1X9XA

Solution structure of dimeric sam domain from mapkkk ste11
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
LPFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase STE11
publication title Solution structure of the dimeric SAM domain of MAPKKK Ste11 and its interactions with the adaptor protein Ste50 from the budding yeast: implications for Ste11 activation and signal transmission through the Ste50-Ste11 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 9
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1x9xA00
2E8NA 1JI7A 4RQNA 1LKYB 2F3NA 2KMDA 1X9XA 2GLEA 5KNIA 2KSOB 1SXEA 1SGGA 2QB0B 2EAOA 4PZOA 5JRTA 2JV3A 3TACB 4NJ8A 1Z1VA 2D8CA 1F0MA 3K1RB 1V85A 2LMRA 2KG5A 1WWUA 2LPEA 2F8KA 2K60A 2QARB 1B0XA 2QB1A 2ESEA 4IS7A 1COKA 2EANA 5JU5A 2L5YA 1OW5A 2QKQA 1PK1A 3SEIA 1SV0C 2D3DA 2B6GA 3BS5A 2Y9UA 3TADC 2KE7A 1LKYA 1SV0A 1V38A 1SV4A 2KSOA 2QB0A 1UQVA 3TADA 1X40A 3IDWA 3BS7A 2EAPA 4NL9C 1X66A 3BQ7A 4NL9A 2E8MA 2YTUA 1RG6A 2K4PA 2QARA 2KIVA 2E8OA 5J8YC 4MHVA 1SXDA 4PZNA 1WWVA 2EAMA 5J8YA 3HILA 2DKZA 3SENA 2F44A 2ES6A 2Y9TA 4RQMA 2DKXA 5F3XB 1OXJA 1KW4A 1UCVA 2FE9A 3KKAC 1PK3A 2DL0A 3H8MA 5JTIA 1DXSA 2E8PA 5L1MA 3KKAA 1PK1B 1B4FA 3BS5B
chains in the Genus database with same CATH superfamily
5ALJA 4C8MA 4Z6CA 2F3NA 2KMDA 4P0QA 4KLUA 5ALHA 5ALOA 4M47A 4Y2TA 2JH1A 1XO1A 2KNJA 1ZJNA 3WU2U 2HHTA 3M9NB 2H3IA 3VC8A 3CP8A 4RNOA 4UB6U 1RDFA 2KVSA 4UB4A 2AQ0A 2LPEA 3RR7A 2I1QA 5J0YA 7ICGA 1Z00A 5ALWA 4P0PB 3WKBA 2JH7A 4GXIA 5DB9A 3KHLA 1BPZA 3V6JA 4KN4A 1MA7A 1PK1A 4F5PA 4QIWC 5KFQA 4RQ4A 9ICFA 3LK9A 4UB2A 3J81j 1WG8A 3BZKA 4JV0A 3WK7A 4RQ5A 2G5HB 4J9RA 2JEFA 5DDMA 5DQGA 4KLQA 2XCAA 5CJ7A 4FFDA 2FPKA 3GILA 2EAPA 5KFAA 1X66A 5KT4A 2JXJA 1DK3A 4ELVA 1XC9A 4NLGA 4F4ZA 1ZOLA 1ZETA 2E8OA 1RZTA 2WB1C 2G08A 2RRDA 4IRDA 1S5LU 2AQ4A 5L1LA 3MC1A 4QZEA 3MGHA 3C2KA 1DRGA 4I2HA 3LWLA 4UB8U 1KW4A 1A77A 2BCUA 3AQEA 5L1MA 2H3VA 1JX4A 1HUZA 2W7PA 5EWEA 2FMSA 3EW9A 4ECWA 4IL6U 1ZQQA 2KIWA 3HWTA 4UB1A 3SAGA 4EX6A 2BPFA 7ICKA 3RJIA 1ZRMA 2Q4TA 3ICXA 3MGVA 2KD1A 2YB1A 5AI5A 4P2HA 4UBCA 8ICFA 1F0MA 2W03A 5J29A 1K5OA 2UVUA 2PXIA 1CI4A 1COOA 3B9JA 4QZDA 3F5AA 4C0ZA 5KFZA 5J0WA 3JPPA 5DB7A 5D4BA 1ZQIA 7ICVA 4EYIB 2ASLA 1KKXA 3PMLA 1SKSA 5J0PA 1NJWA 4LZGA 3WKDA 3BDPA 4K4HA 4O3OA 5J0OA 4DQQA 3Q8RB 1ZYQA 1PZNA 4F2SA 4KLJA 5AM4A 2HBLA 3HPOA 4QZGA 4J9QA 4ED1A 3N7PD 3MR6A 3D2SA 4RPXA 3V6HA 4F5NA 4F8RA 1H38A 2KV2A 3ZD8A 2ZJAA 8ICXA 8ICKA 4Y2VA 3ZDEA 2P6RA 4EEKA 5ALKA 1TE2A 4RNMA 4UQGA 2DKZA 1XSPA 4PPXA 1NJZA 4Z6DA 2AJQA 4Y2PA 2MUTB 2YN4A 1ZXIA 2KJ5A 3PY8A 2MA1A 3KFUF 4BWMA 2KVCA 2R8JA 5J0SA 4K4IA 4C4TA 5HHHA 5ALGA 1ZQWA 2E3TA 2ATLA 3ZDCA 5EWGA 1JI7A 2M0NA 3RH4A 1LKYB 3C28A 4WJ3B 4PGXA 3H0LB 4ECSA 4F4YA 4ECQA 4J9SA 2EQYA 4DQIA 1X9WA 2HOIA 1DK2A 1J97A 3TACB 2ZTDA 3QNMA 3QUQA 3T79A 1MQ3A 1ZQMA 4BX9C 2NO5A 3F2DA 3LVWA 4I2BA 3TANA 3OHAA 3C1YA 3GZFA 2G5IB 1S8OA 1RYRA 5B66U 1JN3A 5DBAA 2ZUBA 5AKZA 2IHNA 3RJHA 2K8AA 1TK5A 4XRHA 3M8RA 5AKJA 1ZD5A 3PZPA 3TADC 4YXMA 5AKXA 3JPSA 4RT2A 2NRTA 2BDPA 3G6XA 4DL3A 2ASDA 2XVTA 2CPRA 4RUAA 2ZXIA 5B5EU 3QU4A 1PUZA 2KN7A 3PMNA 5CB1A 4O3PA 5DLGA 3RAXA 8ICNA 5AM5A 1KBUA 8ICQA 5IINA 3C29A 2BDUA 1WWVA 4YMMA 2EZYA 5AIBA 3TI0A 3SENA 4OO1J 3JPRA 2AXTU 1L7NA 1KQQA 4EEYA 2LM4A 3M9OB 2Y9TA 5J2IA 2WF5A 2HHVA 3L4PA 2DKXA 3M6ZA 1NZBA 4F5RA 4Y2QA 2E8PA 4M2YA 1L7OA 4IC9A 4LJXA 3DDHA 2KFNA 2E8NA 1CEZA 5EE0A 3D6JA 2A1AA 3MFIA 5ALUA 1FEZA 3QU5A 3A0HU 4GXJA 5KG2A 1UA1A 1T7PA 2IOFA 9ICHA 8ICMA 2GWSA 4F5OA 5JRTA 3TAQA 4DSKA 1QQ6A 4QZIA 3WKEA 4R63A 5AI6A 1Q3VA 5BOMA 4EELA 2LMRA 2KG5A 5EE9A 4DS4A 3UPQA 5AM0A 2K60A 1SL1A 2NV3A 1LV5A 7ICNA 2GH1A 5CP2A 4IQTA 4M9NA 4J9MA 3TAPA 1S0MA 4RQ3A 1PVPA 1D8YA 1N63A 1SV0C 4YQWA 1NK8A 3BS5A 3ZDAA 1ZQFA 2W55A 2OWOA 3RTVA 1IV8A 1C7YA 2A1JA 5IIJA 3OJUA 4KLDA 4LVSA 2DUYA 2F77X 1L7MA 9ICEA 5KL1B 3C2MA 2J6UA 4ELTA 2HDOA 1SIJA 1SKWA 3KTQA 8ICUA 1SWWA 4I2DA 3PR5B 4KTQA 3ISDA 3N4MB 4TUQA 5J2CA 1ZQEA 4C8NA 2W8KA 1KFSA 2UVWA 4ECRA 3C21A 2H3FA 1D9DA 1RYSA 3WKCA 4FZNA 3T5LA 2JZBB 2G06A 1L5UA 