2CDFB 3ZKSD 4DQAA 2VRQA 4P4KD 2XV0A 1C16B 1OEZW 3HE7A 4JM0A 3US9A 3I9PA 1INEL 3FAXA 3OR6A 4RDBA 5FW8A 3S3JA 2XT1B 2DKUA 4OF0A 4HIEB 3NJKA 4PGEA 4XPFH 2ZXQA 5IEHB 3NZSA 3I9GH 3BRDA 2CJ3A 4WW2F 1FYTB 1ZHKA 2ATPA 1NUNB 3L3OB 1SDDB 4QRQB 5F96L 4CSTA 2ZOUA 2PXYC 4J6IA 4K8RH 4HX1A 4CC4C 3MSPA 5E1QA 1I8MB 2J6EA 3UG5A 3C6SB 3FU9A 1P7QD 1XR8B 3VFRB 4V11A 4RAUA 1KIRA 1GGTA 1NBZB 4LRIA 4OKDA 2YBRB 1NSNH 4AMWA 4HKZA 4TM9A 4RNRB 3T0AA 5GRZA 3SGEH 5J3HD 3RY6A 4NO5A 3B9KA 3KPRE 2CK0H 3PDOA 1Z32X 4TLSA 4U1NA 4DOHE 4JFZL 2BNUA 4IBQA 1IM3D 2F2HA 3L3HB 4UOW1 2XY1A 2OSYA 4B7IA 4KNUA 4NZRL 3QIBD 4JFFA 1KBGH 1BZDA 3KLQA 5KVDE 4U1KB 1ETZA 3CDZA 1CFMA 3GIZL 4WGKA 2AK4E 5E5LA 4GO8A 2KDGA 1WUZA 3L1FA 1FE8L 3CFQA 4F57H 4KQ0A 1CXFA 1SLWA 5AUMA 5LBSA 3X3FL 3O11B 1A4JA 3DUUA 3F62A 3CFBB 1SNRA 4WY7L 2E9BA 2GSGA 3SDYH 3V5HB 3ABLB 1W16A 1N59A 4L8BB 4JZOA 5CGYD 1IV8A 2P5EA 3BP4B 4N1CA 3BRFA 4M48H 1HNYA 3C2AH 3V6OE 4N90E 1AKPA 3DX3A 5KSUB 5I30L 3VXUA 2BVOB 4HLZG 1OE1A 1V54B 8PAZA 1KCLA 5KYXB 3HHSA 3NSYA 4JDTL 4OR1A 5HYSG 1VERA 3OKLA 3KPNB 3DBXB 1M42A 4GSDH 2ZAGA 2XZAL 3DOIA 1AKJD 5K9QG 2BOCA 2DM7A 3ZKNC 5TQ0L 3VFOA 4PCKA 3HAEH 5KOMC 4DO5A 4JFDA 4C59B 3K2IA 1BYPA 4Z77A 3KVQA 4LSVL 4CRPA 4HCRA 2MCAA 5F8QC 1FRGH 1N5YH 1I1FA 4HWBA 1FUNA 4MB1A 1IM9A 3VXME 4OLEA 3RVUD 2L4OA 2F7IA 3ROLB 4DVRH 1RURH 5BS0E 3MRCB 2A7BA 4BCZA 5IBUG 5KYUA 4PMEA 1KB5L 1AQKL 2E9GA 3VD4A 2OMBA 5FWQA 5KBPA 5CBEA 1BJ1J 1J8RA 4F5CA 1RULL 4MA8L 1F2QA 3U6XS 1RI8A 1PKQE 2Y2TA 4EJ1C 5AZEH 5DJCA 1QBAA 4KI5C 3MR9A 4HD9A 4YE0A 3MLPA 1JI2A 3L5XL 2WXIA 2XNAA 5D7IA 4M6OH 1OF2B 2QDVA 2Z4QB 5AL0A 3UH8A 4DK3A 2H3KA 1UUSA 2ATKA 3ZKMD 3NSFA 1JGUL 3DVIA 3DX7B 4A63A 4AL8C 4PS7A 2VDNL 3CFCH 5ICXA 1MCDA 3EYUL 1D7CA 4P5KA 3G5YB 4KBPA 4OFQA 2NY0C 2EDOA 3ZL4H 2Y6TE 3TBTB 4BD4A 1Z3GL 3SHSA 3S37L 5D7KE 3I3BA 4JFFD 1OGAA 1ZGLB 9PCYA 4GLRH 3CHXA 3U4EB 1MRFL 2R0KL 3VG9B 3OPZH 4TNEA 4RAHA 1CXEA 1KIQA 1YQVH 4NEHB 3DX8A 3M45A 3IMSA 3JYCA 1MCHA 1YNLH 3FB5B 4ENZA 1JBJA 5GZOA 1J5CA 4IIQB 4XPHL 4D3CL 3BSZH 3B5HA 1PDKB 1G7QA 2GJPA 3EDEA 4TNVF 1CB4A 4F37K 3FPXA 4TNGA 1JV2B 5KZCB 3O2DL 1D9KA 4AITA 5D7IF 2NUPB 3IF1B 2D2CC 5MEQA 4JFOB 4RMVA 2VXSL 2P5ED 4XMXA 1S4IA 5C7XL 3EUUA 5ID0B 2DJUA 1TJGL 4LDLB 1EHAA 2H2SC 3F2LA 1MVYA 4DCQB 1V7NH 2FBOJ 5DK2B 1MJ7H 3VXUD 2WJ7A 4HPYL 3K72B 4KRLB 1KUMA 2OCJA 3RWEA 4MCYA 1KELL 4XZUA 1QRKA 1YECH 3SZ6A 4UT7H 2N7BA 3NESA 1E43A 1RUKH 1WZAA 5F9JA 3U7AA 4K3HA 2CG9X 2E86A 2G5RA 4EDWL 3V4PH 2PWFA 4IRZL 1I3UA 3WEAA 1YMMB 2BVYA 4JFDD 3IM1A 4XMPH 3D18B 3EF7A 3KGRA 4KK9D 4R83A 4GAGL 4K5OA 3PNWB 4MA7L 1RZ7H 1BW8A 5GZNC 1K8DB 1KJ3H 3BEVB 5EO9B 1IM9D 5HYQA 1C7TA 3TEUA 1TKWB 1VAHA 5DR5H 4P4RB 1ZHLB 3VWJA 4ZAKD 2BCMA 3PP3K 3ZR5A 4Y7OC 2I9TB 1BXVA 3UTTE 1QP1A 4Y16B 5BVPH 2XXCB 2EO9A 4R26L 3LN5B 4AYFA 4B7LA 3VGAC 4UILL 4JZJC 4PW4A 2GT9B 3WCYA 4ANUA 1ZWIA 4X42A 1TQCB 1R3LA 4YS4A 3RJOA 1TJXA 3U2SB 4RA0C 4YZFF 4OZHA 2A73B 2ZUYA 3O3AB 1ZLDA 4IJ3B 5C2UB 4WTZA 2ADGA 2BRQA 3OB8A 5I82A 1W0VB 