1X9XA

Solution structure of dimeric sam domain from mapkkk ste11
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
LPFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the dimeric SAM domain of MAPKKK Ste11 and its interactions with the adaptor protein Ste50 from the budding yeast: implications for Ste11 activation and signal transmission through the Ste50-Ste11 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase STE11
total genus 9
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1x9xA00
2FE9A 5JTIA 2EANA 1RG6A 4MHVA 2QB1A 4NL9A 2DKZA 1WWUA 2Y9TA 3SEIA 1SV4A 4NJ8A 1SXDA 3BS5B 1PK1A 1WWVA 3K1RB 5J8YC 1LKYB 3TACB 4RQNA 1SXEA 2QKQA 1V38A 1UQVA 2ESEA 2F3NA 2EAMA 1SGGA 2KMDA 2E8NA 3KKAA 3HILA 1DXSA 1F0MA 1X9XA 4IS7A 1SV0A 3BQ7A 2L5YA 2K4PA 2E8MA 5F3XB 1X66A 2EAPA 2F8KA 2GLEA 3H8MA 1UCVA 5KNIA 1OW5A 5L1MA 5J8YA 2JV3A 3BS7A 1PK3A 2KSOB 2KE7A 3KKAC 1PK1B 1B0XA 2LPEA 4NL9C 1JI7A 2F44A 1X40A 3TADA 1COKA 3SENA 2B6GA 1OXJA 2E8OA 2D8CA 2DL0A 2EAOA 2Y9UA 2D3DA 2YTUA 5JRTA 4PZNA 2ES6A 1B4FA 1LKYA 1V85A 1KW4A 2KIVA 2E8PA 2QB0B 2QARB 3BS5A 2K60A 2LMRA 4RQMA 3TADC 2KSOA 2QARA 2KG5A 1Z1VA 4PZOA 2DKXA 5JU5A 1SV0C 3IDWA 2QB0A
chains in the Genus database with same CATH superfamily
4PL2A 5J0WA 4DFMA 1Q8KA 2LI6A 4C4TA 3RH5A 4JV2A 4GLXA 3D2QA 3WKEA 4NJ8A 2OXOA 5J2HA 4FO6A 3OJSA 2K8AA 1N2XA 2P35A 1ZQLA 4ICAA 3QU9A 9ICQA 5AKIA 5KT4A 5L1KA 2P6UA 5KT7A 2DWQA 1ZYQA 3BQTA 4C8NA 1L8LA 4PL1A 5KFAA 4J9QA 2C2RA 3A0HU 4I2BA 3LDAA 3I76A 4KLGA 1S76D 4GIBA 1TVAA 3AQFA 3RBEA 4B9NA 2G5IB 4DSIA 4A8EA 1DGJA 2V4RA 5DLGA 3RJHA 2C2EA 1ZQBA 1B43A 5KFKA 1UT5A 5EE9A 2C2DA 1PK3A 2ZIXA 2ZG6A 2KSOB 3KKAC 5AKKA 2AGQA 1B0XA 2W3RA 5KFOA 3OHBA 4ACOA 3V72A 2UVRA 4RQ6A 3AMZA 2BPGA 3L5KA 1JIHA 2K4HA 2NRTA 3M6ZA 1JXLA 1KFTA 3IG5A 5KFDA 3D2NA 3RJFA 3E58A 4NY8A 1X6IA 2LYAA 2NRZA 4KN7A 1B4FA 3IV6A 3BZCA 3GILA 1NK8A 1YZ6A 5AKZA 3RB3A 3NTUA 5DG8A 2WF8A 2R8KA 4Q8EA 5EE0A 4XQ8A 1ZQKA 1L3TA 4RT3A 3KZIU 2W43A 4UQGA 2W8KA 2W04A 1SL1A 1T7PA 4IQWA 2QB0A 3RRHA 3RJJA 3IM1A 5AI4A 5CWRA 1Q46A 2RDJA 2F1JA 7ICLA 4ECZA 1XS9D 5AM2A 5AM5A 4RQ2A 1FEZA 2DF4B 1RQNA 3QUCA 3MDCA 2KV2A 1V38A 1QCKA 3SAHA 3TKAA 5ALPA 4QZHA 4EEYA 4RQ8A 3QNMA 4BWJA 3HILA 4IL6U 3SD7A 2BQUA 1U9LA 4Y2SA 4M6WA 2PFOA 4R8UA 8ICNA 5DGAA 1QSYA 2ZIXB 1JRPA 5AI6A 4DWIA 2H5XA 2HHWA 1X42A 2WF5A 4P0PA 4DS5A 1T3QA 2J6TA 5AI9A 2V4QA 4ECYA 3HW8A 3NGDA 2XGQA 4ED8A 4DFJA 4M04A 3KBBA 4QZGA 4KLHA 3EPGA 5KAFU 5CP2A 1ZQTA 3VCBA 4I2AA 3NS1A 4IQUA 5ALMA 3UMGA 4UBBA 4OJ6A 3T5LA 2A3VA 3V6HA 4ECXA 1IIPA 2E8OA 1N62A 4OJOA 3TQ1A 5HMLA 5IINA 4DS4A 1QQ7A 1Z1BA 8ICYA 3C28A 4F3OA 9ICCA 1SZPA 5DB9A 3EYZA 1KW4A 2DPIA 3C2KA 1S10A 3WK5A 2KTQA 2BDPA 2JHDA 2GWSA 2ZIWA 2KSOA 4P4OA 3M6KA 3B9JA 4BX9C 5DB8A 4DFDA 4DSEA 2IBKA 1ZQEA 4EELA 2BPCA 3V7LA 3ORYA 3PMNA 3KTQA 2JZBA 5JTIA 5ALIA 4YR3A 7ICEA 2JH1A 5L1IA 5J0PA 5E79U 5EWFA 1L7MA 9ICSA 2F1HA 3SEIA 4ED3A 3SAFA 3K1RB 3M1YA 1ZQYA 3FC4A 1ECWA 4DSKA 1Q3UA 2QKQA 3V6KA 4HAIA 3AEVA 3L4PA 5AICA 3SI8A 2HHSA 3IRUA 2E1EA 1KQQA 2ZJAA 3M8SA 1XSPA 1QSSA 2KMDA 1A76A 3WK4A 4NXZA 2ZTEA 2KFZA 4O3OA 2HOFA 1S77D 3AL0B 2G09A 4Y2PA 4B9TA 2BR0A 3GFKB 2A1JA 1JUDA 5KL1B 3QZ7A 7ICGA 2AQ0A 5J2DA 4CDGA 3H8JA 2ODGA 4DFKA 3M9OB 5KG3A 3LWLA 1ZQDA 4RQ0A 3PW4A 3NUQA 4NL9C 2JEFA 5G5HA 5DDMA 5EWEA 2KJ8A 9ICHA 3HKZF 4M0AA 1S0NA 2HOIA 1NK6A 1IV8A 1ZRNA 4UB8U 3PVXA 1N60A 5JUMA 3V6JA 1ZQHA 1D8YA 4O0IA 4RPXA 3TFSA 4GXJA 3FYHA 4GC7A 4F72A 4B9SA 3DEEA 2W9BA 1ZD2P 3B0XA 3C5GA 4F4WA 1NJXA 4NLGA 7ICTA 3PY8A 2WTFA 2W9BB 4BXOA 2W9CB 5AK3A 4AP9A 4RZRA 4MF2A 2HBMA 5AM3A 3V7JA 3AU6A 3KZXA 2PI5A 4F2SA 2XY5A 2RQ5A 4JUZA 1SKWA 2WF6A 4Z6FA 1QTMA 2G07A 3SYZA 4Z6DA 5EWGA 2PXIA 1KRPA 1O08A 2AQ4A 2WFAA 1ZQXA 4QZFA 4BUGA 3BQ2A 3RRGA 3HKZC 1ZD5A 5AI0A 1ZOLA 5TZVA 4OJ5A 5KTQA 3TARA 4KLIA 3M8RA 5F3XB 4KLDA 9ICXA 2HHQA 1L5UA 4TQRA 4YQWA 2BKEA 3RJKA 3MFIA 4UAZA 2KVSA 4M2YA 1JI7A 3K1ZA 3HJEA 3BZKA 3SENA 4P4MA 4KX5A 5AKXA 3F2BA 1MQ3A 2DL0A 4QWCA 3PZPA 3PV8A 1PVQA 4O3SA 9ICGA 4Z6CA 3MFHA 2EZXA 2RDIA 4EBDA 2VA2A 5J2EA 1URJA 4YR2A 2JR5A 