4QIWF 2JGAA 5KG3A 4M9JA 9ICGA 2EAMA 1S77D 4KLIA 9ICRA 2FJ6A 3AEVA 1A6SA 4NXZA 5DLFA 4DCCA 3JPNA 1ZQYA 2YQEA 3KKAA 2KK0A 3AU2A 2XY5A 1Z1BA 2F1IA 3C1ZA 1AROP 4CRXA 1TAQA 4US9A 3OJSA 2HHWA 4P4PA 2YMPA 4GFJA 4QNLA 3NTUA 1QSSA 4YXJA 1TVAA 2HBKA 3L5KA 3UMCA 4KLMA 3RJKA 1SB3C 3PSFA 5KFTA 1LVHA 3GDXA 1ZD4A 2XICA 3V6KA 5KT5A 3QE9Y 2H5XA 3JPQA 3EPGA 1Z4OA 4G3IA 9ICMA 4DEZA 2KP7A 4O9MA 1B0XA 3EZ5A 4PHAA 3BZCA 3SEIA 2B6GA 2WAQF 1L8LA 5E79U 1HIWA 3RB3A 4OD0A 5GTHU 3N97B 1JXLA 2GO7A 1D9FA 2BPGA 5DKWA 3PW4A 3WK4A 3HX0A 3UXNA 4CF5A 2ZTCA 2J6TA 4DLGA 3ETRA 3SZ2A 1PVRA 2ZIWB 1ZQDA 5IIIA 3QEAZ 4KX5A 5AKIA 1QH9A 4ED2A 1Z00B 5CEHA 5ALYA 3QZ8A 4KLLA 5J2AA 2BGWA 2VKQA 1KN5A 5AK6A 4I29A 5KT2A 5DBCA 4EENA 5KFRA 4KN7A 3WKAA 1S97A 9ICIA 4USAA 2ZIXA 5KFOA 9ICWA 2VANA 4RU9A 1KSPA 4I2IA 3AN1A 4UARA 3RF9A 2ZIVB 1TK0A 4DFPA 1CRXA 4OJ5A 4M6WB 1U45A 1N48A 4KLOA 2R8HA 2VIXA 2HSZA 2C22A 2P35A 4NLNA 5AM1A 3LVVA 4ED8A 2R8GA 2KSOB 1Y88A 2FLLA 4B9NA 3RJFA 8ICIA 4RQ2A 2AGOA 3K1ZA 5KG4A 4NJ8A 1KTQA 2ZIUA 3G6YA 2YX8A 1NNLA 2NRWA 4B9UA 2FDRA 5KFVA 1X6JA 3I1YA 4C4SA 5DQIA 4TURA 1BNOA 2CN1A 1SL2A 3AMZA 3CW2C 1N5WA 2KICA 4PH5A 1MQ2A 1X9SA 2FMQA 1BPBA 2KTQA 4J9LA 9ICQA 3B0YA 3RH6A 5FP0A 4EBCA 1N60A 1VJ5A 7ICHA 3PSTA 3FM9A 4JWNA 1BPDA 3M7DA 4I27A 2YTUA 1IM4A 4NY8A 3JPTA 4CGZA 4QZ9A 1Q3UA 4Y2UA 4TUPA 1XSNA 1SXDA 1WYGA 4DQSA 3D2NA 5AK5A 4RPZA 4YR2A 3SMVA 5CA7A 2OXOA 4YD1A 1JMSA 2HBJA 1ZQNA 5HR7A 4RQ8A 1ZJMA 4RQ1A 3LWMA 3RAQA 5ALLA 2V4RA 4Q43A 2WHEA 5JTIA 5CWRA 3H8WA 1FO4A 4MF2A 4BXOA 1ZQTA 1K1SA 2HVHA 4DOBA 5ALIA 2AU0A 4OJLA 1QSYA 4JMUA 2QB0B 9ICKA 3BQ2A 5L1JA 5ALQA 4DFJA 5J0XA 3QU7A 5AI8A 1NK0A 4F91B 4M04A 1Z1VA 2ALZA 4EZ6A 3NGDA 5DGAA 1X2IA 4OJOA 3WK6A 2OHFA 4QZFA 4I2AA 5L1KA 2WAQC 3IG8A 2LI6A 1SZHA 2KJ8A 2BZFA 2L5YA 3B0XA 5C5JA 2QKQA 1IXRA 5KFXA 3TFRA 2E5SA 1TFRA 3F53A 3PSPA 5AKYA 1M6YA 2C2DA 8ICPA 5KFIA 2G07A 1V9PA 4MFAA 3RRGA 1XO0A 2N1RA 4AP9A 5KFNA 4F92B 3UXPA 3WK5A 3PX0A 2P6UA 4P4MA 2KIVA 4UAVA 4P0PA 4I2FA 1N5XA 5KG0A 4DSFA 4FE3A 1S0OA 2B0CA 4M9LA 4K4GA 5J8YA 5DBBA 1YT3A 2F44A 5DQHA 1QLNA 1N62A 1VLBA 5J2HA 5L9XA 1Z4NA 3EWAA 5KAIU 3M1YA 2HW3A 3S6JA 3NRZA 1Z19A 3RFAA 5KFYA 4J9OA 1SZPA 2HI0A 1DOQA 2DFLA 3QYPA 9ICNA 2G0AA 3V7KA 3FC4A 3KHHA 2KOBA 4JB3A 2D8CA 1QQ5A 4CF3A 5AKHA 5KFWA 1ZQBA 5DG7A 2BR0A 3I76A 2YMQA 3PW7A 5ALMA 5KFJA 1O08A 4C8OA 4PGYA 2XY7A 1AQ6A 2D3DA 3BQ1A 1L3VA 3KBBA 9ICCA 3NVZA 2Y0SF 5AK4A 2BQUA 2W9BB 1ZQPA 1SV4A 4G9BA 3CYMA 4EZ9A 4NM1A 2M9NA 4QZAA 2W04A 1U9LA 4YR3A 2F1JA 3UXOA 3V7JA 5DG8A 4OCZA 1KEJA 3KZXA 3D2QA 3PVXA 4A8EA 2FPMA 3SAHA 9ICXA 4UASA 4EBEA 3F5EA 4MEYA 3UQ2A 1HUOA 2LYBA 5KFLA 4LZDA 1L3TA 2W9CB 2R8IA 5KFSA 3HKZF 8ICYA 4Y2SA 2W7OA 5TZVA 1FFUA 5AKEA 1S76D 2VJ5A 1ZQZA 5ALZA 5F3XB 2H3QA 2OCEA 3KKAC 4C7YA 4DL5A 4UB5A 1J2MA 2LYAA 4DL7A 1RQLA 1RM6C 1U4BA 1ZQXA 2OH2A 5ALNA 2FI1A 8ICJA 4RQ7A 5KFHA 4F71A 5G5GA 4CE6A 4ACOA 2AHOB 4PL2A 4F4WA 2ISOA 2FMPA 1QQ7A 1MC8A 1IIPA 5KFBA 4ECUA 8ICHA 2KKPA 4F4KA 5IIMA 4MFCA 1C20A 1KFTA 2F8KA 5D49A 3MR2A 2QARB 4O3RA 4ED6A 2EANA 5JU5A 2FLPA 2BCQA 1OW5A 4QWAA 4I2EA 2K4IA 3RB6A 1LKYA 2BCRA 4B6JA 2R18A 3GV7B 3AM9A 4DF4A 4R8UB 5KTQA 1QCKA 1X40A 3OPXA 4NLZA 2IOFK 3BS7A 3OSPA 3RRHA 2HHSA 3IHQB 3TFSA 3NVVA 1ZD2P 4DS5A 4OJPA 3WK9A 2KHQA 5KFEA 4O3SA 2E8MA 2E1EA 2LKYA 5KFUA 3Q8PB 4UW9A 3H4BA 2UVRA 2C28A 1J2NA 4FS2A 4KLFA 3T3FA 3BJYA 4E0DA 1TAMA 1S0VA 1SWVA 1XU4A 3Q8QB 1D8LA 3T5KA 4ZOHC 2OM6A 1HJPA 2DL0A 2E1FA 3NS1A 5KFFA 4FZLA 4Y2XA 5EWFA 1ZQVA 1L8OA 2IHMA 4ECTA 2BCVA 4RQ6A 2I9GA 3IP4B 3JPOA 2MSNA 2YY6A 1BPEA 1ZQCA 2XCPA 3PO5A 2HOFA 1N2XA 4DL4A 5KT7A 1U47A 3RR8A 3IV6A 4DSLA 1NK9A 1L3SA 1BPYA 1T3QA 3UMBA 1U48A 3G6VA 8ICCA 4DSJA 1ZQUA 2NRZA 3GU3A 4RPYA 3SAFA 5AM3A 1V97A 2CRXA 5IIKA 3PO4A 4RT3A 4ZH4A 2Y0SC 1BVSA 1COKA 4F50A 4BGDA 5IILA 7ICUA 4TUSA 3ALRA 2RDJA 2VA8A 1V38A 1N56A 5DGBA 4QW8A 2H3ZA 3MDCA 2XI9A 9ICUA 3DV9A 3PW5A 3GIKA 3ONNA 2VA3A 4DQPA 4C7ZA 2IA6A 4F72A 3GQCA 2W9AA 4I2GA 4NL9A 4UAYA 3HKZC 2DPIA 4GIBA 1RG6A 4P0QB 3MR5A 1S0NA 3KZIU 5IIOA 1S10A 2XIDA 1NZPA 2KHVA 2BQRA 1ECWA 3M8SA 4UAZA 4JUZA 1ZQJA 