1XA0A

Crystal structure of mcsg target apc35536 from bacillus stearothermophilus
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
328
structure length
318
Chain Sequence
MSAFQAFVVNKTETEFTAGVQTISMDDLPEGDVLVRVHYSSVNYKDGLASIPDGKIVKTPFVPGIDLAGVVVSSQHPRFREGDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAMAIGTAGFTAALSIHRLEEHGLTPERGPVLVTGATGGVGSLAVSMLAKRGYTVEASTGKAAEHDYLRVLGAKEVLARELDKQRWAAAVDPVGGRTLATVLSRMRYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVYCPMDLRLRIWERLAGDLKPDLERIAQEISLAELPQALKRILRGELRGRTVVRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MCSG Target APC35536 from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative NADPH Dependent oxidoreductases
total genus 88
structure length 318
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xa0A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1xa0A01
2H9IA 4S3MA 2ET6A 1VKOA 2VCYA 4W6ZA 1P1RA 2VHWA 4H16A 4UUPA 5GMOA 2OL4A 2JKVA 4TRJA 4CM4A 3EAGA 4ZGWA 4EEZA 2PLAA 1PGQA 1XGKA 2QYSA 3AWDA 4BNGA 3UCEA 2HMTA 3BMNB 3GDFA 1JVSA 4YQYA 1Q0LA 4BQRA 2EWMA 3KETA 1V3VA 5K0ZA 2EIHA 3JD0A 2V65A 4MVJD 1N2SA 4GH5A 2NVUA 4R1UA 1P1KA 1E7SA 4GQAA 4MVJA 3N58A 5IDWA 3CINA 1QLHA 1E5QA 1SCUA 1XCBA 3QE3A 3PGXA 2EHDA 1UH5A 3NDIA 3PYLA 4XZ3A 4E4YA 1HT0A 4Q3CA 5JDCA 3DZBA 1D1TA 3WGIA 2ZJ1A 1BXZA 1Y5MA 2Z1NA 1KYQA 3I5MA 2Y67A 3PDUA 3DMYA 5L7YA 3ROMA 4EUHA 2JFHA 3FTPA 3GHYA 3LVFO 3BTUA 5TF4A 1ZUD1 1V3UA 4GI2A 4YRDA 4E33A 3NTQA 1GYRA 4KWHA 2J5RA 4ITUA 3GY0A 3F5QA 2Y1FA 4J7XA 3GPIA 2X5JO 3RFVA 4CMIB 2EERA 4BMVA 2FOIA 4QFCA 2NU6A 4TKMA 4D3FA 3K92A 3S2EA 1NQOA 3PK0A 3DAPA 4N54A 5JCXA 1GEEA 3I9MA 4YTEA 2NV6A 4A27A 2HRBA 4PG6A 4J4TA 4TRMA 1MG5A 1MLDA 1N92A 2I66A 4NU6A 4G2NA 3FF4A 3ZHBA 3COSA 1B3BA 1FMCA 3K2EA 4IDFA 1SPXA 1TEHA 1BW9A 3B1KA 4CL3A 4GPD1 3W4IA 3WGQA 3ROQA 3MJ4A 4UVHA 3AK4A 3KRTA 2W2KB 1C1XB 1LRJA 4D46A 1XG5A 1VJTA 5I8WA 2NM0A 1GZ3A 3HADA 4MIEA 3S8MA 4J90A 4EBFA 5I8ZA 1GQ2A 3EGOA 4BNIA 1H6DA 1EVYA 1KBZA 1R4MA 4INAA 3O4RA 3WGHA 4C4OA 2O23A 3DHNA 4GLLA 4HFRA 5EESA 4QFDA 5KVSA 3BA1A 3PRJA 3DMTC 1NP3A 4E32A 4XRGA 4XR4A 5JS6A 3K6JA 3KEOA 4IQGA 1MC5A 4ALNA 4JK3A 2PGLA 1HKUA 4YT8A 5F3RA 3P5SA 4WGGA 1C0LA 1CJCA 1P0CA 2I5PO 2GUGA 2WYUA 3U4IA 4ONEA 2NU7A 3ZW8A 3VTFA 1Q7BA 3ZU2A 4IY1A 3ROKA 1K5HA 1YWGO 1LC3A 4G5HA 5CAEA 1C14A 4IJUA 3RFXA 4FD3A 1HSZA 3S1LA 4CMIA 1TA4A 5LDGA 5J23A 3DEYX 3AM4A 5IN5A 1PSDA 4GWGA 2FR8A 4AFNA 3FBGA 1SO8A 4PG5A 1ISHA 2NQTA 3K30A 4OIMA 1QLJA 3LT4A 2EKPA 2W90A 3DZGA 1T4BA 2LDXA 4RLHA 1Q1NA 3E18A 4FPXA 4A5OA 2Q99A 1RM0A 4RF4A 4E5MA 4Y98A 1Q7CA 4WCDA 3W4JA 4QO7A 2IYOA 4YT2A 4DTIA 4TKLA 4KTTE 2H6EA 1YJQA 4ZQEA 2VOJA 4I5EA 3BYZA 2O3QA 5IXSA 3OP4A 3VZSA 2JJYA 3WR5A 4PLWA 3Q6IA 4B4UA 1V0JA 1Y9AA 1EE2A 1X7DA 1CEQA 1R0KA 4RVDA 3FHLA 1ZK4A 5EMHA 4YB8A 1H9BA 3S2IA 3VPGA 1DAOA 2EKLA 3V8BA 3ZHXA 2VNAA 3OJLA 4CQMB 1UP4A 3S55A 4A7PA 1N9GA 2D1YA 1LXCA 4TZTA 1G0OA 3P2YA 4L4XA 2XXBA 3ZV5A 1M6HA 2VHVA 4Q3BA 2AEJA 4CQLB 1O9BA 5CEJA 3KYBA 1DSSG 3D3WB 5AXDA 3KV3O 1BMDA 4QO8A 3RVDA 2NTNA 3RROA 2A35A 1G1AA 2P5UA 3TJRA 2BD0A 3G1TA 3GF4A 5A9TA 2FR1A 4F45A 1ZKMA 2EG9A 4R5MA 3V2UA 4FCCA 4R9RA 2EJWA 1PS8A 2OUIA 1LDBA 1T25A 3E82A 4XQEA 2I3AA 3PHGA 3ZDFA 3NV9A 3DO5A 4BV9A 1RM5A 4WLNA 1LRKA 1SC6A 1LNQA 2IZ0A 4CR8A 1A4UA 1CERA 2AW5A 1M75A 1TXGA 5KJ1A 5KOIA 1R6DA 5A02A 1ULUA 2DKNA 1DIAA 3JQ6A 4YEDA 4DIOA 4DLAA 4L4RA 3D5TA 2O3JA 3L4BC 4BO4A 4BNKA 4WCFA 1QR6A 1YH3A 4CLHA 5ITVA 2P91A 3UN1A 3TL3A 5CG1A 4JX8A 5KNLA 3UH1A 1DPGA 5I9LA 2GZ3A 1BGVA 5ES3A 3Q2KA 3ETEA 1BXGA 4PZCA 4ALJA 1WZIA 4DMLA 3K8ZA 1U3TA 4RCVA 1CETA 1ZO8A 4J9VA 4DYDA 1GD1O 4IDAA 3NT5A 4O1MA 3WYEA 3ZWCA 3QIVA 4R1NA 2Z1MA 3CMCO 2YHIB 4J1NA 2B5VA 1EUCA 4P4GA 1B7GO 3AFMA 3TOZA 4MVJI 2WMDA 1I2CA 1ID1A 1LI4A 2HK8A 3VH1A 4KQXA 1BVUA 3C1AA 1H94A 5AXCA 2D0IA 4QEDA 4DBVO 5EN4A 2W8ZA 5G0VA 3BIOA 3RUEA 2E37A 4PG4A 3M6IA 1X1EA 5CDUA 4CM8B 4P38A 5I7FA 1V9LA 3KZVA 4U6QA 2PD3A 3AY7A 3P2OA 1ISMA 4E31A 5LCXA 2NWQA 3ORFA 4NHEA 3RCBA 3U4CA 2CFCA 4EZBA 1ENYA 2GRAA 4L73A 3ZWVA 5K6AC 1B0AA 3PWSA 4HBGA 5BT9A 1PJQA 3CXRA 4YWJA 5JAIA 4E5KA 1EVJA 1WVGA 4FR5A 1JVBA 4TVOA 4ZA2A 3GC6A 5F1OA 3RC2A 2IRWA 1LDGA 2P5YA 4MP6A 4CLXA 4WUVA 3EVTA 4BV8A 3E9MA 1UAGA 4R16A 4OHUA 4OXYA 3PQEA 1WXDA 5EQFA 4RV9A 3ZNNA 2G76A 3UICA 4IXWA 1IHXA 2I65A 1IPEA 2D59A 3PJFA 2I9PA 4MKRA 1PQUA 1NYTA 2Q3EA 4P4NA 3PXXA 4HWKA 5G4LA 3HB4X 1HDCA 4DMMA 2VUSA 3PDJA 5JC1A 4PIVA 3H6KA 3LDHA 3KM0A 4KZPA 3L6DA 2ZTLA 4BNLA 1M76A 1SB8A 4R5HA 2Q50A 1DHTA 1V8BA 2CVZA 2P68A 3QVTA 3WG9A 1PL6A 1H6AA 1P74A 3VKUA 1ZFNA 4H15A 4NJOA 4BB6A 3I3OA 4CM1A 2CZCA 3TFOA 3RKUA 4DUPA 3VZPA 3GFGA 4FJ2A 1C1DB 5CDSA 1U4SA 2DFVA 4U0JA 5DP2A 2E49A 2J3KA 3QWFA 1P31A 2AG5A 2EW8A 4NBWA 1JWAB 3PHHA 1KEWA 4RQUA 5JY6A 4YAEA 2IODA 3ASVA 2C0CA 4OSPA 3SBOA 3ZI0A 5JXWA 5KIAA 2A92A 3FI9A 2HMWA 2X6TA 1NR7A 4A10A 3JQFC 2J5QA 3QVWA 3CPSA 4YRAA 2X1HA 3HFSA 3WS7A 1I3KA 3DFUA 5I7VA 4XQCA 4BMNA 2OFPA 3SC4A 5ITWA 4XJSA 5FWNA 3HUDA 1AHIA 2J3IA 3WSWA 1NWHA 1PZEA 1BDMA 4ND5A 4P22A 2Q1UA 5A3VA 1PZHA 4F6LA 3GHHA 2I67A 3FPCA 3DFZA 4E2ZA 1U3UA 4YT5A 4DQVA 3RUCA 3KLPX 4ROSA 5LC1A 