4QGYA 3MRHB 3NGBC 4GIPD 1KV7A 1S7TA 1TZ8A 2AVFA 3WLWD 1B6UA 5HGGS 3TT1L 2AJZB 5FIEA 1H6EA 3S5LB 2DI7A 1B4TA 1P4BL 4GW1B 4MZ3A 4NN6B 4S2SB 1T21B 4R7DB 1OGAD 4Z95L 2AF2A 4G8GB 5E99H 4AIEA 2GBAA 3P0GB 2QGBA 4PBXA 3DV6B 4MNHB 1OTSD 1OT4A 3BVVA 2UWEE 2HKHL 3N44B 2NY6C 3R19A 3H3PH 5GZOD 1BPVA 5E6YA 4R0LC 5DLML 1ODUA 3V7AG 4K3JH 5AVVB 1MFNA 2FO4A 5D1ZB 4JJ5B 4HC1L 1D9KD 1G6RA 5HDQH 1B4LA 1XF3B 2G2PA 3GRBA 1ILUA 1AS8A 2EQDA 1IAKB 2IDTA 5FW7A 4X5WB 5HI3C 4OLVH 5KBKA 3ARDA 1N0XH 4JFFE 5HGHB 2OMXB 2FB4L 1CIUA 2ZSVA 3ILQC 2AK1L 4L3CB 4X80H 4Z5RA 4ELDA 5JO5A 2HRGA 1ZSHA 3IFOA 1OAQH 1IKOP 4OLXL 3U2IA 4DKEL 4UDUB 3ZN6A 4N2AA 4AQEB 1LEKB 4YFDB 4Y5XA 1WPCA 4KHXL 4IS6B 35C8H 5D96C 1JGLL 1SPDA 2J71A 4P59L 3VVWA 3SGDH 3TCTA 1YVLA 4POUB 3P0VH 1FO0B 5LXGL 3K3QA 2YC1A 4RH4A 3ALWA 5IK3B 4ANVA 1CLZH 1Z9PA 5E5MB 4QWWD 2CGZA 3CD4A 3VWJD 2VN6A 4G7SB 2WHVA 1UUNA 1CDYA 1VGKA 4Y4FA 2BW5A 1RZKL 4M61B 1AIFA 5D2LA 3RWCA 5IUSA 4JO2L 2E8ZA 4U1LA 1YPZA 4XAWH 3ZSSA 2BX5A 2JCCB 4GB9A 1HXMB 4KX9A 4Z7UA 4M7JH 2YSSA 3RL1B 1BM3H 3BUTA 1V7MH 1YYMH 4PJFA 2N7SA 4JRFA 4XNQB 1SM3L 3FQYA 3ECUA 1AO7B 3C8KA 3HPLA 2HRPL 4WWKC 1H0DA 2UUDH 2XPZA 5IESH 3IJYA 2H0PA 1F4HA 1MH5B 1Q0XH 2ADFL 3AADB 4RZKA 2Y7SA 3BP5B 2B59B 1KT2B 4WHYG 1BZ9A 2A9ML 4WSKA 2UZYB 4HIIA 1OB0A 1HHHB 1Q4NX 4F5CE 4Y4HB 4CBZA 5E6IC 4S1RL 1LMIA 1FZJB 2B4CH 2BOLA 3KYKL 5TF1H 1CLCA 5I0VA 2C9AA 4MMXC 3RAJL 1ZGLM 3NFNA 1YPZF 5FYJH 2EDFA 3DTUB 4MXQC 3OF6D 3GEWB 4PV8A 3MRPB 4Z7UF 3ECBB 4JMXA 5I0XA 2Q3AA 4UF7C 4MB5A 3SPVB 5C3IA 1TXKA 2ROXA 4QNPE 5PAZA 2NYZA 4G8FB 4KY2A 4P07A 4V2BA 5E5UB 3IGAB 3VFPB 1R4XA 4ORGA 1AZUA 3DYPA 5IREA 4JGNA 1T1WB 4IRSB 2NUTA 2P8MA 4ENED 2OBGA 1BFSA 2QADD 2VM4A 4P2QA 1JGVL 4IBSA 1GKEA 1MQ8A 2NNAA 2J4WL 1VEPA 3MOQA 3SGJC 5ACZA 4A2EA 3U0PA 3VH8G 4QY8A 4FKKA 1MCIA 4G1MA 2WO2B 3SJVD 1JYXA 1J10A 4L4JA 2ALWA 1EWHA 1RJLB 3FKUS 3B6SB 1XB8A 2DWDA 1FFTB 4GMTL 2YQGA 5JW4N 2Y72A 4IK7A 2XWRA 3IMVA 4H1LA 3VNYA 3X3GL 1FG2B 1K4DB 5BV7C 1DSFH 3LN4A 2H32H 5I2IA 3HS0A 4WK0B 4Z7QB 4N0FA 2GIXA 1E8XA 2VQ1B 4NM8L 3SDCA 4FFZA 2ZOKA 2WSDA 3KM1A 5TE7H 3SKOB 5EA0L 4PVNA 5FV1L 3G5XB 1XL4A 4A2DA 4ZS7L 1I1YA 4JQVA 3GM8A 4G9FA 3BZFA 3OAZH 3ZDYF 5FC9A 5AW9B 2R1YA 1DYZA 3TP4A 3VJ6A 4NT6A 5DHEA 5HPMB 4Y1AA 1P5UB 4K7PY 1OGPA 5J12B 3DROB 2XZQL 4JY4A 4DT2A 2VM3A 4DEWA 5FKAB 4MB3A 1CDUA 1B3JA 3FSWA 4Q9CA 4AWJC 3TZVA 3SO3B 2IAMA 1T89A 1T2JA 3HN5A 2V5SA 5L88L 4GQZA 2WINA 4FNLH 4PRNA 5BZZA 4W9HC 3DJSA 3I75B 4X4ME 3FHAA 1DANT 2R4RL 5IBTH 3RZCC 1JTOA 2W9EL 1UC6A 2DQUH 4ICXA 4DNLA 1DQMH 1FCCA 4XVUC 3RX9A 1CICC 1TCRA 1IEHA 1JVKA 4FE9A 3FQUA 4PWJA 1BZOA 3S48A 1CDIA 4ZS6D 5E8EB 4HIPA 5EC1B 3ROOB 1QW9A 4NKIL 3DRQB 2UZIL 2MH4A 1S7WA 1XEDA 3H54A 4OZHE 1FZOA 1QKZH 5JPNB 3S36L 1PSKH 3H3KA 5SWSB 4U6TA 2QFPA 1PCSA 2CCLA 1OOAA 2KHAA 5I74B 4DGUA 3GS0A 2LW3A 2F53B 1HXKA 1QO3A 2Z7UA 1XCTB 1W0WB 2N3JA 4KJQD 4RISH 1WTGT 3D4YA 1KZYA 2YWYA 5HHMD 1L9TA 2QR0A 3NJXA 5T5NG 3TJEH 4Z18A 1HHIA 2VISB 1U8JB 4NQVA 1MHHB 1PD0A 2Q6WA 4BWWA 