1XAGA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
353
structure length
353
Chain Sequence
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDDILSYENVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDMITDLDFETLYQYMLSDKKNDKQGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
molecule keywords 3-dehydroquinate synthase
total genus 129
structure length 353
sequence length 353
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xagA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xagA01
4RGQA 3UHJA 2D2XA 1OJ7A 3ZDRA 5K8CA 3RF7A 1NRXA 1VHDA 1NVEA 3JZDA 2BI4A 3OWOA 3OX4A 1JPUA 3ZOKA 1RRMA 3W5SA 1JQ5A 1NVBA 1XAHA 5FB3A 5BR4A 4MCAA 1NUAA 3BFJA 2GRUA 1VLJA 1NVDA 3QBDA 1XALA 3QBEA 1JQAA 5EKSA 3HL0A 1SG6A 1XAGA 1O2DA 4RFLA 1NVAA 1NVFA 1NR5A 5HVNA 1XAIA 1TA9A 2BL4A 4RGVA 3IV7A 4P53A 3CLHA 4QGSA 1KQ3A 4FR2A 3CE9A 1XAJA 3OKFA 1DQSA 1UJNA
chains in the Genus database with same CATH superfamily
4BKQA 3HM9A 4BLOA 3GPLA 2JBHA 2WD8A 4MGIR 1ZG3A 4PPNA 3IXMA 5M04A 4UEQA 3T7SA 5J4HA 5LMNB 3PPXA 5K8TA 2WAXA 3JAWB 4O4IA 1QGZA 2QWXA 3IUSA 2XGOA 3LWDA 4EBBA 3TG8A 1GCOA 3EA0A 3NEPX 1Y8QB 1P5FA 3EGVA 3JQRA 1K4MA 5KYKA 3F8WA 4R8LA 3SXUA 5JZ9A 1PK9A 2FOXA 5B7NA 3TD6A 2FLWA 2ZJOA 7GPBA 4KBYA 1XD2A 3MGGA 1ESZA 4L07A 4KWHA 4QDJA 5AMXA 1T5OA 4J3NA 4Z9FA 4B6FA 4RGVA 4ONEA 4Z49A 4EMUA 1JSRA 3W5CA 2ZJYA 2Q28A 3FOFC 2GJ8A 1H93A 2FOLA 1U9CA 1A2BA 2QUBA 3WOHA 2O6LA 4AUEA 2ZJ3A 1P29A 5AKJA 1Z6YA 4OHPA 3CRRA 3G3EA 2XXAA 4Y2SA 1H65A 1KFCB 1QCYA 2EIHA 1ZMXA 5F5LA 1OKKD 2X0EA 3T3DA 5JY6A 3UGJA 5K3OA 4MKXA 1D4OA 4QBFA 5IHPA 3ZHUA 1NVGA 1NKSA 1PJRA 2JKYA 3GA5A 4MYCA 4ADSG 1C3OB 3KDSE 4YV7A 5K1ZA 4TXHA 4YHBA 4RHCA 4IIVA 2IZOA 1U2GC 4U3JB 3DE2X 1ZRSA 3LWZA 5ESRA 5EOVA 4G0ZA 2PGXA 3NWBA 4E94A 5L4NA 3BFPA 7REQA 5H3CA 1QF7A 3HVHA 4AYXA 3L4SO 3GQVA 1MP0A 2C59A 2FP4A 1BGWA 1IYZA 1FFHA 1XRLA 2UKDA 3I6QA 5CK5A 2VHWA 1JHQA 3DA8A 3HA5A 4J1SA 1SUPA 3MA0A 3IX7A 4JXJA 3V2HA 4DMMA 5IABA 4DUYB 2Q3EA 4IHJB 3LNTA 1FPQA 1GT91 5D8DA 1XRJA 