1XA0A

Crystal structure of mcsg target apc35536 from bacillus stearothermophilus
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
328
structure length
318
Chain Sequence
MSAFQAFVVNKTETEFTAGVQTISMDDLPEGDVLVRVHYSSVNYKDGLASIPDGKIVKTPFVPGIDLAGVVVSSQHPRFREGDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAMAIGTAGFTAALSIHRLEEHGLTPERGPVLVTGATGGVGSLAVSMLAKRGYTVEASTGKAAEHDYLRVLGAKEVLARELDKQRWAAAVDPVGGRTLATVLSRMRYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVYCPMDLRLRIWERLAGDLKPDLERIAQEISLAELPQALKRILRGELRGRTVVRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MCSG Target APC35536 from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative NADPH Dependent oxidoreductases
total genus 88
structure length 318
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xa0A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1xa0A01
3Q2IA 2PFGA 3KSZO 4LRSB 2NQTA 1A7AA 4E5KA 1E7WA 2Y0CA 3VAZA 1RM5A 1DAOA 2NUAA 3FNGA 4RZIA 1SBYA 4TWRA 3PHGA 3SC6A 3GF4A 1E6UA 3I9OA 4R68A 5I9NA 1T4BA 1O95A 1EVZA 3OA2A 4J7XA 3RAJA 1EFKA 2ZJ0A 4YPOA 5JBIA 3STHA 2AEMA 2O3SA 2GERA 4CMIA 2O2SA 1K89A 2HK7A 5L4LA 1TLTA 1ONNA 1HZJA 5CDTA 1QLHA 2EW8A 3JQFA 3HJAA 1O5IA 2GASA 1P31A 3NT5A 3SLGA 4H16A 3HZZA 1VSUA 4TSKA 4YJGB 3QQPA 2PKRA 1WPQA 4FW8A 4OXNA 3RC1A 3WIDA 2AQ8A 5KOIA 4R4JA 4IZIA 3JD3A 4TKMA 1T4DA 4I8XA 5A5FA 2X0NA 3VZRA 4MKXA 2VWHA 3WWZA 1P33A 4A10A 1UDAA 3QWAA 1KVUA 3UICA 3DO5A 1E3LA 2JL1A 2WYUA 1T26A 2QRLA 5IN4A 2GN9A 4RV9A 1UP6A 2VN8A 5IFLA 4BOYA 4ALKA 2HSDA 1XSEA 4QO7A 2FPGA 3RROA 4PZEA 5FI5A 4L73A 2P5UA 1Q0QA 1YXMA 1M2WA 2HKIA 3FNFA 4D44A 2IXBA 3KETA 4GX1A 4XIYA 1BW9A 3A14A 2WJPA 4YAJA 3BTOA 1H6CA 2GLXA 2JD1A 1R15A 3GHYA 1DLJA 1UAGA 2UYYA 1I33A 2YQ4A 3FNHA 3JD1A 4Y6PA 2PTGA 2HMUA 2VYVA 3KOUA 3QVSA 1WLYA 4KTTE 3F1LA 4GSKA 4QUKA 4LRTB 5A5EA 4MVJI 5F5LA 3T4EA 1NVGA 3I9MA 4GVLA 4J1SA 3ADPA 3NJ8A 4L74A 3DBHB 4QO8A 2W98A 2Q3EA 3DONA 3FTNA 1D8AA 3JQAD 1A27A 4XQGA 4WLVA 4Z3KA 1O94A 1IHYA 3C24A 4B4UA 3ADOA 3H5NA 4BNKA 5C7LO 4M8SA 3OSUA 4GLOA 1E1NA 2QRKA 1XYGA 3BHIA 1E3IA 2HRBA 1Y6JA 1H6DA 4F3YA 3E03A 4UUPA 3MTGA 1UXIA 1JWBB 4CL8A 1PQWA 1DJQA 1UP4A 3B70A 2YHUA 3B6ZA 3GN1A 1BXGA 3KHUA 3JQCA 2EP5A 1NQAO 2GD1O 3QSGA 4ZN6A 1YQXA 2X0IA 4KZPA 4GX0A 1CETA 2X0RA 3JTMA 1E6EA 4JQCA 2W2KB 5KVVA 4A5OA 1PJTA 2I67A 2IZ1A 2NU9A 3UAGA 1PS9A 1EQUA 4S3MA 4NBTA 1QORA 4UUOA 3F4BA 2ZJ1A 4E0BA 1V9LA 2DAPA 1XCBA 1P45A 4XGIA 3V1YA 4PG8A 2X5KO 3HDJA 4BGVA 4J1QA 2DBRA 4XB2A 2ET6A 5DZSA 4URFA 3ANNA 3GPIA 5DBIA 4PRLA 1PZHA 5TQVA 3H2ZA 1YDWA 4W7IA 4UVHA 5GMOA 3B20A 3GDOA 3Q9NA 3IUSA 1X15A 3K73O 3VKVA 1KC1A 1U4OA 2DBVO 3PRJA 4CUKA 2VCYA 3WMWA 4RVGA 5AXBA 4DQVA 6LDHA 4M55A 4BL5A 4ALLA 1JDJA 1ADGA 5JYEA 1NXQA 2HQ1A 1X7HA 4OXKA 2C29D 1Q0HA 3LVFO 2NWQA 1BGVA 2ZCUA 4K6CA 2I5PO 2B83A 1LDGA 3ZV3A 2AQIA 4WLUA 1YBVA 1M6WA 4YJHA 4E5NA 2Z95A 5IDYA 2RAFA 5L40A 5JNLA 3UCXA 3CPSA 1Y8QA 2BI8A 3FPCA 3CMMA 1EDZA 3PHIA 2HAEA 4ITUA 3AOEC 3ASVA 2HUNA 4RCVA 3AM4A 4BNXA 1BXGB 4NJMA 2OFPA 1LSUA 1SMKA 2JFFA 3FPLA 4IQ8A 4A27A 5F1OA 2ILTA 1TT5B 3MZ0A 4PG7A 5F21A 3AOEA 2OGUA 4TZKA 4O63O 5CHEA 4Q9NA 4YACA 4J91A 3JYQA 2J8ZA 4LK3A 4IIVA 3K96A 5U9CA 2O4CA 3W6UA 1ISIA 4M54A 4BV9A 5EIOA 3PGXA 4RPLA 2RHRA 5DCWA 3VH1A 3V2HA 3DAFA 1ISHA 2GPTA 5CFZA 3NX4A 3RIHA 4BGIA 1MFZA 3DHEA 5AXAA 5TC4A 2A94A 4Z0HO 3DBLA 4ALJA 3G17A 3EHEA 3GFBA 1UR5A 1JTVA 2AEFA 1A5ZA 3JQAA 2J3JA 3WFIA 1RJWA 2B37A 5DF1A 1HDYA 3GVHA 2E48A 2O7QA 5B37A 1LJ8A 4AJ4A 4BKOA 3OICA 1G6KA 4ZICA 5JC8A 2VYVD 2Q1WA 3GEGA 5H83A 2VRBA 2CVZA 1N9GB 5G4KB 3RBZA 3ZWYA 1SNYA 4DPKA 5TLSA 4IJUA 4XDYA 3GK3A 1RPNA 1T24A 5U1PA 4JP3A 3U4DA 3OHSX 3I83A 4OL9A 1GPDG 3ITKA 4RVSA 1PR3A 1AXGA 2A92A 3RUCA 1I24A 1CQIA 4DC0A 3O8QA 3DEYX 3V2GA 5KVSA 3H7AA 1N2SA 4GMFA 5HRUA 2EERA 2BHLA 4CM1A 4P4NA 4CM8A 1PZGA 3IL2A 3BXXA 3C1TA 4FJ0A 4ND5A 1R12A 2H9IA 1WW8A 4J0EA 5KJCA 1VM6A 3AU8A 4EUHA 4F46A 1R0KA 1WZIA 4ZQEA 4Q3BA 4M87A 4CLEA 2D2IA 1YOVB 3MJCA 3FF4A 2DKNA 3D0OA 2Y66A 5HTOA 3PP8A 5JMPA 3SXPA 4J6FA 4DLAA 1ONOA 1ADCA 3SJUA 1RM0A 4NQZA 1ADFA 4PVDA 3JQ6A 3OP4A 1YRLA 1G0OA 1Z7BA 2OOSA 2V65A 4NIMA 1E1LA 5AQ1A 5KCZA 4FB5A 1RWBA 5DULA 4WJZA 4OM8A 1LLCA 4I5EA 4NR0A 1IE3A 4TKLA 1R16A 1B16A 3F3SA 2QW8A 2HJSA 2PLAA 3KUXA 4RVFA 1GEEA 2DU8A 1U8FO 1YB1A 3H4VA 4LVUA 4C7JA 1RYDA 3O8QB 1HDXA 3KEOA 4CMIB 1AXEA 3PGJA 3V2UA 2GF2A 1ZJYA 4E31A 3DFZA 4QQRA 2JAHA 4GWKA 4PLTA 4D0SA 1XDWA 3EVTA 3JQ8B 1UH5A 2H1SA 4WOJA 1F8GA 2WE8A 2EEZA 3HFGA 2IE0A 3KYDA 3RC7A 3QWIA 3TZHA 1EEHA 1UDBA 4E2XA 3ZHZA 4JBGA 1ZSYA 2V6BA 1Y9AA 1E92A 3LF2A 3B1KA 3CKYA 4YJFB 4Q3AA 1ZMTA 1E1MA 2B35A 3H5RA 3W8EA 2D5AA 4AJLA 1QYCA 1N92A 1P1FA 2D3TA 3NAQA 4GAEA 4YVFA 4E12A 3F6YA 2ZATA 1LLUA 1H9BA 1QLJA 4BNLA 5DCYA 1EFLA 2VHZA 3ONFA 3RUEA 3NTQA 4TZTA 3ENNA 2EGHA 4OKNA 5B12A 3QVXA 1U2GA 2V6GA 4IUYA 4WPGA 3RFTA 3HB4X 1VC2A 2A35A 5BSHA 3WGQA 4D79A 1KETA 4IQGA 5CDYA 4XKJA 1R4NA 4NMHA 3D4PA 5JCXA 1T1SA 3BTSA 2Q1UA 2VWPA 3E9NA 4PG6A 4D42A 5A9TA 1B2LA 3MWEB 3Q6IA 2B5VA 5IZCA 4OAQA 3PHJA 1K6XA 2CUKA 1R0LA 3IP1A 1EDOA 1Y7TA 3SJ7A 2Q46A 1Y8QB 1ZH8A 2QYSA 5EMHA 4G81A 4W82A 1MLDA 1PIWA 2PZMA 