2IOFA 3TANA 2F8LA 4Y2XA 1ZQRA 3MR2A 1DOQA 4Q45A 4UW9A 4F71A 4LZGA 2YQEA 4TQSA 2DFLA 2FJ6A 5T14A 3C1YA 3T5KA 1BPXA 2ISPA 3MBYA 1L6NA 8ICFA 1N63A 2KNJA 2BCRA 9ICVA 2Y9TA 3Q8KA 1SXDA 3H4BA 2W8LA 3BS5B 5J2JA 1PK1A 5ALQA 4NWIA 4QW9A 4MFAA 4IR9A 3KHHA 4RQ3A 3I28A 4FS1A 4UAWA 3N7PD 2XGPA 4JB3A 3RB6A 4J9PA 2LM4A 1Z00B 2XO7A 1TK8A 8ICVA 3ZD9A 3F2DA 1GO3F 2G0AA 3QEBZ 4ED0A 3H0LB 3WK7A 1UA0A 2LYHA 3EZ5A 3UMBA 4XUSA 3QU7A 5AKEA 5KNIA 4FBTA 4DQPA 5L1MA 3WK9A 1ZQAA 3AUOA 2JRZA 3RR8A 4IR1A 1M6YA 4Q44A 3HX0A 5CRXA 4OD0A 1X40A 1ZRMA 1QLNA 2ZUBA 2G06A 3LVWA 4M6WB 3NVWA 3GDXA 4O3QA 8ICUA 5GTIU 4C80A 1ZQIA 1XSNA 4I2IA 4PZNA 4Y2VA 2NRWA 2W9MA 4DEZA 1TE2A 1UHUA 4DLGA 4TURA 5DG9A 4FZLA 1KFSA 2PFPA 4RU9A 3JPSA 2BGWA 2ZXIA 1DGSA 3OHAA 4M9HA 3Q8SB 1QSLA 4CCHA 2C28A 5DG7A 5KFUA 2DKXA 4BXOB 1PZNA 5J0QA 4DSJA 3BQ1A 4I29A 1NK0A 3RJEA 1ZQGA 4K4GA 8ICGA 1HUOA 3RBDA 4TUQA 1Q3VA 3PO4A 2K8BB 4QIWC 5KFJA 4KLQA 2JMGA 1NK5A 2HDOA 2Y0SF 5DB6A 7ICNA 1WWVA 5J8YC 3S6JA 5KFFA 1SXEA 4PGYA 4PJ0U 3BQ0A 4PHPA 3TAPA 3HPOA 4BJQA 2W9AA 2E8NA 4K4IA 1F0MA 4RNNA 1A0PA 4IS7A 3ZDAA 1S0VA 5IIJA 4QWEA 5HR7A 3TI0A 1KBUA 3A0BU 3WK8A 1FO4A 4M9JA 3D2SA 2DUYA 5J8YA 4YMMA 1ZQCA 3IP4B 1ZQPA 2FLPA 4YCXA 1LV5A 3AQEA 2VJ4A 1TAMA 2A1JB 2D8CA 7ICQA 4KLTA 5HHHA 1BPZA 4I2HA 2PMZF 5J0OA 2YTUA 5DQGA 1JN3A 2HCFA 2OCEA 4YMOA 4XRHA 2H3QA 4ZH4A 4RUAA 1BPYA 4LJXA 3LK9A 2AXTU 5ALVA 2K60A 4F91B 4Y2JA 5IIMA 5KFQA 5BOMA 4MEXA 4FBUA 2J6SA 3AN1A 5J0YA 4J9LA 4EENA 1DRGA 2FMPA 4MHVA 1HIWA 1SWWA 3M7DA 4NL9A 2VANA 2RLTA 2EDUA 5G5GA 4BGDA 4ED7A 2K89A 4I28A 2ZUDA 2NRVA 1CRXA 1EXNA 2UVWA 1BPBA 8ICQA 9ICMA 3MR6A 4DFPA 2ESEA 2AGOA 7ICSA 1SGGA 1U49A 3F5AA 3ZI4A 1DK2A 5AK6A 5KFIA 1SV0A 2BCVA 9ICRA 2CN1A 2K4PA 5K4LA 2R8GA 2GO7A 2VA8A 3PSIA 3NRZA 2BQ3A 2FLLA 2GOLA 4Q8FA 3CYMA 5KFSA 2HBLA 2QLTA 3EW9A 1X2IA 1N5WA 8ICOA 5KG4A 1T94A 1A77A 1L7NA 4GXIA 5L1LA 3R9KA 5DQIA 3C1ZA 5KG0A 1A6SA 2JXJA 4KLJA 1SB3C 2NV3A 4IQVA 4I2FA 3G6YA 3C23A 5J2CA 2HHTA 2FMSA 5FP0A 3ZDEA 1NJWA 2KICA 2XCAA 5AIBA 4AYBF 2HHVA 5DB7A 1XO1A 3C2MA 5ALUA 1JMSA 2IOHA 3SAGA 4CF3A 4KX3A 3RJGA 1X9WA 1NI3A 2D6FC 1TK5A 1X6JA 4JK1A 3D6JA 9ICJA 3OTQA 2QB1A 5D4BA 1FFUA 1WWUA 3QE9Y 2CRXA 4F93B 1SV4A 2BQRA 5ALKA 3MR5A 4F4KA 4DL7A 1J2MA 2BZFA 4IQTA 1WG8A 3FAHA 5AK4A 3ISBA 9ICFA 2KIWA 3QEAZ 4M47A 2XCPA 5KG2A 4HYKA 4X5VA 2XY6A 4C4RA 3CNHA 4P0PB 3SV3A 3PW5A 3H40A 5KFWA 3ONNA 3KD3A 1JROA 9ICTA 4I27A 1C7YA 1ZJNA 5KT6A 2JH7A 1CEZA 3PX4A 3H8WA 2MUTB 3RH6A 2E1FA 5KFRA 1NK4A 1TAQA 2KE7A 5AK5A 2EQYA 7ICMA 3UQ0A 4JV0A 4J9MA 4FZMA 5KAIU 4XA5A 4EX6A 1JXEA 3LYSA 1L3UA 2I9GA 1OXJA 3SR6A 2HSZA 1NJYA 3GQCA 1V9PA 1T8EA 4JWNA 2EAOA 4FE3A 2Y9UA 3E0FA 1ZQSA 2LYBA 3PNCA 1LKYA 4MFCA 2I6XA 5KFPA 3OPXA 4WJ3B 4Q43A 3OGUA 2EZYA 2JEIA 4F5NA 3OJUA 3TADC 4UAYA 1KFDA 2W7PA 5ALLA 4P0QB 2KG5A 2I1QA 2PI4A 5J0TA 3MC1A 4QNLA 4Z6EA 1BPDA 4I2JA 2H3VA 4F5RA 2KHQA 4NV0A 2ZIVA 2FDRA 1PVRA 3CP8A 3TACB 4JMUA 3GV5B 4F4XA 4KLOA 3SZ2A 9ICUA 7ICVA 1ZQNA 4UATA 4F4YA 2KZMA 1ED1A 3NVZA 1N5XA 5KT5A 4O5KA 7ICKA 4P0QA 3N28A 2KOBA 9ICWA 1ZQMA 3JPQA 4KN4A 9ICPA 1S9FA 5CJ7A 3QU2A 3OSNA 3ETLA 4Y2QA 3UMCA 4RPZA 2Y0SC 3QX7A 4YFKA 2HVIA 3KHRA 3LVVA 1TK0A 1PK1B 2KD1A 3MDAA 2XC9A 4KMUA 3F53A 4UB1A 2F77X 1NJZA 4NLCA 1NOMA 3PSTA 1IXRA 1WCLA 1U4BA 2HI0A 4BDPA 4LZDA 4CE6A 3K75D 5AM4A 4P4PA 2W7OA 5TISU 4O9MA 5DBBA 4O5EA 3GZFA 2E8PA 2KJ5A 3NVYA 2DPJA 4QZEA 4I2GA 1B22A 2WF7A 2FMQA 2R8HA 4B6JA 4J03A 1P7DA 5IIOA 1RYRA 3T5JA 2DQNB 3QUBA 2NO4A 4QZ9A 1LB2B 8ICBA 5ALEA 4G3IA 4BWMA 4GC6A 1CUKA 4UB6U 1RM6C 2HHXA 3N7SC 3RF9A 4I2DA 4PHAA 4RQNA 4GXKA 2VIXA 1Z4NA 1F44A 4QZCA 3AM9A 2YY6A 4KLSA 2LM1A 4JWMA 2XY7A 1WYGA 2XIDA 2ZJ8A 3H0MB 1RXVA 1F5SA 1PUZA 3O0FA 8ICLA 2LHTA 4DL4A 1SKSA 4KTQA 3RR7A 3QU5A 1RDFA 4YMNA 5DQHA 3B0YA 2R8JA 2HBKA 3PSFA 4PGXA 2PFNA 2KKVA 4UAVA 1X66A 5BPCA 9ICAA 3RAQA 3GIIA 3DDHA 2F8KA 5IIIA 3ZDDA 2Y1JA 5ALOA 5J2GA 4UB3A 1FIQA 7ICUA 2H3FA 4R65A 3C5FA 4F8RA 2JV3A 2WAQF 4MF8A 3NRWA 5CEHA 4F5QA 2UVVA 4C8LA 5ALRA 5J0XA 3OSPA 5C5JA 4DLEA 2B21A 3MR3A 2CPRA 4DO9A 1T3NA 9ICIA 5ALNA 2VKQA 4CRXA 2NO5A 1YT3A 