4DHWA 4Z7OB 2X5OA 4DR5B 1QQAA 1DCMA 4KR0A 2EGUA 1E5XA 4KWCA 3AWDA 1K88A 1QF9A 4F06A 3IHLA 5DHSA 1O8CA 4PXAA 1A50B 5BWMA 3KCNA 1A4RA 3KYJB 4FEGA 1XXLA 1E3JA 4C4AA 4DC1A 4EFDA 1CQPA 1WP9A 2C4HA 5JH7A 1ZWLA 1DZ3A 4U7FA 1YR6A 16PKA 1ORWA 1Z5OA 2VSXA 1FLDA 4KGZA 1EFLA 4XJSA 3G2LA 4DLXA 1GQYA 1DAHA 1P1CA 3CNHA 5CT9A 4A8TA 4BS9A 2VF2A 3L0PA 1FDOA 3HJGA 3MJDA 5C7IO 3JTMA 4YAWA 3TNJA 2QSUA 1NVBA 3MRXA 4OM8A 3WA7A 1H1LB 4K6FA 4M1MA 2WUEA 1RJGA 2APJA 4X20B 1QE3A 3T9FA 2IELA 3TZQA 3A32A 5COQA 1C7RA 4B6OA 5BOSA 1FFGA 3N6VA 3BMQB 4RHTA 4Y18A 5DBFA 1TA9A 5EJ5A 4ZT6A 3N7AA 2GYUA 4BO1A 1OZAA 4N7MA 3PU6A 1D6SA 4HPJB 4IH9A 4KVGA 4EPWA 5KNDH 2XNJA 4TMKA 4DNFA 3N39C 2Q1TA 3B1VA 3S2FA 4F2PA 1QGAA 4LZAA 1P7WA 2ZVJA 2IZZA 3PXUA 4JLJA 5EP3A 3WLJA 1QONA 3HB0A 1F60A 3LOQA 1C9NA 1Z5GA 4KU4A 3PZRA 4PSKA 4KV7A 2G40A 3H97A 2FF7A 4F92B 1FCJA 4OYRA 3OM0A 4JI6B 4BMPB 4R8SA 3M4JA 4WPGA 3V8MA 4FCWA 3G82C 1LI4A 3GAFA 4KN9S 4M2LA 4QYIB 1CFJA 4II7A 1P45A 3PPVA 2DCMA 5ICCA 3ZX5A 5IT9A 5JVDB 4U2DA 4YQZA 5JDIA 5IUJC 5IJXA 4XAQA 1M73E 1KF0A 3C7DB 1P5RA 2QSJA 2X8WA 3GLUA 3TLZA 1WCIB 4EG1A 3QZUA 4JB0A 3W04A 1TEXA 2ZBVA 4JY7A 5K8CA 5BT8A 4ZU6X 2WWFA 3NV9A 4BYMA 5B1IA 2O8BB 4XIFA 3ADKA 2AX4A 4MV9A 2LW7A 1U0OC 3F67A 1NLYA 2ODAA 3L6EA 3OCCA 1UBEA 4ZVNA 3WAJA 3CHYA 1JDNA 1QOQB 3W4KA 4MAAA 3QVXA 4J29A 2QTFA 1L4MA 3CPEA 4TKZA 3C7AA 2J46A 4HVCA 3PCTA 1E6LA 1NVVR 3GAMA 1KOJA 1QGDA 2A5JA 4PPFA 3UG6A 3OCWA 2HSDA 3VPXA 4DA6A 2E4ZA 1WDTA 5DYNA 5EPUA 3GJRA 2NU6B 1YCDA 4X61A 1K3UB 5HZGA 2VJLA 2ADMA 3SHFA 1UH5A 4X3CA 1P33A 1UJBA 1KOLA 1QLWA 2XE7A 1S4QA 1NI4B 3FZQA 3O8LA 4PZCA 4EGQA 2FDCA 3DE0X 3EZXA 3WLIA 3GGJA 3QV1A 5JLJA 2FN7A 3EXIB 3GMTA 1QH1A 2FP3A 5HA5A 3T3PB 2R8XA 2C5LA 4LVCA 1ND6A 4JC5A 5FR1A 4F85A 1KO7A 2XMDA 1S3FA 3T1OA 3MELA 1PW5A 2EGGA 2BONA 3GLHA 3O2QB 4I1RA 4Q3AA 1SNYA 2CJWA 3I2FA 4KDEA 2Q3LA 2Z95A 3S8MA 3KBBA 3WS7A 3FW1A 4ZI7A 3I04M 4MPTA 4XFDA 2WMOB 3DOHA 2PVPA 1J2TA 1F2UA 4IVNA 4J4BA 3RTBA 3KKLA 5I4KA 1H1DA 4U1RA 4B3CA 1H2FA 4EB6B 2Z43A 