2EF1A 4KUGA 3GUCA 3ROQA 1KERA 3VH2A 1EVYA 4OSOA 2QRJA 1QSGA 1BVUA 2JFGA 4F6CA 2WEKA 3ZHBA 2YV2A 2J3HA 2LDXA 1P1HA 1T2AA 1DIBA 1J4AA 1F17A 3INGA 3PLRA 2FR8A 3BMCB 1FDUA 3W6ZA 3ZNOA 3LC1O 2RH8A 3GHHA 1PJLA 3QLJA 4U8GA 2R00A 3WGYA 2QYTA 3U5TA 3OETA 3GA0A 3JQDA 5C7IO 1YL6A 1IZ0A 1W8DA 3JQ9C 3SX2A 4L4SA 3PEFA 4G5HA 2EP7A 3R6DA 3DC2A 3VVBA 3KZVA 2JJYA 4RF5A 1NHWA 3R3JA 2NM0A 4U6QA 4BGEA 4ND1A 2EV9A 3P19A 1UZNA 3TZCA 2P9GA 4J7CA 5IAAA 1I3NA 1C1XA 3D5TA 1UJMA 4KDFA 2WD7B 1JKJA 2Y1FA 3OA0A 5AVOA 3ZW9A 5A03A 3JD4A 1ZSNA 4XJSA 1ENYA 4AJEA 4YT4A 2C59A 3DZFA 5T64A 1DDOA 1B3RA 5F1KA 4CR7A 4E6PA 2CF5A 5ADHA 3VDRA 4IS2A 4NI5A 3G49A 5AYVA 4II2A 2CNBA 3Q2KA 4OQYA 3ZV5A 4INAA 4YQZA 5JDIC 2YZ7A 1ZFNA 2EJWA 1VJ1A 2YHIA 3HDQA 4RPKA 1GL3A 3L0DA 4YDRA 4EBFA 4F45A 5AXCA 2PGLA 2Y0DA 2EKPA 5DOZA 3WGZA 1B15A 4UUNA 3I6IA 5ER9A 3L4BC 4LCJA 4UVEA 4XR9A 2R2GA 4YXFA 2I6TA 3FR8A 1DRVA 3U09A 1W0CA 3ITDA 4WCFA 1OC2A 2PKQO 4PG4A 2P91A 4YAGA 4TRNA 4BNHA 2D4AA 1C0KA 4HFNA 1KVRA 1U3UA 1LTHR 4HXYA 2EHDA 1S6YA 1DJNA 1CEQA 4I5FA 3ZWVA 4WLNA 3TOZA 3RCBA 3OQ6A 4AICA 4NJMB 2B4RO 2Q2VA 3BMNA 5L53A 5G0UA 2I9PA 3ZNQA 2QIOA 4GKVA 2EXXA 3KTDA 4YJHB 4YT8A 1TB4A 1U5AA 4JCOA 4PG5A 5K1SA 3TZKA 4D3DA 1BTOA 7MDHA 1TI7A 1N1EA 1Q2XA 1ISFA 3DBVO 3DZHA 1SCUA 3JCZA 4R54A 1WNTA 4AFNA 4AJKA 4CV2A 3M2PA 2E4AA 1E7YA 3A1NA 3G0OA 3GVXA 3O26A 1NR7A 1FXSA 3HE3A 3ONEA 3LF1A 2ZTUA 4A26A 4OHUA 3I9NA 3QVOA 3LSYA 3VPFA 3VZPA 3BIOA 3O4RA 4R5HA 2Y1DA 4IZHA 2PGJA 5DCUA 4CLRA 1NFQA 3H9GA 4OSPA 4NHEA 4PRKA 2ZCVA 3AWDA 1WXDA 3JQ9A 4ZQBA 4PFJA 1LA2A 2F00A 4EZBA 3AFMA 4WK6A 1TT7A 2R00C 4W7HA 3GVIA 2NACA 4IGEA 4K26A 5DP1A 3WYBA 4YRAA 1I30A 3HADA 5I8WA 1ISJA 1O9BA 1T2DA 2I99A 4ZGWA 2FOIA 3WBBA 2BMAA 1VL6A 1E7MA 2IEDA 1QV6A 5CDSA 1ZNQO 1C0PA 4L0QA 5A1TA 4FS3A 1B8VA 5KKAA 3H9UA 1T2EA 3GR6A 2NTVA 1SB9A 1GTMA 3WQQA 4UVGA 2FPPA 5JY1A 1KOLA 3WSVA 4CV0A 1PGJA 4D0RA 4GQAA 3OJ0A 4MVJM 4P8RA 4MINA 1SPXA 4XYEA 2EJVA 5A9RA 5JYDA 4E2ZA 4MIOA 1V6AA 1NYTA 4YB8A 1CRWG 4ZQFA 4JGBA 4D41A 1MG0A 1YDEA 3WDSA 4LSWA 4EEXA 4FSHA 5IDXA 1D7OA 5I7SA 2GN8A 4DGSA 4ALNA 1VJ0A 1M66A 3CZMA 1N7GA 4BO6A 4WGGA 5F1PA 4YRDA 4BO1A 1PL7A 3VHRA 1OC4A 4E5MA 4PIVA 3QIVA 3LU1A 1HDZA 3CSDA 3JYLA 5K6AA 3OF2A 1KEUA 1PS8A 2WE7A 3ETEA 1SAYA 2PZLA 3K2EA 3PWKA 1XKQA 5EN4A 3PYMA 4PLVA 1R37A 3UXYA 2G82A 5A4DA 3IKTA 1WDLA 3TDKA 3N7UA 5JDCA 4OOEA 2UAGA 3MOIA 3X2FA 2BFPA 3AW9A 1DEHA 2UUPA 1GQQA 1M75A 2HMSA 4S1VA 1PJCA 2RHCA 4BMVA 1NPDA 2J5KA 1C1DB 3MJVA 4ND3A 4J0FA 1QP8A 2JCYA 3V1TC 2X4GA 2Q1TA 3UCEA 5IZ4A 1VJTA 4FJ1A 3E48A 1OOEA 2XOXA 4BIIA 4W99A 1K2WA 4R3NA 3ICCA 3MJTA 4W6ZA 4UREA 4P4LA 2XXBA 1E3WA 3C7DB 4XQEA 1MG5A 1PJQA 3E18A 1EMDA 4GI2A 2FSVA 3GMDA 2H63A 3X2EA 1HE3A 1E7QA 3TSCA 1NAIA 5TS3A 1PZEA 2YQ5A 3LT1A 5GZ1A 3BMNB 2JD0A 4C4OA 4B7XA 3DFUA 2ZIZA 1PQPA 1Z45A 3AM3A 1PU2A 4UEKA 1HKUA 1C1XB 1ZUD1 1DHRA 1ZW1A 3FNEA 2CVQA 2H5LA 3LT0A 4XIJA 3ZWXA 3G1TA 4UEOA 4L4XA 4RPHA 4RQTA 3AI1A 1HYEA 5T8KC 1E1KA 3GAZA 3A9WA 4NBWA 5FF9A 3WGOA 3DTTA 1ZO8A 3INRA 3ZU4A 1ZZEA 2IZZA 2AQKA 2HRZA 3GY0A 4Q3DA 2OBNA 4J3FA 3EZYA 3Q0EA 4AJOA 1EZ4A 1R0SA 4Z3DA 2ZB3A 4Y8VA 3DZGA 4CQMD 1YE3A 4BQPA 2YHIB 2O3UA 3HFSA 2YFQA 2LDBA 1JU9A 4N5LA 3D3WA 4ZHSA 4IY1A 4QECA 5KVQA 4CUJA 1HE4A 1IHXA 4CQMA 1PWZA 3BTVA 3L6DA 4B4OA 4AJHA 1YGYA 4MVJF 4M49A 3ZHXA 3PQFA 1AUPA 1H9AA 1MC5A 1ONPA 1DPGA 2PR2A 1QYXA 4CODB 1HXHA 1U2DA 4IDFA 2DPGA 1ZK4A 3GRKA 3ORFA 4AL4A 4E2YA 5BNTA 5I9LA 1KBZA 2W4QA 2PY6A 3KEQA 2G76A 3ULKA 5A9SA 4BB5A 4DQXA 3JQEA 3GRPA 4BO8A 5B4VA 1BSVA 1XWFA 3I9JA 3I52A 4CMKA 2WTBA 2V6MA 3QWBA 4H3VA 4J90A 2G5CA 1A9ZA 1LC3A 1N8KA 4CMEC 2Y1OA 3PTZA 4YTEA 4CM6A 4WASA 3UF0A 3WYCA 1EUDA 2C2YA 4EITA 4PLHA 1DOHA 3GLQA 5ICMA 1LQUA 3TJRA 4W4TA 3AFNA 4M89A 3KSUA 4TQGA 3BHJA 4IINA 3DHNA 3OJEA 1YVEI 2DTDA 3WSWA 4R5MA 4DWVA 3COSA 4R69A 4IIUA 1F8FA 3AY7A 2UVDA 4QXMA 4D3SA 4J49A 5L3ZA 1V8BA 3IMFA 1CDOA 4GSLA 4N5MA 4TRMA 1CIVA 2AMFA 2O2YA 4CM7A 2WSBA 4IM7A 2IZ0A 3DWFA 4JBIA 1Z7EA 4NFSA 1OI7A 2HLPA 2JFHA 4NBVA 4Q3NA 5JW6A 1ZXLA 4DXHA 2NQ8A 4UVDA 5TIIA 1JVSA 4FPXA 4B7CA 5HS4A 1ZKMA 2PA3A 5COQA 4U0JA 5C3MA 3CE6A 2EG9A 3ZWCA 1YL7A 2A9FA 2FR1A 1RM4A 2Q2WA 4F6LA 5DBGA 5EJ2A 3AM5A 2B5WA 2EW2A 2TMDA 5BSFA 3ZN2A 1MFPA 5CDUA 4L8VA 2HCTA 4B3HA 2AG8A 3WJ7A 4PLYA 4HFMA 3MCVA 2Y93A 2J3IA 1I8TA 1WMAA 1H94A 4FJ2A 4R1NA 1P44A 3D7LA 3O03A 4OOFA 3IUPA 4OKIA 4FOSA 3AU9A 4CLOB 2B4TO 3DBLB 9LDBA 5CEJA 4CMEA 1YWGO 3DAPA 1IY8A 5ITVA 4ZQGA 3EAGA 4D46A 4RDIA 3OJOA 3WFJA 2CZCA 3VDQA 1H0KA 5K0ZA 1E77A 4YR9A 5MGBA 5G0TA 1ADBA 4LMRA 3PJGA 3HWRA 5ITWA 2DFVA 5TT1A 3RSHA 1QXSA 4FC7A 1QKIA 1KVSA 4DQUA 1OBFO 3OQ1A 1TT5A 2AG5A 1WZEA 2D5CA 1UDCA 3F9IA 3K30A 5T67A 3TOXA 1Z82A 5ENVA 3C3XA 3OFSA 3IJPA 4BNNA 1HZZA 3UVEA 5BQFA 1LX6A 1PJ4A 2WDZA 3QVTA 3WQSB 2CMDA 1AHHA 1I36A 4GWGA 4CM5A 5K9ZA 3W4JA 1WVGA 1LDYA 3AI2A 5L9AA 1ENZA 3PXXA 3N74A 1N7HA 4IDDA 4FDAA 4WOKA 3KVOA 4AJNA 2JCXA 2Y1GA 4DBVO 3T7CA 4L4RA 4YRBA 2PZJA 2C0CA 2O7SA 4U7WA 4CUZA 1PWXA 4MVJD 3OIDA 3BMOA 4MDHA 5I9MA 1NFFA 4II3A 1UZMA 3GFGA 3EC7A 3DOCA 1PR9A 2YYYA 3QHAA 5JY6A 1NVTA 1HF3A 4TRRA 4KWIA 2D59A 1Q7BA 2FRDA 2VOEA 1F14A 4QEDA 5JE8A 