2QB0B 5DDYA 4ELTA 5CHGA 1Z4OA 4YP3A 1NNLA 3PW2A 1NKCA 1Z1VA 3RB4A 4PZOA 4ELVA 4UARA 4Y2UA 8ICWA 5ALGA 3SV4A 4CNQA 3ALRA 4KLMA 2WHEA 2PFQA 1RYUA 4I2EA 2K4EA 3WKAA 5C0YA 1O03A 4GFJA 4KMOB 4DL2A 2ZIUB 3RB0A 4F5PA 3UPQA 1LKYB 2IMWP 3ZDBA 1KEJA 3VC8A 3ZD8A 4RQ7A 3JPOA 5ALDA 4KLLA 4FZNA 5KFHA 1DXSA 2V9WA 3F5EA 4ECRA 1D9FA 8ICZA 4DSFA 2AH5A 1IG6A 1L3VA 2VJ5A 4TUPA 4QZBA 5KT3A 4EBCA 5J2KA 2ZXHA 2YMLA 4Y2YA 2KFNA 1S97A 8ICEA 1Z3EB 3T5HA 2KZ3A 3CRXA 3BS7A 3RAXA 2NRXA 4J9KA 5J2BA 4ZOHC 5EE1A 1XU4A 1ZD4A 2OM6A 1NKBA 3K4GA 1AQ6A 4RQ4A 9ICLA 1XWLA 2HMXA 4DF8A 3JPRA 3QUQA 2KHVA 1SL2A 5ALHA 3Q8MA 4NLZA 8ICXA 2D3DA 4DL3A 2ES6A 4KLEA 5KG6A 3H4DA 2HOQA 3KHGA 9ICOA 2QARB 2YMPA 2UVUA 4ED1A 1JX4A 2OWOA 3KFUF 3HWTA 5F9LA 3M9NB 4UAUA 1VDVA 4PPXA 5KFEA 4RNOA 7ICPA 3CW2C 1ZQFA 1AROP 3N4MB 1RG6A 1SZHA 5KFCA 5D49A 4UB4A 2O6KA 2AGPA 5KFBA 3MGHA 3HP6A 3EUB2 3PMLA 4DQRA 3T3FA 2MRLA 1NKEA 1BVSA 2DBYA 1D8BA 2ASLA 1FFVA 2BDUA 8ICRA 3NVVA 5AKGA 5DBCA 8ICCA 2W3SA 4OJLA 4EX7A 4R8UB 3KKAA 2WB1F 1NK7A 5DGBA 2ZIUA 1CI4A 2ASDA 1S0OA 5J0RA 4EZ6A 4RQ1A 3I1YA 4YN4A 2E8MA 7ICIA 4J9RA 3U26A 5AKLA 1KSPA 3WKDA 5AI8A 4KLFA 3Q8RB 4OCZA 3ZDCA 2F2AB 1RYSA 1WUDA 1L8OA 1U47A 3GIJA 5DBAA 5KFVA 2HBJA 2LPEA 5J2FA 2E5SA 1BNOA 3RH4A 4TUSA 3TADA 4ED2A 1TAUA 5KFXA 4ECSA 1K1SA 3H8SA 1X9MA 4DSLA 4FS2A 2FPKA 4MFFA 7ICRA 3JPPA 2Y1IA 5EOZA 5CA7A 2C22A 1N61A 4C0ZA 9ICNA 4DQIA 3F2CA 1HUZA 4EBEA 4F2RA 1LVHA 1S0MA 3IHQB 4CGZA 4NM2A 4NM1A 4NLBA 1VJ5A 1OUQA 4YD2A 1D9DA 1Z00A 4QWBA 2RP5A 4OO1J 1COOA 3G6XA 3WU2U 5JU5A 1SIJA 1S8OA 2KKPA 2A1AA 5AM0A 4J9NA 2I5HA 3THVA 2WAQC 1HEKA 4IC9A 5DLFA 3PO5A 2DKZA 2IHMA 2OH2A 2P66A 9ICKA 3LWMA 5HR6A 5AKJA 4O5CA 2PMZC 2YMMA 2YX8A 2G5HB 2WB1C 3RFAA 2BCUA 4C8MA 2FLNA 2W11A 4QJFB 5B5EU 4M9NA 5J2AA 2Z7JA 1X9XA 2BHNA 5KG1A 7ICHA 4QZDA 4J9SA 3WKCA 3IN5A 3GV8B 2OHFA 5J0SA 2J6UA 2AJQA 3PR5B 2M0NA 4ECUA 2W54A 5L1JA 3ISCA 5KG7A 2W55A 4UASA 2BCSA 4DQSA 4FFDA 2ZIVB 4RUCA 3C21A 4QWAA 2KZZA 2XI9A 3ICXA 2KK0A 1TFRA 2R8IA 3KHLA 4LVSA 3H0RB 2EH9A 1L3SA 2HW3A 3HT3A 2GH1A 4IRDA 2DGZA 2FPMA 4C8OA 2MSNA 1KN5A 2N1RA 8ICIA 3L3FX 1RQLA 2FPLA 3H7IA 2VA3A 4EYIB 1BNPA 4ECQA 1SKRA 2KVCA 4ELUA 4YXMA 3J81j 3BS5A 1PVPA 2Q0ZX 8ICPA 3Q8LA 3QUTA 1RXWA 4QW8A 1JALA 1ZQZA 4YD1A 4QZIA 2AU0A 4DCCA 8ICJA 4UBCA 3SMVA 4DL5A 4U7CA 2KJ9A 2P6RA 3UQ2A 3V7KA 1TKDA 4Y2TA 3M9MB 1ZQWA 2EANA 2ZIWB 5KFNA 4KITB 5ALWA 4C8KA 4NLNA 8ICAA 3RTVA 3AU2A 4QIWF 3G6VA 3KOOA 1Z19A 4M9LA 3MGVA 2W03A 4MEYA 4F92B 3EPIA 1KTQA 3BDPA 3BJYA 4DQQA 5ALZA 2YB4A 5KFYA 4YVZA 4IRCA 1UQVA 3QU4A 4F50A 4O3RA 4U6PA 2R18A 1MQ2A 2IHNA 1NZPA 2ZJ5A 1UA1A 7ICFA 1J2NA 3Q8PB 4DOBA 1RZTA 2JGAA 3BQ7A 3N97B 3QYPA 5CR0A 2FI1A 5KFLA 1TV9A 8ICSA 3UM9A 2EAPA 1RPLA 1J97A 1MA7A 1XSLA 2KN7A 8ICKA 2KP7A 1ZD3A 2NYVA 5HHIA 3IG8A 2LBOA 2E3TA 1C20A 3UXNA 3ED5A 5AKHA 2Q4TA 4O3PA 2MUTA 4CF4A 4R66A 5KFMA 2F44A 4UB5A 5J0UA 1COKA 1UT8A 1MSWD 3DV9A 5F9NA 2ZTDA 1QQ6A 1S5LU 3C2LA 5L9XA 4US8A 1V97A 5ALYA 4F4ZA 4B9UA 4C7YA 4M9GA 2LKYA 1KL9A 2LMRA 5B66U 1K1QA 1ZQOA 1NZBA 2JZBB 1WCNA 2H3IA 5AM1A 4I2CA 4YR0A 2HHUA 1SV0C 3IDWA 1KLNA 1KDHA 2FE9A 9ICBA 1ZQUA 2A19A 4RQ5A 4YG2A 2ASJA 1YZ7A 3GIKA 4DOCA 3RJIA 3T79A 4QZAA 3JPTA 1U48A 5IILA 4PHDA 1X9SA 5GTHU 2ISOA 2OEHA 1VLBA 4AYBC 2G08A 3N7RC 1DK3A 4C7ZA 3TFRA 1XC9A 3PX6A 7ICJA 4ECVA 5KFZA 4R63A 1MN8A 2MA1A 2F76X 5KG5A 3FM9A 5DKWA 1N56A 4QZ8A 8ICHA 2OYYA 3NASA 4UB2A 2F1IA 3Q8QB 1L7OA 1SL0A 1ZQQA 4US9A 1H38A 2RHFA 2CXYA 2EZZA 4DF4A 3H8MA 1IM4A 1UCVA 2K8CB 4CF5A 3PR4A 1OW5A 1UPHA 4QWDA 3ETRA 3GIMA 4Y2RA 5KL8B 5AHXA 4ECTA 5D46A 4E0DA 4IRKA 3PSPA 8ICTA 3UXPA 1ZJMA 4F5OA 4DL6A 2BPFA 2B6GA 5KFTA 5HP4A 2RRDA 1XNSA 2H3ZA 5ALSA 2WF9A 2XVTA 5A0LA 1V85A 2IA6A 4PHEA 2JEJA 4B9VA 2YMQA 1XO0A 2M9NA 3PW0A 2ATLA 1D8LA 1L7PA 2ZUCA 4ECWA 2QARA 2ALZA 2JEGA 4O3NA 1K5OA 3C29A 2YN4A 1ZQVA 4ED6A 3WK6A 4B9MA 4RT2A 2IOFK 1SWVA 9ICEA 5J29A 4RNMA 4YXJA 1ZXIA 2KEYA 5J2IA 4OJPA 4DOAA 4K4HA 3PX0A 1MC8A 5AKYA 1BGXT 4O3MA 1KKXA 3HRDD 2F3NA 2EAMA 1T4GA 4JV1A 3GU3A 5KFGA 3MGIA 1ZQ1C 4PH5A 2L5YA 2K4IA 5ALTA 5EE3A 5HNKA 3E2EA 2PKEA 1ZETA 2GLEA 5CB1A 3FDSA 2MAXA 4B9LA 4EYHB 3TAQA 3WKBA 4USAA 5BOLA 4PGQA 2ZTCA 1U45A 4J9OA 4C4SA 3UXOA 4G9BA 4EZ9A 1HJPA 2YB1A 5IIKA 3PW7A 1N48A 2MU2A 5HMMA 5JRTA 2BCQA 2XICA 2KIVA 1QH9A 5AIAA 1Y88A 2AHOB 5ALFA 3MABA 4RQMA 2B0CA 2W9CA 1ZQJA 8ICMA 7ICOA 5H2FU 4P2HA 3QXGA 3ISDA 5KT2A 4R64A 2HVHA 5AI5A 3JPNA 4NLKA 1NK9A 5ALJA 4EEKA 1QQ5A 1BPEA 5ALXA 3EWAA 4RPYA 4KLUA 3QZ8A 3SQIA 3GV7B