3SCMD 2HX8A 3A22A 3ZDZF 4P2QD 4FD0A 3CN3A 2Z0BA 3OAYH 4N4YB 4YO0A 3MRFB 3R0MA 5AVXB 2JVUA 3RUGA 1CC3A 4MSWA 3TO4C 4WI9A 4BSWA 2Y5QA 4LKCA 3UGUA 3ULUF 5JW4Q 2P5WA 5DWUL 2A1WL 2D0HA 1JFQH 3UEQA 5FO7B 4HU8A 2X70A 4CGTA 4IOFC 3WHXB 1XIWC 1CQYA 3IJSB 1VB9A 3MLVH 4PEEA 3TC9A 3SDCD 1RLWA 1N10A 2Z0UA 4OFKA 5J6GB 2R0WL 1RZ8B 4N2NA 2IBZX 3BKCL 1WAPA 5KSAA 1AOZA 4MNQA 2OZ4H 1ACZA 2KL6A 4HPOL 4GI8A 2CBQA 5D1ZI 1KTDB 1UXWA 3ELQA 1E50A 1UWGL 2VGLM 1T5WB 1QEXA 4R2GB 4JMNA 4AC4A 3LZOA 4MAYA 2VSCA 4Y1AD 3WTWA 1JPTL 2OJEA 1KLFB 1MW2A 4Q0XH 3KH4A 4HSCX 2FYYA 4X4ZA 5I1GH 1DP0A 4U1GB 2BNRB 3APNA 5AYQA 5GS1A 5EZJB 2IH8A 4L8DA 4LEBA 3TZVD 4YHNA 5GRWA 4I1PA 1TYEB 2ZP9A 5FV2A 3WG7B 4AXWB 1MI5B 5C0JB 4B96A 4YOKA 1EHLH 3K6SA 4B97A 5KJ4A 4L5FE 4U33A 1SF3A 1F90L 2P24A 3AROA 3GSVA 4I0CC 4ELMB 2PR4L 4GNKB 5D2LE 4LCYB 5BVJB 5DJYB 3NACH 4BE6A 3VYPA 1R3IL 4GRLC 4O2FB 4OCRL 3VD3A 1MVUA 2HG5B 1U8MA 1WP6A 4PJFE 3QFDA 3QO1B 1U3HB 4R6UA 3SKMA 1W72B 1E40A 2V7HB 1A3RL 4UTAA 5F0JB 4YX2L 3LPPA 2VQUA 3QZWA 2CUIA 4NO2A 2I32A 3DJRA 2AXGA 2FEEL 1XZ0A 3ESPA 1S7SB 3N0PB 3PYCA 2EC8A 3CH1A 2G60H 3MC0A 1XXDC 5T1MA 1COBA 4N0YL 1W9XA 2E9IA 2KLSA 4FJ6A 4NXKA 5C7ZA 4NFDA 2ROYA 1S5HA 3D39E 1NEZG 2R0ZH 4CUCA 2Q87A 1BMWA 1JD7A 1GSKA 4FI7A 3ZIMA 1IJ9A 5C0AE 3M07A 1Y1DA 4ODUA 2PW1B 5AENA 2X2JA 4HS8H 4GOSA 4N2DA 2X4NA 5CBAB 3IXTA 4XN9A 1CVRA 1IIIA 4HQQH 4HIJB 4LCCC 3V5KB 3DHPA 1BECA 5ERWA 1S3KH 4HXAH 1JUFA 5F6IB 2BNQB 2CKBA 3FQTA 3IMTA 1WJ3A 1G4MA 4MQXC 4WQOA 5KVFE 3Q9QA 3UZVA 2WVUA 3HBGA 5C0EA 4YHZH 2XVKA 3QEUB 3CPLA 4OFVA 1DFXA 5IVOA 5KSAD 4MNQD 4ZQKA 2GEQA 3ZK0A 1CK0H 1RUQL 1NWPA 4JFQB 1GZPB 3A6CH 2DF3A 2EDBA 1Q1JH 1G4RA 4MAYD 5EEZA 2WWNA 1PLGH 4KTYA 4WFEE 4Y2OB 4DN4L 4U6VL 4I85A 2BWDA 5BPPA 4L2LA 1EUUA 1E4XL 1HSAB 1BF2A 4GKSA 1ZLWK 1MWAH 1VADA 2EDQA 1OW0A 2YSTA 3E8UH 3P3UA 1TMQA 3BZEA 3LRLA 4AZUA 5SX4H 1ZVYA 1CE1L 2Q76A 5BOPA 1XGTA 4YJZL 3EDFA 3L48A 1CFVH 4RFOH 3VXTB 1XTLA 1XGUB 2BHFA 2WZAA 5FKPA 5GJSH 5JQ6H 4G9FE 1IE4A 5JTWA 4WU5B 4ZMPA 1INQB 3FQ4A 1HHJB 4YBHA 1HI6B 2Z8SA 5HHNB 1F41A 2ZUUA 2PTUA 4HH9B 1D2OA 3BH4A 4XE5B 2YUWA 4Y9BA 3COOA 2EE6A 5I5MA 4I1NB 3NTCL 5CKGA 5HDRA 3V0VB 2BHUA 4LL9A 1ZLEA 4GBXB 2C9PA 2XWDA 5B7MA 2DI9A 3GMRA 3KWWA 1YEHH 1BGXL 1FNGB 4F8OA 4ZXBD 1NMCB 2PCPA 3GD1C 3DV4A 4F9LC 2FGWH 3BWZA 5ADPH 4GAYA 4N2EA 1KPUB 4A38A 3GIVA 5T3XH 1E9PA 2OMUB 5D5MF 4QYOA 2ID5A 4XCNA 4FZ8H 3QORA 4I4WB 5FECB 2OSXA 5BZWA 3LRSB 3TH2T 4FOMA 1KIUB 1LILA 2AV7A 1HKFA 4HCGA 4HFWB 5DTFA 3T1WA 2X6CA 1ZTXE 1AZBA 1ZANH 3SE3A 3WIHA 3FZUC 3MYJB 1OSEA 2X4QA 5D1XC 5C9KA 2V17H 4M8QA 4I77H 3KPRB 2B1HL 3HPJA 5D1QE 2WXFA 4JGMA 4DOHB 3VFVA 2FWSA 1FBIL 4M7KH 1JI1A 4KAQH 4N8VG 2HVKA 4UQCA 3EFFB 4OKVA 1EJ8A 2X87A 4M4RB 3RUGE 4K2UH 1M2VB 1SBSH 1UWEL 4RBPH 4M8UA 3GBMH 3MRMA 1ZEAL 2AK4B 1F13A 2BY3A 2V8MA 1WFNA 1BFOB 3APDA 2P5WE 1W91A 3UXFA 3ZL2A 2H9GA 2A9CA 4L8SA 1MJUH 1E8YA 5CFHA 4M43H 2P8PB 2WXGA 1JCKA 4HUCA 5SWQA 3VFWA 2RGSA 1JNLH 1QUNA 2XPYA 4BZ2L 2AC0A 2N1KA 4OCWL 4UMGA 