4MF8A 5KFDA 5EE1A 2HHUA 2D6FC 4UB3A 1NKEA 1JIHA 3HJEA 4C8LA 3Q8KA 3ED5A 1QSLA 4EYHB 4IR1A 1UCVA 2B21A 2FE9A 5KG7A 3AQFA 3UQ0A 2JEIA 4X5VA 2WF9A 3H7IA 4XA5A 4DOAA 1PK1B 4ICAA 2PKEA 1KFDA 4O0IA 4QWDA 1UPHA 4J03A 9ICVA 5J0UA 2EZZA 2G09A 3IRUA 1DGSA 2AGPA 4ED0A 9ICTA 2DBYA 3EUB2 3IN5A 1NK4A 5AM2A 2W54A 4Z6EA 2JZBA 4MEXA 4B9TA 2WFAA 2ISPA 2WTFA 5DG9A 9ICJA 2PI5A 3ETLA 2YB4A 4NM2A 3A0BU 3Q8MA 8ICOA 1U49A 2BKEA 5AICA 4HYKA 4QWCA 3RH5A 5AI9A 2WF8A 2AGQA 3QUTA 1N61A 5CR0A 2PI4A 3MABA 1YZ6A 2WF7A 2ODGA 3HW8A 1JXEA 3MBYA 2UVVA 3N7RC 5KFMA 1ZQRA 3SYZA 1UQVA 2KZZA 2LHTA 1SL0A 1NI3A 8ICRA 4FS1A 1BGXT 7ICIA 8ICZA 4QJFB 4XUSA 3H8JA 2RHFA 1UT8A 2HVIA 5F9NA 4CF4A 1FFVA 4YD2A 2W3SA 2XC9A 4DO9A 1XSLA 5J8YC 4Y2JA 3T5JA 1ZRNA 5HHIA 4TQSA 4YCXA 2XY6A 3HILA 5DB6A 2JEGA 3SD7A 3RJGA 4UATA 8ICEA 1L3UA 1RPLA 3PX4A 1UA0A 4QZHA 4YMNA 5H2FU 3H8MA 3NASA 2JR5A 3PW0A 1NK7A 2W8LA 5TISU 3IG5A 3N7SC 5J2KA 2ZIWA 5ALSA 2IMWP 1SXEA 2EAOA 4EBDA 3QZ7A 4FO6A 3FDSA 3HP6A 2HCFA 3M6KA 1WUDA 3QU2A 2LYHA 4BUGA 5AK3A 3PR4A 5ALVA 5DDYA 4QZ8A 2CXYA 2IOHA 2ZIVA 1TKDA 9ICOA 3NUQA 2EH9A 4M6WA 2KFZA 2MRLA 7ICEA 7ICJA 1ZQ1C 2Y9UA 5EOZA 2VA2A 2KE7A 1A0PA 4UAWA 4PHEA 4JWMA 2KSOA 4IRCA 4QZCA 2KZMA 4ECXA 5J0QA 5D46A 8ICBA 2LBOA 3TARA 1Q46A 3WK8A 2Y1JA 2P66A 2K8CB 4DLEA 2BQ3A 2BHNA 5J2FA 3E2EA 4F2RA 3DEEA 3ZDBA 1HEKA 1QTMA 3FAHA 2NRXA 5AKLA 1RXWA 3QUBA 2ZJ5A 2AH5A 4F3OA 4PJ0U 2O6KA 3KHGA 4QWEA 5C0YA 2F2AB 1DGJA 4I28A 1IG6A 1JRPA 3QU9A 1MN8A 4IR9A 1F5SA 3ISBA 4M9HA 4NV0A 4PHDA 2K8BB 4YR0A 4DQRA 4O3NA 5J0TA 5J2JA 3GV8B 1K1QA 3ZD9A 5HP4A 4HAIA 2EZXA 4DSEA 2PFQA 5K4LA 1XNSA 5DB8A 1JUDA 5EE3A 4FBUA 2ZUCA 4GXKA 5ALEA 8ICTA 5KNIA 4UBBA 2W43A 4PHPA 5ALTA 4GC7A 9ICBA 5J2BA 2HHQA 2JV3A 2V9WA 8ICGA 3MFHA 3K1RB 4DFKA 3Q8LA 5AHXA 1RYUA 1T94A 1X42A 5G5HA 4P4OA 3GIJA 2EDUA 7ICSA 4GLXA 4CDGA 1Q8KA 3C5FA 4JV2A 2C2EA 7ICTA 3RBDA 4ED7A 1NK5A 4R66A 4Y2YA 1UHUA 2MU2A 3GV5B 3PX6A 8ICAA 4U6PA 4RNNA 4KLSA 3VCBA 2QB0A 4DSIA 8ICVA 3OHBA 4M0AA 2W9MA 4R64A 1KLNA 1SKRA 1KRPA 4PL1A 3QX7A 2GOLA 3SV4A 5AI0A 5GTIU 1RXVA 5KT6A 2KJ9A 3BQ7A 5ALXA 2BCSA 1NJXA 4TQRA 4ECVA 3C2LA 1UT5A 5L1IA 2K4PA 4B9MA 4C8KA 3O0FA 2C2RA 1MSWD 2HMXA 8ICSA 3EYZA 4ELUA 2R8KA 4BJQA 5BOLA 4QW9A 2FPLA 1NK6A 2YMMA 1TAUA 1ED1A 4YMOA 4J9PA 5KAFU 7ICFA 4O5KA 2NO4A 1ZQHA 4F4XA 3CNHA 2ES6A 3NVYA 4IQUA 2ZUDA 2IBKA 5J2DA 2RQ5A 5AIAA 2RDIA 4QZBA 5HMMA 9ICLA 3BS5B 1OUQA 1XS9D 4Q8FA 1NKCA 2A1JB 4AYBF 4U7CA 1BNPA 1KL9A 1SGGA 4PZOA 4MFFA 5AKKA 3RB4A 2XGPA 3V72A 4UAUA 2OEHA 2HBMA 1ZQGA 4QWBA 4DWIA 4DL2A 3UM9A 1V85A 3LYSA 4Y2RA 1WWUA 7ICLA 5ALFA 3HT3A 3LDAA 2ESEA 3V7LA 1YZ7A 4CNQA 3C23A 4FZMA 5KG6A 1Z3EB 2ZJ8A 4IQWA 1B43A 2K4EA 5A0LA 1TK8A 4R65A 4DFMA 3PNCA 5KL8B 3OGUA 3RJJA 2VJ4A 4KMUA 2MAXA 2PFPA 3OSNA 2A3VA 3F2BA 4ECZA 3THVA 2MUTA 2F76X 1O03A 5KG1A 5ALDA 2K4HA 5HNKA 4C4RA 4NL9C 3SV3A 1T3NA 1JROA 2ZG6A 5ALRA 3H0MB 4DOCA 3E0FA 3BQTA 4XQ8A 1ZD3A 1NOMA 3UMGA 2XO7A 2JHDA 1RQNA 4YG2A 2BPCA 3MDAA 1EXNA 4KMOB 4PZNA 2RLTA 4KLTA 4US8A 3QXGA 9ICSA 5HR6A 2DGZA 2W9BA 2DPJA 2KZ3A 1BPXA 2JMGA 5J2EA 1OXJA 1PK3A 4BDPA 2XGQA 3AUOA 3R9KA 4Q8EA 3ZI4A 4JK1A 4NLCA 4KLHA 5KG5A 4YFKA 4NLBA 2PMZF 4GC6A 2GLEA 3TQ1A 3QEBZ 4NWIA 4Q45A 1A76A 3MGIA 4EX7A 3QUCA 5KFCA 2W9CA 3KOOA 4RZRA 5KT3A 1ZQAA 4KX3A 3U26A 3H4DA 3TKAA 5KFKA 1PVQA 4O5CA 3NRWA 2FLNA 4IRKA 3AL0B 3MR3A 4J9KA 4DL6A 3H40A 4IS7A 1FIQA 3KHRA 1T4GA 5F9LA 4IQVA 4PGQA 1ZQKA 4FBTA 4O5EA 7ICMA 1L6NA 9ICPA 3RB0A 8ICLA 7ICRA 2ZIXB 2QLTA 3PW2A 3TADA 3I28A 5BPCA 3IDWA 3Q8SB 2A19A 3ZDDA 1URJA 4O3QA 3N28A 2ZXHA 4BWJA 2HHXA 9ICAA 4NLKA 1WCNA 1F44A 3KD3A 3PSIA 2PFOA 3PV8A 2QARA 2PFNA 2I6XA 3M9MB 3K75D 1ZQLA 4MHVA 2K89A 2ZIUB 5J0RA 3H0RB 4KLGA 3NVWA 4B9VA 4OJ6A 2DQNB 2WB1F 5KFGA 7ICPA 5CHGA 4KITB 2F1HA 5AI4A 2WF6A 4RQMA 4KLEA 2LM1A 2W11A 4R8UA 3ISCA 8ICWA 2ZTEA 1DXSA 2Z7JA 1L7PA 4C80A 4AYBC 4B9SA 1GO3F 2NYVA 4Q44A 7ICQA 2KKVA 1NJYA 4RQNA 1P7DA 3H8SA 4F5QA 1X9XA 5KFPA 4ECYA 1D8BA 5CRXA 3EPIA 3F2CA 3RJEA 5ALPA 4YP3A 4RQ0A 1ZQOA 3IM1A 2DWQA 3HRDD 7ICOA 2Y1IA 4I2CA 2I5HA 1WCLA 2QB1A 1B22A 3SI8A 4RUCA 3AU6A 3FYHA 4F93B 2ASJA 2JRZA 3CRXA 2V4QA 2W3RA 4I2JA 2YMLA 3OTQA 1KDHA 2HOQA 3GFKB 1SV0A 3L3FX 5J2GA 4J9NA 1TV9A 3C5GA 2OYYA 3GIIA 3SR6A 1CUKA 1XWLA 5HMLA 2NRVA 4JV1A 4BXOB 4O3MA 3ORYA 2Q0ZX 1JALA 4Z6FA 3K4GA 1S9FA 4M9GA 1VDVA 1X9MA 2RP5A 4YVZA 4DF8A 2DF4B 3SQIA 2J6SA 3GIMA 4B9LA 5T14A 2KEYA 3BQ0A 2JEJA 1T8EA 3E58A 4ED3A 1LB2B 3RBEA 2F8LA 4CCHA 5JUMA 4DFDA 1ZQSA 1NKBA 4YN4A 2PMZC 1X6IA 5AKGA 3T5HA 1B4FA