3PWSA 1SOWA 4GVXA 1VL0A 3L4BA 1R4MA 1XGKA 3DQPA 3RI3A 3TRIA 4ZA2A 1ML3A 2YY7A 4EJMA 3H3JA 1WDMA 3H5AA 1I01A 3RUDA 4NZ9A 4QX6A 3VVCA 1XHLA 4WE3A 3ST7A 4MIEA 4CQLB 1LDBA 4NNJA 3H8VA 2E6UX 2IXAA 2ZKLA 3UFXA 3DL2A 1XU9A 4BQRA 3I4FA 4GMGA 4PN3A 3GDGA 3RBXA 4JLWA 1U28A 2B4QA 3OMLA 3P7MA 5GZ6A 1I2ZA 1UZLA 2VOJA 1LQTA 2ZB7A 4MKRA 1ENOA 2VZ8A 4N5NA 3EZLA 3NTRA 2P2SA 4NFYA 1SO8A 4NU5A 5T8KA 1E0DA 1KY4A 5JDIA 3AY3A 4WLOA 1KVTA 2CFCA 4E3ZA 5IXYA 4MKZA 2Y0EA 2XF8A 4RVUA 4LSMA 4IMPA 1H6BA 4LCEA 1PGNA 1YONA 4MJLA 3RBVA 2G17A 1JW9B 1NR1A 3DZIA 3JQAB 2WYVA 3G3EA 3PQDA 1IZ9A 3I6QA 4DUPA 1ORRA 3QE3A 3GG9A 5COBA 4PZCA 1KC3A 4EEZA 4ND4A 3TQHA 1PL8A 3WWYA 5AXDA 3G79A 2VUTA 3D1LA 4GH5A 3NV9A 2I76A 2OP1A 1C0IA 3DHYA 4MPDA 1LSJA 1Y5RA 1Y8RB 2NVWA 1IPFA 2VQ3A 1R6DA 4ID9A 4CLRB 2E49A 3ANLA 3ZWAA 2CVOA 2UV8A 3ROKA 2QX7A 1Z75A 1SB8A 4DVJA 5TGDA 5DOVA 2VT2A 1DRUA 3KSDO 4WUVA 3C1OA 5CEFA 2Q2QA 5A3JA 3L9XA 1DFIA 3U49A 2PH3A 1NQTA 4R01A 3VTFA 5JSFA 2FY8A 2ZYGA 4BNVA 1IOLA 4TROA 1MC4A 2DBZA 4OGWA 1IYZA 1JQBA 2GO1A 3ETDA 1LLDA 3UCFA 3LC2O 4DC1A 3F5QA 4YAKA 5JDCC 1HLDA 3WMXA 1LLQA 1B8PA 2BKAA 1DIAA 1X1TA 1T2CA 1RKXA 2Q4BA 4CQLA 3A06A 1LU9A 4XGNA 3W1VA 1U1IA 4XQCA 1RM3A 2OZPA 1BG6A 1KYQA 3PIDA 1U3WA 1ZK3A 3CUKA 4R1UA 4MO2A 5ENDA 3WGTA 3JQBC 3OQBA 1LI4A 4G65A 3ZCXA 2W8ZA 3HUDA 1KS9A 3RJ9A 1P1IA 1B14A 2P4QA 2WM3A 3HDYA 1QV7A 5DP2A 3BMCA 5B4UA 1O0SA 3K6JA 1Z74A 2TMGA 1KVQA 5JC1A 2FWMX 4BUCA 4B3JA 4WLFA 5KJFA 5CEEA 3BZUA 4K9DA 4AJIA 4B3IA 1YB5A 1ZEJA 2DT5A 4K6FA 4CM4A 1YL5A 2EWMA 1NWHA 4PCVA 5THQA 5JAZA 5A02A 1BDBA 1VE9A 5C7OO 2AQHA 4R1SA 4BNZA 3LT2A 3HSKA 5EERA 1L7EA 3B1JA 1PSDA 3NJ4A 1DO8A 2BD0A 1CYDA 2VHWA 2X5JO 4O1MA 2Q4EA 4RQUA 4UAGA 4PLPA 4FN4A 3FBTA 4DMLA 1P3DA 1AGNA 3GVPA 1SOVA 1UXGA 1GYRA 3V1UA 4LISA 4RL6A 3GUYA 4U6SA 3CXRA 3E5RA 3S2IA 1X0XA 2P68A 3GN2A 2WD8A 3KO8A 5A04A 2C20A 3DTYA 4AJJA 3NGLA 3TL2A 4BNFA 5G2OA 2OL4A 2YDYA 2D0IA 2C54A 1U8XX 1FK8A 3QVWA 1I3KA 1HYGA 2C5AA 3PWZA 3F5SA 2IRWA 4KMSA 3WTBA 4CMAA 2Z5LA 3GNTA 4I9UA 1U7TA 2CDCA 3IIEA 1TA4A 3KV3O 3JSAA 1R4MB 2GR9A 3L77A 4J1TA 5ILOA 2YV3A 2QHXA 2BF7A 1HE2A 2YUTA 3ABIA 1E3WB 2OBYA 1SEVA 4Y67A 5DNAA 3DBRB 2O3RA 4BNYA 3C1AA 4IJKA 1P74A 4EYEA 2BRUA 4HBGA 5JXWA 1XA0A 5JAMA 2NLOA 4I9NA 1ZJZA 1C1DA 1V35A 2ZYDA 3PDUA 1VL8A 5BNIA 3WGIA 3BMQB 5TNXA 1ZXBA 1B7GO 2GCGA 1H2BA 1NNUA 4XRRA 1LDMA 3S55A 1FDTA 5L7WA 3RKUA 3WX0A 4DYDA 1U5CA 3WIEA 1M76A 2IEBA 1BWSA 5FWNA 3JQ7B 3ZU5A 1ZIDA 2DPHA 3GMSA 3E5MA 2X7HA 3D4OA 4WLEA 5MDHA 2A4KA 7ADHA 1P77A 1P0CA 2NTNA 3GVCA 3NUGA 1W73A 1EUCA 2DUUA 2FSSA 4J4HA 3MTJA 1DHTA 1N9GA 5G4KA 4DL9A 2ZQZA 4GLLA 3MJ4A 3KXDA 3ROPA 1NTOA 2HMWA 4Z9XA 1X7DA 3LLSA 4B79A 1GZ6A 3ZWWA 4J43A 1O8CA 2AW5A 3IOYA 4WNIA 1I3LA 1X13A 1J0XO 2BFOA 5G0SA 1ZBQA 1PQUA 4YCAA 5L45A 3ROMA 3MJEA 3RUFA 2V7PA 1OZAA 4BB6A 2Y68A 3JQBA 3T7EA 2YV1A 3SVTA 1MXHA 1LXCA 4CPDA 1O6ZA 3VOSA 2O23A 3KLMX 1P1JA 4JP2A 1A9YA 3JD0A 3UW3A 4J1NA 4MVJG 3RFVA 4BO9A 3CINA 2UUOA 3FRJA 1EE9A 1I0ZA 5CG1A 4BKPA 5CDGA 2ZB8A 1GEGA 3AUSA 5DDIP 1TVEA 4KQXA 3F46A 4CM9A 5ICSA 1QMGA 4P38A 3FCOA 4FFNA 4OXYA 4BMNA 1RYEA 2E37A 1HDRA 4K1LA 1ENPA 1CWUA 4ZQHA 1KY5A 1ZMOA 4OO3A 2X23A 3D5QA 3AK4A 3ZV6A 2D1YA 4ND2A 1ULSA 1HDGO 1YO6A 3RQSA 4CQMB 1F0YA 3ZDFA 4MP3A 4CMHA 5LC1A 2X5OA 4WEQA 3RC2A 3RJ5A 4DIBA 2I66A 4ZU3A 1VLLA 2X86A 4PLFA 2I65A 2QZ9A 3I5MA 3GEMA 4P4GA 2VHYA 4IMRA 2PNFA 4CLXA 5IJZA 3AY6A 3OJFA 4IDCA 2ZTMA 2Q45A 2VHVA 5CG2A 5LDHA 3BTUA 1JLLA 2QQ5A 3UGKA 3S2FA 3KYCA 3NDIA 4EI2A 3Q11A 1PS0A 1HYHA 5F3RA 5KTKA 2CSUA 3HQ4O 3SC4A 3WGGA 4Y98A 4DMMA 1NQOA 3B1FA 4YA6A 4AJ1A 5JO0A 3ETGA 1DSSG 2FHSA 4BKQA 1E5LA 2VUUA 3HHPA 3R1IA 4KDEA 4PLWA 4IPTA 1PGOA 4XJTA 4OQZA 1NBOA 3PFFA 1K0UA 1YKFA 3C8MA 5G4LA 2BI7A 5GZ3A 3JYNA 1UUFA 1DFHA 3WTCA 2PGDA 3JQGA 4I9HA 3I3OA 5TRTA 2P9CA 4GKBA 1IULA 4HP8A 4IDBA 3VPGA 4A7PA 2Q1SA 4JN6B 3ZWBA 4B4WA 4OIMA 4QT0A 4WCFB 4JNKA 1KIFA 9LDTA 2PD3A 1ZVMA 3L6EA 2IYPA 3GT0A 5A06A 4MIYA 2PH5A 2UDPA 1HSZA 4FFOA 5HBRA 4DTIA 1A72A 1DC5A 1EK6A 1GZ4A 4OJNA 3U9LA 4BNMA 3W4KA 1Z73A 4XEHA 3E1KA 3QY9A 3U4HA 2QZZA 2VRCA 1U9JA 5TF4A 2Z1NA 4EUFA 3RFXA 5C37A 3JYPA 1LNQA 1HDOA 1EVIA 1LC0A 4IDEA 1DLIA 2GZ2A 4NFHA 3IS3A 1PL6A 1Y8RA 1DC4A 2NV6A 4RDHA 1SEPA 4MOWA 4DIFA 3AUAA 3HB5X 3IAHA 3PHHA 4G2NA 4UEJA 4CMJA 4FC6A 5L4SA 1HT0A 2Y99A 3K9QO 3P5SA 3QWFA 2X1HA 5H82A 3TL3A 2GYYA 2WD7A 3H65A 3RC9A 4O0LA 1GR0A 5JO9A 4ROSA 1PGQA 1C3VA 4E21A 1U3VA 2W90A 4CLDA 3AUTA 1UXHA 5HS6A 3EUWA 2P5YA 4YWJA 3SEFA 1V3VA 1AN9A 3HN7A 3IC5A 4EJ6A 1BDMA 3ONDA 3AJRA 4TRJA 3WLFA 3PFWO 4M86A 4BVAA 3TFQA 3CZRA 2X58A 3QRWA 4FGWA 2C82A 1JVBA 4HFJA 4BO7A 4BNJA 1IL0A 4E2WA 4J4TA 4I5GA 1I2BA 3EW7A 5JPIA 4FFPA 4DLLA 1X7GA 3K2BA 3EY4A 1OFGA 1C0LA 5IXSA 1Q7GA 4Z0TA 5BNFA 1XLTA 3W8DA 1LRLA 1P0FA 4QSMA 1ZSVA 2BFMA 4XYGA 4Z0PA 3WG9A 3WICA 1KEPA 1B0AA 3PLNA 1NQ5A 3ZHYA 2BFAA 5TJ9A 3VPXA 3H9EO 4Y6RA 2GZ3A 1J6UA 5CP8A 3WXBA 1VSVA 2C5EA 3A4VA 1YQGA 1NHGA 3R0IA 2QG4A 4KUEA 4CL3A 3CMCO 3LZ6A 3PIIA 5CPBA 2VNAA 4CMCA 1MGOA 3F1KA 3GAFA 4E30A 3DZBA 4FBGA 4YJGA 2AA3A 1FF9A 4MVJA 1OAAA 4BNUA 4FOOA 4XRGA 4U0KA 5JAIA 4K28A 4MVJH 4B4VA 1JAYA 3S1LA 4A73A 3U3XA 