4I3RH 3R1GL 4EKJA 3DPBB 4EF3A 1S7UA 1H19A 2PNDA 4S1QH 1MIMH 3TIEA 3AUVA 4RSVA 2WJ5A 3DK2A 3QJQB 3AXHA 4K4KA 4OJFL 4O4YH 3P77B 4KK8C 5DHYB 3DO7B 3SE9L 1CU4L 1VGEL 2NNCA 4OCXL 2VE6A 2VMCA 5KJ7E 1PIFA 3ZL1A 4UOW0 1XCQB 4JL1A 1OPGH 2A83A 3LZNA 4NP9A 4TVPH 4BK5C 3RKDC 2BSCA 5K39B 3U30B 1MFCH 3BXNB 1CE6B 3EYQD 1LO2L 5EIIA 3CLEH 3CTTA 4HEME 3GGWA 3U7WL 3VXMB 4JK0D 4ODWB 1FAKT 4HAGA 4GW4A 1MCEA 1SJVA 2Q3XA 2XN9A 4ZYKA 1J11A 3PHAA 5BS0B 1DQLH 1S7QB 1RUML 5IY5B 2O1AA 3MU3A 3ZXAC 3F7KA 1H15A 4AOFA 2V9RA 4KXAA 2D4DA 3IDNB 4BZ1L 1KCRL 3QP3A 3QORD 1P9MA 2ZNWA 3NJJA 4TSAL 3SKNA 3W2DL 1MCOH 1PKQB 2V2TB 2YD2A 4E42B 4P04A 4AL8H 3QUYC 3KYOA 3VX1A 1QYGL 4Z9KB 4FMKA 5B1KA 4UV4L 3LQAC 4ANKA 3CHPA 1IBGL 1MFAH 2KZWA 5FK9A 2EICA 3IJHA 1ITBB 2KERA 4K7FA 4OSUL 4DUVA 4LZKA 1VZHA 3U1QA 5J56B 1UADC 4WVRA 3RWDB 1GCFA 3ZQWA 4BFJA 2VIRA 1AH1A 1J9RA 2VLJA 1ESOA 3NBNA 5GS0D 1TPXB 2JJSC 1PX3A 1M53A 2FH6A 3UCQA 2FGZA 4E9XA 4XPGH 2EYSB 1KCVL 2BOBA 1OT2A 1NFAA 5GGSY 3RWHA 3WO3B 1CG9A 2UZXA 2WXOA 2A77H 2XXGA 3I2CH 4ZO6A 4QF1A 2BC4B 4X8JB 1KY6A 3IWVA 4DWHA 4D0CA 1PZBA 4F2MA 3LIZA 2FX7H 2C1OB 2GCYB 2X9XA 4YVNA 2Z65C 2E7CA 1IM3B 1LXMA 3VSUA 9CGTA 4FI8A 4PWFA 4OGYL 3QIBB 5JLZA 4N2LA 1AMXA 1X7SA 3GBNL 3OQ3B 1ZA6B 3G5VB 2YGOA 1JK9B 4L2YA 1NCDL 3BJ91 3K2UL 5EEVA 1JNHB 2EACA 4X8XA 2OMTA 3CC5B 5DS2A 3BZ4A 5IFJA 4HLEA 1VEOA 5KBMA 4L4TD 2NSMA 1ECYA 2XG4A 5JOFA 2Q7YA 3LV3B 3QZMA 1NCAL 4LLYA 2NY1B 5KYWA 1T7ZA 3SYQA 3X12A 15C8H 3KZ8A 4HUVA 4D8PB 3JVGC 1NIBA 3BVXA 4XX1G 2DYSB 5T33L 5JIQA 4YSOA 4CW1A 2HT2D 2OXHA 3LPGA 5DD1L 5MENA 2YIHA 4TSCL 2XN9D 5CCHE 4XXCA 2DICA 4ODXA 2QHRH 3VFTB 4YSUA 4Y5VC 4OCSH 3UTTB 4GAFB 3GSQA 1IB5A 4Y7MA 1RZJL 1KLUB 3A4DA 5IEKA 4JDZB 1DBBH 2A6DB 1DEEB 2TSAA 4X9BA 2C7FA 1XGPA 5AAWA 5E7BA 5C0FB 4IEFB 1OSPH 1X5ZA 4YSSA 2HKFL 1NKOA 2OMVA 2OJZH 2YPVH 3SYPA 4ZMWA 2OQJB 3AU1B 4MD5B 4BUQA 1D5IL 2ED6A 3ISYA 3HE7B 3LN9A 3OR6B 1QASA 3FS9A 4DEPC 1UEMA 4JS7A 1H5BA 1CBVL 1BG9A 1U6AL 1DVFD 2QFRA 4PGEB 1JRHI 4G82A 2VLJD 4YIQA 3UJIL 2ATPB 2PW2A 3SPGA 3KJ6H 2FIKA 3GJFA 2AXHA 2JK5A 3ZRCC 1PJ9A 2UWEB 4HBCH 1GPOH 1OO2A 1A7PH 1BQUA 1AGDA 1KENL 3ZX1A 2UYLB 4HKZB 3F01A 3MFGB 3EJCA 4NO5B 5I1JH 3B9KB 4PJXA 1GAFL 3PDOB 4U1NB 3ZTJH 1WFMA 2BNUB 5C08A 1KN4L 3WY1A 2WN3A 2VXVH 4JR9H 2WZ5A 3MLUH 2OTWA 4X9YA 4GKZA 5JPMC 4JFFB 5AQ0A 4TQHA 4M93C 1JPSH 1RZKC 5E2WL 3O81A 1ETZB 1CPUA 4KXCA 2B77A 2NLJA 1U8PA 2W65A 1M7XA 3NAAH 4NQXA 4Z3TA 3CX5J 2JELL 3W1ZA 2MHAA 3OKMB 1TEGA 3MCLL 5AUMB 1A4JB 3DUUB 1TSHA 1YNKL 3M46A 3RTQB 2GSGB 3GSNH 2ZPKH 4UIKL 4JZOB 5C6TL 2XN2A 3QCUH 4MNGA 3D33A 3OG6B 4MA1B 4YHKH 3ZO0A 4XPBL 2VLRA 4Y9FA 3NG5A 4F80A 2TAAA 3OMAB 4NNPL 3N2JA 5MEND 4JPIA 4OLUH 3HHSB 1OAYL 2B3IA 5CN2A 1JF5A 1TIUA 4ONGH 1IAIH 2AAAA 2AW2A 4AMKL 1U91B 2NSQA 3VFOB 3NPSB 5E56A 3QG7L 1JDAA 2CRMA 5CILL 4FABL 4Z77B 8CGTA 1R34A 1A4BA 4FI6A 2KC0A 2NY3B 5EWIL 3HNVL 1D6VH 2NXYC 2D0GA 2DLIA 1I1FB 3IMRA 4M3JA 4A1RA 3P3SA 1IM9B 5K1VA 1FCGA 3GXMA 3QC5X 2YAMA 5K93A 5MI0B 1Q9WA 5KYUB 