chains in the Genus database with same CATH topology
2E8NA 1JI7A 4RQNA 1LKYB 2F3NA 2KMDA 1X9XA 2GLEA 5KNIA 2KSOB 1SXEA 1SGGA 2QB0B 2EAOA 4PZOA 5JRTA 2JV3A 3TACB 4NJ8A 1Z1VA 2D8CA 1F0MA 3K1RB 1V85A 2LMRA 2KG5A 1WWUA 2LPEA 2F8KA 2K60A 2QARB 1B0XA 2QB1A 2ESEA 4IS7A 1COKA 2EANA 5JU5A 2L5YA 1OW5A 2QKQA 1PK1A 3SEIA 1SV0C 2D3DA 2B6GA 3BS5A 2Y9UA 3TADC 2KE7A 1LKYA 1SV0A 1V38A 1SV4A 2KSOA 2QB0A 1UQVA 3TADA 1X40A 3IDWA 3BS7A 2EAPA 4NL9C 1X66A 3BQ7A 4NL9A 2E8MA 2YTUA 1RG6A 2K4PA 2QARA 2KIVA 2E8OA 5J8YC 4MHVA 1SXDA 4PZNA 1WWVA 2EAMA 5J8YA 3HILA 2DKZA 3SENA 2F44A 2ES6A 2Y9TA 4RQMA 2DKXA 5F3XB 1OXJA 1KW4A 1UCVA 2FE9A 3KKAC 1PK3A 2DL0A 3H8MA 5JTIA 1DXSA 2E8PA 5L1MA 3KKAA 1PK1B 1B4FA 3BS5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8N A;  1JI7 A;  4RQN A;  1LKY B;  2F3N A;  2KMD A;  1X9X A;  2GLE A;  5KNI A;  2KSO B;  1SXE A;  1SGG A;  2QB0 B;  2EAO A;  4PZO A;  5JRT A;  2JV3 A;  3TAC B;  4NJ8 A;  1Z1V A;  2D8C A;  1F0M A;  3K1R B;  1V85 A;  2LMR A;  2KG5 A;  1WWU A;  2LPE A;  2F8K A;  2K60 A;  2QAR B;  1B0X A;  2QB1 A;  2ESE A;  4IS7 A;  1COK A;  2EAN A;  5JU5 A;  2L5Y A;  1OW5 A;  2QKQ A;  1PK1 A;  3SEI A;  1SV0 C;  2D3D A;  2B6G A;  3BS5 A;  2Y9U A;  3TAD C;  2KE7 A;  1LKY A;  1SV0 A;  1V38 A;  1SV4 A;  2KSO A;  2QB0 A;  1UQV A;  3TAD A;  1X40 A;  3IDW A;  3BS7 A;  2EAP A;  4NL9 C;  1X66 A;  3BQ7 A;  4NL9 A;  2E8M A;  2YTU A;  1RG6 A;  2K4P A;  2QAR A;  2KIV A;  2E8O A;  5J8Y C;  4MHV A;  1SXD A;  4PZN A;  1WWV A;  2EAM A;  5J8Y A;  3HIL A;  2DKZ A;  3SEN A;  2F44 A;  2ES6 A;  2Y9T A;  4RQM A;  2DKX A;  5F3X B;  1OXJ A;  1KW4 A;  1UCV A;  2FE9 A;  3KKA C;  1PK3 A;  2DL0 A;  3H8M A;  5JTI A;  1DXS A;  2E8P A;  5L1M A;  3KKA A;  1PK1 B;  1B4F A;  3BS5 B; 
#chains in the Genus database with same CATH topology
 5ALJ A;  4C8M A;  4Z6C A;  2F3N A;  2KMD A;  4P0Q A;  4KLU A;  5ALH A;  5ALO A;  4M47 A;  4Y2T A;  2JH1 A;  1XO1 A;  2KNJ A;  1ZJN A;  3WU2 U;  2HHT A;  3M9N B;  2H3I A;  3VC8 A;  3CP8 A;  4RNO A;  4UB6 U;  1RDF A;  2KVS A;  4UB4 A;  2AQ0 A;  2LPE A;  3RR7 A;  2I1Q A;  5J0Y A;  7ICG A;  1Z00 A;  5ALW A;  4P0P B;  3WKB A;  2JH7 A;  4GXI A;  5DB9 A;  3KHL A;  1BPZ A;  3V6J A;  4KN4 A;  1MA7 A;  1PK1 A;  4F5P A;  4QIW C;  5KFQ A;  4RQ4 A;  9ICF A;  3LK9 A;  4UB2 A;  3J81 j;  1WG8 A;  3BZK A;  4JV0 A;  3WK7 A;  4RQ5 A;  2G5H B;  4J9R A;  2JEF A;  5DDM A;  5DQG A;  4KLQ A;  2XCA A;  5CJ7 A;  4FFD A;  2FPK A;  3GIL A;  2EAP A;  5KFA A;  1X66 A;  5KT4 A;  2JXJ A;  1DK3 A;  4ELV A;  1XC9 A;  4NLG A;  4F4Z A;  1ZOL A;  1ZET A;  2E8O A;  1RZT A;  2WB1 C;  2G08 A;  2RRD A;  4IRD A;  1S5L U;  2AQ4 A;  5L1L A;  3MC1 A;  4QZE A;  3MGH A;  3C2K A;  1DRG A;  4I2H A;  3LWL A;  4UB8 U;  1KW4 A;  1A77 A;  2BCU A;  3AQE A;  5L1M A;  2H3V A;  1JX4 A;  1HUZ A;  2W7P A;  5EWE A;  2FMS A;  3EW9 A;  4ECW A;  4IL6 U;  1ZQQ A;  2KIW A;  3HWT A;  4UB1 A;  3SAG A;  4EX6 A;  2BPF A;  7ICK A;  3RJI A;  1ZRM A;  2Q4T A;  3ICX A;  3MGV A;  2KD1 A;  2YB1 A;  5AI5 A;  4P2H A;  4UBC A;  8ICF A;  1F0M A;  2W03 A;  5J29 A;  1K5O A;  2UVU A;  2PXI A;  1CI4 A;  1COO A;  3B9J A;  4QZD A;  3F5A A;  4C0Z A;  5KFZ A;  5J0W A;  3JPP A;  5DB7 A;  5D4B A;  1ZQI A;  7ICV A;  4EYI B;  2ASL A;  1KKX A;  3PML A;  1SKS A;  5J0P A;  1NJW A;  4LZG A;  3WKD A;  3BDP A;  4K4H A;  4O3O A;  5J0O A;  4DQQ A;  3Q8R B;  1ZYQ A;  1PZN A;  4F2S A;  4KLJ A;  5AM4 A;  2HBL A;  3HPO A;  4QZG A;  4J9Q A;  4ED1 A;  3N7P D;  3MR6 A;  3D2S A;  4RPX A;  3V6H A;  4F5N A;  4F8R A;  1H38 A;  2KV2 A;  3ZD8 A;  2ZJA A;  8ICX A;  8ICK A;  4Y2V A;  3ZDE A;  2P6R A;  4EEK A;  5ALK A;  