1GUYA 2VZ9A 4Q3CA 4BS9A 4JROA 1GAEO 3EK2A 3O9ZA 1L1FA 5B4TA 5I7EA 4BHTA 1HETA 1XIVA 1I5RA 3BMQA 1S7CA 2RH4A 2DC1A 3PI7A 4U5QA 3PZBA 4WEOA 5TJHA 4LW8A 3ZZNA 2OORA 1FMCA 1Y5MA 4J2OA 4TVOA 5JMWA 2FP4A 2W2KA 1H6AA 1MXFA 3VPSA 4X54A 2C07A 4O6VA 3ZGYA 3FN4A 5L51A 2J6IA 4YQYA 3NTOA 2OHXA 2CD9A 3GEDA 4HADA 4IGFA 1Y81A 4DPLA 2PK3A 2O48X 4P22A 3AOGA 1IB6A 5BR7A 1Z6ZA 4R1TA 2FZWA 4YAEA 5JS6A 1GCOA 4RVHA 3WNVA 4BGUA 4BKUA 4XYMA 4WECA 2FR0A 1EBUA 1QG6A 5C5IA 1HWYA 3OBBA 4L76A 2ZTVA 3GPDG 3F47A 1FJHA 2Q99A 1V3TA 4E13A 2HK9A 2EKQA 1W6UA 2B36A 1GY8A 3KYDB 3VPHA 4CM9D 2O3TA 3DBHA 4BO3A 3IKVA 1CF2O 1HEUA 3OJLA 4JIGA 5TSDA 3N58A 1WP4A 4KQWA 3UOGA 4D43A 1LRKA 1Y9EA 1TXGA 3E9QA 4XD2A 1QR6A 5KJ1A 4E5PA 3RKRA 3GH3A 4BKRA 3DDNA 1D3AA 1EUZA 1VKOA 3WBFA 3KM0A 2JCVA 5HM8A 4GPD1 1LEHA 2Y05A 4A2CA 1XQ1A 2B69A 1U7HA 4ZVVA 1HL3A 3C7CB 3DB2A 4WCFC 3IDSA 1K6JA 5A3VA 4XX0A 4RLHA 2JHFA 1EBFA 1WDKA 1C14A 1GV0A 1QRRA 4A03A 1WWKA 3H2SA 5BSGA 3DOOA 4XR4A 4R16A 2OMEA 2NNLD 2Y1CA 3S2EA 5L7TA 1VI2A 3DBRA 1D4FA 4IDGA 3GGGA 1PJBA 5KIAA 4CM3A 4JXKA 4GBJA 2HMTA 3ZV4A 5IF3A 3UKOA 4DRYA 1EVJA 4L9RA 2HK8A 4RPJA 5EQDA 3RU9A 1DC3A 4PZDA 2FZEA 1JA9A 5EINA 1PZFA 2XPCA 5JAQA 4D7AA 3OECA 1VKNA 2BGLA 2X0JA 2WYWA 1XU7A 4R9SA 3UH1A 1PJ2A 3VC7A 4Z6KA 3H9JA 1BXKA 3DR3A 3I23A 2H6EA 3TN7A 3UHAA 1LSSA 3DAGA 4CM8B 3JQGB 4E32A 2X9NA 1YQDA 2DQ4A 2VWQA 5KJ6A 3Q1LA 3L07A 1DC6A 4FR5A 4B8WA 4RVDA 1E3JA 3ENKA 1NAHA 3PQEA 2F1KA 2NVBA 2NVUA 3OH8A 1H2HA 3M1LA 3JD2A 3BYZA 4NG5A 3AI3A 3H6KA 4IJWA 1SC6A 1Q0LA 2NU6A 2E82A 2YFHA 3OIGA 5DN9A 1MUUA 3AUUA 1NPYA 1J49A 3NGXA 4KWHA 1DFGA 4PVCA 1VRWA 3SBOA 1M6HA 3U62A 4I1IA 4IJVA 2GN6A 3LC7O 3GZ4A 4KOAA 4CR6A 2J5RA 5A9SB 2C7GA 3D3WB 4RGBA 2CDAA 4GX2A 4JK3A 4O59O 4ZJUA 4CLHA 3I9LA 3QW2A 5K6AC 4ZRNA 2CDBA 2YW9A 3TZQA 4R3WA 4BV8A 8ADHA 2Q49A 4GGPA 2W2LD 5KNLA 4RF4A 4E4YA 1ZK0A 1B26A 3PZRA 5T6BA 3KB6A 3G1UA 1Y1PA 3FI9A 3QJ5A 4YEDA 1YBMA 5COAA 5DBFA 5A05A 2AE1A 4LN1A 4FFLA 1ID1A 3QV1A 4FD3A 1HDCA 4FFMA 1BHSA 1ARZA 4HNGA 1B8UA 4XA8A 3NRCA 1YJQA 4OMUA 2J5QA 4HNHA 3VTZA 3ZW8A 4BMSA 3F4LA 3C85A 2GDZA 3MEQA 1K6IA 3WJAA 2NADA 1YS4A 4RPGA 2POQX 4M1QA 4YAIA 1PX0A 4XYBA 4QTZA 4QFDA 5ES3A 1OMOA 1IUKA 4BO4A 3RUAA 3RASA 2VYND 4D3FA 6ADHA 1GQ2A 3PK0A 5ER6A 3WGHA 1LBEA 4ESOA 3L9WA 1PTJA 3M2TA 2R6JA 2BH9A 4BO5A 1DXYA 4DBZA 2CY0A 4L75A 3I4CA 3FTPA 4NBUA 3RWBA 2EGGA 4IXTA 2Z1MA 1NWCA 4WNCA 1DB3A 5FI3A 3LYLA 3MJSA 1KEWA 3PJFA 1GZ3A 1E3EA 4LVCA 2IDZA 4A0SA 1XQ6A 4CM4B 1GYPA 1U3TA 3LLVA 4IQ0A 1F12A 4R51A 4XGKA 4IDAA 3NEPX 1DRWA 5KVCA 1YOVA 5CPFA 1X14A 4J16A 2DTXA 4PLCA 3MOGA 3NT4A 5JLAA 3TFOA 3DOJA 1QYDA 3NT2A 3OEWA 5FFFA 1N1GA 4NK5A 2YJZA 1B3BA 3GGOA 1MX3A 3WYEA 4EUEA 2EKLA 1BRMA 4IBOA 1T1RA 4NH4A 4RF3A 4WKGA 3LK7A 4C7KA 1GUZA 5FEUA 4MVJE 4OYRA 2GRAA 4O5OA 1ISMA 2AHRA 5L7YA 2NVUB 4YJDA 1ISGA 2RCYA 3BMOB 4HKTA 3TF5A 2OUIA 4W9NC 2C7VA 1DIGA 3CTMA 5JCJD 4N18A 3CEAA 1HRDA 4CJXA 5I7VA 1QYVA 2XXJA 4BO0A 1XEAA 3GGPA 2J3KA 2GUGA 4RO0A 1ZK1A 2VNSA 4HY3A 3CH6A 3L6OO 1A4IA 5KJEA 4HV4A 5EL0A 2VUSA 1NPTO 3PDJA 3PJDA 1NX6A 1XG5A 2HMVA 3FWZA 1L7DA 3UN1A 3ZWPA 3OEYA 1P1KA 2GGSA 5CAEA 4AJPA 1BVRA 1F06A 1Q1NA 1ULUA 1JAXA 3RUHA 1LUAA 3ASUA 3I9KA 3INTA 4HX5A 4TVBA 2B0JA 2Q50A 2DM6A 3NKLA 2GSDA 5BT9A 4UVIA 3ZU3A 3GQVA 5DT9A 5LCXA 1MV8A 3PHLA 5T57A 3VKUA 3M6IA 3EDMA 3GZNB 5G0WA 3GDFA 1EK5A 4KUHA 4CV1A 3DMTC 3K92A 4XCVA 5I8ZA 5L4NA 3E8XA 2O50A 2X9VA 5TT0A 4FGSA 1LSOA 1K5HA 3M1AA 4CLOA 1GYQA 4RJTA 1JWAB 1PJSA 2DLDA 3RD5A 1GUFA 2G1UA 4JJGA 3QA9A 4QFCA 3DMTA 2P9EA 2ZK7A 3ON5A 2VTEA 2DBQA 2O3QA 3L4SO 1XR3A 2PD6A 1E5QA 4KP7A 3U0BA 1X0VA 3DZKA 4NJOA 3WLEA 2HO5A 3WOHA 1QYWA 3IJRA 3ZWOA 2IODA 4EJ0A 1D1TA 3FD8A 1YJ8A 2NTJA 4BNGA 2YDXA 1TEHA 4Y9DA 2EIHA 4CMBA 1UXJA 4MP6A 1T2FA 2D8AA 4XB1A 3VH3A 2DUWA 3JQFC 1JKFA 1U4SA 3P2OA 5F5NA 5GY7A 1X1EA 3BHMA 3DXFA 1NP3A 4LGVA 4N7RA 1I32A 2X9GA 3ZWNA 4DLBA 3RVDA 3DMYA 3LQFA 1GDHA 2JAPA 4B7UA 5T5QA 1HE5A 3GZNA 4YBZA 3ZI0A 1VPDA 2JKVA 4RORA 4AVYA 1GCUA 3NDRA 1R66A 2VRCD 3K5PA 5FYDA 4DREA 4E5YA 1DAPA 3EYWA 2GNAA 2OXIA 4W9NA 4HUJA 2ZYAA 3I1JA 4RLSA 5EPOA 2FPIA 2OP0A 3S2GA 4HFRA 3V5NA 2DFDA 2FMUA 1DIHA 1K3TA 4R41A 1I10A 4HWKA 5HA5A 4FIZA 8LDHA 1AHIA 3HN2A 3LDHA 1NVMB 3HDHA 2HDHA 5THKA 4E33A 3E82A 2PWZA 1WMBA 5IZCC 4FFRA 2PV7A 3TNLA 4YT2A 5H81A 5IDWA 1MA0A 3MWDB 4LMPA 3PPIA 1PEDA 4RF2A 1A7KA 1BXZA 1A4UA 3OIFA 1GFSA 1GD1O 3ANMA 1JN0A 3H9QA 5B1YA 2WMDA 1E7RA 1LRJA 4XWYA 4PLZA 3S8MA 2NU7A 1MB4A 3W4IA 4B8ZA 4BO2A 3NYWA 2DTEA 3Q9UA 3WS7A 1FDSA 2PKQP 5EQFA 1BMDA 1GADO 2RBEA 4YT5A 5EESA 4EW6A 5HWSA 3FBGA 3HNPA 4R9RA 3D64A 3QWHA 4JJIA 2I3GA 1WAMA 2VZ0A 4NU6A 1W4ZA 5IN5A 1LDEA 4J4BA 1EE2A 3PVZA 5IDQA 4XZ3A 1Q7CA 1SZJG 1NASA 1V3UA 3UUWA 4GGOA 4WCDA 1CJCA 2P4HX 3VZQA 3KLPX 3U4IA 2Y67A 4FQ8A 1DIRA 4CV3A 1DBVO 4BNWA 4DIOA 4TMFA 2JD2A 1G1AA 1GPJA 1FDWA 2HU2A 3HG7A 4PLGA 2FN7A 3VZSA 4FCCA 1CERA 2GZ1A 2O3JA 3IP3A 1H93A 2BELA 1IPEA 5LDGA 3GC6A 1H5QA 2X22A 3GOHA 4GX5A 4J9UE 3FWNA 4NBRA 4EGFA 4JBHA 5TX7A 3WB9A 1ZK2A 5AOVA 5JCJA 4ONEA 1HLPA 3FHLA 1PGPA 4AJ2A 3OM9A 1KEVA 4NK4A 2VHXA 3FSRA 4YYZA 3BAZA 3PYLA 3CIFA 4Z9FA 3SLKA 4AG3A 3U4CA 2ZB4A 