chains in the Genus database with same CATH topology
2FE9A 5JTIA 2EANA 1RG6A 4MHVA 2QB1A 4NL9A 2DKZA 1WWUA 2Y9TA 3SEIA 1SV4A 4NJ8A 1SXDA 3BS5B 1PK1A 1WWVA 3K1RB 5J8YC 1LKYB 3TACB 4RQNA 1SXEA 2QKQA 1V38A 1UQVA 2ESEA 2F3NA 2EAMA 1SGGA 2KMDA 2E8NA 3KKAA 3HILA 1DXSA 1F0MA 1X9XA 4IS7A 1SV0A 3BQ7A 2L5YA 2K4PA 2E8MA 5F3XB 1X66A 2EAPA 2F8KA 2GLEA 3H8MA 1UCVA 5KNIA 1OW5A 5L1MA 5J8YA 2JV3A 3BS7A 1PK3A 2KSOB 2KE7A 3KKAC 1PK1B 1B0XA 2LPEA 4NL9C 1JI7A 2F44A 1X40A 3TADA 1COKA 3SENA 2B6GA 1OXJA 2E8OA 2D8CA 2DL0A 2EAOA 2Y9UA 2D3DA 2YTUA 5JRTA 4PZNA 2ES6A 1B4FA 1LKYA 1V85A 1KW4A 2KIVA 2E8PA 2QB0B 2QARB 3BS5A 2K60A 2LMRA 4RQMA 3TADC 2KSOA 2QARA 2KG5A 1Z1VA 4PZOA 2DKXA 5JU5A 1SV0C 3IDWA 2QB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE9 A;  5JTI A;  2EAN A;  1RG6 A;  4MHV A;  2QB1 A;  4NL9 A;  2DKZ A;  1WWU A;  2Y9T A;  3SEI A;  1SV4 A;  4NJ8 A;  1SXD A;  3BS5 B;  1PK1 A;  1WWV A;  3K1R B;  5J8Y C;  1LKY B;  3TAC B;  4RQN A;  1SXE A;  2QKQ A;  1V38 A;  1UQV A;  2ESE A;  2F3N A;  2EAM A;  1SGG A;  2KMD A;  2E8N A;  3KKA A;  3HIL A;  1DXS A;  1F0M A;  1X9X A;  4IS7 A;  1SV0 A;  3BQ7 A;  2L5Y A;  2K4P A;  2E8M A;  5F3X B;  1X66 A;  2EAP A;  2F8K A;  2GLE A;  3H8M A;  1UCV A;  5KNI A;  1OW5 A;  5L1M A;  5J8Y A;  2JV3 A;  3BS7 A;  1PK3 A;  2KSO B;  2KE7 A;  3KKA C;  1PK1 B;  1B0X A;  2LPE A;  4NL9 C;  1JI7 A;  2F44 A;  1X40 A;  3TAD A;  1COK A;  3SEN A;  2B6G A;  1OXJ A;  2E8O A;  2D8C A;  2DL0 A;  2EAO A;  2Y9U A;  2D3D A;  2YTU A;  5JRT A;  4PZN A;  2ES6 A;  1B4F A;  1LKY A;  1V85 A;  1KW4 A;  2KIV A;  2E8P A;  2QB0 B;  2QAR B;  3BS5 A;  2K60 A;  2LMR A;  4RQM A;  3TAD C;  2KSO A;  2QAR A;  2KG5 A;  1Z1V A;  4PZO A;  2DKX A;  5JU5 A;  1SV0 C;  3IDW A;  2QB0 A; 
#chains in the Genus database with same CATH topology
 4PL2 A;  5J0W A;  4DFM A;  1Q8K A;  2LI6 A;  4C4T A;  3RH5 A;  4JV2 A;  4GLX A;  3D2Q A;  3WKE A;  4NJ8 A;  2OXO A;  5J2H A;  4FO6 A;  3OJS A;  2K8A A;  1N2X A;  2P35 A;  1ZQL A;  4ICA A;  3QU9 A;  9ICQ A;  5AKI A;  5KT4 A;  5L1K A;  2P6U A;  5KT7 A;  2DWQ A;  1ZYQ A;  3BQT A;  4C8N A;  1L8L A;  4PL1 A;  5KFA A;  4J9Q A;  2C2R A;  3A0H U;  4I2B A;  3LDA A;  3I76 A;  4KLG A;  1S76 D;  4GIB A;  1TVA A;  3AQF A;  3RBE A;  4B9N A;  2G5I B;  4DSI A;  4A8E A;  1DGJ A;  2V4R A;  5DLG A;  3RJH A;  2C2E A;  1ZQB A;  1B43 A;  5KFK A;  1UT5 A;  5EE9 A;  2C2D A;  1PK3 A;  2ZIX A;  2ZG6 A;  2KSO B;  3KKA C;  5AKK A;  2AGQ A;  1B0X A;  2W3R A;  5KFO A;  3OHB A;  4ACO A;  3V72 A;  2UVR A;  4RQ6 A;  3AMZ A;  2BPG A;  3L5K A;  1JIH A;  2K4H A;  2NRT A;  3M6Z A;  1JXL A;  1KFT A;  3IG5 A;  5KFD A;  3D2N A;  3RJF A;  3E58 A;  4NY8 A;  1X6I A;  2LYA A;  2NRZ A;  4KN7 A;  1B4F A;  3IV6 A;  3BZC A;  3GIL A;  1NK8 A;  1YZ6 A;  5AKZ A;  3RB3 A;  3NTU A;  5DG8 A;  2WF8 A;  2R8K A;  4Q8E A;  5EE0 A;  4XQ8 A;  1ZQK A;  1L3T A;  4RT3 A;  3KZI U;  2W43 A;  4UQG A;  2W8K A;  2W04 A;  1SL1 A;  1T7P A;  4IQW A;  2QB0 A;  3RRH A;  3RJJ A;  3IM1 A;  5AI4 A;  5CWR A;  1Q46 A;  2RDJ A;  2F1J A;  7ICL A;  4ECZ A;  1XS9 D;  5AM2 A;  5AM5 A;  4RQ2 A;  1FEZ A;  2DF4 B;  1RQN A;  3QUC A;  3MDC A;  2KV2 A;  1V38 A;  1QCK A;  3SAH A;  3TKA A;  5ALP A;  4QZH A;  4EEY A;  4RQ8 A;  3QNM A;  4BWJ A;  3HIL A;  4IL6 U;  3SD7 A;  2BQU A;  1U9L A;  4Y2S A;  4M6W A;  2PFO A;  4R8U A;  8ICN A;  5DGA A;  1QSY A;  2ZIX B;  1JRP A;  5AI6 A;  4DWI A;  2H5X A;  2HHW A;  1X42 A;  2WF5 A;  4P0P A;  4DS5 A;  1T3Q A;  2J6T A;  5AI9 A;  2V4Q A;  4ECY A;  3HW8 A;  3NGD A;  2XGQ A;  4ED8 A;  4DFJ A;  4M04 A;  3KBB A;  4QZG A;  4KLH A;  3EPG A;  5KAF U;  5CP2 A;  1ZQT A;  3VCB A;  4I2A A;  