2BEKA 4JQCA 4MULA 1DEOA 1LK0A 3H99A 4M0MA 3ZWKA 1QRSA 5LQJA 1PL8A 3IHTA 5J2UB 2AF3C 4GM0A 1BD4A 2HEGA 4ISBA 4TTAA 2OCDA 3GJZA 3PDCA 2AD5A 2ZRGA 3GJ0A 2UVQA 1BVUA 1E8NA 2CNLA 4QFBA 3RKUA 4EDFA 2HCFA 2V55B 3W3AA 1U9JA 4BUJA 4CDGA 5BWBA 1U0BB 4FIZA 1E5TA 1WQ3A 3PI6A 4F3YA 4DR1B 3M4YA 2AJLI 3B5EA 3BRCA 3G8BA 3RT9A 4NU5A 4J1NA 1UP4A 5IC4A 3WY9A 3HXPA 3VZRA 2ORIA 1U1DA 5KOHA 4DSZA 2CLKB 4UARA 2XMBA 4X1IA 2IYZA 1T9GS 3D4PA 1CQIA 4YXWA 3ZE0B 4M1YA 3LDUA 5EZYB 3EXG1 1LLQA 3OE1A 4J0CA 2ZUEA 3GWGA 4YRIA 5B3LA 2OM6A 1TQ4A 4H7KA 4QSHA 5AI8A 1Y3FE 1TKAA 2CL0X 4E4YA 2AJTA 3FGPA 1H2AS 1NR7A 2XF8A 3SLRA 1A9QA 1K68A 5A02A 3O73A 3WQHA 4LBWA 1NWHA 3AHGA 3A3PA 3GVXA 3V1LA 1TXGA 4LZZA 5FXMA 1JB1A 2EJCA 2YZNA 4DHEA 3STVA 5H80A 2NUBA 2NXWA 3MAJA 2DVMA 4DDWA 4D8WA 1LLFA 1U5BB 3JQBC 3FVQA 3GYBA 3NXKA 4Q7JB 1I3CA 3UENA 3KAJA 4DIEA 5JSFA 2OYRA 2QMEA 1I8TA 1T91A 4RL6A 1AB6A 2QW1A 3H04A 1JPJA 1TO6A 3ND6A 4TTVA 5JCJA 4QT4A 2HJSA 5FFNA 3MINA 4DQKA 5JAHA 1Z68A 1XKTA 2PGLA 3H3FA 1M6HA 4IGFA 5E6RA 1CUCA 3WR5A 3X1MA 2C7QA 3IH5A 5ALPA 2VWGA 3FOBA 4CMBA 1YB7A 3CUEF 3DE6X 3ZGVA 2P8SA 4R3NA 5EL0A 4RULA 5EXDA 3BBPA 4WY8A 2LR0A 2P6OA 3UAYA 2Z56A 4C76A 3JWIA 4M49A 5DISB 3VNUA 1WB6A 2YZMA 3F6BX 4NNJA 5KMGA 3ZJUA 2WTEA 1YAJA 5LZ2A 1GNTA 1XXHE 3EXFA 4UPDA 1N3IA 1P91A 1CLUA 5FEMA 3UQZA 2QGFA 1JHPA 4Z86A 4XSVA 1CUYA 3ZU5A 5LBTA 4B6QA 4L5YA 4PZ0A 1IPHA 4FB5A 1LC3A 3WB1A 4ZK2A 2ORYA 4AJ9A 2IYTA 3ZHTA 2YOGA 4B87A 4PZAA 2X6RA 2FWMX 5JAOA 1Y4ZA 3KK0A 3OEWA 4FCTA 2WY2D 4BNUA 3U9TA 3DVAA 4W4TA 5CLGA 2N3ZA 2C9OA 1TF7A 2YWXA 3NUQA 4L0QA 1R18A 2GERA 2GD1O 2GFHA 1CUFA 3I28A 3C8UA 3OT5A 1KAQA 4LC9A 4ZO7A 4GMKA 5TMBA 4Z1OA 2XNHA 3U1BA 2V8OA 3GXOA 1GEGA 3M1AA 2O3UA 2DWUA 4RVNA 3RG2A 3Q6IA 4P92A 5LOVB 4ML3A 3D6HA 5E2BA 5BSFA 1S8NA 4I6GA 3OTQA 2JLCA 4G1CA 2B1QA 1GG5A 4HQKA 1V37A 1XRQA 1W8DA 2B7BA 3IV9A 5IFLA 2PGAA 4P8RA 4RAOA 3TNYA 4WXEA 5H3HA 2X2OA 3OHSX 2VZEA 4G5QA 1HT2E 4HLUA 2F67A 2X0JA 4MW1A 5EQTA 4DJDC 1NLZA 3BHIA 2MU1A 4XGNA 3FHLA 1MOZA 1RTTA 4HGOA 