1OAJA 2DQEH 2JQMA 1XSIA 3G6JF 2Q8AL 4ZMZA 2EVIA 2M83A 3QHFL 5I1HL 1K85A 1N64H 4OLYL 5DEZA 1O5DT 5CM1A 4KNSA 4S1DD 4LU5H 3VX0A 1PVHA 4AK1A 3VI3E 5AAMC 3VTMA 5DZ9A 4H0LC 4HHAA 3MR9B 3HZVA 3QGVA 5DEFA 2XNAB 5D7IB 3QH3A 3RVTD 1J8HA 2ATKB 2OMZA 5CSBA 2AJSH 5L7XL 4K8RD 1YEKH 2VXQH 2WTRA 3VXNA 1RD6A 4LBAA 4AV4A 2XA8L 5JMRA 2Y0SA 3HIZA 5ICXB 2G2NA 1HZHH 4P5KB 4TTDD 5C08D 5ADOH 4YDIL 3IDGA 4GXUM 1UVQA 4OCLC 5K33A 3E9UA 4BGDA 2GITA 4L9LC 1OGAB 3WDHA 4MYWB 2FWLB 1BVLA 3IS0X 1F3JA 1O75A 5EUOF 2SODB 3DX8B 2P7TB 4P2OA 3SDXA 2AJUH 3FYIB 4JFPA 5FCUH 2V5YA 5BV7H 1G7QB 3IN0A 1S8DA 4QOKA 2WP3T 4NUGL 1PLCA 1D9KB 2PWDA 4CVXA 4EQ3A 5IKCA 2WKGA 2ZCZA 1UM6H 5HSFA 1L9OA 4M1DL 3BSZA 3B9AA 2XQBH 3AG1B 3DOSA 3JUZA 1JJUA 5K9JL 5B7FA 2VLRD 1NBYA 1G9EA 2DWXA 4S1SL 4FQ1H 4QXWA 5E2TL 1AOHA 4AYSA 1XAUA 3EO9L 1IGIH 1NGPH 3RWEB 4MCYB 4CU6A 4YBLB 2Z31D 2DBLH 3MRLB 1QNIA 5DRNA 5F9JB 2X6BA 2B9BA 4WTXA 2ARWA 3HN3A 3DGCR 3QUZC 3SDXF 1W6WA 1YDPB 2QPSA 1U33A 1JZHA 4GI9A 3BYTA 5ID1A 4FFYL 2WMPA 3DX4A 4UUJA 1X4YA 3BHBA 3VRLE 4UQEA 2ZX7A 1LO4H 4XP4H 5HYQB 1BIHA 1YN7B 4M1GH 2OSWA 2EDNA 5F7BA 4P3CH 2NX5D 5KBLA 4XHJD 5EIQA 3VWJB 3S97C 4ZMLA 3KPTA 3FCBA 4CU8A 2FBRA 2K45A 4PRIA 4MS8C 3L2NA 1JZ2A 3CK0H 5JHAA 2CGRL 1EMTH 4YVUA 5D6DA 3AWEA 5I16A 2ZZUT 5C1MB 1O7VA 1HCZA 1R3LB 2NY7L 2YD9A 1FC1A 5EN2A 2ICCA 3KJ4B 4OZHB 4H44C 4XCEA 3MV7A 4AUYA 2COVD 2H1XA 1IGCL 3B1TA 4YFLI 2F8IA 1J8HD 2ADGB 3OGCA 3TN0A 4WHTA 1EBPA 4B60A 2DH2A 2CDEA 4G42B 4NWUH 4TQEL 4L05A 5ESVB 3RIAF 1S7TB 1PG7W 2ARJQ 4Z8FH 4OD2A 5DQDL 5FR3A 1BQRA 4M9OA 3A67H 5IROD 1SXNA 3EHBD 3BP7A 3HE6B 1KG0A 4UIMA 4XI5D 3U0WL 4LARH 4CBPA 4DKFH 4LVOB 2VCOA 2WQUA 4Z7AA 1IGML 2HYMA 2K6WA 5EZPA 5KANI 4PM1A 2GPZA 4AIOA 5BUPA 3PUCA 4P2OD 2GJ6A 1N3NA 3NFSH 3H6JA 3KLSA 2ENSA 3F85A 3L1GA 4L37A 4GXVL 3WN5C 5AB9A 3VFMA 4KRPD 2WWKO 3WN6A 3GKWH 4XC1L 1UJTA 4PJXE 1G6RB 4DGVL 1MF2H 2X28A 1B0IA 2A9DA 5J11B 2AEQH 3BAXA 4AKOA 12E8H 2IFFH 2WTOA 3CU1A 5MP6H 4GI6A 2B3RA 3ARDB 4KKLC 1QWHA 2B2XH 5DQ9A 4OF8A 2ZSVB 2I9LA 4Z5RB 1BBDH 3Q7JA 5JO5B 1NPNA 1N7MH 2R9HC 1B9KA 5JQIB 4M5ZL 5LWYH 4FQQA 3POCA 3FT2B 2Y1VA 3UJJL 4Y5XB 1XGQA 5IT2L 2WUBL 4M56A 4GUQA 1SXZA 2QV4A 4XWGH 3Q1SH 3LH8A 3NJLA 3UTSA 2F8VA 4Z7IA 1LO3L 2YA2A 4LLAA 1U3YA 3QRGH 5AKSA 4BBWA 4EI5C 5JIPA 2K6ZA 2YC1B 1WDAA 4ZD3L 1I3GL 3ETBF 4XHQA 3II2A 4PJEE 1KMGA 1UM4L 2XWTB 5L9DL 1HEJC 3GF8A 3BGMA 3FUKA 1TZOA 3ML9A 1VGKB 4Y4FB 2YGVA 2Z64C 3LEVL 3MA9H 4PRID 3ZUCA 4OZFG 3DX2A 5TK2A 3FFCD 5DZAA 5FUCE 5D2LB 4LEXH 4A2LA 5I0ZA 4DP1X 4U1LB 6FABL 1YPZB 1IC1A 4K7PL 4IRJC 3RTLA 2VN4A 5D4QA 4ZSOA 2VC2B 2YSSB 4PGCA 4PJFB 4KX8A 1YEDB 4JHAH 3QAZB 3N9GH 3HPLB 3C8KB 2L8AA 1H0DB 2VL4A 1JNJA 2X9WA 3W37A 3ZTEA 4OQTL 2G5BA 3AQZA 4WF7A 3UYPB 3F58L 3BQUC 1OTTC 4WI8A 1IZKA 3KGTA 2E27L 2LVEA 4HIIB 5TFSL 3EGXB 4OJCA 1JF1A 1DBKH 2AEPL 4W9KC 5H35A 3QVAA 4IW4C 1NJ9A 1YHPA 2AZUA 3Q8CA 1NICA 1YUKB 3UGEA 4X6CE 5I1LA 2DQCH 1MFEH 3KPSA 3MLWL 2GIYA 5F9AC 1LE9A 1S78D 4POYA 1OOWA 2Z91A 2DQIH 5JHDA 3WENA 1XD0A 