3NS1 A;  4IQU A;  5ALM A;  3UMG A;  4UBB A;  4OJ6 A;  3T5L A;  2A3V A;  3V6H A;  4ECX A;  1IIP A;  2E8O A;  1N62 A;  4OJO A;  3TQ1 A;  5HML A;  5IIN A;  4DS4 A;  1QQ7 A;  1Z1B A;  8ICY A;  3C28 A;  4F3O A;  9ICC A;  1SZP A;  5DB9 A;  3EYZ A;  1KW4 A;  2DPI A;  3C2K A;  1S10 A;  3WK5 A;  2KTQ A;  2BDP A;  2JHD A;  2GWS A;  2ZIW A;  2KSO A;  4P4O A;  3M6K A;  3B9J A;  4BX9 C;  5DB8 A;  4DFD A;  4DSE A;  2IBK A;  1ZQE A;  4EEL A;  2BPC A;  3V7L A;  3ORY A;  3PMN A;  3KTQ A;  2JZB A;  5JTI A;  5ALI A;  4YR3 A;  7ICE A;  2JH1 A;  5L1I A;  5J0P A;  5E79 U;  5EWF A;  1L7M A;  9ICS A;  2F1H A;  3SEI A;  4ED3 A;  3SAF A;  3K1R B;  3M1Y A;  1ZQY A;  3FC4 A;  1ECW A;  4DSK A;  1Q3U A;  2QKQ A;  3V6K A;  4HAI A;  3AEV A;  3L4P A;  5AIC A;  3SI8 A;  2HHS A;  3IRU A;  2E1E A;  1KQQ A;  2ZJA A;  3M8S A;  1XSP A;  1QSS A;  2KMD A;  1A76 A;  3WK4 A;  4NXZ A;  2ZTE A;  2KFZ A;  4O3O A;  2HOF A;  1S77 D;  3AL0 B;  2G09 A;  4Y2P A;  4B9T A;  2BR0 A;  3GFK B;  2A1J A;  1JUD A;  5KL1 B;  3QZ7 A;  7ICG A;  2AQ0 A;  5J2D A;  4CDG A;  3H8J A;  2ODG A;  4DFK A;  3M9O B;  5KG3 A;  3LWL A;  1ZQD A;  4RQ0 A;  3PW4 A;  3NUQ A;  4NL9 C;  2JEF A;  5G5H A;  5DDM A;  5EWE A;  2KJ8 A;  9ICH A;  3HKZ F;  4M0A A;  1S0N A;  2HOI A;  1NK6 A;  1IV8 A;  1ZRN A;  4UB8 U;  3PVX A;  1N60 A;  5JUM A;  3V6J A;  1ZQH A;  1D8Y A;  4O0I A;  4RPX A;  3TFS A;  4GXJ A;  3FYH A;  4GC7 A;  4F72 A;  4B9S A;  3DEE A;  2W9B A;  1ZD2 P;  3B0X A;  3C5G A;  4F4W A;  1NJX A;  4NLG A;  7ICT A;  3PY8 A;  2WTF A;  2W9B B;  4BXO A;  2W9C B;  5AK3 A;  4AP9 A;  4RZR A;  4MF2 A;  2HBM A;  5AM3 A;  3V7J A;  3AU6 A;  3KZX A;  2PI5 A;  4F2S A;  2XY5 A;  2RQ5 A;  4JUZ A;  1SKW A;  2WF6 A;  4Z6F A;  1QTM A;  2G07 A;  3SYZ A;  4Z6D A;  5EWG A;  2PXI A;  1KRP A;  1O08 A;  2AQ4 A;  2WFA A;  1ZQX A;  4QZF A;  4BUG A;  3BQ2 A;  3RRG A;  3HKZ C;  1ZD5 A;  5AI0 A;  1ZOL A;  5TZV A;  4OJ5 A;  5KTQ A;  3TAR A;  4KLI A;  3M8R A;  5F3X B;  4KLD A;  9ICX A;  2HHQ A;  1L5U A;  4TQR A;  4YQW A;  2BKE A;  3RJK A;  3MFI A;  4UAZ A;  2KVS A;  4M2Y A;  1JI7 A;  3K1Z A;  3HJE A;  3BZK A;  3SEN A;  4P4M A;  4KX5 A;  5AKX A;  3F2B A;  1MQ3 A;  2DL0 A;  4QWC A;  3PZP A;  3PV8 A;  1PVQ A;  4O3S A;  9ICG A;  4Z6C A;  3MFH A;  2EZX A;  2RDI A;  4EBD A;  2VA2 A;  5J2E A;  1URJ A;  4YR2 A;  2JR5 A;  2IOF A;  3TAN A;  2F8L A;  4Y2X A;  1ZQR A;  3MR2 A;  1DOQ A;  4Q45 A;  4UW9 A;  4F71 A;  4LZG A;  2YQE A;  4TQS A;  2DFL A;  2FJ6 A;  5T14 A;  3C1Y A;  3T5K A;  1BPX A;  2ISP A;  3MBY A;  1L6N A;  8ICF A;  1N63 A;  2KNJ A;  2BCR A;  9ICV A;  2Y9T A;  3Q8K A;  1SXD A;  3H4B A;  2W8L A;  3BS5 B;  5J2J A;  1PK1 A;  5ALQ A;  4NWI A;  4QW9 A;  4MFA A;  4IR9 A;  3KHH A;  4RQ3 A;  3I28 A;  4FS1 A;  4UAW A;  3N7P D;  2XGP A;  4JB3 A;  3RB6 A;  4J9P A;  2LM4 A;  1Z00 B;  2XO7 A;  1TK8 A;  8ICV A;  3ZD9 A;  3F2D A;  1GO3 F;  2G0A A;  3QEB Z;  4ED0 A;  3H0L B;  3WK7 A;  1UA0 A;  2LYH A;  3EZ5 A;  3UMB A;  4XUS A;  3QU7 A;  5AKE A;  5KNI A;  4FBT A;  4DQP A;  5L1M A;  3WK9 A;  1ZQA A;  3AUO A;  2JRZ A;  3RR8 A;  4IR1 A;  1M6Y A;  4Q44 A;  3HX0 A;  5CRX A;  4OD0 A;  1X40 A;  1ZRM A;  1QLN A;  2ZUB A;  2G06 A;  3LVW A;  4M6W B;  3NVW A;  3GDX A;  4O3Q A;  8ICU A;  5GTI U;  4C80 A;  1ZQI A;  1XSN A;  4I2I A;  4PZN A;  4Y2V A;  2NRW A;  2W9M A;  4DEZ A;  1TE2 A;  1UHU A;  4DLG A;  4TUR A;  5DG9 A;  4FZL A;  1KFS A;  2PFP A;  4RU9 A;  3JPS A;  2BGW A;  2ZXI A;  1DGS A;  3OHA A;  4M9H A;  3Q8S B;  1QSL A;  4CCH A;  2C28 A;  5DG7 A;  5KFU A;  2DKX A;  4BXO B;  1PZN A;  5J0Q A;  4DSJ A;  3BQ1 A;  4I29 A;  1NK0 A;  3RJE A;  1ZQG A;  4K4G A;  8ICG A;  1HUO A;  3RBD A;  4TUQ A;  1Q3V A;  3PO4 A;  2K8B B;  4QIW C;  5KFJ A;  4KLQ A;  2JMG A;  1NK5 A;  2HDO A;  2Y0S F;  5DB6 A;  7ICN A;  1WWV A;  5J8Y C;  3S6J A;  5KFF A;  1SXE A;  4PGY A;  4PJ0 U;  3BQ0 A;  4PHP A;  3TAP A;  3HPO A;  4BJQ A;  2W9A A;  2E8N A;  4K4I A;  1F0M A;  4RNN A;  1A0P A;  4IS7 A;  3ZDA A;  1S0V A;  5IIJ A;  4QWE A;  5HR7 A;  3TI0 A;  1KBU A;  