2VWGA 3KRTA 3K31A 1P1RA 4GL4A 1AE1A 4ILKA 4NPCA 2AXQA 2AEJA 2DVMA 2OO5A 4N54A 3KYCB 1YB4A 1CQJA 4MVJP 1E7SA 4IS3A 1UP7A 5I7FA 3ZH2A 3GG2A 4ALIA 3C7AA 1EQ2A 4I08A 4DA9A 1O89A 1UAYA 1JKIA 1GV1A 4XYLA 2JHGA 1D1SA 3A28A 4OH1A 2I3AA 4KTVE 3K8ZA 1I3MA 1XELA 1HTBA 2X8LA 3IQDB 3WQRA 4Z9YA 3KBOA 3ICPA 4DPMA 4JJFA 4H7PA 4Y6SA 3RU7A 1M67A 2O4UX 3V8BA 1T25A 4BNTA 1G0NA 1FDVA 2BGKA 1YBAA 1MP0A 4UUMA 2CF6A 4JX8A 2SCUA 1N5DA 2V6FA 3JV7A 1LDNA 1R4NB 1UXKA 2WWRA 3W8FA 3R3SA 4XDZA 5IG2A 3O38A 2VYNA 4UULA 5U4QA 4RZHA 3P2YA 4I5DA 5J23A 5BSEA 4ALMA 4Q3EA 3RUIA 2X6TA 4EDFA 4J9VA 1PJ3A 2Y1EA 4NDNE 3H3FA 3E6AA 2ZTLA 1E6WA 1J5PA 1NM5A 2BGMA 1YH3A 3PYXA 3NDJA 2ZQYA 4CR8A 5ILGA 2VT3A 4ZRMA 1ZEMA 4MP8A 1GQYA 2BLLA 5KWEA 1NFRA 2C2XA 2PZKA 2XAAA 5G0VA 3ZNNA 2PD4A 4IXWA 3EGOA 2W2LA 3ZNPA 3JYOA 3GNSA 4CMGA 1E3SA 4D45A 3KYBA 3EMKA 2AE2A 3E9MA 3Q3CA 5JFOA 5L95A 3JQ8A 3TWOA 3EVNA 3GNQA 1V0JA 2G0TA 4ZD6A 4BNIA 1GU7A 2RIRA 3ZWMA 3TPCA 4H15A 4J2HA 3DZJA 1I2CA 4DYVA 3VH4A 3D4NA 1P9LA 1A71A 3D3EA 4YJFA 2HJRA 1ZCJA 2IYOA 2NSDA 3JQ7A 4XQ9A 3WR5A 3ZU2A 1HSOA 4PGFA 2VTDA 3BA1A 3LT4A 3T4XA 3FR7A 3PJEA 4J7UA 3TZ6A 3WNQA 2GN4A 5KKCA 4Q39A 2NU8A 3QP9A 1BW9B
chains in the Genus database with same CATH superfamily
1E63A 4NZZA 5DXFA 4LMAA 2XHEA 1BD3A 3K9CA 3BRWA 3BGVA 4GE3A 5EAIA 3TBKA 3W3ZB 2BKXA 2Y0CA 3UPTA 4RZIA 3SC6A 2Q9BA 3G89A 3ZK8A 1YS1X 3B9RA 3I9OA 4QG3A 2BI4A 4ODIA 4R68A 1T4BA 5FOQA 2P1RA 2FW8A 1UEXC 2EKZA 1EVZA 2ETVA 2R6ZA 3CRZA 4P83A 1WULS 2OT3B 3E9EA 3GGSA 2VJCA 3MJHA 4IJMA 3VR6A 5JAUA 3DEIA 4P36A 3PDIB 3ORRA 4BKMA 2GERA 3ZVKA 4CMIA 4RH1A 2O2SA 1K89A 5ALSA 3TUJC 1DAHA 4BFVA 3OCVA 5LFAA 1ONNA 4F2PA 1N6IA 2R7MA 1M9NA 2G1JA 2OORC 3FWKA 5A0VA 1GU1A 5JYBA 2XVMA 4BVFA 7ABPA 3PWTA 4YJGB 5HRAA 1WPQA 2XBUA 1FSZA 4C06A 5C32A 1TO1E 1OBVA 4R4JA 4Q5IA 4H1UA 3AZQA 3RGGA 3W5UA 3DAOA 5H8WA 3RYFA 1JDUA 4FGKA 1KYZA 5KQMA 4KXQA 4WKCA 1QHNA 3OF5A 1DJMA 4OHBA 2YIDA 3O74A 3VSBA 1T4DA 1U8EA 1V9SA 2IOYA 4I8XA 4QL3A 1AKVA 3WL3A 1K5PA 3VZRA 1P0IA 3II6X 3MXTA 3FIJA 4TLLB 2RSLA 4A10A 1EFPA 3N75A 4HXGA 3RRBA 2LW7A 3QWAA 1UQTA 1OGIA 1TQ8A 2VVTA 2XMBA 5DNUA 2CB0A 2B2NA 3DO5A 2WYUA 4G6ZA 2J7PD 3G7SA 2B34A 3OX1A 4LDRA 3BWBA 3I2IA 2VBFA 2QN2A 1CLUA 4KWTA 4F1WA 4ALKA 2JFVA 2WSSD 2HSDA 4W7SA 4QO7A 5IVPA 3QPWA 1U0RA 4JASB 4L73A 3RQIA 1EVQA 5F7XA 1FC0A 2P5UA 1MVLA 4YX9A 3DE7X 4Q1DA 4XDHA 4F91B 3KETA 2IXBA 3UJNA 2F8TA 3W7AA 2BGIA 2BFWA 3A14A 3I39X 3R41A 1QAOA 2V54A 1CY0A 5LA6A 3T15A 1K3FA 2I4OA 1C9MA 5ALEA 1R15A 3GHYA 2RGDA 3HGTA 1KFCB 1DLJA 1JLKA 1OX6A 3GJ3A 4BN5A 4YJ2F 4OVKA 2NO4A 3FNHA 3ICWA 5IEJA 2P2ZA 5BUSA 1WLYA 3LWNA 2OCAA 3F1LA 1AZSC 4QUKA 1YNOA 5F5LA 1BAPA 4KIGA 2YRWA 2PDAA 3GIDA 2C99A 5IMBA 1EX1A 5LB4A 3T4EA 5K8TA 4QM7A 2WTUA 3DBHB 4KGVA 2W98A 3SZOA 1UZAA 3DTVB 1ESZA 3IAEA 2O2XA 3FYUC 1ECLA 1W0JA 3JQAD 4QAQA 3B6JA 2HQBA 1PJRA 4BNKA 4HS4A 4OD0A 1Z5WA 3FPFA 3GLIA 4HH0A 3D8UA 4RE6A 1BJTA 4W8OA 2IBSA 3LQ4A 2FB9A 2HRBA 3KJHA 1Y6JA 3F6CA 4MEAA 3IVAA 4F3YA 2NIPA 4UUPA 1QS0B 5I9IA 2B1QA 1E9EA 2XH8A 4IQFA 4CL8A 4GOOD 2IGTA 4RZ2A 3A9VA 1DJQA 2HA7A 2P2GA 1UDXA 3HN6A 3SZRA 1PZMA 3B6ZA 5ULLA 4DM3A 3KHUA 3JQCA 5GGXA 3ZWKA 2J41A 2GD1O 1E5VA 1FS6A 1BKSB 2IYSA 3W8RA 4KZPA 3T5TA 5BPHA 4QYWA 1HX7A 4DLXA 1NNLA 1QIDA 4MICA 3NC4A 2W2KB 1A76A 1SHKA 4A5OA 1BXRB 1J0BA 3NORA 5A5GA 3JU3A 2I67A 4N5IX 1QZZA 4N40A 2X0EA 3UAGA 3E84A 3LPDA 4JR2A 1DKPA 1QORA 2QGFA 2GK7A 3LPAA 1MD9A 3T9FA 1XCBA 1V45E 3GROA 1QNLA 2WLTA 3EEIA 1M3SA 1P5HA 3V1YA 1JR4A 1KWKA 2FPIB 1DU4A 4J1QA 4DRXB 2DBRA 4XB2A 5T4BA 1XZPA 3PFBA 3KVYA 5KC8A 1E4EA 3RT1A 1ONBA 3GJSA 5IABA 1JDPA 4GMKA 3BT7A 5HF5A 5TQVA 1T5TA 3KBBA 3PX3A 1JEEA 5GMOA 3FPBA 4LY6A 5BV2P 2XZDA 1V1MB 1JDBC 1X15A 3VKVA 2DBYA 1RRMA 3G2PA 2NT3A 4AF8A 3FY4A 3T1VA 3PRJA 4HDKB 2VCYA 5DYTA 3D2CA 4CNBA 2Q1XA 5L3SB 5AXBA 3GDWA 4M55A 4BL5A 1NMYA 1OXVA 4QUJA 5CJJA 4ALLA 1H66A 1MO5A 1JDJA 4EKDA 5J9FA 3V6MA 5JYEA 3T41A 3L7JA 3KJQA 1NXQA 2ODWA 3LUGA 2PAAA 3RIEA 3ROGA 1X7HA 2WIKA 3VMFA 3JAMA 5KSPA 3DUWA 1OLSB 2R1VB 4LRWA 3IPYA 1MVOA 2NWQA 1OFVA 5FHQA 2CUTA 3IURA 1YS7A 2I5PO 1Q1BA 2OBLA 3AETB 4K9RA 1Y8CA 3P32A 1XT6A 1X1SA 2ZR8A 2XEDA 2XBMA 2AQIA 4ED9A 1YBVA 4MUMA 1M6WA 1TZKA 5E9AA 3MJFA 4KO2S 2GA8A 2RAFA 4D02A 2UZ1B 5L40A 4IXMA 2BI8A 2N1MA 4RCVA 3CMMA 1ZR2A 3A9CA 2C7BA 2HAEA 3AOEC 3PHIA 4R2KA 3H11B 5K09A 1AQ6A 1G5FA 2PBZA 1JEQA 4KQ2A 2X4DA 3EZFA 4NJMA 4ZYVA 2QLNA 2FN4A 3LWZA 1WSDA 2GBGA 4O33A 1LW6E 1HE8B 1ZAYA 1JHQA 1I0LA 3MZ0A 4C0QC 3BCHA 2QVCA 3FCYA 3EFBA 5ALOA 4ICIA 2C97A 1U94A 4O63O 4NBNA 4Q9NA 3M34A 3ZD9A 4YACA 3O8RA 4J91A 2QVBA 5U4XA 1H1LB 2J8ZA 4NZMA 4DSAA 5BXYA 5B3JA 3EZGA 5EJ6A 2A67A 2FLVA 3DWGA 4M54A 5GGYA 2WIFA 5EIOA 3PGXA 2CL6X 4FD2A 5DCWA 3VH1A 5A3RA 2WFMA 2QD1A 3DQZA 1UPXA 1C9JA 4WIAA 1EEXB 4UTNA 1NUUA 3MERA 3PCRB 1VECA 2PKEA 3B38A 3NX4A 2D0OB 3PE3A 5CFZA 3IALA 2H9AA 1WCIA 3H16A 2IC5A 3LL7A 3R24A 1K6MA 5TC4A 4ALJA 4QODA 4C1BA 1UR5A 3UAZA 3A37A 4DR6B 1JTVA 4NOKA 2EJBA 4QULA 2AEFA 2ZBRA 4L95C 4Y1RA 1NBME 3DNMA 3AF1A 2WYOA 3UV3A 1HDYA 2IYRA 2WVJA 2ZQ5A 3GVHA 3H9BA 3UC9A 3HK2A 2JB9A 1DE0A 1QM5A 1RPJA 2P9HA 2VA9A 2VYVD 2Q1WA 3EF3A 3MTAA 4UMVA 