1JQBA 3PHLA 1I30A 1JW9B 4ZRNA 1LA2A 5GY7A 3GEGA 4EUEA 5IAAA 4B4OA 2VYVA 3OJ0A 4Z3KA 3ENKA 1H5QA 3PIIA 4L74A 5T8KC 5AQ1A 3PI7A 3H3FA 2O50A 2FSSA 3JQ7A 1GFSA 1T2CA 1GEGA 2RBEA 5F1PA 3ZWBA 5THKA 5C7LO 1HLDA 3KUXA 1RYEA 4BKOA 4Z9YA 2FSVA 2H1SA 1A4IA 3MJTA 1O8CA 1ORRA 1FF9A 3D4NA 3G49A 2QX7A 4FJ1A 4NBRA 1LLDA 3RKRA 3ZNQA 3GNSA 2RHRA 1HXHA 1NVMB 3UKOA 3LZ6A 1CF2O 3DC2A 1PQPA 2VHXA 4IJVA 4AJ2A 2Q46A 3LT0A 1SBYA 2EP5A 1PS9A 3OFSA 1NAHA 4TQGA 5CDYA 3F47A 1LUAA 4PLHA 1UR5A 2ZCVA 5MDHA 3TZQA 1P3DA 3DHEA 5JE8A 3U9LA 1X7HA 4IJKA 3IUPA 2CF5A 3WMWA 3PZBA 4B4WA 1E5LA 1LDMA 4GGOA 1O5IA 3R3JA 2BHLA 2YHUA 1DIBA 1UZNA 4IDCA 1Y6JA 1KVTA 5JDCC 5DN9A 4XYBA 5BSFA 1LTHR 3AOEC 1WDMA 1LLUA 3JYPA 2POQX 1ISJA 3FCOA 3E5MA 2JD1A 1TI7A 3AUUA 2NQ8A 2R6JA 5IZCA 3UGKA 2BGLA 2RAFA 3BTVA 3AI3A 3T7CA 3C8MA 3DBHA 1NFFA 4J1TA 1MV8A 3BTSA 2DAPA 3FRJA 4GL4A 3IDSA 5C37A 3ZU4A 2PZLA 1VM6A 2A94A 1VE9A 5G0UA 4CM9D 5C3MA 4OYRA 4G81A 1TB4A 4J4HA 1SZJG 3W8EA 3KVOA 3GG9A 1O6ZA 5FFFA 4CMHA 1JDJA 3QWHA 3BMCA 2C7GA 1PJSA 5CPFA 1B2LA 2NVUB 2HJRA 3IKTA 1HSOA 5KKAA 1IPFA 4LMPA 2VWPA 2GN4A 2IXBA 5CEEA 3KYDA 5B37A 1HWYA 4WOKA 1F14A 4RVFA 1SNYA 2YV3A 3NYWA 3WNVA 4HFMA 1JWBB 4MINA 4XD2A 1LJ8A 1KEVA 2DTXA 2FRDA 1R37A 5TT0A 3V2GA 4ESOA 5CFZA 4CLDA 4IS2A 2BF7A 2VN8A 4NJMA 4FIZA 2DUWA 3HDHA 1ONPA 2Y0CA 3OA0A 3RUDA 2Y66A 3PZRA 3KSZO 4WK6A 3NTRA 2ZK7A 4IQ8A 4NH4A 3WQSB 2D5AA 3OQ6A 2HO5A 3PWKA 3WIEA 1Y8RA 1J5PA 4YAIA 4ALIA 1I0ZA 4BNJA 1UXGA 3Q9NA 4RLSA 2DBZA 2GGSA 5TIIA 2PKQP 1P77A 1ZXBA 2ZTVA 2Q1SA 1PJ3A 2VRCA 3TF5A 3IP3A 4ZN6A 1K6XA 1K89A 3DHYA 4YAKA 1EBUA 4Y8VA 3D5QA 4O59O 5L4SA 2V6BA 1MXFA 1Y8RB 5EL0A 2NTJA 3F5SA 3PYMA 3BZUA 3UF0A 3GVPA 3JQAB 2CNBA 1ZK3A 3JD2A 3I9JA 1JTVA 3DBVO 2IZ1A 4OOFA 2R00A 3PLRA 2VHZA 4YVFA 1HEUA 3QRWA 2BRUA 4ZICA 4Z0TA 1A72A 3JQDA 3LLVA 3D4OA 3CE6A 2X0RA 3JQBC 4BHTA 4BKRA 2C82A 3F9IA 2HJSA 3D7LA 3I1JA 4R01A 1MUUA 4I9NA 1ZIDA 4CMEC 4NQZA 1YS4A 4PGFA 1CWUA 3G3EA 4BIIA 2DBQA 3UUWA 4BB5A 3RU7A 4NPCA 3CZRA 4MDHA 4XYEA 3OJOA 2B37A 5A5EA 1E77A 3NJ4A 5FYDA 4IGFA 1E7MA 4IIUA 1PU2A 3EK2A 4KOAA 4PLZA 4Q3NA 1I32A 3TPCA 2OO5A 4RJTA 2QQ5A 3BHIA 3FWNA 1NPDA 3UCFA 3F4LA 5L40A 4YAGA 3IIEA 5HRUA 6ADHA 1WWKA 1A7KA 2NTVA 3GZNA 4PZEA 2JAHA 4Z3DA 5HWSA 3W6UA 5JO9A 1R15A 4R9SA 5A9SB 4FFMA 4LMRA 1ZSVA 2EV9A 1PL8A 1PJ2A 1ZCJA 1ZW1A 2OMEA 4PCVA 3QW2A 3ENNA 1K6JA 3AY3A 4U7WA 4W9NC 4Y6RA 3NT2A 2FWMX 4MJLA 3IL2A 1ONNA 2AEMA 3GT0A 1WMAA 1Z73A 1QMGA 2OGUA 4BNMA 4FS3A 4CM4B 4DBZA 5DCUA 3GZNB 3JYNA 4W99A 2VWHA 5G0SA 5TC4A 3PWZA 1KIFA 4B4VA 4MVJM 1ENPA 3K31A 3RUAA 3VPFA 2NUAA 4DIBA 4NK4A 3M1LA 1XHLA 3WSVA 4FGSA 4NBVA 4OAQA 3C3XA 3OIFA 1HYEA 3GLQA 4JBHA 2Q1TA 1FDTA 4WLVA 3OA2A 5MGBA 2E4AA 3GMSA 2O3SA 4LCJA 4XGIA 1DDOA 4FW8A 1XU9A 4UVIA 3BHMA 4GKBA 4GVXA 1HYHA 4CLRA 1EQ2A 1RJWA 4EW6A 2SCUA 5KJCA 1AUPA 3BMQA 3MZ0A 2IEBA 3C7DB 4K9DA 1GQYA 9LDBA 3EC7A 3IKVA 5KKCA 1XIVA 4EUFA 4IZIA 4JXKA 1YBMA 1ADCA 3H9JA 4NMHA 3B6ZA 3OIGA 1Z74A 3X2FA 1XQ1A 3F46A 4DL9A 1E92A 1GUZA 1R4NB 2O7QA 3B1JA 4J9UE 5DNAA 4CUZA 1U4OA 5EPOA 5JNLA 3Q0EA 1IL0A 1VKNA 2GN6A 2Z95A 4Q9NA 4D44A 1VI2A 4GX2A 4EI2A 4J7CA 2DFDA 3PGJA 1ZH8A 2P2SA 4RQTA 4YCAA 3RJ5A 2Z5LA 1LC0A 1SEVA 1JKIA 1Y1PA 4ZU3A 1BSVA 3LT1A 3PFFA 3U49A 5BNIA 4OKNA 1BG6A 1B14A 2W2KA 3UW3A 4CMJA 1WAMA 3CMMA 4WEOA 2HCTA 1FJHA 2GN9A 4ALLA 1GYPA 4KTVE 1FDWA 4NFYA 4CR6A 3RD5A 1U3WA 2Q4BA 2Q49A 1GV1A 1XDWA 1CYDA 2BFMA 1YDEA 5JFOA 3ONFA 4XB1A 3I83A 4R41A 2GDZA 1R4MB 2OBYA 2WE7A 1P44A 5CEFA 2C2XA 1BDBA 4IINA 4YACA 2CDBA 1PTJA 2FMUA 3VC7A 2GERA 2G5CA 2Y93A 3AU8A 3AJRA 1TT5A 2H63A 2UV8A 1YGYA 2DUUA 3E8XA 4BOYA 1YOVA 1U7HA 5K6AA 3X2EA 5TJ9A 1YL5A 3DOJA 5COBA 4N7RA 2YZ7A 1C1XA 5TQVA 1Z6ZA 2BLLA 4WLFA 5JAQA 4K6FA 4K26A 3ZWWA 1I2BA 4RDIA 1SOWA 3DR3A 1E0DA 5JCJA 4RF5A 4TWRA 3STHA 2GO1A 4TROA 4B3IA 1ZK0A 6LDHA 4GWKA 3BMOA 4HX5A 2R2GA 3I9OA 4J1QA 4J91A 2D8AA 4WNIA 5L45A 4RPLA 2B4QA 2NVWA 4OH1A 3M2PA 3TDKA 1D1SA 1HDZA 4WNCA 5A03A 5G0TA 2JFGA 1CDOA 4I08A 3TQHA 2XXJA 2OZPA 3H9EO 3B70A 1F0YA 1N1GA 2H5LA 4J0FA 2P9EA 5TLSA 5DF1A 5AOVA 4I5GA 4JROA 3INRA 2PFGA 2PK3A 3INGA 1ZMOA 1Z82A 2BI8A 2VT3A 5A3JA 4AJ4A 4M89A 4L76A 3DWFA 1R66A 5IJZA 5K1SA 3H5NA 3HG7A 3HWRA 5KVCA 3DOCA 4QX6A 1YXMA 3A4VA 4GSLA 3GEMA 4ZQFA 2BH9A 2VYND 1EDZA 5I9MA 2UVDA 1PGOA 2C54A 3VPHA 1G6KA 1OOEA 2DTDA 3DOOA 1U8FO 3ETDA 2X7HA 3R3SA 4CJXA 4IDDA 3GQVA 4NFHA 4XYLA 3S2FA 3DQPA 1PGNA 4OQZA 2HQ1A 2GLXA 1RYDA 1DLIA 1T24A 1YO6A 5KCZA 2P4QA 2X4GA 3D4PA 4R3WA 4CMCA 2PGJA 4BGVA 1WZEA 4L9RA 3QQPA 4UVDA 4M49A 4R69A 4N5LA 4NDNE 2CUKA 5U4QA 3FNHA 4BO9A 1XR3A 2AQHA 1UXKA 3E48A 3IMFA 4QXMA 4RO0A 1F12A 1GDHA 2AMFA 2P4HX 3PHIA 4CQMA 4QQRA 1V3TA 2IE0A 3QVSA 4XGKA 2PD6A 3LQFA 2HUNA 2AHRA 2Y1CA 3Q3CA 1T4DA 3WQQA 1U7TA 2ZKLA 2V6GA 3OICA 3GN2A 3BMQB 5DZSA 3ZV6A 4A03A 1E6UA 2VRCD 3MWEB 3A9WA 2DU8A 5DULA 4LN1A 1GUFA 4E2YA 1J4AA 1YB5A 3TWOA 1PIWA 4Q3DA 3ZWMA 1B16A 3C7CB 1DXYA 4RF3A 1E6EA 1EK5A 4AJ1A 5DOVA 3L9WA 4FFOA 1GR0A 1RM4A 3MJEA 4BNVA 2PH3A 4RORA 1M66A 4OSOA 4F3YA 1QP8A 1YJ8A 2IXAA 4UEJA 4E5PA 1K0UA 4KWIA 2GPTA 3U4DA 2WYWA 1U5AA 3MTJA 3U62A 3ZN2A 3A1NA 3R6DA 4MKXA 2B36A 2VHYA 1YRLA 2Y1EA 1P1JA 