3A0B U;  3WK8 A;  1FO4 A;  4M9J A;  3D2S A;  2DUY A;  5J8Y A;  4YMM A;  1ZQC A;  3IP4 B;  1ZQP A;  2FLP A;  4YCX A;  1LV5 A;  3AQE A;  2VJ4 A;  1TAM A;  2A1J B;  2D8C A;  7ICQ A;  4KLT A;  5HHH A;  1BPZ A;  4I2H A;  2PMZ F;  5J0O A;  2YTU A;  5DQG A;  1JN3 A;  2HCF A;  2OCE A;  4YMO A;  4XRH A;  2H3Q A;  4ZH4 A;  4RUA A;  1BPY A;  4LJX A;  3LK9 A;  2AXT U;  5ALV A;  2K60 A;  4F91 B;  4Y2J A;  5IIM A;  5KFQ A;  5BOM A;  4MEX A;  4FBU A;  2J6S A;  3AN1 A;  5J0Y A;  4J9L A;  4EEN A;  1DRG A;  2FMP A;  4MHV A;  1HIW A;  1SWW A;  3M7D A;  4NL9 A;  2VAN A;  2RLT A;  2EDU A;  5G5G A;  4BGD A;  4ED7 A;  2K89 A;  4I28 A;  2ZUD A;  2NRV A;  1CRX A;  1EXN A;  2UVW A;  1BPB A;  8ICQ A;  9ICM A;  3MR6 A;  4DFP A;  2ESE A;  2AGO A;  7ICS A;  1SGG A;  1U49 A;  3F5A A;  3ZI4 A;  1DK2 A;  5AK6 A;  5KFI A;  1SV0 A;  2BCV A;  9ICR A;  2CN1 A;  2K4P A;  5K4L A;  2R8G A;  2GO7 A;  2VA8 A;  3PSI A;  3NRZ A;  2BQ3 A;  2FLL A;  2GOL A;  4Q8F A;  3CYM A;  5KFS A;  2HBL A;  2QLT A;  3EW9 A;  1X2I A;  1N5W A;  8ICO A;  5KG4 A;  1T94 A;  1A77 A;  1L7N A;  4GXI A;  5L1L A;  3R9K A;  5DQI A;  3C1Z A;  5KG0 A;  1A6S A;  2JXJ A;  4KLJ A;  1SB3 C;  2NV3 A;  4IQV A;  4I2F A;  3G6Y A;  3C23 A;  5J2C A;  2HHT A;  2FMS A;  5FP0 A;  3ZDE A;  1NJW A;  2KIC A;  2XCA A;  5AIB A;  4AYB F;  2HHV A;  5DB7 A;  1XO1 A;  3C2M A;  5ALU A;  1JMS A;  2IOH A;  3SAG A;  4CF3 A;  4KX3 A;  3RJG A;  1X9W A;  1NI3 A;  2D6F C;  1TK5 A;  1X6J A;  4JK1 A;  3D6J A;  9ICJ A;  3OTQ A;  2QB1 A;  5D4B A;  1FFU A;  1WWU A;  3QE9 Y;  2CRX A;  4F93 B;  1SV4 A;  2BQR A;  5ALK A;  3MR5 A;  4F4K A;  4DL7 A;  1J2M A;  2BZF A;  4IQT A;  1WG8 A;  3FAH A;  5AK4 A;  3ISB A;  9ICF A;  2KIW A;  3QEA Z;  4M47 A;  2XCP A;  5KG2 A;  4HYK A;  4X5V A;  2XY6 A;  4C4R A;  3CNH A;  4P0P B;  3SV3 A;  3PW5 A;  3H40 A;  5KFW A;  3ONN A;  3KD3 A;  1JRO A;  9ICT A;  4I27 A;  1C7Y A;  1ZJN A;  5KT6 A;  2JH7 A;  1CEZ A;  3PX4 A;  3H8W A;  2MUT B;  3RH6 A;  2E1F A;  5KFR A;  1NK4 A;  1TAQ A;  2KE7 A;  5AK5 A;  2EQY A;  7ICM A;  3UQ0 A;  4JV0 A;  4J9M A;  4FZM A;  5KAI U;  4XA5 A;  4EX6 A;  1JXE A;  3LYS A;  1L3U A;  2I9G A;  1OXJ A;  3SR6 A;  2HSZ A;  1NJY A;  3GQC A;  1V9P A;  1T8E A;  4JWN A;  2EAO A;  4FE3 A;  2Y9U A;  3E0F A;  1ZQS A;  2LYB A;  3PNC A;  1LKY A;  4MFC A;  2I6X A;  5KFP A;  3OPX A;  4WJ3 B;  4Q43 A;  3OGU A;  2EZY A;  2JEI A;  4F5N A;  3OJU A;  3TAD C;  4UAY A;  1KFD A;  2W7P A;  5ALL A;  4P0Q B;  2KG5 A;  2I1Q A;  2PI4 A;  5J0T A;  3MC1 A;  4QNL A;  4Z6E A;  1BPD A;  4I2J A;  2H3V A;  4F5R A;  2KHQ A;  4NV0 A;  2ZIV A;  2FDR A;  1PVR A;  3CP8 A;  3TAC B;  4JMU A;  3GV5 B;  4F4X A;  4KLO A;  3SZ2 A;  9ICU A;  7ICV A;  1ZQN A;  4UAT A;  4F4Y A;  2KZM A;  1ED1 A;  3NVZ A;  1N5X A;  5KT5 A;  4O5K A;  7ICK A;  4P0Q A;  3N28 A;  2KOB A;  9ICW A;  1ZQM A;  3JPQ A;  4KN4 A;  9ICP A;  1S9F A;  5CJ7 A;  3QU2 A;  3OSN A;  3ETL A;  4Y2Q A;  3UMC A;  4RPZ A;  2Y0S C;  3QX7 A;  4YFK A;  2HVI A;  3KHR A;  3LVV A;  1TK0 A;  1PK1 B;  2KD1 A;  3MDA A;  2XC9 A;  4KMU A;  3F53 A;  4UB1 A;  2F77 X;  1NJZ A;  4NLC A;  1NOM A;  3PST A;  1IXR A;  1WCL A;  1U4B A;  2HI0 A;  4BDP A;  4LZD A;  4CE6 A;  3K75 D;  5AM4 A;  4P4P A;  2W7O A;  5TIS U;  4O9M A;  5DBB A;  4O5E A;  3GZF A;  2E8P A;  2KJ5 A;  3NVY A;  2DPJ A;  4QZE A;  4I2G A;  1B22 A;  2WF7 A;  2FMQ A;  2R8H A;  4B6J A;  4J03 A;  1P7D A;  5IIO A;  1RYR A;  3T5J A;  2DQN B;  3QUB A;  2NO4 A;  4QZ9 A;  1LB2 B;  8ICB A;  5ALE A;  4G3I A;  4BWM A;  4GC6 A;  1CUK A;  4UB6 U;  1RM6 C;  2HHX A;  3N7S C;  3RF9 A;  4I2D A;  4PHA A;  4RQN A;  4GXK A;  2VIX A;  1Z4N A;  1F44 A;  4QZC A;  3AM9 A;  2YY6 A;  4KLS A;  2LM1 A;  4JWM A;  2XY7 A;  1WYG A;  2XID A;  2ZJ8 A;  3H0M B;  1RXV A;  1F5S A;  1PUZ A;  3O0F A;  8ICL A;  2LHT A;  4DL4 A;  1SKS A;  4KTQ A;  3RR7 A;  3QU5 A;  1RDF A;  4YMN A;  5DQH A;  3B0Y A;  2R8J A;  2HBK A;  3PSF A;  4PGX A;  2PFN A;  2KKV A;  4UAV A;  1X66 A;  5BPC A;  9ICA A;  3RAQ A;  3GII A;  3DDH A;  2F8K A;  5III A;  