2WIGA 3DZ8A 3PNYA 2FQ1A 4B6JA 1UKBA 4RVOA 2CVZA 2WSLA 1Y42X 5G4KB 3KHTA 2GH1A 2AFIB 1JPNA 3SHTA 2DCMA 3ZE0B 3ZWYA 1D1PA 1E1RD 4IJUA 4XDYA 721PA 4P0QB 3RNLA 4GL2A 3HJGA 1RPNA 5E7MA 3U4DA 4JP3A 3M9LA 2IH5A 3SHVA 1WXFA 1GPDG 1E2NA 1ZWLA 1Y4ZA 1XUOA 2ZKIA 2ID4A 3CRMA 3ITKA 4I8IA 4P31A 4X95A 1GZHB 1CK4A 1I24A 3AB3A 4TWZA 4P3PA 1QJCA 1U7WA 3ABOB 3HA3A 2JEOA 4LV5B 4PU0A 1HYQA 4C4AA 4ABTA 3FZNA 2PSEA 1B42A 3FPHA 3UUFA 5EXSA 4KWEA 5K6RA 1GFZA 1YQEA 2VSXA 5BR1A 2OLJA 1V71A 1J2RA 3OUTA 3N5CA 4JU8A 4PGHA 1RRPA 3ND5A 1VCIA 3MW8A 4BLTA 2P5TB 3JASB 3ZCSA 2ZT7A 3C8ZA 4V3BA 2LGJA 3AY0A 3M49A 2I8LA 4F46A 1WZIA 4HNVA 3ONVA 1KJQA 4HGRA 1XD2B 3QKSB 4S1TA 3HJBA 4EQ6B 4F11A 4N8EA 2D2IA 5TMPA 3IQWA 2Z3VA 1XP5A 2YRXA 1J33A 4H7FA 4YCNA 3PP8A 9ATCA 3GFSA 1Q15A 4X45A 1ONOA 5HBGA 1XZIA 4M0PA 1ADCA 3SN6A 1FUUA 3L0PA 3Q7TA 1OT5A 1OYVA 2BGJA 3C0KA 1KR5A 4NQZA 4F86A 2XDQB 1SC4A 5AKYA 1YRLA 1KNXA 2ZYHA 1Z7BA 3HI6A 5KCZA 3AVPA 4AF6A 5CFNA 1FVFA 2K6GA 3C48A 5CD9A 2OXCA 5J2TA 1W0KA 4JUAA 4I5EA 4FSDA 1IN6A 3KUXA 4OKSA 5FNVA 2PLAA 3WY9A 4MW9A 1VG9B 3A10A 2VNHA 1UFOA 2X3FA 5BOVA 4O2AA 2R6DA 3VR5H 5C31A 2Y6VA 4JITA 3ET4A 1UINA 3O8QB 4AD8A 2IYVA 2Z5VA 3BC1A 1FFGA 4ZFNA 4IZOA 4X8MA 4RTOA 1DX4A 1AMUA 3HKBB 3GLFE 1AXEA 3ZY4A 2GF2A 4LC1A 3W5CA 1ZJYA 3DEKA 1X1AA 1THMA 3DFZA 4IXNA 3ZEAA 2VJBA 3LGAA 1MX1A 4G86A 3UV7A 2D3WA 4D0SA 2OV4A 4L9SA 1XX6A 5CBPA 5JAOA 1TJ3A 1TEZA 3NEAA 7REQB 1UH5A 3R7DA 1VFNA 1WVMA 4NE2A 5AHOA 3WL6A 2EEZA 4CF4A 3DL4A 4H1TA 4U9IS 3CH4B 1OPXA 2BZSA 3NP7A 3EJ6A 4TWAA 3ZHZA 4TX1A 1ZSYA 1OFUA 2QI9F 2V6BA 3C6BA 1H2XA 3QEKA 3R75A 3CKYA 3A3YA 1AK1A 3BGDA 1ZL2A 2NZXA 4NS1A 4JHXA 3A1DA 3HEBA 3LBNA 4WKNA 5A3SA 5KC9A 2I2XB 4DUGA 2W83A 1GZ5A 1YIAA 1DGQA 4HBZA 4MA0A 5B1DA 1QYCA 4KPFC 4A6DA 3AHFA 1DPFA 1LTKA 5I7RA 4U7HA 1T0HB 1WM1A 2OV6A 3A1EA 2ZATA 4HH1A 4QATA 1GTZA 3H86A 5DCYA 3L6BA 4X5OA 2VHZA 3HXTA 5ESRA 1RWNA 3HEMA 2BJHA 5HKLA 1GQFA 4TZTA 1DINA 1OVMA 3DCIA 3ENNA 3QBTA 4KHZA 2V6GA 4P5DA 4HMOA 4A4DA 4DDUA 5B12A 4XJVA 4CG2A 4R9NA 4TLMB 4UEQA 3TH5A 1E0KA 1P9RA 1RMTA 2O52A 4O25A 3SQLA 2R87A 2W2MA 2ZJ7A 3L84A 4QYIB 4D79A 2B8JA 4IQGA 4QLOA 4H9GA 1KZ6A 1NI5A 3KAQA 3MSCA 4H7IA 1W5EA 4XKJA 5CT6A 1SVMA 4DUYB 4AO6A 4IWXA 4H6XA 1JIVA 5C7YA 4OJMX 1M33A 1SURA 2VWPA 3E9NA 4PG6A 3WYAA 1WD5A 3E35A 5A9TA 3MWEB 4Y9TA 4K2AA 5EP1A 2B5VA 3C6ZA 4IV8A 1TU3A 1O6GA 2GPNA 3KOWA 4EHFA 1R0LA 3K9FC 5CD1A 1Y7TA 4KIWA 2WJYA 1ZH8A 2R4UA 3WV5A 5EMHA 4YFYA 1ZR4A 1IHOA 3DBOB 1Z36A 1PIWA 2JAUA 4V38A 1UK9A 4KUGA 1WIWA 3OO0A 1OKKD 4P3OA 3VH2A 2XRYA 4WX2B 2ST1A 3PQ4A 1N6RA 1FX0B 4F6CA 3JQQA 4KQ1A 1Z88A 1ACMA 4FGUA 4PTLA 3PEVA 1T0JB 4BQSA 4EDHA 1RZRD 1N6OA 3M5CA 4EA6A 1GPLA 4S1NA 1TEXA 3IAAA 4MMZB 4URUR 4EPRA 1NT4A 1T34A 1T2AA 1DIBA 1J4AA 1F17A 4ENPA 2IPXA 5JNUA 2BEUA 1RPAA 3A6DA 3PCXA 2FR8A 4S2EA 4DYVA 3WWCA 2WJGA 1MPTA 3A6KA 4R98A 2RH8A 3FFTA 2GJKA 2D00A 3QLJA 4U8GA 2GD0A 1JG3A 4U2GA 3MS7A 3GLHB 3AUFA 2QYTA 3OETA 2CDRA 1DJPA 3JQDA 5C7IO 3RV4A 4WV3A 1YJBA 3U7FB 3H1FA 1O2DA 4MUJA 3PUKA 3Q3GE 2VF5X 4L4SA 4DRXA 1NUSA 4DKJA 4HCJA 3PX2A 4G5HA 3OMWA 3TM4A 5JZ9A 1NLMA 1ZI6A 5JD4A 2GCIA 3R3JA 3FPKA 1O96A 2BWJA 2WIAA 4HNUA 3I42A 3UKJA 2BF4A 3O2SB 5IAAA 1I3NA 3I5XA 5MHTA 3JR7A 1IBKB 1SUSA 2PRIA 1SQGA 1TU4A 1RQRA 3ED5A 3MYYA 4FYVA 1N2CB 3DWEX 5CVCA 1R4ZA 1T6XA 5TB5A 1ZESA 3SI7A 1ST3A 5I4IA 4DDVA 2WD7B 1JKJA 2Y1FA 4HJXA 3CUSA 5AVOA 3VDNB 2GRJA 4F5ZA 3H3XA 1OASA 4YUZA 1E32A 1VBFA 4AJEA 2QDKA 4B6QA 3BKXA 5IJ9B 3DZFA 4QVGA 1U8UA 3AMVA 5LYJA 1XAGA 2XDYA 3Q15C 4EHIA 4E6PA 1H0SA 1Q1ZA 1QVVA 1ULZA 4EPXA 4IS2A 3UENA 5ICGA 2B6HA 3VO8A 3G49A 1D9XA 3LX6A 3FOZA 1SULA 2IHUA 2QSYA 3Q2KA 3RK1A 1AQYA 4IWNA 1SA0B 2NP6A 2YZ7A 4LYAA 1O08A 2EJWA 2YHIA 3HDQA 5F9HA 2OB1A 4S24A 1KYYA 4UNSA 4EBFA 4F45A 1WLSA 1R2QA 3O0TA 4G9BA 4IRMA 3SBXA 2EKPA 3WGZA 3IYLW 4LY9A 3HKCB 4DDHA 3LRXA 3DPUA 3V42A 4UVEA 2BIFA 1SFRA 4KB5A 2RJNA 1E6LA 2R2GA 3LKBA 4QPJC 3WKDA 5LQDA 5AW6A 2I6TA 2QK4A 1DRVA 1W0CA 3ITDA 2IXDA 5DM4A 3EXEA 4NOJA 1FP4B 2IBMA 1BE8A 2O8VA 3BZWA 3H2GA 3KDAA 1MT0A 2WA2A 1NBHA 2W0SA 3NRJA 5EMLA 1E89A 3S44A 3TAUA 5C8XA 3OJCA 2YTZA 4LF5B 2ORED 3RIXA 5CNIA 2WG2A 4RM2A 4YIKA 4RFSB 1OU0A 5FEMA 1E96A 1WRBA 2PYDA 3C7TA 4CG0A 5AVTA 5F23A 1E5XA 2XSZA 1LTHR 4KSBA 3UMRA 5K3OA 1K6EA 2DECA 1DJNA 1W35A 1J7KA 2ZYTX 3A7EA 4D6PA 2IFTA 2O14A 3SYTA 4R9VA 4AICA 3BK1A 2OK7A 4NJMB 1IMOA 2PFSA 4OUDB 5ESDA 2B4RO 2FSVC 1G5TA 2HF9A 2Q2VA 2XYRA 4UFNA 2I9PA 1K7CA 1BMQA 1P4SA 1G2PA 1LVUA 2WAMA 3CC8A 4JC4A 4P32A 3ZNQA 2EXXA 4FZ3A 8AT1A 4GR9A 4YJHB 2PBLA 1LPNA 1TB4A 3NDPA 3KQOA 3LYHA 2P2LA 3R0ZA 4JCOA 3TZKA 1BTOA 2UZIR 4U8HA 4DLVA 7MDHA 5J1SB 3IE1A 4G0VA 1TQ4A 1T3HA 1TLFA 1O87A 3QKUA 1PT7A 3JCZA 1SCUA 1YR9A 3KHSA 5FOTA 2ZROA 5DIFA 3AETA 4DXAA 2ZUCA 4EELA 4HVCA 3B1XA 4MLCA 3A1NA 2NO7A 3G0OA 4E09A 2V4UA 2ZUUA 1Q3HA 3RTBA 2FWIA 3A11A 1TJ4A 4BMDA 1KU0A 3IV7A 1PFWA 1D04A 1FXSA 3WLAA 4XH9B 2Y4NA 3ADDA 5KYYB 3N76A 1HRKA 2O2CA 3UANA 1ICEA 4LC9A 3LSYA 2IGBA 3SYKA 4ACAA 3KCNA 2Y1DA 1P72A 2AOUA 1ZYUA 1YQ9A 2IQ5A 3KOMA 1IUPA 4EL0A 3SHWA 2AC2A 1GCGA 3HVJA 1NNSA 1J07A 1W4BA 2LVBA 2H3EA 3HCFA 4I6GA 4PFJA 3OPQA 4E03A 3BQ9A 