2Q45A 2VNSA 3VTZA 3IJRA 3NDJA 4JJFA 4XR9A 1OZAA 1EDOA 5ER6A 1FDSA 3DDNA 5JMPA 3RC9A 5U9CA 1NVGA 3L6EA 2B83A 2VYNA 1QYCA 1YBVA 1GU7A 4OGWA 1DIRA 4AJIA 2NLOA 1QORA 4AJJA 4QECA 3C1TA 1XU7A 4Y6SA 4YJFB 4PRKA 4XRRA 4F46A 3GAZA 4L0QA 2AA3A 4PLPA 4DREA 2JD2A 1T26A 1VJ0A 3FSRA 8LDHA 1EZ4A 1I24A 1X0VA 3LT2A 5JDIC 5G4KB 4IDBA 4CQLA 1NX6A 1NFRA 4DIFA 3OM9A 3SJUA 2NADA 3WICA 4J2OA 5JO0A 1Y8QB 3QJ5A 2YFQA 3DXFA 3WXBA 5JLAA 4YJHB 4I9HA 1DRUA 1TLTA 3WBBA 2DTEA 4YYZA 3GUYA 4NI5A 2EEZA 3UCXA 1B8VA 2WWRA 3BTOA 3KYDB 1YB4A 1ADFA 2WD8A 2FZWA 5BR7A 5KWEA 2ZYAA 5ADHA 3AUTA 1KVSA 2CVQA 2G82A 3BMNA 1JLLA 3D3EA 4PLCA 4OOEA 4CR7A 3ONDA 1J0XO 3DBRB 1HDYA 1J49A 1DB3A 2FPPA 2X86A 3CKYA 3RI3A 1HRDA 5TGDA 4DQXA 3GFBA 3WLEA 5TX7A 2PKQO 3Q11A 4W7HA 1DEHA 5AYVA 4J2HA 3KBOA 3PJGA 3NDRA 3H5AA 1NM5A 5ILOA 1WW8A 1SEPA 1WDLA 3F1LA 1PR9A 5ER9A 2VYVD 3LF1A 3SC6A 1GY8A 4DLBA 3UFXA 2X0JA 5EQDA 5L51A 4YQZA 4JN6B 3W1VA 3AY6A 1KEUA 4X54A 1A9YA 1I3NA 3JQ9A 1B26A 3SVTA 3N7UA 4YAJA 2O4CA 5JPIA 4NZ9A 3T7EA 2DQ4A 1PJBA 2VTDA 2O48X 3E1KA 7MDHA 3VH4A 3OETA 2NU8A 1HZJA 2EP7A 2O3TA 3JYQA 4CQMD 1E3LA 2PTGA 1UP6A 2VWQA 4CUJA 4D43A 2V7PA 3ONEA 1UDBA 3OH8A 4GBJA 1YBAA 1QYVA 3I4FA 4PVDA 4MIOA 3T4EA 5A9RA 4ZQGA 1Y81A 1VSVA 1EEHA 4ZRMA 3PIDA 5BNFA 5A4DA 3QLJA 1J6UA 2AQIA 2BFAA 3AM3A 3JTMA 1X0XA 1ZEMA 3MTGA 4A26A 4XCVA 1NQAO 3E5RA 1D8AA 4CMBA 4CM7A 1EK6A 1HDGO 1ZJYA 5CDTA 3GA0A 1YONA 4F6CA 1NTOA 5CDGA 3RUFA 3QVOA 4GAEA 4R3NA 5DCWA 3JQBA 4YT4A 4Z6KA 4O0LA 4BNUA 5K9ZA 4IXTA 3RJ9A 4BGEA 1GPJA 4CMEA 3VH3A 2FPIA 3DONA 2BFPA 3IP1A 1ZZEA 3U09A 3LC1O 4XGNA 4PN3A 3ICCA 3NGLA 1EFLA 2CDAA 1ZVMA 4PLVA 4LW8A 1U2DA 4HXYA 4CODB 4MVJP 3WYBA 4BVAA 3CTMA 1BVRA 5DCYA 3SX2A 3SLKA 3O8QB 1YDWA 4FC7A 3ZWXA 3D0OA 1W0CA 3QY9A 2Q2WA 4GSKA 4LRTB 3FD8A 1UDCA 2CY0A 2JCVA 3KOUA 4YBZA 1Z7EA 4FJ0A 4FFRA 2YJZA 8ADHA 3W8FA 4RPHA 2XF8A 3H8VA 3LK7A 2I76A 3R0IA 3M2TA 3EW7A 4E21A 4FOOA 3VZQA 2PZMA 2Y05A 1LSJA 3V1YA 4ZQBA 3DZHA 4BNZA 1AXGA 3OMLA 1KERA 4JLWA 3I23A 1VSUA 3E9NA 4MP8A 3GGOA 3ZHZA 2GNAA 3WTBA 3ULKA 1UXIA 4HKTA 4JJIA 4R1SA 2VZ0A 4RZHA 2ZB8A 1GADO 1QYXA 1C1DA 1X15A 3V2HA 4FGWA 4BO3A 3TSCA 4CMAA 2X58A 4ILKA 1PGPA 3JQGB 1P33A 4Z0PA 1AGNA 4E13A 1X1TA 3EUWA 1PJTA 1I3MA 3WBFA 1VRWA 1UZLA 3TL2A 4BNYA 1Q7GA 3WOHA 4WJZA 1XWFA 4LK3A 5A1TA 2PA3A 2JAPA 5CG2A 4WPGA 1EMDA 4OXNA 3RWBA 1E7WA 2PD4A 4YJFA 4G65A 2BELA 3HN2A 4YPOA 1W4ZA 2D5CA 3NKLA 2IEDA 1BRMA 3HDYA 4D79A 1ZXLA 1E3WA 4ND2A 1N5DA 3D3WA 1R16A 5JC8A 4WASA 1HYGA 3FNFA 3BMCB 1IYZA 1QRRA 4BUCA 3RBXA 4D42A 3EY4A 2EF1A 1DBVO 1IHYA 3O03A 4IMRA 3DB2A 4AJKA 1XKQA 3V5NA 3WFJA 4AJPA 1P1FA 1BW9B 1ZK2A 1DFHA 1H2BA 2WD7A 5KVVA 1E7RA 1W73A 1I8TA 4EEXA 2EW2A 4RZIA 1HF3A 3HJAA 5I7EA 2VZ9A 1DRVA 3TZKA 2Y1OA 4IBOA 4CLOA 5HTOA 4MVJG 3GVXA 4OMUA 1A71A 7ADHA 2QW8A 4LVCA 3H7AA 4B8WA 3LYLA 2PZJA 3HSKA 3DMTA 2QRKA 1DJNA 3EZYA 4AJNA 1DC3A 3GMDA 3P7MA 1T1SA 4JP2A 4YA6A 4E30A 1LX6A 4YJGB 4CUKA 4BO6A 1U2GA 4R51A 2AE2A 1M2WA 3GZ4A 3TRIA 2G17A 3ZGYA 3R1IA 4P4LA 4HADA 4GMFA 4N5NA 1PWZA 2YY7A 3NAQA 3H9QA 3L4BA 3L77A 5JMWA 3K2BA 5A06A 5DDIP 4EITA 1EQUA 1IE3A 1PGJA 3SJ7A 3H9GA 4LSMA 1Z45A 1SAYA 4NJMB 1MC4A 1MFZA 1QYDA 3ASUA 4XQ9A 1DJQA 4I9UA 4AVYA 4NK5A 1DO8A 4BNNA 3H3JA 2UDPA 1PZFA 1QKIA 2A4KA 3C1OA 3OJEA 5L3ZA 3SLGA 1SB9A 5F1KA 3QV1A 4I5DA 2YUTA 2X9GA 4DWVA 4QTZA 5H81A 1NASA 1X14A 4E5NA 2Y0DA 3OQ1A 2YDYA 4XWYA 3D1LA 1ENOA 1F06A 3TZHA 2YDXA 1NBOA 3WGOA 1ZJZA 2BI7A 1R12A 2DPGA 5HA5A 1O89A 5L53A 1DOHA 3A06A 3E03A 3GVCA 3HFGA 3U0BA 2G0TA 4RVGA 4YXFA 4J16A 1CRWG 3RUIA 3WX0A 3CEAA 2Y0EA 1PJ4A 1V6AA 2WE8A 4HV4A 3ANNA 4A0SA 1GQQA 3FTNA 4QT0A 2X0NA 1LQUA 2BMAA 1PL7A 1QV7A 3JYLA 4PRLA 4Q3AA 4UUNA 3L07A 3MJVA 1HDRA 3HQ4O 2HMSA 2HDHA 4D0RA 1Z75A 3I6IA 1NHWA 3NTOA 4ZHSA 1YL6A 2C7VA 3WWYA 4NG5A 4U0KA 3GNTA 4BNWA 1QV6A 3UHAA 5TS3A 5T57A 1I10A 4KUEA 4BNTA 3ADPA 1HE3A 3JD1A 1DAPA 3S2GA 4CL8A 4H3VA 2O3UA 1N7GA 5IDXA 1FDUA 4PFJA 4BO2A 4AG3A 1HDXA 4BKPA 3VPXA 1U28A 4M86A 1KY4A 4ND4A 1L7DA 4W82A 2B4TO 3BXXA 1LQTA 2ZTMA 4GX1A 3VHRA 2QIOA 3AI2A 1H0KA 5H83A 2QRLA 3H4VA 3CH6A 1O94A 3LU1A 4J7UA 1ADGA 4KQWA 4Z0HO 3PVZA 2RIRA 2C20A 1DFIA 1Y8QA 4FC6A 4MO2A 3BAZA 2CD9A 2O7SA 4QUKA 4XB2A 2NACA 4LVUA 4OXKA 1I01A 1PWXA 3PQFA 1DHRA 2UYYA 4LCEA 4CV3A 1P1HA 3B1FA 1NXQA 1BHSA 3DAGA 4Q39A 3RASA 1GYQA 4JIGA 1XLTA 1S6YA 4IM7A 4WOJA 3WIDA 1VPDA 1ZSNA 2BKAA 2HK9A 4K28A 3T4XA 2YW9A 1UAYA 3IOYA 2E6UX 3LF2A 3MEQA 4J1SA 4L8VA 4JGBA 1V35A 4WKGA 4BGUA 4ID9A 1N8KA 4MKZA 5L4LA 5FI5A 3ZZNA 2GSDA 3VAZA 3DBLA 4CV2A 3ZWOA 1OFGA 1O95A 4IGEA 3OQBA 1FXSA 3WNQA 3ANLA 3WGYA 4J3FA 4NBTA 4EJMA 2B0JA 1LDEA 1NVTA 1JAXA 1Q0QA 2P9CA 2AQ8A 1YE3A 1ULSA 3G17A 3H2ZA 4E3ZA 2FR0A 4RVSA 4NNJA 5HM8A 1MP0A 1OI7A 2XAAA 3H2SA 1YQXA 3HE3A 2DC1A 3KSUA 4JCOA 3VOSA 1MG0A 5TSDA 4BNXA 1IUKA 3AU9A 3HNPA 3EHEA 2QZ9A 5T6BA 1X13A 3F4BA 4GVLA 4AL4A 3AW9A 3W6ZA 3ZNOA 4DC0A 2X0IA 2Y1GA 3AUAA 1DLJA 2E82A 1JKJA 1LU9A 2PKRA 1FK8A 1H2HA 5JSFA 3KSDO 1N7HA 4ZQHA 5T8KA 4TVBA 1C0PA 5IDYA 1I5RA 3KB6A 4TRNA 1UXJA 4RPJA 4O63O 5IZ4A 1P45A 3TNLA 1B8PA 2WM3A 3W8DA 3DBRA 4KMSA 3C7AA 1ADBA 2GZ2A 2YQ4A 4DVJA 2PV7A 1O0SA 1WDKA 4GLOA 1YVEI 2J6IA 3JQ8A 