1TE2 A;  4RNM A;  4UQG A;  2DKZ A;  1XSP A;  4PPX A;  1NJZ A;  4Z6D A;  2AJQ A;  4Y2P A;  2MUT B;  2YN4 A;  1ZXI A;  2KJ5 A;  3PY8 A;  2MA1 A;  3KFU F;  4BWM A;  2KVC A;  2R8J A;  5J0S A;  4K4I A;  4C4T A;  5HHH A;  5ALG A;  1ZQW A;  2E3T A;  2ATL A;  3ZDC A;  5EWG A;  1JI7 A;  2M0N A;  3RH4 A;  1LKY B;  3C28 A;  4WJ3 B;  4PGX A;  3H0L B;  4ECS A;  4F4Y A;  4ECQ A;  4J9S A;  2EQY A;  4DQI A;  1X9W A;  2HOI A;  1DK2 A;  1J97 A;  3TAC B;  2ZTD A;  3QNM A;  3QUQ A;  3T79 A;  1MQ3 A;  1ZQM A;  4BX9 C;  2NO5 A;  3F2D A;  3LVW A;  4I2B A;  3TAN A;  3OHA A;  3C1Y A;  3GZF A;  2G5I B;  1S8O A;  1RYR A;  5B66 U;  1JN3 A;  5DBA A;  2ZUB A;  5AKZ A;  2IHN A;  3RJH A;  2K8A A;  1TK5 A;  4XRH A;  3M8R A;  5AKJ A;  1ZD5 A;  3PZP A;  3TAD C;  4YXM A;  5AKX A;  3JPS A;  4RT2 A;  2NRT A;  2BDP A;  3G6X A;  4DL3 A;  2ASD A;  2XVT A;  2CPR A;  4RUA A;  2ZXI A;  5B5E U;  3QU4 A;  1PUZ A;  2KN7 A;  3PMN A;  5CB1 A;  4O3P A;  5DLG A;  3RAX A;  8ICN A;  5AM5 A;  1KBU A;  8ICQ A;  5IIN A;  3C29 A;  2BDU A;  1WWV A;  4YMM A;  2EZY A;  5AIB A;  3TI0 A;  3SEN A;  4OO1 J;  3JPR A;  2AXT U;  1L7N A;  1KQQ A;  4EEY A;  2LM4 A;  3M9O B;  2Y9T A;  5J2I A;  2WF5 A;  2HHV A;  3L4P A;  2DKX A;  3M6Z A;  1NZB A;  4F5R A;  4Y2Q A;  2E8P A;  4M2Y A;  1L7O A;  4IC9 A;  4LJX A;  3DDH A;  2KFN A;  2E8N A;  1CEZ A;  5EE0 A;  3D6J A;  2A1A A;  3MFI A;  5ALU A;  1FEZ A;  3QU5 A;  3A0H U;  4GXJ A;  5KG2 A;  1UA1 A;  1T7P A;  2IOF A;  9ICH A;  8ICM A;  2GWS A;  4F5O A;  5JRT A;  3TAQ A;  4DSK A;  1QQ6 A;  4QZI A;  3WKE A;  4R63 A;  5AI6 A;  1Q3V A;  5BOM A;  4EEL A;  2LMR A;  2KG5 A;  5EE9 A;  4DS4 A;  3UPQ A;  5AM0 A;  2K60 A;  1SL1 A;  2NV3 A;  1LV5 A;  7ICN A;  2GH1 A;  5CP2 A;  4IQT A;  4M9N A;  4J9M A;  3TAP A;  1S0M A;  4RQ3 A;  1PVP A;  1D8Y A;  1N63 A;  1SV0 C;  4YQW A;  1NK8 A;  3BS5 A;  3ZDA A;  1ZQF A;  2W55 A;  2OWO A;  3RTV A;  1IV8 A;  1C7Y A;  2A1J A;  5IIJ A;  3OJU A;  4KLD A;  4LVS A;  2DUY A;  2F77 X;  1L7M A;  9ICE A;  5KL1 B;  3C2M A;  2J6U A;  4ELT A;  2HDO A;  1SIJ A;  1SKW A;  3KTQ A;  8ICU A;  1SWW A;  4I2D A;  3PR5 B;  4KTQ A;  3ISD A;  3N4M B;  4TUQ A;  5J2C A;  1ZQE A;  4C8N A;  2W8K A;  1KFS A;  2UVW A;  4ECR A;  3C21 A;  2H3F A;  1D9D A;  1RYS A;  3WKC A;  4FZN A;  3T5L A;  2JZB B;  2G06 A;  1L5U A;  4QIW F;  2JGA A;  5KG3 A;  4M9J A;  9ICG A;  2EAM A;  1S77 D;  4KLI A;  9ICR A;  2FJ6 A;  3AEV A;  1A6S A;  4NXZ A;  5DLF A;  4DCC A;  3JPN A;  1ZQY A;  2YQE A;  3KKA A;  2KK0 A;  3AU2 A;  2XY5 A;  1Z1B A;  2F1I A;  3C1Z A;  1ARO P;  4CRX A;  1TAQ A;  4US9 A;  3OJS A;  2HHW A;  4P4P A;  2YMP A;  4GFJ A;  4QNL A;  3NTU A;  1QSS A;  4YXJ A;  1TVA A;  2HBK A;  3L5K A;  3UMC A;  4KLM A;  3RJK A;  1SB3 C;  3PSF A;  5KFT A;  1LVH A;  3GDX A;  1ZD4 A;  2XIC A;  3V6K A;  5KT5 A;  3QE9 Y;  2H5X A;  3JPQ A;  3EPG A;  1Z4O A;  4G3I A;  9ICM A;  4DEZ A;  2KP7 A;  4O9M A;  1B0X A;  3EZ5 A;  4PHA A;  3BZC A;  3SEI A;  2B6G A;  2WAQ F;  1L8L A;  5E79 U;  1HIW A;  3RB3 A;  4OD0 A;  5GTH U;  3N97 B;  1JXL A;  2GO7 A;  1D9F A;  2BPG A;  5DKW A;  3PW4 A;  3WK4 A;  3HX0 A;  3UXN A;  4CF5 A;  2ZTC A;  2J6T A;  4DLG A;  3ETR A;  3SZ2 A;  1PVR A;  2ZIW B;  1ZQD A;  5III A;  3QEA Z;  4KX5 A;  5AKI A;  1QH9 A;  4ED2 A;  1Z00 B;  5CEH A;  5ALY A;  3QZ8 A;  4KLL A;  5J2A A;  2BGW A;  2VKQ A;  1KN5 A;  5AK6 A;  4I29 A;  5KT2 A;  5DBC A;  4EEN A;  5KFR A;  4KN7 A;  3WKA A;  1S97 A;  9ICI A;  4USA A;  2ZIX A;  5KFO A;  9ICW A;  2VAN A;  4RU9 A;  1KSP A;  4I2I A;  3AN1 A;  4UAR A;  3RF9 A;  2ZIV B;  1TK0 A;  4DFP A;  1CRX A;  4OJ5 A;  4M6W B;  1U45 A;  1N48 A;  4KLO A;  2R8H A;  2VIX A;  2HSZ A;  2C22 A;  2P35 A;  4NLN A;  5AM1 A;  3LVV A;  4ED8 A;  2R8G A;  2KSO B;  1Y88 A;  2FLL A;  4B9N A;  3RJF A;  8ICI A;  4RQ2 A;  2AGO A;  3K1Z A;  5KG4 A;  4NJ8 A;  1KTQ A;  2ZIU A;  3G6Y A;  2YX8 A;  1NNL A;  2NRW A;  4B9U A;  2FDR A;  5KFV A;  1X6J A;  3I1Y A;  4C4S A;  5DQI A;  4TUR A;  1BNO A;  2CN1 A;  1SL2 A;  3AMZ A;  3CW2 C;  1N5W A;  2KIC A;  4PH5 A;  