3ZDD A;  2Y1J A;  5ALO A;  5J2G A;  4UB3 A;  1FIQ A;  7ICU A;  2H3F A;  4R65 A;  3C5F A;  4F8R A;  2JV3 A;  2WAQ F;  4MF8 A;  3NRW A;  5CEH A;  4F5Q A;  2UVV A;  4C8L A;  5ALR A;  5J0X A;  3OSP A;  5C5J A;  4DLE A;  2B21 A;  3MR3 A;  2CPR A;  4DO9 A;  1T3N A;  9ICI A;  5ALN A;  2VKQ A;  4CRX A;  2NO5 A;  1YT3 A;  2QB0 B;  5DDY A;  4ELT A;  5CHG A;  1Z4O A;  4YP3 A;  1NNL A;  3PW2 A;  1NKC A;  1Z1V A;  3RB4 A;  4PZO A;  4ELV A;  4UAR A;  4Y2U A;  8ICW A;  5ALG A;  3SV4 A;  4CNQ A;  3ALR A;  4KLM A;  2WHE A;  2PFQ A;  1RYU A;  4I2E A;  2K4E A;  3WKA A;  5C0Y A;  1O03 A;  4GFJ A;  4KMO B;  4DL2 A;  2ZIU B;  3RB0 A;  4F5P A;  3UPQ A;  1LKY B;  2IMW P;  3ZDB A;  1KEJ A;  3VC8 A;  3ZD8 A;  4RQ7 A;  3JPO A;  5ALD A;  4KLL A;  4FZN A;  5KFH A;  1DXS A;  2V9W A;  3F5E A;  4ECR A;  1D9F A;  8ICZ A;  4DSF A;  2AH5 A;  1IG6 A;  1L3V A;  2VJ5 A;  4TUP A;  4QZB A;  5KT3 A;  4EBC A;  5J2K A;  2ZXH A;  2YML A;  4Y2Y A;  2KFN A;  1S97 A;  8ICE A;  1Z3E B;  3T5H A;  2KZ3 A;  3CRX A;  3BS7 A;  3RAX A;  2NRX A;  4J9K A;  5J2B A;  4ZOH C;  5EE1 A;  1XU4 A;  1ZD4 A;  2OM6 A;  1NKB A;  3K4G A;  1AQ6 A;  4RQ4 A;  9ICL A;  1XWL A;  2HMX A;  4DF8 A;  3JPR A;  3QUQ A;  2KHV A;  1SL2 A;  5ALH A;  3Q8M A;  4NLZ A;  8ICX A;  2D3D A;  4DL3 A;  2ES6 A;  4KLE A;  5KG6 A;  3H4D A;  2HOQ A;  3KHG A;  9ICO A;  2QAR B;  2YMP A;  2UVU A;  4ED1 A;  1JX4 A;  2OWO A;  3KFU F;  3HWT A;  5F9L A;  3M9N B;  4UAU A;  1VDV A;  4PPX A;  5KFE A;  4RNO A;  7ICP A;  3CW2 C;  1ZQF A;  1ARO P;  3N4M B;  1RG6 A;  1SZH A;  5KFC A;  5D49 A;  4UB4 A;  2O6K A;  2AGP A;  5KFB A;  3MGH A;  3HP6 A;  3EUB 2;  3PML A;  4DQR A;  3T3F A;  2MRL A;  1NKE A;  1BVS A;  2DBY A;  1D8B A;  2ASL A;  1FFV A;  2BDU A;  8ICR A;  3NVV A;  5AKG A;  5DBC A;  8ICC A;  2W3S A;  4OJL A;  4EX7 A;  4R8U B;  3KKA A;  2WB1 F;  1NK7 A;  5DGB A;  2ZIU A;  1CI4 A;  2ASD A;  1S0O A;  5J0R A;  4EZ6 A;  4RQ1 A;  3I1Y A;  4YN4 A;  2E8M A;  7ICI A;  4J9R A;  3U26 A;  5AKL A;  1KSP A;  3WKD A;  5AI8 A;  4KLF A;  3Q8R B;  4OCZ A;  3ZDC A;  2F2A B;  1RYS A;  1WUD A;  1L8O A;  1U47 A;  3GIJ A;  5DBA A;  5KFV A;  2HBJ A;  2LPE A;  5J2F A;  2E5S A;  1BNO A;  3RH4 A;  4TUS A;  3TAD A;  4ED2 A;  1TAU A;  5KFX A;  4ECS A;  1K1S A;  3H8S A;  1X9M A;  4DSL A;  4FS2 A;  2FPK A;  4MFF A;  7ICR A;  3JPP A;  2Y1I A;  5EOZ A;  5CA7 A;  2C22 A;  1N61 A;  4C0Z A;  9ICN A;  4DQI A;  3F2C A;  1HUZ A;  4EBE A;  4F2R A;  1LVH A;  1S0M A;  3IHQ B;  4CGZ A;  4NM2 A;  4NM1 A;  4NLB A;  1VJ5 A;  1OUQ A;  4YD2 A;  1D9D A;  1Z00 A;  4QWB A;  2RP5 A;  4OO1 J;  1COO A;  3G6X A;  3WU2 U;  5JU5 A;  1SIJ A;  1S8O A;  2KKP A;  2A1A A;  5AM0 A;  4J9N A;  2I5H A;  3THV A;  2WAQ C;  1HEK A;  4IC9 A;  5DLF A;  3PO5 A;  2DKZ A;  2IHM A;  2OH2 A;  2P66 A;  9ICK A;  3LWM A;  5HR6 A;  5AKJ A;  4O5C A;  2PMZ C;  2YMM A;  2YX8 A;  2G5H B;  2WB1 C;  3RFA A;  2BCU A;  4C8M A;  2FLN A;  2W11 A;  4QJF B;  5B5E U;  4M9N A;  5J2A A;  2Z7J A;  1X9X A;  2BHN A;  5KG1 A;  7ICH A;  4QZD A;  4J9S A;  3WKC A;  3IN5 A;  3GV8 B;  2OHF A;  5J0S A;  2J6U A;  2AJQ A;  3PR5 B;  2M0N A;  4ECU A;  2W54 A;  5L1J A;  3ISC A;  5KG7 A;  2W55 A;  4UAS A;  2BCS A;  4DQS A;  4FFD A;  2ZIV B;  4RUC A;  3C21 A;  4QWA A;  2KZZ A;  2XI9 A;  3ICX A;  2KK0 A;  1TFR A;  2R8I A;  3KHL A;  4LVS A;  3H0R B;  2EH9 A;  1L3S A;  2HW3 A;  3HT3 A;  2GH1 A;  4IRD A;  2DGZ A;  2FPM A;  4C8O A;  2MSN A;  1KN5 A;  2N1R A;  8ICI A;  3L3F X;  1RQL A;  2FPL A;  3H7I A;  2VA3 A;  4EYI B;  1BNP A;  4ECQ A;  1SKR A;  2KVC A;  4ELU A;  4YXM A;  3J81 j;  3BS5 A;  1PVP A;  2Q0Z X;  8ICP A;  3Q8L A;  3QUT A;  1RXW A;  4QW8 A;  1JAL A;  1ZQZ A;  4YD1 A;  4QZI A;  2AU0 A;  4DCC A;  8ICJ A;  4UBC A;  3SMV A;  4DL5 A;  4U7C A;  2KJ9 A;  2P6R A;  3UQ2 A;  3V7K A;  1TKD A;  4Y2T A;  3M9M B;  1ZQW A;  2EAN A;  2ZIW B;  5KFN A;  4KIT B;  5ALW A;  4C8K A;  4NLN A;  8ICA A;  3RTV A;  3AU2 A;  4QIW F;  3G6V A;  3KOO A;  1Z19 A;  4M9L A;  3MGV A;  2W03 A;  4MEY A;  4F92 B;  3EPI A;  1KTQ A;  3BDP