3LC2O 2RHCA 4Z9XA 4E0BA 2PY6A 3EYWA 1QG6A 1P9LA 3JQAA 5ENVA 4J49A 2ILTA 4A73A 1KVQA 1HDOA 2YQ5A 3KYCA 3TN7A 4EJ0A 4I5FA 3NGXA 1Y5RA 3F1KA 2J5KA 3GPDG 5BSGA 3DTTA 3B20A 3I9LA 3NUGA 2FN7A 4KDEA 1TT5B 4J6FA 3ITDA 1YOVB 2I6TA 3WFIA 3JQ8B 4LRSB 4JNKA 3HN7A 1VL0A 1M6WA 1A27A 4HNGA 4EJ6A 1NWCA 4R4JA 4UULA 4B7CA 4FFNA 4YR9A 3AOEA 3CSDA 4D0SA 2JFFA 3HZZA 1UXHA 4FQ8A 1OAAA 2LDBA 5I7SA 4AICA 2OBNA 2Y1DA 2ZYDA 3ZNPA 4GKVA 4ZVVA 3HB5X 3FPLA 5LDHA 3WTCA 1MB4A 2IYPA 2DBRA 1AN9A 2Q4EA 4IJWA 5JW6A 1E1NA 3RC1A 3F3SA 4UEKA 1IZ0A 2D4AA 5AXBA 3O38A 3OEWA 4DC1A 5F5NA 3EMKA 3ON5A 1U5CA 1NHGA 4CM3A 2P9GA 4L75A 5KVQA 2CVOA 3FNEA 3MOGA 1N1EA 5GZ1A 4UREA 1H93A 3KXDA 5ICMA 2Y68A 1DFGA 3DL2A 3G79A 3GNQA 1N9GB 1RWBA 2BGKA 3GN1A 1LRLA 3OECA 1H9AA 3E6AA 1HE2A 2ZJ0A 1PS0A 2G1UA 4FB5A 5A04A 3BHJA 3AFNA 4MP3A 2Y99A 1D4FA 1T1RA 2GN8A 2ZATA 2UAGA 3MWDB 3FBTA 2X23A 4FBGA 1ISFA 2NSDA 2O4UX 3PJEA 3DTYA 1M67A 2J8ZA 4NFSA 4B79A 2D3TA 1VL8A 3VH2A 3MOIA 1KVRA 1Z7BA 3ITKA 4ND3A 4TSKA 4IDGA 3KEQA 5DP1A 4BKUA 2VQ3A 1U3VA 3HDQA 4NR0A 5IN4A 3W4KA 4W4TA 4XDZA 4PLTA 1XA0A 5KJFA 1JAYA 2YV1A 2DBVO 4FDAA 3DZJA 5C5IA 5B12A 4A2CA 4URFA 3DBLB 4I1IA 5EJ2A 1JU9A 1WNTA 2QG4A 4PG7A 4DQUA 9LDTA 2PH5A 3K73O 4RVHA 2VUTA 1XYGA 5IXYA 1Y9EA 3RBVA 5EINA 1VC2A 3C24A 1PR3A 3C85A 1D3AA 3U3XA 1PEDA 3VDQA 2BFOA 4LSWA 2R00C 1B8UA 3PTZA 3WJAA 3I6QA 4AJEA 5AVOA 2JCXA 2HRZA 3O9ZA 3WDSA 5CPBA 1NNUA 4II3A 4WEQA 3UXYA 3V1UA 5ICSA 2F00A 2QYTA 4D41A 2FP4A 3CUKA 5GZ6A 3TFQA 3UOGA 2F1KA 3QWIA 5FEUA 4R68A 4N18A 3JCZA 1IZ9A 1NQ5A 2GD1O 5IZCC 4HP8A 1RM3A 2X8LA 4ZD6A 1ZSYA 5TJHA 1SMKA 2W2LA 3JV7A 4C7KA 3KTDA 1UUFA 4D3DA 4J0EA 3ADOA 4CMKA 4TZKA 5ILGA 4YJDA 4RGBA 2VUUA 3WGGA 4WECA 4B3JA 5L95A 5JAZA 1T2FA 3H5RA 2V6MA 3WYCA 3V1TC 3TOXA 3PP8A 4E5YA 3GK3A 4DPLA 5L9AA 5IFLA 1OC2A 2E48A 2I3GA 2VT2A 4Q3EA 2B5WA 4OM8A 4BMSA 1VJ1A 2O2SA 3GOHA 5T5QA 1ZBQA 1ISIA 1WLYA 3ZWNA 4AJOA 2WD7B 2RH4A 4M8SA 4KP7A 1T2DA 1HL3A 4XIYA 2PGDA 1XELA 5COAA 1U9JA 4DPKA 4JBGA 4M55A 1KETA 3JQGA 3DZIA 3PLNA 2EGGA 4DPMA 3DAFA 3PQDA 4FN4A 3RBZA 1LLCA 1DC6A 5C7OO 1OC4A 2AE1A 4IQ0A 5CHEA 4L4SA 4YJHA 2HMUA 3RAJA 1OMOA 4ZJUA 2AEFA 2O3RA 2ZQZA 4O5OA 3I52A 1KOLA 1UZMA 2TMGA 1C3VA 1IOLA 1W8DA 4XYMA 4TMFA 1E1LA 3NEPX 3GAFA 3H65A 5DT9A 1XQ6A 4BO7A 4W7IA 5JY1A 3HDJA 3JD4A 4B3HA 4OKIA 3MJCA 3EDMA 4UVEA 4EDFA 4WLOA 2HK7A 3U5TA 4BNHA 1E3EA 2GYYA 3WMXA 1GAEO 2XPCA 4OL9A 2PNFA 1QSGA 1DIGA 1KY5A 3GDGA 3GGGA 4RDHA 1U8XX 1NFQA 1AXEA 1RKXA 1E1KA 4IZHA 2NNLD 3MCVA 2X5OA 4P8RA 5JBIA 2W2LD 1IY8A 1TT7A 1LSOA 2CF6A 2C29D 4WLUA 1ONOA 4FOSA 2EJVA 3CIFA 2GZ1A 1P1IA 2HU2A 2J3JA 1F8GA 2JCYA 4MOWA 3I9NA 3RSHA 3NJ8A 4XYGA 2WEKA 5DBGA 1WMBA 3BMOB 3QSGA 2B69A 4AJHA 1LSUA 3ANMA 2EGHA 1R0LA 2C2YA 4EGFA 4BS9A 3E9QA 4PLGA 1TVEA 2HMVA 3ZW9A 5HBRA 5BSHA 4N5MA 4C7JA 3TZ6A 2GR9A 1W6UA 2JL1A 3I9KA 3K9QO 2HLPA 3KYCB 1X7GA 3F6YA 3Q2IA 1E3WB 3O8QA 3GVHA 3D64A 4CM8A 2V6FA 4IUYA 3ST7A 3WWZA 5F5LA 4KDFA 2ZYGA 4MVJE 1T2AA 4ND1A 5COQA 4DXHA 1XSEA 3CZMA 1YQDA 1C0IA 4GGPA 1RPNA 4QSMA 5H82A 3O26A 4U6SA 1K3TA 5TRTA 1EVIA 2NVBA 4NU5A 4PG8A 2EXXA 1WPQA 2W98A 3UVEA 1JKFA 4RPGA 1VLLA 2WSBA 2AQKA 5B1YA 1H6BA 1EFKA 1YB1A 4W9NA 5BNTA 4IDEA 2ZIZA 5IF3A 1K2WA 3OBBA 4OJNA 3VKVA 1H6CA 4S1VA 3GEDA 3EZLA 4XX0A 3QVXA 4J43A 2HAEA 4HFNA 5KJEA 1HE4A 2IZZA 3JQCA 3NX4A 3RUHA 2BGMA 3GDOA 1E7QA 1LEHA 4U8GA 1VL6A 3JD3A 4WCFB 4XA8A 2OP0A 3VDRA 3ZCXA 4DYVA 5B4TA 2I99A 2HKIA 2X5KO 2WDZA 4II2A 3FNGA 5DBFA 4E2WA 4BO1A 5C7IO 3DZKA 1ENZA 4FFLA 4XQGA 2OHXA 5G0WA 5U1PA 4B8ZA 4TRRA 4KUGA 4NBUA 3RFTA 4H7PA 4BO5A 5F21A 4PZDA 5EIOA 1I36A 2PZKA 5I9NA 1T2EA 2FZEA 3IUSA 1OBFO 4RF2A 4M87A 4CLRB 4CLEA 3QWBA 4FFPA 1XEAA 2A9FA 3SXPA 3I4CA 3GGPA 1YQGA 1A9ZA 1ARZA 3PPIA 5ENDA 1MA0A 3AUSA 5JYDA 3OIDA 4YRBA 3KO8A 4YDRA 5DOZA 4XKJA 1LDNA 5KJ6A 3ZH2A 1NPTO 1GV0A 2C5EA 2X9VA 1C0KA 4R1TA 3VPSA 1PJLA 4B7UA 4CMGA 4D45A 2DVMA 2NU9A 4ALMA 1NQTA 4MVJF 3IQDB 5G2OA 3VZRA 2WTBA 4BO0A 5A5FA 4R54A 3FN4A 3RC7A 1E7YA 2ZCUA 1KS9A 3ABIA 1MFPA 4GMGA 1E3SA 4IMPA 1EUDA 4CPDA 1UJMA 4RPKA 4Z9FA 4OQYA 4HFJA 4XDYA 3IS3A 4PVCA 3Q1LA 2FY8A 2ZTUA 1LDYA 3WB9A 1BTOA 2HSDA 4DGSA 4YJGA 5T67A 1KC1A 1PZGA 2O2YA 4Y9DA 3M1AA 3L4SO 1IB6A 2DM6A 3FR8A 3NRCA 4IPTA 2YV2A 4WCFC 4ALKA 4IIVA 3SEFA 5G4KA 3HHPA 2RCYA 1KVUA 4GX5A 2PWZA 5FI3A 4DLLA 2UUPA 2GASA 4JQCA 3RU9A 4UAGA 4MVJH 4JP3A 3VVCA 2ZQYA 1I2ZA 2GF2A 2C5AA 4KUHA 3OJFA 3JQEA 1B15A 3A28A 3ZV3A 2OORA 5TNXA 3TZCA 1R0SA 3AOGA 4RL6A 1PJCA 1EBFA 3OEYA 4HY3A 4JBIA 3LC7O 3H9UA 1GZ4A 1P0FA 3WGTA 3N74A 2JHGA 4Y67A 3ZU3A 1F17A 4NIMA 3RIHA 4J4BA 2C59A 5AXAA 4U5QA 2FHSA 1EUZA 3IC5A 4UUOA 2ZB7A 4K1LA 4Y6PA 1HLPA 2CDCA 2ZB4A 1E1MA 3GVIA 4O6VA 4BGIA 3LLSA 1PQWA 1ZEJA 4MIYA 1DIHA 4WE3A 1Q0HA 2QZZA 1U1IA 2UUOA 3ETGA 3IAHA 5JCJD 2OOSA 3AI1A 2OXIA 3DBHB 2QRJA 1WP4A 3IJPA 5L4NA 4M54A 5JAMA 1QYWA 1ML3A 2VWGA 3GR6A 5HS4A 5JDIA 4M1QA 2B35A 2GCGA 3ICPA 1AHHA 3P19A 3PYXA 1HTBA 1EE9A 3ZWAA 3PEFA 3G1UA 1IULA 3U4HA 1NPYA 5DBIA 1GCUA 4JJGA 3ZHYA 5FF9A 3QA9A 5THQA 4BNFA 1R4NA 4CV1A 1ISGA 1I33A 3NT4A 1QXSA 1HETA 3OHSX 3KHUA 4PLYA 4XJTA 1I3LA 5BSEA 1DC4A 3K5PA 1GTMA 2CMDA 2Q2VA 4AJLA 1GZ6A 4CLOB 3KLMX 