4LS3A 4HN4B 3VR4H 1EJBA 3PXGA 4E4RA 2H57A 4L7VA 1TT7A 3JAWA 4Q19A 4W7HA 1OLXA 2RARA 4HYYA 2ARKA 2DSTA 3OCJA 3GEEA 1GNVA 1HFJA 4GKJB 2XW6A 3QVUA 5BSVA 3FM9A 4OHZA 5I8WA 2CNWA 1OREA 1RJFA 5CBKA 4Z0NA 3AKDA 1TGVA 3UMCA 1JR6A 3LOPA 1YZQA 2FOIA 5E4YA 4BAUA 4CFZA 1VL6A 2AYYA 4I2VA 3ZZTA 1C4WA 4GKAA 3ADKA 1B8VA 1YZVA 2E4UA 5A6VA 4G1BA 3N2LA 4WL0A 3LKDA 4FDVA 1BFDA 2CLIB 3TD2A 1SB9A 4GR5A 4A8JA 3RNOA 2M1XA 1KOLA 4BVHA 3OE1A 3AB8A 3PFGA 2H1HA 2G70A 3OJ0A 5EIWA 4MINA 621PA 2DQYA 1PSZA 1VJ5A 2CE7A 2C4NA 4M9UA 4B81A 1NZFA 3UHJA 1WSAA 3KZKA 5DLEA 1MIOB 2O2JA 4MIOA 5F78A 5HJ2A 4YB8A 5AW1A 5K20A 5CURA 3AYZB 2CKMA 3SFVA 2H8GA 5IUJC 1FW6A 3ZPXA 1I7NA 4F9TA 3GL9A 4D3ZA 3TLXA 4BNDA 2IZ7A 4ECEA 3ER8A 2OQRA 2GN8A 4NCAA 1DC8A 4KO3S 4JP8A 5FPTA 4BMYA 1JU3A 4AKHA 1FFYA 1EESA 2OENG 3H17A 4JLDA 2FMIA 3CZMA 3RAGA 1Z16A 5F1PA 2FP4B 4JLPA 4BO1A 3VHRA 4YMLA 2WTAA 2XRZA 1JECA 1JFTA 4DF3A 1L5OA 1Q16A 5EP3A 5BYBA 4KNYA 4E5MA 2IY9A 4BBAA 3LU1A 1AQIA 1JV2B 1HNNA 1UPFA 2BC9A 3EARA 4Y6LA 3CSDA 1Z22A 4EY5A 5CAEB 4F4FA 3NB0A 2NGRA 2RFLA 2WE7A 1KPGA 2Y0PA 4YP5A 5DK6A 3K2EA 1XKQA 5EN4A 3P20A 4PNPA 3UXYA 1CEEA 2V7GA 3MLAA 1M7BA 3VO1A 3A8TA 4W1RA 5JDCA 3M81A 2ZANA 2UAGA 1QIHA 3E23A 3TOSA 2I91A 1E18A 3AW9A 5AW8A 2HMSA 4GSYA 4G84A 4REQB 4S1VA 3PD7A 4BMVA 1UOQA 2OZLB 3D3NA 1GR1A 1NC1A 1G2IA 2J5KA 3A1CA 1M72A 3MJVA 1RHRA 1JQJC 2J32A 3V1TC 1QP8A 2JCYA 1FJGB 2PX8A 2Q1TA 4DHEA 2A5JA 1NP7A 3G2LA 2FMFA 5KYXA 4BCBA 3MHPA 3E48A 4YP7A 3AJ8A 1A98A 4BIIA 4W99A 1K2WA 1NF3A 4M7RA 4PX5A 3U7QB 4BQNA 4ZCMA 3ICCA 3E3OA 4JQYA 4UC0A 5FTMA 1QB8A 3AUKA 4P4LA 4BFTA 1TCUA 2PMBA 2VUIB 3C7DB 3A25A 3T0GA 3L8FA 3UNXA 3GRCA 4EWLA 5TARA 2FSVA 1U28C 1OYOA 2D1FA 1HE3A 3CN7A 3P0FA 3AEKB 3C4QA 3H7IA 3B3FA 3P0HA 3TSWA 4EVIA 1E7QA 4M3NA 5FBLB 5BXQC 2QLFA 5GZ1A 3BMNB 4E15A 2VUHB 1X70A 2M1ZA 2XR1A 4M7PA 4O4IA 3WGJA 4B7XA 4BDTA 1N33B 3L1VA 2YX1A 2MCFA 5IYZF 4J03A 1Z45A 4ANFA 1E1QA 3CT6A 4NMXB 1DXQA 1MCZA 4PC1A 1HKUA 2ABWA 1N77A 3GJ0A 1JALA 2DKFA 2RGCA 2QW1A 3SF0A 4YPFA 2E6KA 3NALA 1QO0A 5K0SA 2ID8A 3N2GA 3F90A 4RQTA 4FYXA 1KI2A 2E87A 3K0BA 3PEYA 1E1KA 2CNNA 5DBHX 4HLNA 5FF9A 3FH0A 4JYAB 1T9ZA 3KD3A 3DTTA 6CHYA 1P6UA 1LI5A 4QD3A 2XLBA 4ID3A 1QU2A 5H9VA 1US8A 2WOOA 2XT0A 2BGRA 1JDVA 3HY6A 1EM8A 4J3FA 1R0YA 4IG4A 4AN0A 1I9CA 4MPRA 4DT1B 2Q21A 2XE6A 3DVRX 3B1VA 2GA9A 1J0DA 1ZJ6A 1XE3A 3ZVRA 4KXLA 3RANA 4ZAVA 1PG2A 4BMZA 1Q2UA 1YE3A 2HZBA 2WF7A 3KJGA 2YFQA 2JIPA 1QK5A 3DF7A 1T3LA 4YQEA 1JU9A 3USES 3KQQA 3GA7A 3ESXA 4ML3A 4QPNA 1P7ZA 3TD6A 4EVSA 5CCXA 1LW7A 1UBHS 1YDFA 5HFJA 3L7NA 1XPUA 3LX4A 2CEKA 1HE4A 4GO1A 5KVQA 4C01A 4MXDA 4H3KB 3T7AA 3NKFA 4G0XA 4BIMA 2POCA 1EYZA 1A8IA 4B4OA 3S1AB 3TSZA 4DG8A 4JC0A 4KFCA 1N7JA 3AR7A 4KV9A 2BFFA 1L7XA 2A7QA 2MHCA 4CZ2A 4CTNA 3QX3A 4YECA 3KV1A 1F9EA 1PN3A 3E70C 5LN1A 2JC3A 2OHIA 3MIIA 4IDFA 1ZK4A 3RO7A 1RTTA 5BNTA 3NASA 1CXZA 2W4QA 3KEQA 4L50A 3S2SA 3ULKA 4LF8B 1W9HA 1EHYA 1QCYA 1B0UA 1UT5A 4O2AB 1PG5A 3GRPA 5IC6A 3TE6A 3FRHA 3L7IA 1BSVA 1QU3A 3L8MA 3R6TA 3I52A 1QONA 5DLQC 1M7GA 1D5CA 4ZMSA 4EA8A 4JVLA 1HKHA 3CWCA 3SS9X 3QWBA 1K3UB 4ARAA 1RJEA 4CDMA 2G5CA 1A9ZA 2C3YA 1LC3A 1KH1A 3KFVA 2Y1OA 3PTZA 3RLIA 2Z6VA 3SZMA 2NT4A 4G23A 1KR2A 3E3NA 1INLA 4AZ3B 2C2YA 3K6RA 4MGKR 5GJBA 4WBXC 1FLDA 3I76A 1FDOA 5ICMA 4DCOA 1W85A 3LH5A 4F72A 3KSUA 1UPTA 3E61A 3TOVA 4TQGA 4IHJB 5SY4A 2M32A 2LBPA 2XB9A 3CJTA 4IINA 3NIBA 5AK6A 3TS1A 3TZLA 3KJXA 4Q00A 1WZ2A 4QXRA 4R5MA 3RH0A 5EOVA 4HZIA 1P29A 4IIXA 4ZVUA 2DB3A 4R9UC 2UVDA 1XJ0A 4QM6A 2IYAA 2QRUA 3VYSB 4HNTA 1UBKS 3FYUB 5FPQA 3QOYA 3UZUA 4E51A 1KJZA 1V8BA 1M2GA 4FWTA 1CIVA 2AMFA 3LVBA 4INZA 2DY0A 2WSBA 4MYRA 4WW0A 4CM7A 2JLCA 3CJQA 1YHZA 2IZ0A 3EF1A 7GPBA 1A8SA 5KYWB 2D7DA 3GEHA 4CIYA 1ISSA 3GD7A 4ARZA 2HLPA 4Q3NA 4NBVA 2I3BA 3U48A 1ZXLA 1GG5A 3JATA 5IAGA 1T8PA 2XXAA 3ZQ4A 5JFTA 3K5IA 2WDPA 2ONKA 2IYYA 5HS4A 1AOXA 1K5GA 3HKBA 4PONA 5COQA 4F12A 2EG9A 3FNBA 1J90A 1AKWA 1YL7A 2A9FA 2VA8A 4YMWA 3NMUF 5DIZA 3GA5A 3SZGA 2NUAB 2Q2WA 1UK6A 4F6LA 4X1YA 2A58A 2HCFA 3AM5A 5EJ2A 5GM2A 3BJMA 2FOLA 1VLHA 2GN1A 2TMDA 2XT6A 5CDUA 3UWDA 4NV0A 1Z3CA 2VHJA 4HB2A 3V97A 4AZ0A 1R6VA 3DMPA 3Q1KA 2AG8A 2C5LA 4B3HA 1MEOA 2X7JA 4LV8B 1X80B 3BICA 1XTTA 3IUJA 4HWRA 2J3IA 4Q3KA 3QX9A 1H94A 4FJ2A 1Q92A 4R1NA 1IY0A 4XWAA 1Z0SA 3SIXA 3X1YA 3GWZA 2ZWMA 3DYVA 3SF8A 3AU9A 1XDSA 1Z7GA 1JIJA 2O0LA 5BN4B 5IVIA 2NUPB 3BMXA 3E3AA 1ZH6A 4ZO7A 4ZWNA 5ITVA 4XWOA 5FBRB 4ZQGA 1EVKA 3TRIA 3N2EA 3WFJA 2H5EA 2XCTB 1U3FA 5FH9A 3SIWA 3UWKA 4MI1A 4QUIA 1E77A 3S0JA 3TIGA 5K0ZA 3ZE7A 5FA8A 3USCS 3OMXA 2OWEA 4LMRA 5E1DA 4MSUA 4ZOQI 2F1JA 2ODAA 1YU9A 2HA6A 2PWAA 2DFVA 2QYHA 5TT1A 4ZVQA 1K9SA 4RYDA 1U1GA 3C5HA 1A1SA 4C4XA 3IEKA 3MQ4A 1DKRA 3GRRA 1OBFO 3VJMA 3O4GA 4HLQB 4GDFA 3QEBZ 2IU4A 5DEIA 1A1VA 1TT5A 1L5LA 3TOXA 5IJ0B 4DJDC 1SU8A 2OLKA 5ENVA 5C3UA 4MPTA 1U04A 3M6VA 3OFSA 4I50F 4BNNA 3BXOA 3UVEA 5DTQA 2QN3A 3QBEA 1IB0A 4D25A 4BMCA 4XD7A 4LYEA 5F2EA 5BQFA 1PJ4A 2W4IA 2NU7B 3ESAA 1DTWA 3JVIA 3V9PA 1I36A 3HRHA 4FEEA 3W4JA 4O4LA 1LDYA 2IEAA 2WIJA 3PE6A 3NIWA 1OFTA 3WI7A 2HQSA 4IDDA 1VPVA 3G5TA 4FDAA 3TCKA 1E9RA 3AGQA 4ITVA 3LY7A 3HS3A 3KVOA 4WOKA 