1MQ2 A;  1X9S A;  2FMQ A;  1BPB A;  2KTQ A;  4J9L A;  9ICQ A;  3B0Y A;  3RH6 A;  5FP0 A;  4EBC A;  1N60 A;  1VJ5 A;  7ICH A;  3PST A;  3FM9 A;  4JWN A;  1BPD A;  3M7D A;  4I27 A;  2YTU A;  1IM4 A;  4NY8 A;  3JPT A;  4CGZ A;  4QZ9 A;  1Q3U A;  4Y2U A;  4TUP A;  1XSN A;  1SXD A;  1WYG A;  4DQS A;  3D2N A;  5AK5 A;  4RPZ A;  4YR2 A;  3SMV A;  5CA7 A;  2OXO A;  4YD1 A;  1JMS A;  2HBJ A;  1ZQN A;  5HR7 A;  4RQ8 A;  1ZJM A;  4RQ1 A;  3LWM A;  3RAQ A;  5ALL A;  2V4R A;  4Q43 A;  2WHE A;  5JTI A;  5CWR A;  3H8W A;  1FO4 A;  4MF2 A;  4BXO A;  1ZQT A;  1K1S A;  2HVH A;  4DOB A;  5ALI A;  2AU0 A;  4OJL A;  1QSY A;  4JMU A;  2QB0 B;  9ICK A;  3BQ2 A;  5L1J A;  5ALQ A;  4DFJ A;  5J0X A;  3QU7 A;  5AI8 A;  1NK0 A;  4F91 B;  4M04 A;  1Z1V A;  2ALZ A;  4EZ6 A;  3NGD A;  5DGA A;  1X2I A;  4OJO A;  3WK6 A;  2OHF A;  4QZF A;  4I2A A;  5L1K A;  2WAQ C;  3IG8 A;  2LI6 A;  1SZH A;  2KJ8 A;  2BZF A;  2L5Y A;  3B0X A;  5C5J A;  2QKQ A;  1IXR A;  5KFX A;  3TFR A;  2E5S A;  1TFR A;  3F53 A;  3PSP A;  5AKY A;  1M6Y A;  2C2D A;  8ICP A;  5KFI A;  2G07 A;  1V9P A;  4MFA A;  3RRG A;  1XO0 A;  2N1R A;  4AP9 A;  5KFN A;  4F92 B;  3UXP A;  3WK5 A;  3PX0 A;  2P6U A;  4P4M A;  2KIV A;  4UAV A;  4P0P A;  4I2F A;  1N5X A;  5KG0 A;  4DSF A;  4FE3 A;  1S0O A;  2B0C A;  4M9L A;  4K4G A;  5J8Y A;  5DBB A;  1YT3 A;  2F44 A;  5DQH A;  1QLN A;  1N62 A;  1VLB A;  5J2H A;  5L9X A;  1Z4N A;  3EWA A;  5KAI U;  3M1Y A;  2HW3 A;  3S6J A;  3NRZ A;  1Z19 A;  3RFA A;  5KFY A;  4J9O A;  1SZP A;  2HI0 A;  1DOQ A;  2DFL A;  3QYP A;  9ICN A;  2G0A A;  3V7K A;  3FC4 A;  3KHH A;  2KOB A;  4JB3 A;  2D8C A;  1QQ5 A;  4CF3 A;  5AKH A;  5KFW A;  1ZQB A;  5DG7 A;  2BR0 A;  3I76 A;  2YMQ A;  3PW7 A;  5ALM A;  5KFJ A;  1O08 A;  4C8O A;  4PGY A;  2XY7 A;  1AQ6 A;  2D3D A;  3BQ1 A;  1L3V A;  3KBB A;  9ICC A;  3NVZ A;  2Y0S F;  5AK4 A;  2BQU A;  2W9B B;  1ZQP A;  1SV4 A;  4G9B A;  3CYM A;  4EZ9 A;  4NM1 A;  2M9N A;  4QZA A;  2W04 A;  1U9L A;  4YR3 A;  2F1J A;  3UXO A;  3V7J A;  5DG8 A;  4OCZ A;  1KEJ A;  3KZX A;  3D2Q A;  3PVX A;  4A8E A;  2FPM A;  3SAH A;  9ICX A;  4UAS A;  4EBE A;  3F5E A;  4MEY A;  3UQ2 A;  1HUO A;  2LYB A;  5KFL A;  4LZD A;  1L3T A;  2W9C B;  2R8I A;  5KFS A;  3HKZ F;  8ICY A;  4Y2S A;  2W7O A;  5TZV A;  1FFU A;  5AKE A;  1S76 D;  2VJ5 A;  1ZQZ A;  5ALZ A;  5F3X B;  2H3Q A;  2OCE A;  3KKA C;  4C7Y A;  4DL5 A;  4UB5 A;  1J2M A;  2LYA A;  4DL7 A;  1RQL A;  1RM6 C;  1U4B A;  1ZQX A;  2OH2 A;  5ALN A;  2FI1 A;  8ICJ A;  4RQ7 A;  5KFH A;  4F71 A;  5G5G A;  4CE6 A;  4ACO A;  2AHO B;  4PL2 A;  4F4W A;  2ISO A;  2FMP A;  1QQ7 A;  1MC8 A;  1IIP A;  5KFB A;  4ECU A;  8ICH A;  2KKP A;  4F4K A;  5IIM A;  4MFC A;  1C20 A;  1KFT A;  2F8K A;  5D49 A;  3MR2 A;  2QAR B;  4O3R A;  4ED6 A;  2EAN A;  5JU5 A;  2FLP A;  2BCQ A;  1OW5 A;  4QWA A;  4I2E A;  2K4I A;  3RB6 A;  1LKY A;  2BCR A;  4B6J A;  2R18 A;  3GV7 B;  3AM9 A;  4DF4 A;  4R8U B;  5KTQ A;  1QCK A;  1X40 A;  3OPX A;  4NLZ A;  2IOF K;  3BS7 A;  3OSP A;  3RRH A;  2HHS A;  3IHQ B;  3TFS A;  3NVV A;  1ZD2 P;  4DS5 A;  4OJP A;  3WK9 A;  2KHQ A;  5KFE A;  4O3S A;  2E8M A;  2E1E A;  2LKY A;  5KFU A;  3Q8P B;  4UW9 A;  3H4B A;  2UVR A;  2C28 A;  1J2N A;  4FS2 A;  4KLF A;  3T3F A;  3BJY A;  4E0D A;  1TAM A;  1S0V A;  1SWV A;  1XU4 A;  3Q8Q B;  1D8L A;  3T5K A;  4ZOH C;  2OM6 A;  1HJP A;  2DL0 A;  2E1F A;  3NS1 A;  5KFF A;  4FZL A;  4Y2X A;  5EWF A;  1ZQV A;  1L8O A;  2IHM A;  4ECT A;  2BCV A;  4RQ6 A;  2I9G A;  3IP4 B;  3JPO A;  2MSN A;  2YY6 A;  1BPE A;  1ZQC A;  2XCP A;  3PO5 A;  2HOF A;  1N2X A;  4DL4 A;  5KT7 A;  1U47 A;  3RR8 A;  3IV6 A;  4DSL A;  1NK9 A;  1L3S A;  1BPY A;  1T3Q A;  3UMB A;  1U48 A;  3G6V A;  8ICC A;  4DSJ A;  1ZQU A;  2NRZ A;  3GU3 A;  4RPY A;  3SAF A;  5AM3 A;  1V97 A;  2CRX A;  5IIK A;  3PO4 A;  4RT3 A;  4ZH4 A;  2Y0S C;  1BVS A;  1COK A;  4F50 A;  4BGD A;  5IIL A;  7ICU A;  4TUS A;  3ALR A;  2RDJ A;  2VA8 A;  1V38 A;  1N56 A;  5DGB A;  4QW8 A;  2H3Z A;  3MDC A;  2XI9 A;  9ICU A;  3DV9 