1FDVA 5CP8A 2DPHA 4DRYA 1BXGB 4XIJA 4E2XA 3ZWYA 4EYEA 2AG8A 4D7AA 2X9NA 1KEPA 1YKFA 3DZFA 3RQSA 3L9XA 3L0DA 1A7AA 4BL5A 3K96A 4CM6A 1Y7TA 5B4VA 2YYYA 3GG2A 2JHFA 4HUJA 2IDZA 1K6IA 1BWSA 2Q1WA 4RVUA 1HE5A 1ZNQO 1MGOA 1YL7A 2J3HA 3GRKA 5EERA 2EKQA 5IDQA 1MX3A 2DT5A 5GZ3A 2ZB3A 4IS3A 1JN0A 3FR7A 4XEHA 1ZK1A 1MXHA 1E6WA 4HNHA 4K6CA 3WJ7A 1F8FA 3QP9A 4I8XA 1CQIA 3JQ9C 3OF2A 3L6OO 3PFWO 2QHXA 4UUMA 4DA9A 2VZ8A 2VOEA 1CQJA 2WYVA 1GPDG 3A14A 1D7OA 4LGVA 1GCOA 3JQAD 1SOVA 4UEOA 3QWAA 1JA9A 1L7EA 1S7CA 2AXQA 3VVBA 3JYOA 2TMDA 2W4QA 1LBEA 1DC5A 4FSHA 3JSAA 1GUYA 1Q2XA 5T64A 4CM9A 2OP1A 2YFHA 4CM5A 4WLEA 3OSUA 3FWZA 3LSYA 3GUCA 3JQ7B 1B3RA 2RH8A 3JQFA 3MJSA 4MPDA 2C07A 1AE1A 2WJPA 4BQPA 1UDAA 4E12A 2FPGA 3WGZA 4BO8A 2Q2QA 5A05A 3G0OA 3AM5A 5KTKA 1CIVA 2X22A 1NAIA 5BQFA 4E6PA 2VRBA 4OO3A 3PJDA 1BXKA 1NR1A 3QHAA 3GH3A 1ZMTA 2XOXA 3PHJA 1A5ZA 1E3IA 3ROPA 3ZWPA 5L7WA 4D3SA 2CSUA 2DLDA 3WLFA 1HZZA 1LLQA 3ZV4A 5B4UA 3UAGA 5JYEA 2JD0A 4CV0A 3Q9UA 1GL3A 4UVGA 1E3JA 1PX0A 5HS6A 1KC3A 2B4RO 3GRPA 3EVNA 5A9SA 2PR2A 3WQRA 4B7XA 1EVZA 5TT1A 4BKQA 1DRWA 1G0NA 2YHIA 4GX0A 1UP7A 4LISA 1L1FA 4PLFA 1LSSA 2D2IA 2VTEA 5IG2A 3INTA 3ZU5A 5L7TA
chains in the Genus database with same CATH superfamily
4J0JA 2ET6A 3I6BA 3PXUA 2WWYA 4NF2A 3UPTA 3WIVA 5JISA 1MO6A 2OL4A 2JKVA 2M32A 3EAGA 4FCWA 4LGMA 2XSZA 4BQQA 1PGQA 3ED5A 4Q1AA 2IV7A 2QYSA 3N9IA 3V32A 2FAXA 4GPTA 5LB2A 1NVFA 1JVSA 1YIOA 4TT3A 2I4IA 2PAFA 4LYFA 2EWMA 1WV1A 4JASB 3KETA 5F9HA 1V2GA 1OB5A 3PX3A 3IUMA 1ST2A 2JGJA 2V65A 1N2SA 3U39A 1BU8A 3BILA 1XKLA 1E7SA 1C4XA 3CINA 1E5QA 3KQVA 5FLEX 4LMBA 4Z7OB 1DAKA 1N6HA 1JHYA 1I4OA 2YHAA 2C9BA 4O8CA 1UH5A 4DA0A 4E4YA 5JDCA 4TXHA 1C50A 2FPSA 2ZJ1A 3R40A 1PFVA 2WB2A 1Y5MA 2Z1NA 4MQUA 5L7YA 1I13A 3ZEIA 3HP1A 3GHYA 5B7PA 2WWTA 1V3UA 3NTQA 1T3LA 5JYBA 2H1HA 4DCTA 1KP9A 3C6BA 3GY0A 4A16A 1CNMA 1ZHOA 1OAKA 3IUYA 4LSGA 3RF7A 1QIEA 4NSNA 4EJ2A 2F3RA 4IIBA 4L51A 2NU6A 4QFCA 3K92A 1FEZA 3UA3A 2HRQA 5E9QA 4M22A 1XZAA 1A3CA 2VC2B 1J09A 5JCXA 4C2TA 3KU4A 1VMKA 5JANA 3I61A 4YTEA 2GRJA 4N9WA 2HRBA 4PG6A 3KKKA 3RRJA 5KOYA 1MG5A 3CYFA 3E0QA 4G24A 3A9TA 4MWZA 4NU6A 4KWTA 3QE0A 3GZTB 3WK7A 3I8XA 1T9AA 1B3BA 1SPXA 4RLFA 1GTVA 3S6JA 5KWVA 1K86A 1TEHA 1Z8DA 3O1JC 4CL3A 5L3QB 3TQCA 2L82A 5AW0A 2XCOA 4GOKA 4TXLA 5A6SA 2ES4A 3WGQA 1DDIA 4IFEA 2FGKA 2BM0A 4QYIB 2XB6A 4RQBA 1PDOA 3AK4A 4WXEA 4YI5A 1QX3A 3EASA 3LRTA 3E70C 3M4ZA 4NYMR 2YN4A 3CX7A 1H4TA 1C1XB 1LRJA 3T7TA 2ACWA 4HN9A 3ANYB 2JW5A 3AONB 4OB6A 1VJTA 4CKWA 4Q7JB 3ABOB 3EDCA 2QTWB 4FKMA 3JZFA 3OOSA 4CFZA 1P5HA 2YJTD 5JAPA 1A8UA 5I8ZA 2OQVA 3E81A 1L5OA 3T4PA 3EGOA 1GPAA 1PW7A 3EIWA 3M5DA 5LQDA 1RJEA 3CKMA 3QKRB 4PSAA 3GJ8A 3GIDA 3WGHA 3K53A 3TRKA 1TLFA 3SFZA 2O23A 5LZ2A 1YQUA 3LA8A 3H5IA 4YRSA 2ZB2A 1G8JA 4HFRA 1ONBA 4NPAA 4A2QA 4D0GA 1JQLB 3EEFA 2UYHA 4ETNA 1CUYA 4O4LB 3QTBA 3HDVA 4I14A 3PRJA 3DMTC 5HZHA 4M6WB 1EM6A 1PT7A 3RVOA 3WRWA 3OWOA 5AK3A 4ALNA 3N59A 2K87A 5T4EA 3H1FA 3U4MA 3P5SA 4MKIA 4O4HB 4WGGA 4PO9A 3ED1A 1CJCA 3ZUGA 1SKMA 2GUGA 2WYUA 3G7SA 1MHTA 1L5MA 3VTFA 3JWGA 3ZU2A 1USIA 3P9KA 3P1JA 4LYJA 4ZKDA 5A5VA 5C46F 5LYJB 3AVTA 1Y0BA 1ADYA 4JELA 1LC3A 2C4MA 4DF3A 1G5FA 1SIOA 4IJUA 1HSZA 1Q17A 1E79D 3S1LA 2H08A 2EL9A 4RJKA 1S2NA 1I3OA 1A88A 1IBCA 2OKCA 1GNRA 3DEYX 5IN5A 4D25A 1D4ZA 2P4EA 2ZJ7A 1RWPA 2F8SA 3IAFA 1IEVA 3G82C 2UZ3A 1ISHA 2Q3CA 3AEUB 3K30A 4JJ6A 1CFJA 1RRKA 3VSBA 1P6UA 2X77A 4G9BA 4QU5A 1C29B 5CLHA 2WAYA 1NVVR 3E18A 1PQYA 4FPXA 1LNSA 1BGXT 3I5XA 2NV0A 2PZBA 4WN9B 4Y98A 1A8QA 4YI3A 2OBFA 2PGNA 3HBJA 5JT1A 4TKLA 2AOWA 5C5DA 4X92A 1RWOA 2GEBA 4KIJA 3BYZA 3CZAA 4I1SA 4MW2A 1CRZA 2IU3A 4QLOA 2WJGA 3OG9A 2JJYA 4QUDA 3R9KA 3TVDA 3UNXA 5A0VA 3IAS6 1EE2A 1PZMA 1CEQA 2LVBA 4JT8A 1R0KA 4RVDA 1F0NA 3FHLA 4J16C 5EMHA 3A6HA 4YB8A 4FZ5A 1WZUA 4JU9A 5CK4A 4Z4EA 2ERCA 1KQPA 2BMVA 3O8OB 2R6CA 4CQMB 4F5WA 3CN7A 7GPBA 1N2CA 2GFQA 1N9GA 1M2JA 3DFMA 1G0OA 3KKOA 3Q7PA 3M1YA 4PHCA 4PR0A 1QDLB 2A9PA 4NBKA 1EFVA 5DHFA 4ARAA 4EA8A 1QO7A 5PGMA 4Q3BA 3NCHA 1KY2A 1YR8A 2XZTA 4FDVA 3CWQA 3N0TA 1YSCA 3O21A 2VUIB 5FRDA 5I51A 1UBTS 3SDBA 1O9BA 3KYBA 4XM2A 1WETA 2ZRGA 3VU3A 3KVYA 1IXRC 2ACKA 3LTNC 1W5TA 4KO4S 1KZ1A 3QXJA 1PRYA 2AMJA 2WNIA 4ETIA 4BVHA 3IX7A 3RROA 3C5CA 1RZRA 2PLRA 2HL6A 3TJRA 2BD0A 1ZU5A 4RTKA 4F45A 1MB3A 2EG9A 3ECSA 1OT3A 2Q2OA 3MUNA 5SV2A 2QYHA 3S2UA 1R8QA 2CVFA 3O8DA 4BV2A 4FCCA 1R8JA 4IKPA 4Y0AA 2IHVA 2OUIA 1LDBA 2EFHB 2FZLA 4L0CA 4XQEA 2OGZA 2A9JA 2I3AA 3CTPA 3PHGA 4QBTA 3R5SA 1C4KA 4G07A 1UKZA 3ESCA 2BEUA 3ZDFA 1U9YA 4ZZIA 4TZ6A 4BV9A 4MI6A 4BP9A 1RM5A 4C3ZA 1BHQ1 1SC6A 3II6X 4CR8A 1L1QA 2JLBA 1MOZA 1KJJA 3FLMA 1P2GA 4Q12A 2ILVA 4DHWA 4F4FA 2SKEA 4ZOBA 2DY1A 5A02A 2A0YA 4KE8A 1UKCA 4RQAA 4JLUA 1TVMA 4PGAA 1WHTA 2IW3A 2NNWB 3DDWA 3DLPX 2BCGY 2ABWA 3N3BC 4DLAA 2XNKA 4N8DA 4QDKA 1N0UA 1OTXA 4BO4A 1F3OA 3JAMA 1QR6A 1AKYA 3OUUA 3OPYB 4RDCA 4JX8A 5C0OE 5EE1A 3BERA 1IWOA 2LRHA 1XZKA 3GT4A 1AURA 4IV5A 4U2KA 3PPVA 2DGDA 1WZIA 1OV4A 1P80A 3K8ZA 4P83A 4DMLA 4DY4A 5E6UB 4OX9Y 1U3TA 3DT6A 3FZYA 3LGAA 2UUBB 3PA8A 4J9VA 3VR3D 4V1CA 5AOBA 5DBEX 3NT5A 4O1MA 1PDVA 4N7MA 4QLBA 1QC5B 5JJ5A 4JVNA 