1KTVA 2JCXA 2WT4A 3CVWA 4H6VA 5EJMA 1ZI9A 4IUBS 1XCMA 2FTKE 2NO9A 2FEOA 4MLDA 2AG6A 4I4TB 1V5GA 2LP4Y 1SWVA 2X5NA 5HCIA 4YY3B 1W52X 2DWOA 1O6BA 4BVBA 4LXIA 3OIDA 1T8RA 2HWXA 1BMFD 3CLRC 4D1YA 3GLKA 4EMSA 3MILA 3QHAA 2HSGA 4OQXA 1XZDA 2P2NA 4EI7A 4OLJA 1HF3A 1KHTA 1WTAA 2DUNA 4U1RA 1Z4MA 5I9SA 4AJ9A 3PA6A 2FRDA 2VOEA 3IAS6 5TEVA 1FFXA 1NUAA 2P4UA 3CN9A 1FFCA 4TL9A 4X8HA 1NJ5A 4OMDA 3ZE8A 1SG0A 2M9MA 4RSMA 3U3JA 1NBAA 2FMHA 4H7DA 3DQPA 3EGDB 2ZIGA 4KR6A 4ZA2A 2H3HA 2PXCA 2YY7A 3T54A 2KW5A 4TN1A 2VAMA 4TTPA 3H3JA 3SE0A 2ECQA 1UM9A 2K5UA 2J9RA 3FGNA 4EI8A 3RUDA 4YV2A 4URXR 3RG2A 2I34A 4N1AA 1RAIA 2FRVA 2DETA 1L4YA 2IW1A 3R76A 1QQ7A 1RCFA 3TM5A 5HK8A 2YBDA 1EVEA 1E9DA 4CQLB 2DH6A 1QF9A 1J25A 3DE3X 4KAFA 1Q1GA 2E6UX 3UK2A 3DL2A 3VR3A 4M8IA 3ITEA 4GMGA 3CSUA 4B4DA 4D6YA 1CY1A 1LQTA 1VI6A 4RMHA 2MINA 1JFFA 4K6MA 3NTRA 4NU5A 2P2SA 4NFYA 4DEYA 4LZJA 1KZGB 4RNDB 4ZTUB 4B75A 2B2XA 1E0DA 1E3DA 1O6FA 1K0FA 2V74B 1V1RB 3AY3A 1ZONA 3KKEA 4WLOA 4ZOLF 3GJXC 1OWLA 5TPWB 1FVXA 1U9CA 3QKWA 3U31A 2G67A 2XF8A 1GG2A 1R8QA 1G7SA 3LHKA 4IMPA 2PEZA 1GPAA 1PAUA 2G83A 4LCEA 3SX4A 1PGNA 1YONA 4MJLA 4Y0VA 3ADCA 4MQEB 2F9FA 3LUPA 3OLZA 2A0XA 1FSFA 2WYVA 3G3EA 4FT4A 2JAWA 3I6QA 3WE7A 3OTWA 4B3FX 3NVMB 4WKOA 2P8SA 4KQHA 5BRJA 1XKTA 2PVPA 4AQ7A 2C9CA 3HWX1 5G3ZA 1KJIA 3R3ZA 5D84A 2XVXA 1JYSA 3D1LA 3FYCA 4LVNA 2FW1A 3OQOA 4ZVMA 3HM2A 4ZV4A 4ARUA 5IX8A 4Y9SA 2IOHA 3P26A 3G68A 1RRVA 1RTKA 2IEYA 3DHYA 3EQ6A 1Z6PA 4ZO4A 2NVWA 5FTJA 1CUZA 4ID9A 2Y1WA 1V1JA 2W2PA 2F1RA 4RZSA 3ROKA 2C3OA 2HADA 1Z75A 1AC5A 2IIBA 5TGDA 2VT2A 1M5UA 1ZD2P 2R1UA 5DE3A 5KWJA 1K98A 3Q7PA 4R2XA 1AMOA 3C1OA 1PR2A 5CEFA 3W2HA 4OXQA 4EK9A 4C04A 1Z8NA 4S35A 4CG1A 1SXJA 4HLDA 1R3DA 4RQBA 1ULBA 1ABFA 2R79A 1UKVY 3U49A 2PH3A 2ZT8A 1KDOA 4IIJF 2NP7A 1QE0A 4DY6A 2QX6A 2ID9A 3C8UA 1FFAA 3QJGA 5JSFA 4YRLA 4HTFB 3PITA 4TROA 4OGWA 4HAIA 1JQBA 3ETDA 4CG3A 1LLDA 4J07A 5JDCC 1LLQA 4K0RA 3W5BA 1BEEA 3KEGA 2V7WA 4D8WA 5IHXA 3W1VA 1RM3A 3C5VA 3V8PA 3ACDA 3AXSA 4GPIB 4F3KA 1YZYA 3PR1A 1H69A 2QN1A 1NI4A 4M53A 1MHTA 1KEZA 3WGTA 4EKIA 4TS1A 1BFUA 2NX2A 2R96A 4IEIA 1IOZA 1R5OA 2JHCA 1F1JA 2BFDA 1C1YA 3C4JA 3JQBC 3OQBA 1JSRA 2OYCA 3ZCXA 1NN3A 1KS9A 1FDRA 1GSOA 4G0OA 1GT6A 5AI9A 2ZFUA 3RJ9A 3VU3A 1G8GA 3LKVA 1THGA 3LXXA 3RSFA 2GYWA 3KQVA 1Q6YA 4IKEA 4M1KA 1X1QA 1JH9A 3L7MA 1O0SA 4Y2XA 3ZDCA 2H06A 2PKYX 1Z74A 4OHVA 4TPKA 4HT3B 5GIPE 2QUJA 4XARA 5JC1A 2GHQA 3STXA 2FWMX 2OCLA 3ET5A 4MRMB 3VR4D 4B3JA 4HDOB 5KJFA 3OE7D 1W36C 4X41A 1JLLB 3RV3A 4S1OA 4Z4HA 4CM4A 4PCVA 2J9ZB 3CEHA 4R1OA 1CVRA 2XE7A 3PTLA 5AJWA 3CG4A 1VE9A 3SDBA 5C7OO 5AVVA 5AW0A 1P1CA 2JGNA 3OTIA 3QMMA 5JYCA 3H9CA 3BX1A 2JGFA 3IIIA 5CDFA 5KTRA 5EERA 2NSYA 5K99A 1ZGBA 1YR1A 2QRMA 4TKUB 1GCAA 3CPEA 4F4DA 1DO8A 3KKPA 3R40A 4UAGA 4UOQA 1FMJA 4PLPA 3B7WA 4YCBA 1QWSA 1P4HA 2VHUA 3FAKA 2XODA 3MRTA 3BF8A 3BPSA 1NLYA 5DWDA 4FX2A 5LQNA 1N6LA 2ECKA 3OKFA 2ALJA 2GBLC 1PD0A 2GPAA 3IMGA 4MV6A 3W77A 2O6HA 4ZVNA 3S2IA 1QDUA 3KO8A 3S29A 3GJ6A 3PT5A 4DSUA 4YAIA 5A04A 1XDBA 3LK6A 5CH3A 4AJJA 5BWOA 1BO6A 1QHFA 2C5FA 2WP8J 5HVNA 3UM9A 5G2OA 1KEKA 2IUEA 2OL4A 1YUNA 2XZPA 1D03A 1D0VA 3CUVA 1P73A 1I3KA 1P6QA 3BA6A 1FA9A 3QVWA 2PGOA 1H1TA 1T35A 4MK4A 5FNVB 2Z9CA 4PHFA 3F5SA 4KMSA 4YI3A 4X44A 4QFMA 4KNWA 2FW9A 2GK6A 2ADOA 2CDCA 3LCRA 3TNYA 3W78A 3CUYA 5C8VA 1S02A 3R3VA 4TLAA 5LLTA 1Z26A 2FHPA 1S96A 2ZI5A 3U37A 1Y7LA 1QUEA 4J1TA 3OTGA 3WIUA 2QHXA 2ODNA 5JH7B 2YUTA 2CVPA 2NXEA 5AP9A 3X1JA 1X42A 1OXBB 3LOQA 4CFYA 4Y67A 2DX7A 3M9WA 1ZCZA 1EFVA 4C6RA 1M2OB 3C1AA 3REGA 2KJQA 4FZRA 4JDPA 2P62A 2XQVA 4EYEA 3T5PA 1GPH1 1QZTA 1NXSA 2BRUA 1IBSA 2B82A 4BLQA 1Y1LA 2I03A 3OHMA 3V7FA 2GXAA 3MQ2A 1BRTA 5IK2D 1C1DA 3RHZA 1VL8A 2GBFA 4KXFB 4CEIB 1XZKA 3OOWA 2BEWB 2JJ1A 4D4HA 1YUBA 2VDRB 3BMQB 5DCLA 5TNXA 5JJLA 2BE9A 1ZXBA 4KIJA 1QPGA 1CZRA 1EGVB 4LJLA 3KALA 1W6RA 1D7AA 3O8NA 1WBJB 3AINA 3RKUA 3WX0A 1U5CA 3WIEA 1BQ4A 3M5WA 1M76A 2IEBA 3N53A 3OJWA 3X1WA 1YVUA 5FWNA 4B9EA 4PQRA 5HILA 3ZU5A 5F9MA 2X0KA 3ZYCA 3K8YA 3T61A 3GMSA 3N6VA 1CR6A 2YV4A 3E58A 4XSHA 4OXXA 1QVWA 5TMBA 3GVCA 4B4KA 4TWJA 1EUCA 2OUKA 3EMVA 4Y1EA 2XEXA 1LJUA 5FQOA 2G25A 1XEFA 4MI6A 3TTSA 2D2VA 1UWKA 1WCV1 3FKSD 4MHSA 1KK1A 5JG7A 3ILVA 4NCNA 1STOA 2ZQZA 3BWVA 4ZALA 4C05A 1F4LA 3ROPA 1NTOA 4S2UA 3ZCPA 3TVYA 2I4TA 1LB1B 4P35A 4EF5A 1CQJB 3QOFA 2W71A 1O8CA 2AW5A 1D8TA 3IOYA 3OM0A 3EJWA 1JIQA 2E1PA 3QXCA 4FFBA 2GLTA 4WNIA 3IDOA 4EHLA 1DJLA 4Y2QA 5G0SA 2FKAA 1M2NA 2ZBGA 3ROMA 1M1ZA 4OUKX 4P98A 3RUFA 1N9ZA 4JT4A 4A16A 1XL1A 2I87A 5DTJA 2ZJ3A 3VSAA 2PMKA 3JQBA 2YV1A 3RFUA 1LXCA 3VYTB 2NZ2A 2OFWA 2PL1A 3O82A 1DELA 1JDSA 5LP1A 3G9QA 1P1JA 1MB3A 3IQEA 4F6RB 4WWHA 4XM2A 4YLYA 4ND8A 4Q1VA 3UJAA 2CK3A 4GYWA 1X8KA 3QTLA 4BO9A 3CINA 1A95A 1Z34A 2UUOA 4ENQA 1LVHA 2H08A 3MRXA 5LZ9A 3U4AA 5KHLB 2NO1A 2W8BB 4AROA 4DKXA 3JW8A 1L9KA 2ACVA 2ZB8A 3EG9A 4PWYA 3TGPA 2AX3A 3RRJA 1JFRA 3IMCA 1N3IA 1TVEA 2Z0MA 2G0NA 2VPQA 5FO0A 1W5TA 5ICSA 1JYEA 4CKCB 3FCOA 3FFWA 2B3DA 4HUQB 2W22A 1USWA 2E37A 1HDRA 4JJ7A 4R3UC 4BFZA 3MT0A 1FP7A 2VQ6A 1CWUA 1TFUA 2R8BA 3BVPA 5FL3A 2QRHA 5IDVA 1JEAA 1KY5A 3JAWB 2G09A 1VG0B 2QF7A