4GSQA 3LNEA 1UOLA 4ODBD 5D2NA 1RP8A 3R18A 4A2GA 4K23H 4U0RB 4EPSA 3V79C 5AD0A 2PN5A 1LM8V 4ORGB 5K1NA 1K5NB 3VGHA 1FNAA 4ILDA 4XXDA 1FC2D 2P8MB 4IU2A 4M6ML 2R51A 4QHNA 4KKBD 5ALBL 2NNAB 2YLKA 4X4XA 4OZIA 4XCFL 5J1AA 3U0PB 4QY8B 3WEXB 4G1MB 4QOKE 4PB9L 2NXZC 3MRBA 3MRJA 4W9LC 1INEH 4PJCA 4HKXA 2NW3A 2JE8A 2DWDB 3UTSD 2H0JA 3T2NL 4H1LB 2YD7A 2E7DA 4U2YA 2ADYA 3UABA 1SMDA 3LN4B 1TLKA 4UTBH 5I2IB 3HS0B 3CMOH 4JO5A 4N0FB 1MDTA 2GC4C 5F96H 3PQYA 1U0QA 1UEYA 2DQGH 2YKLL 2EYTA 3EF4A 4TVSa 3DURA 5H37G 3TBVA 1I1YB 3FUDA 4PJDA 5IJKA 4PBWD 4G9FB 3O4LA 3BZFB 4A55A 1FZMA 2R1YB 3SYAA 1MUJA 3VJ6B 1PS3A 3QIUA 1JZEA 2GI7A 3BSGA 4JFZH 2OSLB 4JY4B 2OL3B 3MJ7B 5GRYA 4PJCF 1SOQA 1Q72L 3BN3B 4TOYL 5I76B 4JVPA 2AKRA 1WZ1L 1UACL 4NZRH 4MLSA 2IAMB 1ADQL 2PABA 2QGDA 1NANH 2IGTA 1MJ8L 1XL6A 2WINB 1IKNC 3GIZH 3RDJA 1VKXB 1TJIL 3QUKA 5GGTA 4F8LA 4Q6IB 3DETC 1GXEA 4DPRA 3ZDZB 1P84J 3QDHA 2NY5L 3X3FH 1BMZA 4KNQA 3P1VA 4HJ0C 3BESR 1TCRB 4PJDF 4WY7H 1ZLUH 3FQUB 3L1OL 1CFQA 2NYYC 5FAAA 2HT3C 2G3MA 1FNLA 3QCVL 1HOCA 1S7WB 3MV7E 1FZOB 3KPSD 1JGDA 4LCWE 2XTJC 4LL4A 5I30H 4GSUA 3ULUL 3V55A 5FYJD 4W9ZA 4JDTH 1QO3B 2ATAA 3ZYJA 3E2HC 1ECZA 2EDEA 5FM4A 1JHKH 1YNTB 3B83A 4DP8X 5I1DA 4C4UA 4YAQB 2QR0B 4F8PA 2XZAH 3PV6A 1HHIB 5D1QB 3R4RA 4NQVB 4X7CC 2Q6WB 4A7QA 4PJ8C 1NMBL 3T2OA 1E27B 4UQ3A 4JRXD 4P2YA 3MUJA 5T3ZL 4LSVH 2QSQA 4YO0B 5LBGA 1F4WL 1I4FB 2GJ6E 3RUGB 4OT1H 4XP6L 5KN5A 1AGEA 5JA9A 5CSGA 4BSWB 1P4IL 1WLHA 4WKZA 4LKCB 1GYUA 3CLWA 2CALA 3MJ8A 1DVYA 2MKLC 1FFRA 1X9LA 2P5WB 5C6WH 3ZPDA 1UJ3C 2ED8A 2JKJA 4GRWE 2X70B 4KKCC 1AQKH 3STZA 2RACA 1RZFL 2XOTA 3CHSA 1RULH 3L3GA 3PQYD 3T3ME 5AVZB 1HCVA 2DYPD 2ZUQC 3DGGA 3VDAA 4OUUA 5KSAB 3LB6C 4MNQB 4WV1A 4PLKD 4MVBC 5AOJA 4PS4L 1O7DE 5A40E 3O4LD 4PJBA 3L5XH 3L3IA 1UXWB 2XCMC 3M8OL 4JO3L 4WI3A 4OY9A 4WJG3 1WFOA 4JFHD 5EZLA 5FA3A 1XSOA 4QXUH 1JGUH 4OBSA 5BMFL 4I3SL 2OZ4A 2OJEB 1KTCA 1PZ5A 1IUZA 2VDNH 3GTNA 3DO3A 3EYUH 4HYTB 3TJPA 3UTSE 4BFGA 1A6VH 4GEIA 4JM4H 5GS1B 3S37H 4L8DB 2CJUL 2X42A 4MHHI 4YHNB 2ZWLT 4OD1L 3PWUA 1MRFH 3L3DA 2R0KH 3GXTA 2V3FA 4E0RB 1YAZA 1INDL 3ZRSA 3K6SB 3TV8A 3LNHA 2P24B 1UH4A 3GSVB 2HVJA 4D3CH 4XPHH 4P0DA 2WLLB 3ZZQA 3O2DH 4PJBF 3LZLA 2CAKA 4N6RA 3DVNA 1MVUB 2VXSH 1KJ2L 4PJHA 4JQXA 5C7XH 1HX0A 3G08A 3QFDB 3ZDXF 2JSFA 1TJGH 2F5AH 3SKMB 1JXFA 2I27N 5CD5D 3QZWB 4PWHA 3V0HA 4HPYH 1MNUL 4NO2B 2WK2A 2AXGB 4H8WL 1E2VA 1XZ0B 5I19H 1AC0A 1WC7A 3ILPB 2A74C 1ULVA 1QR4A 1TQBB 3D25A 4Y2NA 2EXWC 5CU5A 5CIPH 5T1MB 2Q9OA 3DKHA 3KBHE 4XPTH 4IRZH 5SX5K 4J28A 2QL1A 4DP0X 2YUZA 2FO8A 4GAGH 2EIKB 1U8NA 4ODUB 3DHJA 2Z4TA 1AGFA 4L3AA 2X4NB 3IXTB 4FYTA 2DD8L 4PJHF 2Y07L 1GA2A 1TFPA 3TPUA 5JHDE 2IF7A 4TUKL 4KRNA 5E8OA 5D2NE 3LH9A 2ZXBA 5ERWB 3MXWL 2EVGA 5E4EC 1S5IL 2CKBB 3FQTB 2M26A 3UZVB 3C5SB 5D4HA 2UX7A 2FWUA 2NNRA 1QR1B 4UILH 3CPLB 3TPKA 3D8MA 4N20A 3I6KA 4ZQKB 1MCLA 4W9JC 4H40A 4JGUA 4OZIE 2WBXA 2JIXD 1RZJC 1EV2E 1SMAA 2WQAA 1XCXA 2WIIB 3CZEA 3GTTA 4NCDA 4BFIA 1JYWA 3ESMA 4GQPH 1I53A 3CNKA 