2FN9A 2QT0A 2Z1MA 3MCAA 4D97A 5BOSB 2ZM5A 3DQZA 2B5VA 3BWBA 4XUCA 4AY6A 3G2PA 2ZYUX 3IAM1 1Z62A 3R4CA 1T5LA 5ALMA 2WMDA 1JEJA 2HZ7A 3O4VA 4HO1X 4B3XA 4IGKA 1BFDA 2XLCA 1TCVA 2HK8A 3ELWA 1HRKA 4CETA 3C1AA 5T6MA 5CDFA 2D0IA 3HA3A 2R6GA 4LI0A 5L3SA 1P5RA 4ZEXA 4BWFB 3RADC 4RVHA 4MV3A 4FLMA 4BMPB 5K3EA 4CM8B 5I7FA 1V9LA 1PYGA 4U6QA 1YE8A 2QGFA 3AY7A 5AJHA 1ISMA 3CRQA 1OUMA 1KQNA 4E31A 1QKKA 4KMMA 3GLKA 4UBIA 3U56A 3KALA 2BP7A 1ZVKA 4H9GA 4KXWA 3RCBA 3U4CA 3UAWA 3UWKA 5BMVA 3M3HA 1XLWA 3VJKA 4QNNA 3FSGA 1JP7A 4IOLA 3O4JA 3IV6A 2GRAA 4LOJA 4L73A 3FGNA 5CFNA 5K6AC 2ZT8A 4FMPA 3L4JA 3THWA 2VPXA 1PJQA 3CLSD 2ASVA 1EGHA 2DUNA 1TU4A 4R2MA 4EEKA 3SXJA 1OASA 1I3CA 5EIWA 5F1OA 3MD9A 1RXYA 1NATA 3FPKA 2PO7A 3OFVA 2P5YA 3VU8A 2AH5A 4IGAA 4MP6A 4WUVA 1FVFA 3SZOA 4BV8A 1FUIA 4M1ZA 4UZEA 3VR5D 3ZGZA 3G2NA 4R0VA 4PHGA 4RV9A 2G76A 3UICA 1RTTA 2I65A 2D59A 1PQUA 1NYTA 1HQKA 2OCKA 3SYMA 3RLFA 4J0QA 4M60A 2QRQA 5ALRA 4TWIA 3HB4X 4FINA 1TYEB 5DMXA 3UAZA 1I7SB 2ZREA 4R7GA 5I9SA 3RNLA 1UODA 2FDXA 3HFJA 2H48A 2EFYA 5IT9A 2CSXA 3P71T 4A8JA 3D7SA 2CHEA 2I8LA 3HRKA 3ASYA 3KM0A 4UJ3A 4YAUA 1J5XA 3L6DA 1QTIA 2Y92A 3MW8A 4E11A 1WSWA 1OI2A 2JJQA 4BNLA 1XMJA 2RK4A 2X1MA 5E4YA 1C8KA 1J21A 5JQWA 1CQXA 1Q21A 3RGGA 5J47A 1JR4A 1K7SN 3G8BA 1V7PC 2VPZA 3ETNA 4BQIA 1TZBA 2N75A 1H6AA 3DEKA 2CT8A 4AQDA 2ZRMA 2IUFA 4HDCA 5AW9A 5BW8A 3OTQA 1RKUA 3QV2A 4NJOA 5CM9C 1UWKA 1JA1A 3HO6A 5J4HA 1W48A 3AEQB 4DUGD 1YA8A 3ITNA 3I3OA 4DIUA 1SKBA 3SM3A 1H42A 2CZCA 5DGCA 2OA0A 1DKUA 1Q22A 4M1KA 4N8SA 3F7MA 1HLGA 2JZOA 1Z0AA 4UUBA 3I0ZA 4WA7A 4NV0A 4DG9A 4EYQA 5KQRA 1AT1A 1DBQA 2Z3VA 4OXXA 5DP2A 1SQ5A 3V80A 3RTGA 4QKQA 5HNKA 4CEHB 1T6YA 1DAIA 1Z07A 2G7MC 2Z04A 3KJGA 4G1MB 4DNFA 2XCUA 2VH1A 3EMBA 3T3DA 1P31A 5B2EA 1H2AS 1SFRA 1T5DX 4NBWA 4LXYA 5FPQA 5A4AA 2RGEA 1E4EB 5JSKA 3K1TA 3SNHA 3OEHA 1BE8A 3BQ9A 5JS1A 1JZQA 2QT1A 3WL7A 4REQA 3EC2A 3HKCB 4K9SA 1WUKS 3RC3A 1CUCA 4HGPA 4OSPA 5BSWA 2CJWB 5JXWA 5KIAA 4X64B 4I50A 5C1BA 1RPZA 3LNTA 4HH4A 3ZJUA 4BJ5A 3OM1A 2JFZA 2C2HA 3M6MD 1EFUA 2AOVA 4JLOA 3RYHA 5AVTA 2C94A 2UVPB 1V2HE 4DCJA 2GA8A 5I7VA 1OWMA 1G21E 3E1GA 1Q0ZA 4Z1OA 2DQZA 1N2OA 2QUBA 1WXXA 3CQ9A 5H0IA 2F1JA 4BUJA 1XRRA 4DW8A 5FWNA 3HUDA 1UMBA 4G1BA 1Z63A 3D4IA 4JT9A 1KU0A 5A3VA 2VJKA 3DEJA 3OT4A 4LNUB 4CCAA 1XXHA 4EM6A 3FPCA 3TIVA 3UYKA 4TLBA 5HQTA 1SCJA 2QUKA 4EUSA 4OMCA 3SS7X 1SHZA 2JIMA 1TOAA 3LQ1A 3Q8MA 4HJRA 3FMVA 2QL5A 4ZRNA 4ZDIA 2WYHA 5C2JB 2QW1A 3TX6A 4L74A 2WT8A 3WWDA 3FPAA 3CF2A 4C0KA 2XX3A 2QLTA 2QSJA 5HILA 2O2EA 2P40A 2ZRQA 1AF7A 4M8KA 1GFSA 1T2CA 2AN9A 2RBEA 1V25A 3KKMA 5G3YA 1TO1E 5THKA 3ZWBA 1QB8A 4I0WB 5K3FB 5JADA 3E5HA 4N5DA 4NOLA 5BV7A 1RYEA 1E64A 1FRVA 4LNUA 1MO4A 1QFXA 3GFFA 1FFGA 2W0MA 2NYVA 1X80A 1Y5LA 3U44B 3D4NA 3OUTA 2GEDA 2E89A 1MENA 3B1WA 3G0BA 3RM3A 1LPPA 3COJA 5AH0A 4NBRA 4WACA 3ER8A 1L5LA 2VH2A 1EXDA 1NJ6A 2NZWA 1B76A 2KI5A 2M98A 1TKAA 3NHPA 3ZHTA 3P9IA 2R5NA 1ECFA 1NVMB 4MLZA 3FCEA 5AJXA 1NY5A 1XZCA 2VHXA 2YVUA 1W0JA 1FSGA 3M33A 3N8GA 2Q46A 3FPBA 1SBYA 3EFBA 3BWCA 1YB2A 4XCXA 1PS9A 4EPYA 1W0JD 4IYRA 3ZKWB 1NAHA 4UPEA 5CDYA 4AUNA 4FMDB 2P1DA 3SCZA 1RJ9B 3PC8A 2PMWB 3TZQA 2AZXA 3U9LA 1I51A 4ER5A 2CF5A 2B92A 5I4CA 1O96B 1E5LA 2OZEA 4G1VA 4CN9A 1W93A 4LKOA 3R3JA 5CDHA 2BHLA 3U3KA 3VNAA 5A4IS 2E18A 3H5WA 4M0UA 5JDCC 1WDMA 1LLUA 4JP8A 1ISJA 4GVPA 3FCOA 3MSXA 1JPVA 5TMEA 1V5EA 3AUUA 3BFKA 3YASA 1XJ5A 5D51S 3WNBA 1Z36A 1JIQA 1L3CA 4LBZA 3UGKA 1L5NA 2RAFA 1TQ2A 3BTVA 1YK0A 5NULA 5B3KA 721PA 2B25A 1JEAA 2RHGB 2JLAA 1QVVA 3R75A 3DBHA 3TIGA 3WRVA 5B7QA 1NFFA 2P3QA 1N2GA 2RI6A 2ZUDA 1RI4A 1WXWA 1M7HA 5K3BA 3RVLA 3WV5A 2DSTA 4K40A 3T54A 4MS1A 2A67A 3T38A 3ZS9A 3LY8A 2B3TA 4G81A 1T3SA 2IEYA 3H9CA 1KWGA 3KVOA 4IMJB 2CMKA 1VYVA 3HEAA 4QASA 4QZVA 2XA2A 5GPBA 3S7TA 1PJSA 2DLCX 3E2IA 4XDHA 1MABB 4A1FA 4C0LA 1ZZGA 2VWPA 3G88A 3NHLA 5F64A 4O2RA 3B12A 3ZCUA 1T8WA 3E58A 3U13A 5CA1B 3HYSA 3USES 4WOKA 3NDBB 1FVXA 2YBDA 1GTZA 3CX6A 2YV3A 4QHTA 4A8PA 2FLWA 4HFMA 5FH9A 3RUPA 2I7VA 5ECGC 1RABA 4NCHA 2GAIA 4KITB 3HWWA 4P3XA 1QHHA 2PUJA 2FRDA 2VLIA 2XMZA 4L5IA 4WI1A 1QQAA 5HMMA 3C6QA 3NUQA 4R2XA 4HUQB 4DUZB 3BCSA 2VN8A 5JJLA 2AZTA 2N1BA 2Y0CA 2Y66A 2R62A 3O4HA 1MABA 2QMQA 4ZCLA 3VU0A 2NXNA 1FTSA 3ABQB 1ZCBA 3KWJA 4JZYA 3NTRA 2I1VB 4QGBA 1ZRMA 1U80A 3I53A 3WQSB 3RE1A 5I4IA 4OI1A 4UU1A 5HDQA 2HO5A 3UYLA 2P4SA 4YIKA 1NW8A 1N34B 1H1DA 1UBUS 4KLRA 1UXGA 3A1FA 4OGGA 4J6EA 5KYVA 3KD3A 3EVFA 2EX4A 5BSUA 2DBZA 3UOAB 5TIIA 4UW9A 1GNLA 3BIJA 3P9YA 2ZTVA 2AI1A 5HCNA 2JAUA 1JSXA 4OAPA 4A0HA 4DEYA 2F8TA 1EX9A 1RACA 1BKYA 3NBQA 3NOVA 1GKLA 4PCAA 4AO6A 1K89A 1K4KA 1QK3A 1AO0A 3W2TA 3D5QA 5HP4A 1KJ9A 2YQZA 2AFRA 1D2HA 3OLWA 4JT2A 2GCIA 4MWCA 3TDMA 3UF0A 1G8FA 2QBYB 2CNBA 1KFJB 2JCGA 3ME5A 4PO1A 5A1JA 5JMTA 3WC4A 1JTVA 1CR1A 2QU8A 4B6RA 1JUDA 5JCOA 1YI1A 4K1XA 2R00A 3BD8A 3OZVA 4Q24A 2VHZA 4Z51A 5K0BA 3KWMA 3OUZA 4GMXA 4ZICA 2ZUEA 1A72A 3SHVA 4G5XA 1W581 4ZHQA 1GN8A 4JC0A 2HWKA 4BKRA 4BHTA 3GRCA 4GOXA 4UPDA 1N4DA 4RFLA 3DOHA 3KJZA 2B1QA 4R01A 4H4EA 3T5GA 1DI0A 4WZBB 4CKEB 5HF5A 1Z33A 4K6GA 2FCAA 2DBQA 3RU7A 2P9YA 1U9IC 4NPCA 5AW5A 4MDHA 4U39A 