A;  3PW5 A;  3GIK A;  3ONN A;  2VA3 A;  4DQP A;  4C7Z A;  2IA6 A;  4F72 A;  3GQC A;  2W9A A;  4I2G A;  4NL9 A;  4UAY A;  3HKZ C;  2DPI A;  4GIB A;  1RG6 A;  4P0Q B;  3MR5 A;  1S0N A;  3KZI U;  5IIO A;  1S10 A;  2XID A;  1NZP A;  2KHV A;  2BQR A;  1ECW A;  3M8S A;  4UAZ A;  4JUZ A;  1ZQJ A;  4MF8 A;  5KFD A;  5EE1 A;  2HHU A;  2D6F C;  4UB3 A;  1NKE A;  1JIH A;  3HJE A;  4C8L A;  3Q8K A;  3ED5 A;  1QSL A;  4EYH B;  4IR1 A;  1UCV A;  2B21 A;  2FE9 A;  5KG7 A;  3AQF A;  3UQ0 A;  2JEI A;  4X5V A;  2WF9 A;  3H7I A;  4XA5 A;  4DOA A;  1PK1 B;  4ICA A;  2PKE A;  1KFD A;  4O0I A;  4QWD A;  1UPH A;  4J03 A;  9ICV A;  5J0U A;  2EZZ A;  2G09 A;  3IRU A;  1DGS A;  2AGP A;  4ED0 A;  9ICT A;  2DBY A;  3EUB 2;  3IN5 A;  1NK4 A;  5AM2 A;  2W54 A;  4Z6E A;  2JZB A;  4MEX A;  4B9T A;  2WFA A;  2ISP A;  2WTF A;  5DG9 A;  9ICJ A;  2PI5 A;  3ETL A;  2YB4 A;  4NM2 A;  3A0B U;  3Q8M A;  8ICO A;  1U49 A;  2BKE A;  5AIC A;  4HYK A;  4QWC A;  3RH5 A;  5AI9 A;  2WF8 A;  2AGQ A;  3QUT A;  1N61 A;  5CR0 A;  2PI4 A;  3MAB A;  1YZ6 A;  2WF7 A;  2ODG A;  3HW8 A;  1JXE A;  3MBY A;  2UVV A;  3N7R C;  5KFM A;  1ZQR A;  3SYZ A;  1UQV A;  2KZZ A;  2LHT A;  1SL0 A;  1NI3 A;  8ICR A;  4FS1 A;  1BGX T;  7ICI A;  8ICZ A;  4QJF B;  4XUS A;  3H8J A;  2RHF A;  1UT8 A;  2HVI A;  5F9N A;  4CF4 A;  1FFV A;  4YD2 A;  2W3S A;  2XC9 A;  4DO9 A;  1XSL A;  5J8Y C;  4Y2J A;  3T5J A;  1ZRN A;  5HHI A;  4TQS A;  4YCX A;  2XY6 A;  3HIL A;  5DB6 A;  2JEG A;  3SD7 A;  3RJG A;  4UAT A;  8ICE A;  1L3U A;  1RPL A;  3PX4 A;  1UA0 A;  4QZH A;  4YMN A;  5H2F U;  3H8M A;  3NAS A;  2JR5 A;  3PW0 A;  1NK7 A;  2W8L A;  5TIS U;  3IG5 A;  3N7S C;  5J2K A;  2ZIW A;  5ALS A;  2IMW P;  1SXE A;  2EAO A;  4EBD A;  3QZ7 A;  4FO6 A;  3FDS A;  3HP6 A;  2HCF A;  3M6K A;  1WUD A;  3QU2 A;  2LYH A;  4BUG A;  5AK3 A;  3PR4 A;  5ALV A;  5DDY A;  4QZ8 A;  2CXY A;  2IOH A;  2ZIV A;  1TKD A;  9ICO A;  3NUQ A;  2EH9 A;  4M6W A;  2KFZ A;  2MRL A;  7ICE A;  7ICJ A;  1ZQ1 C;  2Y9U A;  5EOZ A;  2VA2 A;  2KE7 A;  1A0P A;  4UAW A;  4PHE A;  4JWM A;  2KSO A;  4IRC A;  4QZC A;  2KZM A;  4ECX A;  5J0Q A;  5D46 A;  8ICB A;  2LBO A;  3TAR A;  1Q46 A;  3WK8 A;  2Y1J A;  2P66 A;  2K8C B;  4DLE A;  2BQ3 A;  2BHN A;  5J2F A;  3E2E A;  4F2R A;  3DEE A;  3ZDB A;  1HEK A;  1QTM A;  3FAH A;  2NRX A;  5AKL A;  1RXW A;  3QUB A;  2ZJ5 A;  2AH5 A;  4F3O A;  4PJ0 U;  2O6K A;  3KHG A;  4QWE A;  5C0Y A;  2F2A B;  1DGJ A;  4I28 A;  1IG6 A;  1JRP A;  3QU9 A;  1MN8 A;  4IR9 A;  1F5S A;  3ISB A;  4M9H A;  4NV0 A;  4PHD A;  2K8B B;  4YR0 A;  4DQR A;  4O3N A;  5J0T A;  5J2J A;  3GV8 B;  1K1Q A;  3ZD9 A;  5HP4 A;  4HAI A;  2EZX A;  4DSE A;  2PFQ A;  5K4L A;  1XNS A;  5DB8 A;  1JUD A;  5EE3 A;  4FBU A;  2ZUC A;  4GXK A;  5ALE A;  8ICT A;  5KNI A;  4UBB A;  2W43 A;  4PHP A;  5ALT A;  4GC7 A;  9ICB A;  5J2B A;  2HHQ A;  2JV3 A;  2V9W A;  8ICG A;  3MFH A;  3K1R B;  4DFK A;  3Q8L A;  5AHX A;  1RYU A;  1T94 A;  1X42 A;  5G5H A;  4P4O A;  3GIJ A;  2EDU A;  7ICS A;  4GLX A;  4CDG A;  1Q8K A;  3C5F A;  4JV2 A;  2C2E A;  7ICT A;  3RBD A;  4ED7 A;  1NK5 A;  4R66 A;  4Y2Y A;  1UHU A;  2MU2 A;  3GV5 B;  3PX6 A;  8ICA A;  4U6P A;  4RNN A;  4KLS A;  3VCB A;  2QB0 A;  4DSI A;  8ICV A;  3OHB A;  4M0A A;  2W9M A;  4R64 A;  1KLN A;  1SKR A;  1KRP A;  4PL1 A;  3QX7 A;  2GOL A;  3SV4 A;  5AI0 A;  5GTI U;  1RXV A;  5KT6 A;  2KJ9 A;  3BQ7 A;  5ALX A;  2BCS A;  1NJX A;  4TQR A;  4ECV A;  3C2L A;  1UT5 A;  5L1I A;  2K4P A;  4B9M A;  4C8K A;  3O0F A;  2C2R A;  1MSW D;  2HMX A;  8ICS A;  3EYZ A;  4ELU A;  2R8K A;  4BJQ A;  5BOL A;  4QW9 A;  2FPL A;  1NK6 A;  2YMM A;  1TAU A;  1ED1 A;  4YMO A;  4J9P A;  5KAF U;  7ICF A;  4O5K A;  2NO4 A;  1ZQH A;  4F4X A;  3CNH A;  2ES6 A;  3NVY A;  4IQU A;  2ZUD A;  2IBK A;  5J2D A;  2RQ5 A;  5AIA A;  2RDI A;  4QZB A;  5HMM A;  9ICL A;  3BS5 B;  1OUQ A;  1XS9 D;  4Q8F A;  1NKC A;  2A1J B;  4AYB F;  4U7C A;  1BNP A;  1KL9 A;  1SGG A;  4PZO A;  4MFF A;  5AKK A;  3RB4 A;  2XGP A;  3V72 A;  4UAU A;  2OEH A;  