A;  3BJY A;  4DQQ A;  5ALZ A;  2YB4 A;  5KFY A;  4YVZ A;  4IRC A;  1UQV A;  3QU4 A;  4F50 A;  4O3R A;  4U6P A;  2R18 A;  1MQ2 A;  2IHN A;  1NZP A;  2ZJ5 A;  1UA1 A;  7ICF A;  1J2N A;  3Q8P B;  4DOB A;  1RZT A;  2JGA A;  3BQ7 A;  3N97 B;  3QYP A;  5CR0 A;  2FI1 A;  5KFL A;  1TV9 A;  8ICS A;  3UM9 A;  2EAP A;  1RPL A;  1J97 A;  1MA7 A;  1XSL A;  2KN7 A;  8ICK A;  2KP7 A;  1ZD3 A;  2NYV A;  5HHI A;  3IG8 A;  2LBO A;  2E3T A;  1C20 A;  3UXN A;  3ED5 A;  5AKH A;  2Q4T A;  4O3P A;  2MUT A;  4CF4 A;  4R66 A;  5KFM A;  2F44 A;  4UB5 A;  5J0U A;  1COK A;  1UT8 A;  1MSW D;  3DV9 A;  5F9N A;  2ZTD A;  1QQ6 A;  1S5L U;  3C2L A;  5L9X A;  4US8 A;  1V97 A;  5ALY A;  4F4Z A;  4B9U A;  4C7Y A;  4M9G A;  2LKY A;  1KL9 A;  2LMR A;  5B66 U;  1K1Q A;  1ZQO A;  1NZB A;  2JZB B;  1WCN A;  2H3I A;  5AM1 A;  4I2C A;  4YR0 A;  2HHU A;  1SV0 C;  3IDW A;  1KLN A;  1KDH A;  2FE9 A;  9ICB A;  1ZQU A;  2A19 A;  4RQ5 A;  4YG2 A;  2ASJ A;  1YZ7 A;  3GIK A;  4DOC A;  3RJI A;  3T79 A;  4QZA A;  3JPT A;  1U48 A;  5IIL A;  4PHD A;  1X9S A;  5GTH U;  2ISO A;  2OEH A;  1VLB A;  4AYB C;  2G08 A;  3N7R C;  1DK3 A;  4C7Z A;  3TFR A;  1XC9 A;  3PX6 A;  7ICJ A;  4ECV A;  5KFZ A;  4R63 A;  1MN8 A;  2MA1 A;  2F76 X;  5KG5 A;  3FM9 A;  5DKW A;  1N56 A;  4QZ8 A;  8ICH A;  2OYY A;  3NAS A;  4UB2 A;  2F1I A;  3Q8Q B;  1L7O A;  1SL0 A;  1ZQQ A;  4US9 A;  1H38 A;  2RHF A;  2CXY A;  2EZZ A;  4DF4 A;  3H8M A;  1IM4 A;  1UCV A;  2K8C B;  4CF5 A;  3PR4 A;  1OW5 A;  1UPH A;  4QWD A;  3ETR A;  3GIM A;  4Y2R A;  5KL8 B;  5AHX A;  4ECT A;  5D46 A;  4E0D A;  4IRK A;  3PSP A;  8ICT A;  3UXP A;  1ZJM A;  4F5O A;  4DL6 A;  2BPF A;  2B6G A;  5KFT A;  5HP4 A;  2RRD A;  1XNS A;  2H3Z A;  5ALS A;  2WF9 A;  2XVT A;  5A0L A;  1V85 A;  2IA6 A;  4PHE A;  2JEJ A;  4B9V A;  2YMQ A;  1XO0 A;  2M9N A;  3PW0 A;  2ATL A;  1D8L A;  1L7P A;  2ZUC A;  4ECW A;  2QAR A;  2ALZ A;  2JEG A;  4O3N A;  1K5O A;  3C29 A;  2YN4 A;  1ZQV A;  4ED6 A;  3WK6 A;  4B9M A;  4RT2 A;  2IOF K;  1SWV A;  9ICE A;  5J29 A;  4RNM A;  4YXJ A;  1ZXI A;  2KEY A;  5J2I A;  4OJP A;  4DOA A;  4K4H A;  3PX0 A;  1MC8 A;  5AKY A;  1BGX T;  4O3M A;  1KKX A;  3HRD D;  2F3N A;  2EAM A;  1T4G A;  4JV1 A;  3GU3 A;  5KFG A;  3MGI A;  1ZQ1 C;  4PH5 A;  2L5Y A;  2K4I A;  5ALT A;  5EE3 A;  5HNK A;  3E2E A;  2PKE A;  1ZET A;  2GLE A;  5CB1 A;  3FDS A;  2MAX A;  4B9L A;  4EYH B;  3TAQ A;  3WKB A;  4USA A;  5BOL A;  4PGQ A;  2ZTC A;  1U45 A;  4J9O A;  4C4S A;  3UXO A;  4G9B A;  4EZ9 A;  1HJP A;  2YB1 A;  5IIK A;  3PW7 A;  1N48 A;  2MU2 A;  5HMM A;  5JRT A;  2BCQ A;  2XIC A;  2KIV A;  1QH9 A;  5AIA A;  1Y88 A;  2AHO B;  5ALF A;  3MAB A;  4RQM A;  2B0C A;  2W9C A;  1ZQJ A;  8ICM A;  7ICO A;  5H2F U;  4P2H A;  3QXG A;  3ISD A;  5KT2 A;  4R64 A;  2HVH A;  5AI5 A;  3JPN A;  4NLK A;  1NK9 A;  5ALJ A;  4EEK A;  1QQ5 A;  1BPE A;  5ALX A;  3EWA A;  4RPY A;  4KLU A;  3QZ8 A;  3SQI A;  3GV7 B; 
#chains in the Genus database with same CATH homology
 2FE9 A;  5JTI A;  2EAN A;  1RG6 A;  4MHV A;  2QB1 A;  4NL9 A;  2DKZ A;  1WWU A;  2Y9T A;  3SEI A;  1SV4 A;  4NJ8 A;  1SXD A;  3BS5 B;  1PK1 A;  1WWV A;  3K1R B;  5J8Y C;  1LKY B;  3TAC B;  4RQN A;  1SXE A;  2QKQ A;  1V38 A;  1UQV A;  2ESE A;  2F3N A;  2EAM A;  1SGG A;  2KMD A;  2E8N A;  3KKA A;  3HIL A;  1DXS A;  1F0M A;  1X9X A;  4IS7 A;  1SV0 A;  3BQ7 A;  2L5Y A;  2K4P A;  2E8M A;  5F3X B;  1X66 A;  2EAP A;  2F8K A;  2GLE A;  3H8M A;  1UCV A;  5KNI A;  1OW5 A;  5L1M A;  5J8Y A;  2JV3 A;  3BS7 A;  1PK3 A;  2KSO B;  2KE7 A;  3KKA C;  1PK1 B;  1B0X A;  2LPE A;  4NL9 C;  1JI7 A;  2F44 A;  1X40 A;  3TAD A;  1COK A;  3SEN A;  2B6G A;  1OXJ A;  2E8O A;  2D8C A;  2DL0 A;  2EAO A;  2Y9U A;  2D3D A;  2YTU A;  5JRT A;  4PZN A;  2ES6 A;  1B4F A;  1LKY A;  1V85 A;  1KW4 A;  2KIV A;  2E8P A;  2QB0 B;  2QAR B;  3BS5 A;  2K60 A;  2LMR A;  4RQM A;  3TAD C;  2KSO A;  2QAR A;  2KG5 A;  1Z1V A;  4PZO A;  2DKX A;  5JU5 A;  1SV0 C;  3IDW A;  2QB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...