4LX0A 3NASA 2VQFB 1DO0A 4DBLC 3OJOA 4A82A 3CN9A 4TYPA 4BZWA 1DU4A 1QANA 2GAFA 2QXTA 4HC4A 4TTJA 2FW8A 3JX9A 4Q3NA 5EXXA 2OQRA 3EK2A 5CCXA 2B5OA 2D2XA 2VPTA 1I32A 1TUGA 1QNFA 3HN6A 3NIFB 2E5LB 1CNFA 5KSYA 5KX5B 1LD3A 2FEWB 3FWNA 4HEHA 2WTEA 4EGJA 3K70D 3F4LA 1TJ5A 4U7PB 5HRUA 3EA4A 3IIEA 3JRWA 1WWKA 4PZEA 3OZEA 1R15A 3EEIA 1CXZA 1IBSA 1Z0IA 3CNQS 2JGNA 2JGRA 3F90A 4Q9DA 4EZEA 4MX8A 1NC3A 2EV9A 2AYYA 1PL8A 1PJ2A 2XHEA 1QAQA 2OMEA 3OTHA 4HSGA 3NUZA 3QW2A 3AY3A 2IHUA 4OVKA 1PNTA 4AP6A 1HNWB 5ARBA 1VLZA 3NT2A 1UKEA 2FWMX 1NX9A 4MJLA 4RWZA 3IL2A 1RQXA 1PF7E 2Q0HA 2QL6A 2OGUA 3P96A 3EFEA 1Z2DA 4M88A 1X3LA 5H1YA 4JI6B 4WKCA 4BLPA 1GT91 3R0ZA 4XDGA 4DB4A 5DCUA 3GZNB 1PHPA 1CR4A 2Q6VA 3JYNA 3ILXA 4KK3A 5G0SA 5TC4A 4G0VA 1PT5A 1Q11A 3K1AA 1V1RA 4G5YA 3S1AA 4B4VA 2HSGA 6GPBA 1PR4A 1ENPA 3WRXC 1SBTA 1MB9A 4URXR 1UMDA 2GLTA 4FLFA 4YRFA 2FPKA 2K5UA 4C4XA 3GLFE 2PQ6A 1PJZA 3P2EA 4UPVA 3CVYA 4FMCF 1N75A 3AF3A 4NBVA 4ARSA 3ND6A 3C3XA 3QE2A 3WZLA 5HTKA 3W9BA 4JBHA 2ZJ8A 4HVLA 3N7TA 2H1OA 2E4AA 2R5WA 2DT8A 1DDOA 3G9XA 3P2JA 3P26A 1Z0JA 4KXVA 4R71A 2O06A 3FVTA 3TRHA 4CLRA 2I1LA 2HC9A 3VDMA 1C8VB 2BVNA 1RI1A 4DR4B 3WKCA 3ZCQA 2WYIA 1KFKB 5A2QA 5D6NA 5GAJA 5FA6A 2PT5A 1S2IA 5KKCA 1XIVA 1VDMA 3KWLA 1JHVA 3GCGA 1NT4A 4MEBA 1GZHB 1VRVA 4BJ3A 3WHLA 4UQOA 1EESA 1EWRA 4J76A 2CEKA 4KW7A 1M10A 3ROZA 4EF5A 1WBJB 2B3DA 3BDVA 1GZVA 4FOLA 2BISA 1EFPB 4GXRA 2W6CX 4IHJA 3D7MA 3DTVA 3DVRX 1K9SA 1E92A 1U0OC 4H6PA 2DPYA 1RLJA 1MJGA 4U7GA 1QCZA 2AD1A 1Q44A 3VU9B 3M34A 4NCAA 5JNLA 1UFQA 1C1YA 1VI2A 3KFLA 3UT5B 5MN4A 2CYCA 2DFDA 2P2SA 3DEAA 4BP1A 3FDZB 4MRVA 5TY0A 3TMKA 3CNOA 3GEPA 3KHKA 4YMSA 4JBNA 5FQOA 3GFTA 1BG6A 3EPHA 1TU0A 1FYXA 3DQQA 5EJEA 4DUYB 1C81A 3REGA 4WEOA 2HCTA 3W2GA 2VTBB 3GX1A 2TRSB 1IJFA 1PFWA 1IN4A 4NFYA 1R5BA 3BB1A 3CVJA 4O2BF 2ACVA 3WGLA 2OLJA 2BFMA 2ICAA 4BX9A 1UBLS 4XD7A 4M1MA 4XB1A 5C31A 4HB0A 3TLGA 1T5OA 4C0AC 2HCRA 1R4MB 2OBYA 4MSUA 1H4QA 2YMQA 3WISA 4OUDA 2C9ZA 2C2XA 5EHNA 5EIHA 3UJ8A 1BDBA 4YACA 3QU4A 2FMUA 2Y93A 5JR3A 2JEYA 3LP6A 3IOCA 4LY6A 3GLGB 2UV8A 2H63A 4BOYA 1DKRA 3N2GA 4CGYA 3WO0A 3GAMA 1NQWA 1X1SA 5K6AA 5IVHA 5DLEA 1YTUA 1A95A 5COBA 4N7RA 2IH4A 5B3JA 2OD7A 2YZ7A 3RHFA 3ZK9A 4NMWA 1TCUA 4DCOA 2ARKA 4UM8B 4CTMA 4F9TA 4HNTA 3NVDA 4BLSA 4LC9A 3GLIA 1OD6A 1KI6B 4B32A 2R8OA 5D7BA 3EPLA 5DSZA 2ZRAA 1Y9ZA 3UFXB 3RJTA 4QDUA 2B7LA 3HVKA 1E0DA 3C8HA 5JZVA 3UK6A 3GARA 5AK5A 1ZK0A 2VIIA 3R0QA 1N32B 3I45A 4G01B 4AMYA 2JGDB 5HOQA 3GLTA 5K0NA 2ZRDA 4J91A 2D8AA 1KBOA 3CU5A 3WLIA 2BM9A 2D00A 3FOAA 3UB3A 4HVAA 3WHPA 4BX3A 5HX7A 1RXEA 1FNDA 2CXPA 5MGBA 2IY8A 3NFRA 4XCQA 4BMOB 1G6OA 2QLFA 3V1NA 2V9ZA 1HDZA 1BN7A 3HEBA 2E85A 4HPJB 3PPYA 1XQYA 3TQHA 2OZPA 5E2IA 1EB9A 1ZLYA 3EH2A 3GLIB 2MJLA 3MERA 1Z18A 2H5LA 1RYHA 2P9EA 3G02A 5DF1A 4I5GA 5FBWB 2O1SA 1CTQA 4J3NA 3EPJA 4JROA 3O0DA 3INRA 1NF3A 3LOUA 3INGA 1MCZA 4CEIA 1ZMOA 1Q57A 1FU8A 4WOCA 4YCJA 2VT3A 2OLKA 4BMDA 3RSLA 4AZTA 1ZY2A 2C83A 3KKLA 3QBEA 1R66A 2JPDA 4KXQA 1JS1X 1Q20A 5CVVA 1OF1A 3VNSA 3O82A 5IJZA 2HW8A 1GZ5A 2Q5QA 5FHQA 4QX6A 4DSUA 3A4VA 1OREA 2FK7A 3A3NA 3TQTA 1SXJC 2QVZX 3KSBC 4I19A 2VYND 3ZI4A 4OLAA 3HUEA 3CSSA 1G6KA 2PWAA 4CBVA 1X92A 5JD5A 4DDTA 3WK8A 2YRWA 4O4IA 2DTDA 1B6RA 3DOOA 1U8FO 2PRSA 3KLOA 3ETDA 2X7HA 1D6NA 4ARBA 4EDHA 1KOGA 3W3AD 2I2AA 4FW9A 2ZDHA 4IJ6A 2F55A 1YO6A 1DLIA 1R64A 2D54A 3LQ2A 1G6Q1 3D4PA 4AKHA 4IJ5A 4CMCA 3WNZA 4JYPA 2Z2JA 2FUKA 1XZQA 2ZBRA 4KWEA 3W5HA 5J2UF 4M49A 4R69A 5FTLA 2G6TA 4NDNE 5C1OA 4PX3A 1CJBA 121PA 2FW0A 3LLMA 4RY9A 5AFSA 1OTYA 1UXKA 7YASA 4MVYA 5AJUA 4BBZA 4RO0A 5CA0B 3HP7A 1GDHA 1ZESA 1Q95A 1UPXA 2AMFA 4M0CA 1GTSA 2P4HX 2YOHA 4AKSA 5K0FA 3QVSA 2PD6A 1J1ZA 3BF7A 2HUNA 2C1EA 3Q3CA 2Y1CA 4AP5A 4QOJA 4OXIA 3PXDA 5AR1A 5B1HA 4EABA 2QY6A 2XAUA 1RKBA 4CNBA 4A03A 4I1UA 1HFWA 3LAWA 1EP3B 2VRCD 5DULA 1LPBB 1KGDA 3BKXA 4JC5A 4I3HA 4NH0A 5ESXA 1B16A 3EY9A 1DXYA 3HI4A 4PGGA 1R9GA 2E4WA 4KMOA 2YCLA 4AJ1A 5CFOA 1P39A 4FFOA 1OE0A 2ZRPA 3MJEA 4W1SA 4BNVA 3CM0A 3UJ9A 1P4SA 3H1BA 4F3YA 5LQRA 5M34A 3HRHA 1K0UA 1JDNA 2G08A 3C3WA 2DKFA 1BDJA 4NV1A 1Y48E 3SKVA 3U62A 3ZN2A 2F64A 2KBEA 3A1NA 2B36A 5H7XA 3KQTA 3ZGNA 4BPBA 2DLNA 3CJTA 2GS9A 4J0IA 1P19A 3T94A 3PFCA 1CSEE 1YRWA 1ZL0A 4C0HA 2CXSA 4LWOA 4Z4CA 2EJTA 5BWLA 3JY6A 3FOFC 1VHLA 3ZUPA 5ER6A 2ATIA 4D8XA 5JMPA 2Q7OE 3RC9A 2HU5A 5U9CA 1T36A 2XUJA 1NVGA 1Z35A 2X8JA 2FZGA 4XI9A 1YBVA 1EFAA 4EG6A 4AJJA 3C1TA 1XU7A 3PF8A 4RKFA 1SA0B 3T15A 5AVKA 2AA3A 1EWYA 3L0SA 4ZYXA 3WYFA 2JD2A 4DREA 4UM9B 3AESB 1VJ0A 3FSRA 3W9SA 1AM4D 1JYFA 4W9RA 2QG9A 3B8EA 2IUYA 2I62A 5IH3A 2CJPA 4X20A 2VDLB 5CYOA 3UKJA 2F48A 2G63A 3THSA 4CQLA 2GJ4A 4PZ9A 2DWOA 1KYTA 2VF8A 1ZINA 3AFIA 3OPMA 3CR7A 4J2OA 3SJUA 1Y8QB 4JFAA 2OK7A 1AKRA 3DXFA 2YYZA 3PNLA 5MFPA 2O8DA 4DDKA 3K9NA 3AB3A 4JLPA 1BD4A 1W88B 4G3XA 4U8HA 4YYZA 3DPSA 1XNJA 1NJ1A 1YZVA 1KMCA 5LMZA 2WWRA 2PZEA 1KFBB 2Z9DA 1JQAA 2XQIA 3CHYA 2HA4A 2R5FA 1GLVA 2GD6A 2ANBA 1YRQA 2JGLA 5KWEA 2QTVB 1B6SA 2SCUB 3IV9A 2XIJA 2IE8A 3ANTA 1KO8A 2CVQA 2G82A 3LQRA 3QNMA 4JJEA 1OYOA 2XR1A 4PLCA 4QYTA 4WT7A 4Z7JA 4JI8B 4BDSA 3T3IA 1KXJA 1KOJA 3VR4A 1YB7A 1SG0A 3P5BA 