3L7FA 4PCYA 5J57B 1F4YL 2GJJA 1DDHA 4K5NA 4PJ7A 3TT1H 3ARYA 3EBGA 1QFWI 2WAQA 4I0PC 4LLUB 1P4BH 3BMWA 3KM2A 3RNKA 3T4YA 3KLHC 3HMXL 1UWXH 2ZOWA 4Z95H 1S46A 3BZEB 1VADB 3C8DA 4H2AA 5LO7A 1T1ZA 1FO0L 3QC6X 1GOFA 2Q76B 1XGTB 4QXVA 4RGNC 5AWNL 2IALA 4Y1TA 2HKHH 5FKPB 1MWAA 3IE9A 5DLMH 3GB7A 3QWRA 3UFIA 4JFHE 3BKML 4J3UA 3O41A 1YQ2A 3BD4A 4HC1H 4NHCL 3SGKC 3OWEA 5C07A 3EJZC 4JHUA 1WICA 5JUEL 2AJVL 1HJBC 4H88H 7CGTA 3QXTA 5DMGC 5I1EL 1AS6A 1F56A 1N4XL 4X7DC 5LUMA 1JZ5A 1CI5A 4N22A 2FB4H 4QLRA 4WJ5A 1URZA 1YC7A 5E4IA 4XCYB 3GMRB 3U7YL 1U58A 1YMHA 2YD5A 4Y0GA 3L2LA 4AYMC 1J9CT 1YY9C 3MNMA 1UZ6E 4OLXH 4DKEH 2C3HA 4GG6A 5GSVA 1DBML 1KNOA 3B9DA 3DV4B 4HWZB 4GAYB 4C4KO 4DUXA 3OBAA 3GIVB 3O6FD 5AVYB 2ADIA 3ET9F 4QYOB 4KRMB 1JGLH 2C7UA 4JE4B 4XCNB 1QI5A 1TCMA 4ZUWA 4P59H 3HA0A 5DJ8A 5BZWB 2PXYA 2YR3A 3B2UD 3H55A 1UCTA 4MS6A 4APQC 4CC4A 2FHBA 3PPSA 4A39A 4Z78A 2AV7B 1O6TA 1TG8A 5DTFB 2FX8L 1CYWA 2JF1A 2ZOLA 4OAWA 4YGAB 3BAIA 2X4QB 4KROC 4AV5A 2C9RA 1GS8A 1RZKH 3EG9A 3FFOA 2D8KA 3VFVB 3D34A 4KXZH 4JO2H 4MAZA 4GG6F 2E7BA 4FA6A 2HVKB 4D9QE 1YEEL 2AJYL 4OKVB 1HYSC 3FC8A 4J3OG 4WTZG 1DJGA 3O6LL 3VFUA 4MXWL 2IANA 3UO8B 1SM3H 1IL1A 2XWJB 3MRMB 3U36A 4Z3HA 2HRPH 2EXSA 3RVWC 2B15A 3UBGA 4H8VA 3AGWA 3DNKA 3KEHA 4WZ9A 2XRAL 1X3DA 2ADFH 2VZSA 4L8SB 2A9MH 2EZ0D 4QTIL 1CLYL 2ZX8A 3VFWB 5IB2A 5SWQB 2CD0A 3IYLW 2X4UA 4NBZB 1XAKA 2RALA 3WTTA 3PWJA 3WHE0 1OT1A 4S1RH 1PX4A 3KYKH 3UP6A 3RAJH 4G7QB 4LIQL 1S7UB 3TYFB 5ABZA 3APCA 4DW2L 3QWRD 2FX9H 3TIEB 4TQ8A 1QPKA 4ZAKC 3AJ7A 5E9DE 3VRJA 1J18A 4IGBA 4KKAC 2Q10A 5HPOA 3AGVA 2MNUA 2NZ9D 1S9WA 4JPQA 2J8HA 1BIIA 2VE6B 3GSRA 4LBEA 3WI9A 4MJ5B 4D0BA 3PWPA 1UB6A 3P4LA 3VGEA 4YDMA 5B38A 5A2KH 1R24A 2FT6A 3FQWA 3MV11 5F7FA 3TFKC 3B7UX 1XO8A 1JGVH 5EIIB 3GGWB 1FFPA 4LVNC 2E4FA 4KJPC 5TQ2L 4GW4B 3CXDL 5F3HA 4LO9A 1JPFB 2XN9B 4ZYKB 2Y1AA 2H6UA 3NJVA 5CF3A 1RQ5A 1H15B 4GMTH 5CO1A 5DJ6B 3U4AA 3SKNB 3X3GH 2PXYD 2JTYA 2YOCA 1B90A 1ACXA 5T3XD 2CHXA 4ZFOA 3VI3B 4MCNA 3KYOB 3SQOL 4PCSA 4NM8H 4CN4A 5EA0H 4J27A 4FNRA 4HA1A 4EI6A 2Y1ZA 5JW3L 4ZS7H 3SBWC 4MMYA 1ILSA 1PIGA 3IU3A 3QRLA 5FK9B 4D9RE 3HZMA 4Y4KD 4K5PA 4YUEL 2H2PC 2BFGA 1J9SA 5JNYA 4PJIE 1AR2A 4GFXA 2QJDA 3S37X 3H9HB 1ZKAA 1TZHA 1DLFL 2XZQH 4K5LA 4PBDA 2VLJB 3OKDB 1FIGL 2IAND 3VD1A 4K94L 3UEZA 1GS7A 3HHRB 2IVFC 2QKIC 1KV3A 4L3FA 1IKFL 2BOBB 3RWHB 4F58L 5L88H 3MBXL 3O8XA 1CG9B 1ZPUA 2UZXB 2VWEC 4BQCA 4KI5F 2R4RH 4U6HA 1RK1A 1O9ZA 2W9EH 4ATTA 3W11C 1UD3A 5C0CE 4XVOA 4UQBA 2E7LC 3VI4F 3ESNA 1HWWA 5HDOA 4R7LA 4TLUA 5FYKE 1SN0A 3U9WA 5E1IA 3BZDA 4MJIA 4PR5A 3WFZA 5JR1L 2UZIH 5JLZB 3X2QB 1HDMA 5KSVA 1FNEA 1GL4B 4W6YB 3S36H 4U1IA 4U05A 2Y6SC 3DMMC 1D6EA 1J05A 2O61A 2VSDA 5BRZE 3CVDA 1XH3A 3D87B 2J2ZA 4PJ7E 3ZKND 1E2ZA 2X40A 3OLGA 3CQQA 4G8EB 2CNYA 1RP9A 2VN7A 4JB9H 3VXOB 3QFJD 4YXKL 5IFJB 3IDXL 4FDWA 2FD6L 1FPTL 3NH7L 2XG4B 3T1FA 5DJAA 3US1A 4LLYB 5KYWB 4HUVB 5GZNA 5FUZL 5IMMB 1URIA 4CW1B 3GJEA 1KB9J 5C0GA 4U6XA 4V1DE 5JYLA 2H1PH 4S0TD 3KPMA 1MCPL 