2HBM A;  1ZQG A;  4QWB A;  4DWI A;  4DL2 A;  3UM9 A;  1V85 A;  3LYS A;  4Y2R A;  1WWU A;  7ICL A;  5ALF A;  3HT3 A;  3LDA A;  2ESE A;  3V7L A;  1YZ7 A;  4CNQ A;  3C23 A;  4FZM A;  5KG6 A;  1Z3E B;  2ZJ8 A;  4IQW A;  1B43 A;  2K4E A;  5A0L A;  1TK8 A;  4R65 A;  4DFM A;  3PNC A;  5KL8 B;  3OGU A;  3RJJ A;  2VJ4 A;  4KMU A;  2MAX A;  2PFP A;  3OSN A;  2A3V A;  3F2B A;  4ECZ A;  3THV A;  2MUT A;  2F76 X;  1O03 A;  5KG1 A;  5ALD A;  2K4H A;  5HNK A;  4C4R A;  4NL9 C;  3SV3 A;  1T3N A;  1JRO A;  2ZG6 A;  5ALR A;  3H0M B;  4DOC A;  3E0F A;  3BQT A;  4XQ8 A;  1ZD3 A;  1NOM A;  3UMG A;  2XO7 A;  2JHD A;  1RQN A;  4YG2 A;  2BPC A;  3MDA A;  1EXN A;  4KMO B;  4PZN A;  2RLT A;  4KLT A;  4US8 A;  3QXG A;  9ICS A;  5HR6 A;  2DGZ A;  2W9B A;  2DPJ A;  2KZ3 A;  1BPX A;  2JMG A;  5J2E A;  1OXJ A;  1PK3 A;  4BDP A;  2XGQ A;  3AUO A;  3R9K A;  4Q8E A;  3ZI4 A;  4JK1 A;  4NLC A;  4KLH A;  5KG5 A;  4YFK A;  4NLB A;  2PMZ F;  4GC6 A;  2GLE A;  3TQ1 A;  3QEB Z;  4NWI A;  4Q45 A;  1A76 A;  3MGI A;  4EX7 A;  3QUC A;  5KFC A;  2W9C A;  3KOO A;  4RZR A;  5KT3 A;  1ZQA A;  4KX3 A;  3U26 A;  3H4D A;  3TKA A;  5KFK A;  1PVQ A;  4O5C A;  3NRW A;  2FLN A;  4IRK A;  3AL0 B;  3MR3 A;  4J9K A;  4DL6 A;  3H40 A;  4IS7 A;  1FIQ A;  3KHR A;  1T4G A;  5F9L A;  4IQV A;  4PGQ A;  1ZQK A;  4FBT A;  4O5E A;  7ICM A;  1L6N A;  9ICP A;  3RB0 A;  8ICL A;  7ICR A;  2ZIX B;  2QLT A;  3PW2 A;  3TAD A;  3I28 A;  5BPC A;  3IDW A;  3Q8S B;  2A19 A;  3ZDD A;  1URJ A;  4O3Q A;  3N28 A;  2ZXH A;  4BWJ A;  2HHX A;  9ICA A;  4NLK A;  1WCN A;  1F44 A;  3KD3 A;  3PSI A;  2PFO A;  3PV8 A;  2QAR A;  2PFN A;  2I6X A;  3M9M B;  3K75 D;  1ZQL A;  4MHV A;  2K89 A;  2ZIU B;  5J0R A;  3H0R B;  4KLG A;  3NVW A;  4B9V A;  4OJ6 A;  2DQN B;  2WB1 F;  5KFG A;  7ICP A;  5CHG A;  4KIT B;  2F1H A;  5AI4 A;  2WF6 A;  4RQM A;  4KLE A;  2LM1 A;  2W11 A;  4R8U A;  3ISC A;  8ICW A;  2ZTE A;  1DXS A;  2Z7J A;  1L7P A;  4C80 A;  4AYB C;  4B9S A;  1GO3 F;  2NYV A;  4Q44 A;  7ICQ A;  2KKV A;  1NJY A;  4RQN A;  1P7D A;  3H8S A;  4F5Q A;  1X9X A;  5KFP A;  4ECY A;  1D8B A;  5CRX A;  3EPI A;  3F2C A;  3RJE A;  5ALP A;  4YP3 A;  4RQ0 A;  1ZQO A;  3IM1 A;  2DWQ A;  3HRD D;  7ICO A;  2Y1I A;  4I2C A;  2I5H A;  1WCL A;  2QB1 A;  1B22 A;  3SI8 A;  4RUC A;  3AU6 A;  3FYH A;  4F93 B;  2ASJ A;  2JRZ A;  3CRX A;  2V4Q A;  2W3R A;  4I2J A;  2YML A;  3OTQ A;  1KDH A;  2HOQ A;  3GFK B;  1SV0 A;  3L3F X;  5J2G A;  4J9N A;  1TV9 A;  3C5G A;  2OYY A;  3GII A;  3SR6 A;  1CUK A;  1XWL A;  5HML A;  2NRV A;  4JV1 A;  4BXO B;  4O3M A;  3ORY A;  2Q0Z X;  1JAL A;  4Z6F A;  3K4G A;  1S9F A;  4M9G A;  1VDV A;  1X9M A;  2RP5 A;  4YVZ A;  4DF8 A;  2DF4 B;  3SQI A;  2J6S A;  3GIM A;  4B9L A;  5T14 A;  2KEY A;  3BQ0 A;  2JEJ A;  1T8E A;  3E58 A;  4ED3 A;  1LB2 B;  3RBE A;  2F8L A;  4CCH A;  5JUM A;  4DFD A;  1ZQS A;  1NKB A;  4YN4 A;  2PMZ C;  1X6I A;  5AKG A;  3T5H A;  1B4F A; 
#chains in the Genus database with same CATH homology
 2E8N A;  1JI7 A;  4RQN A;  1LKY B;  2F3N A;  2KMD A;  1X9X A;  2GLE A;  5KNI A;  2KSO B;  1SXE A;  1SGG A;  2QB0 B;  2EAO A;  4PZO A;  5JRT A;  2JV3 A;  3TAC B;  4NJ8 A;  1Z1V A;  2D8C A;  1F0M A;  3K1R B;  1V85 A;  2LMR A;  2KG5 A;  1WWU A;  2LPE A;  2F8K A;  2K60 A;  2QAR B;  1B0X A;  2QB1 A;  2ESE A;  4IS7 A;  1COK A;  2EAN A;  5JU5 A;  2L5Y A;  1OW5 A;  2QKQ A;  1PK1 A;  3SEI A;  1SV0 C;  2D3D A;  2B6G A;  3BS5 A;  2Y9U A;  3TAD C;  2KE7 A;  1LKY A;  1SV0 A;  1V38 A;  1SV4 A;  2KSO A;  2QB0 A;  1UQV A;  3TAD A;  1X40 A;  3IDW A;  3BS7 A;  2EAP A;  4NL9 C;  1X66 A;  3BQ7 A;  4NL9 A;  2E8M A;  2YTU A;  1RG6 A;  2K4P A;  2QAR A;  2KIV A;  2E8O A;  5J8Y C;  4MHV A;  1SXD A;  4PZN A;  1WWV A;  2EAM A;  5J8Y A;  3HIL A;  2DKZ A;  3SEN A;  2F44 A;  2ES6 A;  2Y9T A;  4RQM A;  2DKX A;  5F3X B;  1OXJ A;  1KW4 A;  1UCV A;  2FE9 A;  3KKA C;  1PK3 A;  2DL0 A;  3H8M A;  5JTI A;  1DXS A;  2E8P A;  5L1M A;  3KKA A;  1PK1 B;  1B4F A;  3BS5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...