3TDNA 4GP6A 3VUEA 3KJIA 1HDYA 1U1EA 3VNQA 2Y1XA 8ABPA 3C3KA 1D2CA 2I7XA 1TEZA 3TQFA 3Q11A 4W7HA 4GLFA 1DEHA 5F7ZA 4J2HA 3E05A 3WLOA 4AG6A 2YJ6A 3H5AA 3H87A 2EJUA 1Y7LA 3NBAA 5ILOA 1LK7A 2EF0A 3C8DA 1PR9A 3ER9A 4MQFA 3DT9A 4YPVA 2O7NA 2W00A 4PZYA 3G6WA 2ZIEA 4KX3A 5K3OA 3ZY3A 3J81k 3ERCA 2X0JA 5L51A 2BJVA 3LCVB 1WTAA 5EP4A 1GXSA 4DT1B 4V3CA 2BUBA 2H8GA 1C3EA 4C20A 4MRMA 1MOSA 4JL8A 3AR5A 4C7OB 1NT2A 2EEPA 4YONB 3SVTA 1HFJA 5JDIC 4YS6A 3K70B 3WBKA 4YUXA 2D4HA 4FILA 4H7EA 1ESDA 4NZ9A 3H8WA 5EHGA 5JPIA 4A8TA 4DSZA 2IHNA 4B3GA 1SKYB 2ZUTA 1NMYA 1HZJA 3WGNA 1Y7HA 2O3TA 2Z2KA 4JUAA 1RZVA 2PTGA 5ALPA 4CUJA 4HZGA 1N5KA 4A23A 5KQPA 2V7PA 1XYYA 3LW7A 3ONEA 5KYNA 2WIAA 1F2UB 3BXHA 3DV0A 3A2NA 1QYVA 1RP7A 4LF4B 2IYYA 5ALWA 5FD8A 1ZM4A 1V7ZA 1XUOA 2ZSIA 5DX1A 2AI2A 2XXAA 2NO7A 5IDVA 4ZQGA 4C14A 2J4DA 4YDQA 5F2NA 1S0UA 1VP9A 3TEJA 4EYSA 1UC5B 2AQIA 4KV7A 2AXEA 1LCIA 5G1OA 4EYKA 4QUEA 5JCOC 4FZVA 3GLGE 4RACA 1N77A 5TPWA 3K94A 3GA0A 1OJLA 1L8LA 1NTOA 4R2LA 4CEJA 3NS7A 4R3NA 2XZDA 2N47A 3JU3A 1OI4A 3JTEA 5K9ZA 1G5QA 1SC9A 1IJEA 5F73A 4PWZA 3VNUA 3TW8A 4JI3B 2JFPA 4KLNA 2HA5A 3PR2B 2IKSA 1QHEA 4DQKA 3KVRA 5JS7A 3UJCA 5LMCA 2BFPA 4Z4QA 2O52A 1V8DA 3U81A 1L1RA 1U9IA 3IO3A 3LC1O 3G8AA 2AXNA 3ZE1B 4D9BA 4PN3A 3ICCA 1NZFA 3NGLA 1NN0A 1FLDA 3JVEA 4TM7A 4LW8A 2JVIA 3QOXA 4ZJZA 5LLTA 4B9AA 1WHSB 3SBDA 4HXYA 4HGNA 5A7HA 4CODB 1V8FA 3CTMA 1BVRA 1WG8A 3DUFB 1D0VA 3FDJA 5DCYA 3SLKA 4FFBB 2GBIA 4RTQA 2OPBA 5CVTA 1U99A 1L4BA 2Q2WA 1GKUB 2WTAA 3KEFA 4R3UC 4FZJA 1AGXA 2QGNA 2JCVA 1Z7EA 1KYWA 2LW7A 5DWDA 4G63A 1IIRA 2AB0A 3H8VA 3MINB 4OQLA 3HI6A 3K8OE 5EXEA 4XTCS 5FPSA 1MTZA 4EMBA 3EW7A 2IY7A 1JSLA 3VYRB 1JGTA 5CIYA 1KYIA 3HV0A 4IIGA 4EFMA 4X65B 4NC9A 5HGJA 3WK5A 5JSZA 2JGEA 4LSZA 3V1YA 1MH9A 1HFKA 3A2MA 1KJQA 4DCPA 3DDSA 1HA3A 3FHCB 3K5IA 4EFKA 5I5GA 3S2SA 3K9BA 2XNHA 4DA8A 1UWVA 1KERA 3JSXA 4U9IS 1JPNA 1PEYA 1RXVA 1VSUA 3SIRA 3MJRA 3R7AA 4PCUA 2IZ6A 3ZHZA 3CPEA 2GNAA 1F48A 1P9RA 4BMXA 3GJSA 2OYCA 1VA4A 3DPIA 3ULKA 2Q29A 4ATNA 1T2NA 4R1SA 4D56A 1QIHA 1Z6PA 4I50F 4DNPA 1VIMA 3IOEA 3L84A 3NNNA 3PB3A 3BEOA 3GLHA 4I81A 4QATA 5BQOA 5ALOA 3RR2A 3N2EA 1CY4A 1USWA 4L22A 5JSYA 2QVYX 4BO3A 4JJAA 1GDTA 3VSDA 1A1VA 3TSCA 2AT1A 3AHFA 4ZIRA 4P4TA 1EP9A 1P33A 2QD1A 1Y3AA 3EUWA 1PJTA 1E89A 1V8OA 3IMKA 4LOHA 1Q7EA 3WGVA 1YQQA 1Z4QA 2ZULA 1D2RA 3TL2A 1Q7GA 3N70A 1I6WA 4IFTA 4PC1A 3K0CC 3ZS8A 9GPBA 2PA3A 2EKDA 2JAPA 5CG2A 2YN2A 4OHOA 5KNCD 1ZGJA 3I9V1 3RWBA 2MIIA 1E7WA 1TK3A 2PD4A 2ZPTX 5D3ZA 4UOEA 3RYCB 1X8KA 4OHXA 4YJFA 3VKWA 5G02A 3H04A 2JCBA 2E87A 4EPVA 4JENA 1CUWA 1C2YA 2PTHA 2PYZA 2YWGA 3RLIA 1W4ZA 2IEDA 3HDYA 4PSDA 4PZLA 1ZXLA 4AN4A 3JVIA 2C3YA 2VDUE 5EE0A 1E3WA 1A9SA 2ERYA 4JMLA 4ND2A 4PAOA 3OM0A 4DDWA 1XN4A 1M1YB 1JT2A 1OAOA 1R16A 4L07A 4WASA 4NDZA 2I03A 2FUCA 1IYZA 1QRRA 2P9BA 5J4YA 1DBVO 3HY3A 1BE0A 3LVQE 3O03A 4G84A 4Q9LA 5ES4B 4F96A 5HIAA 3WV4A 2W42A 2AMYA 1P1FA 1X9HA 2Q0XA 2QGZA 3ACDA 2CC2A 4ZC1A 4DSOA 3S1SA 1MU0A 1XBTA 5FADA 2J67A 1LY1A 1T3GA 2GJSA 3EXEB 4MQLA 4TMYA 4JYAB 1I6KA 1W73A 1I8TA 2VDKB 3ZGOA 5GV7A 3QXXA 4P5PA 1SBQA 2EZ4A 2XV1A 1HF3A 3ROEA 4XUDA 5LU8A 3ZIDA 1Z7WA 4EFLA 5HTOA 4OMUA 3IUJA 4K5QA 4WBNA 4D9JA 2V4MA 1TZ2A 2QW8A 4C88A 1ZJWA 3EWNA 2CBGA 5LQKA 3QLTA 2PZJA 1X80B 1KO5A 2ETXA 2FMTA 4AJNA 1OT5A 3ZVNA 4A6EA 1BS2A 3A05A 1JSZA 3EUAA 4DR1B 3L0ZA 1T1SA 4YA6A 1G7TA 2G06A 1LX6A 5CTAA 1G6HA 4UDOA 3W0LB 1GSOA 4EY3A 3O3MB 1EX7A 1QTRA 1U2GA 3F4KA 4R51A 4A6PA 1W85A 2AE2A 4ICIA 2W93A 3R4VA 4TWJA 1M2WA 3I3SR 1JLMA 4YROA 3O3CA 5TMDA 2G0NA 3R1IA 4PPGA 3DLBA 4HADA 1ZGBA 3KQHA 2HHHB 1KMHB 1R9NA 4B09A 4DMCA 5FWXA 3H4IA 3L4BA 1SUIA 2I71A 1OGIA 1TYAE 5AMXA 1P2FA 5A06A 4DV6B 1K68A 2A9RA 3SJ7A 1AG9A 4B84A 3M9WA 3NHZA 1PKXA 2ZJ3A 3EGIA 2XW6A 4HYQA 2VK2A 5DYYA 2YWEA 3NATA 2P5SA 2XNSA 2Z30A 2QD3A 3D54D 3SC2B 4EOGA 3AVUA 2ZRJA 3ASUA 3SNKA 2J1LA 4XQ9A 3SZRA 1KO1A 2CE7A 4OQDA 1DAGA 4AVYA 2PUFA 2XTZA 3BD9A 1DAMA 2RGWA 3ENQA 4NK5A 5AJVB 3GLIE 1IU9A 2O1WA 3A25A 4MI9A 2NZYA 3H3JA 2UDPA 5L3ZA 4BVFA 2E2WA 4YXWA 1UKAA 1QHFA 1JXOA 3QV1A 1QKJA 4I5DA 5I8PA 1Y8AA 2V7WA 5DB4A 3RV4A 4C0SA 4QTZA 3GJYA 4I8DA 5A71A 3OQ1A 3O1IC 4MUJA 1JLKA 1IMJA 1ENOA 3TZHA 2QNRA 2VJQA 4P92A 4CVNA 5BWBA 4RHEA 2BI7A 3UMMA 3F6CA 3UW1A 5I7OA 2DPGA 1CBUA 1YUBA 2QD5A 2ZIVB 5L53A 5TMPA 2BJWA 1TKBA 2HBYA 3V7UA 5AVXA 2ISCA 3ID6C 4J16A 3RUIA 3DP7A 2WM8A 1DUVG 3SR0A 1JFRA 3CLHA 5TPWB 1UC9A 1MT3A 1PJ4A 1R6AA 3DE1X 2VHUA 3KJEA 1H2XA 2CEAA 3SJCA 3QEAZ 1NBIA 1FP6A 1QIGA 5EUCA 5J1TB 5KC9A 2BGGA 3VDNB 4ZI3A 4OLHA 3FTNA 4X8OA 3UATA 1UBGA 3HO1A 2AJLI 5H70A 4PRLA 5EWMA 2GEVA 4Q3AA 4UUNA 5K2MA 2XGSA 1YCHA 2HA7A 4JT4A 3MAGA 3PI6A 1YS1X 4UD6A 5TF0A 5DM0A 5CT4A 1PTKA 2IPLA 3NTOA 4OP2A 2C7VA 2JZCA 3O91A 4MQMA 4NG5A 1Y4SA 3QX7A 3U4AA 1VSTA 4AS2A 1A9OA 3UHAA 3ODPA 3CRVA 3KR9A 3NG1A 4ZXPA 5AHXA 4ZFNA 4NE7A 3OZCA 5DM70 4R7TA 5BN1A 5CLFA 2ZAGA 2BSQA 5J2UB 4DV5B 3W05A 4PM4A 4R40A 5J5AA 1GFWA 2WM9B 4M38A 3RRFA 3S2GA 3K3PA 2P8SA 2ZYRA 5DI3A 4DRZA 2EC5A 1N7GA 1ZUHA 2EX1A 1FDUA 3IBGA 4NQRA 4NICA 4PFJA 5G53C 4AG3A 4WKPA 4EKEA 1W52X 2Q6IA 4EKYA 1J20A 1HOTA 1U28A 4D6XA 4F7WA 1KY4A 1CJTC 3CUSA