5MENB 3KW8A 3JZYA 2ZKXA 3GK8L 4GS7C 4H1LG 3GSQB 5C07E 1MCQA 1U8OA 1G6VK 5DWUH 2A1WH 3DK0A 5IEKB 3ETTA 4JZJA 2CCWA 3GSUA 2PP7A 3NCJL 1XGPB 4QUOA 2IADA 1NGZA 4KI5D 5E6RB 2QSCL 4DEUA 2E0PA 3QQ3A 2OMVB 3WO4B 3JV6A 5E24E 1SRDA 3BJLA 3UTQA 2R0WH 3BKCH 4ONFL 3BH9B 1JD9A 4HPOH 4BM7A 3A4EA 1ZT4A 3B7SA 1UWGH 3L4CA 4JFYA 3ZE1F 2NY0D 1EHXA 1H5BB 1JPGB 2Q2LA 4H0HB 4LLMB 1MCWW 1JPTH 3HG5A 3LJ3A 4Z0XA 3O6KL 5DUML 2PW2B 4L3EA 4BH8A 3PP3H 3GJFB 2CSPA 2JK5B 2WN2A 3NIDE 4NKDA 4NP4L 2SEBA 3GZKA 4LASL 1F58L 3BI9X 4X99A 2XXMB 4FG4A 1AGDB 4MBRA 1NQBA 1DFBL 3N91A 4U1JA 2OYLA 3WAKA 1F90H 4WO0A 3EJYC 2PCYA 4OUOA 1EFXA 3I9GL 4PJXB 2PR4H 5IR1A 3D09A 1QA9A 3SOBL 4OV6F 5C08B 3WKYA 3IBEA 5FF6A 5F7MC 1R3IH 2H2SD 2OTWB 4OCRH 4GKZB 2HG0A 2NLJB 1U8PB 3WYRA 4ODSH 2W65B 2JKLA 3N1MC 4NQXB 1MLBA 4I13B 4YX2H 1A1MA 1QG3A 1T6WA 4PY8J 1ZV9A 4DH2A 2MHAB 1S9YA 5KS9A 2WXLA 4G59C 3W57A 4CADB 3DYMA 2LTQB 3FUIA 5AG9A 3BT0A 4LNVA 4M02A 3LVEA 2X2IA 4P3WA 2I25N 4MNGB 4N0YH 2FJGA 3TURA 3FT3A 5GZND 2DQDL 4IBWA 1V3JA 3GDCA 3PRZA 4U1HA 3GSNA 2IWFA 4N2MA 1DO5A 2C3GA 2J8UA 3MRIB 3LKRB 4PJEB 4PRBA 3P9MA 2IDFA 1LEIB 2NTFA 3H53A 3TLRA 1CR9H 1EGJA 1Q9KA 4WWID 5EC2B 4PVMA 2CPCA 2FL5A 1Z2KA 4EXKA 5J4MA 2L3BA 4ORZC 1GY1A 3PWPE 3C2AL 1E4WL 2P44B 1JRHL 4WEMB 3G6DL 3QJOA 3R8BB 3OLEA 4WWKA 5ANMA 3P0YL 1KTKE 3CBKB 3PWLA 3GINA 3ZTNL 4Z7VE 5DFVC 1RUQH 1A1OA 3JQOB 3N1GC 5IIEA 3QRBA 4NUPA 2DMGA 1MIEL 2J8UF 5IFAL 3Q6FA 1HQRA 4AQOA 1EAJA 2PF6A 1B2WL 2MKWA 5E6IA 4ECNA 3SCMC 4U6VH 1E4XH 1WGOA 4MMXA 5IHHA 5JR1H 3OHXC 1A6TA 2NY6D 4HHAB 2J12B 1FL5A 3EJQA 3HZVB 4E41D 1WYJA 2HCZX 1CE1H 2WLJA 3VXSE 3BUIA 3QH3B 1J8HB 5I0DA 3CLFL 3NEXA 3TCXA 5CZVH 3VXNB 3SB3A 3RJDA 4C8XA 1D7FA 2GFBA 3QI9C 4E9LA 2QEJA 1SXAA 5HI3D 3GM0A 3IDGB 2AJXL 2CDGB 2APTA 1UVQB 3EHBB 3HNTH 2VXQA 2ZNXA 2GITB 4HBQA 3ILQD 3WDJA 3WJLC 3UOAB 2OW6A 3BAEL 4RIRA 2D7QA 1OCWL 1CFSA 3V4VL 4I87A 1BVLB 3HCVA 4WO4D 2ZAHA 4PD4J 3NVQA 5FFOA 5BNXD 5I1AA 3NTCH 4LOUC 3SGJA 4P2OB 3SDXB 4LRNL 3LDBB 1G1YA 1S8DB 3AXLB 3H1ZA 1BGXH 4QOKB 5DJZA 4NOFA 3TYGL 4FHKA 3TNNB 3B2PA 2A6IB 5GS3A 1KZQA 1KTBA 4AW7A 4OGZA 2PTVA 2UVEA 3JWDC 2XWBA 1KJVB 2XQYK 3AAZA 3DOSB 3OPZL 3FOLB 3DPDA 3V7MA 1NBYB 3CDGA 3FONA 4JKLA 1UOKA 5E2UL 4BUHA 4ZPTA 2OFQA 4MJIE 2JLPA 1YNLL 1E5AA 3E3QC 1WAAE 2QHLA 1T20B 1MJJA 2K4AA 3OAYK 4PH8A 3OKEB 2G30A 1ADWA 3S9DB 2J88L 4GAJL 4XB7A 5DRNB 3TBCA 5IZ7A 4FG0A 1XD1A 4F7KA 1FV1A 1SJMA 5AOKA 1NAML 1BEYL 3DJTA 1YEFL 1BXUA 2B1HH 2X2UA 3QE5A 3ULUC 1FBIH 2R1WA 4C47A 2WMPB 1U93A 3CGTA 4UUJB 2UZPA 1ERNA 3BHBB 3NIFF 4H7VA 3VSVA 2VN3A 2Z1KA 5HP5A 2NNFA 3T71A 1UWEH 1PZAA 1ZEAH 1EEZA 3GMLA 3R7RA 3V4PL 1OAUL 5F1NB 3V0JA 3RZCA 2P3YA 2KT6A 4XMUA 3BIAX 3MVSA 1A4CA 1WBZA 1J12A 4PRIB 5FYKU 5E6ID 5ETUB 1ZT7B 4ZNEA 3K4ZA 2AANA 3UDWC 1KJ3L 1KFGA 4Q9RL 1KXVC 1HC1A 1LO5A 4F92B 4BZ2H 1NIFA 5EN2B 4R90L 3ZT6A 4XOCA 4XCEB 3MV7B 4MXQD 4OCWH 3S36X 4ETQA 3CC1A 3EOTL 1DTUA 3R1GH 5LG6A 5MERB 3TN0B 4WHTB 4YC2C 1WO2A 4KV5E 1UA6L 2CDEB 4LCWB 2IMMA 3WJJC 1RLBA 1HYRC