4ZK6A 3N8HA 1U3CA 1ZRNA 2PKQP 5FULA 1SC1A 1MFPA 1QYDA 2W6IA 4LISA 3NBYC 1ITZA 1L5OA 4I2NA 5TV2A 1VZ3A 3QEMA 3EJ6A 1Z47A 1RBZA 3BERA 2BI7A 2Q2VA 2WWXA 2BHRA 1MO5A 4QXOA 5KX5A 2YW2A 3VKGA 1HY3A 4G9GA 2G9UA 1PZHA 4J4TA 4MDEA 1FSGA 4MVCA 4LGYA 5JTTA 1YMVA 1Q1AA 5IBPA 5C8YB 2Z2ZA 1BKYA 4INJA 1AUPA 2WF5A 3OWHA 3ETJA 4R2WA 4MB6A 3DDHA 5KOJB 4BKPA 5HQ3B 3TSAA 3WNZA 3ZVRA 2GN4A 3GIDA 3M7IA 4X54A 5FJIA 2VNIA 1MR3F 1V11B 4RL4A 3A1NA 1DHTA 1C3OA 4P80A 2ZAOA 4V03A 3NVAA 2AYXA 1FUUA 3RLIA 1DLIA 5DCLA 1KHTA 3FFAA 2D7CA 3IT1A 4OYLA 3TRDA 3UMYA 3CU5A 3F74A 3VZDA 4BL5A 3WJ1A 1K06A 2X0KA 2JRLA 3EMBA 1P0IA 2MT9A 1QFYA 3GJ6A 3JQAA 3AV3A 4OA8A 5EHXA 2EF1A 5A7HA 1JQJC 3AFGA 4I5DA 3MF4A 4HFMA 1GP2A 1VLHA 1TJNA 3RVMA 1SXJB 1OJLA 1W96A 4L0MA 2XDQB 3WKAA 3QYFA 4D9IA 2GEVA 1Y8RA 2O2DA 5DOVA 1UJNA 3P5BA 1N8NA 4FONA 5DLDA 2RBEA 1PG0A 4NU6A 3IKVA 3DBOB 1JE0A 3RS2A 1GAXA 2CDCA 1OR8A 1Z0ZA 2XD4A 4P4GA 4EDHA 1IXKA 5IJ9B 4PYLA 3ZWAA 3KJXA 1E9CA 1H6CA 5LQRA 3IPCA 3VDRA 4MO2A 1L5MA 4LNUA 1M7HA 2I1LA 3AERB 4NOLA 5FO0A 1TTQB 5EN4A 3SK0A 1P4GA 4YQEA 3I5AA 3L7MA 4K6OA 2YTZA 4TKMA 3K1ZA 3U6KA 4TT3A 1U6JA 2H0AA 3EUWA 3EVGA 1I0IA 1TUGA 1GHTA 3GNSA 2Z8YM 1G4UR 4RZSA 3PP8A 3C3XA 3ETCA 3NBMA 4S12A 5KTPA 1Z6PA 1IDN1 2SCUB 1W5TA 5SZIA 1DDIA 2I62A 5FADA 1I4WA 1OXUA 4EJ6A 1E1MA 2XWBF 4HDNA 3K0CA 5CXXA 5FWAA 3ED5A 1J06A 3SIWA 4HNUA 2AHOA 1VYTA 3OFKA 4NI5A 4OJQA 4L7QA 4ZPJA 1QHXA 5H0IA 4DYDA 1W4AA 1B4DA 3CNBA 4D3XA 1AHPA 3CLSC 3EZ6A 3K35A 2EX1A 5AVYA 4JJ7A 4GOMD 3A7EA 1DFHA 2O9JA 3TLEA 4EUHA 4YAKA 1HYBA 3FHCB 4BNJA 3O84A 1JG7A 3G1WA 1QO7A 1V96A 2GRAA 1X7XB 3GLIA 1JDPA 1YASA 4WI1A 2HV8A 5BOVA 4LE1A 3DZFA 3GOQA 2OMEA 2GFIA 3GLHB 4HWSA 3SMVA 4EFLA 3GCWA 1V16B 1JU3A 2PGIA 3VR4A 2XTMA 5IP5A 2EGHA 4WA8A 3EEOA 2QQEA 4LVUA 2AX3A 2V1UA 1ZW1A 1XTTA 1TM3E 3OT4A 5EIOA 1CY4A 1K8ZB 4PLWA 4XM1A 1PN3A 2XD9A 1EWVA 4RH3A 3EOAI 3C3PA 3QA9A 4EX7A 4C21A 2FUEA 4JP2A 1N0UA 1YMUA 2WIGA 4RKRA 4E30A 1A9XA 5A9SA 3CIFA 5JNLA 3ZTYA 2NVWA 1QB7A 1BC5A 1RYYA 1QCZA 1DAOA 1XJCA 3FLAA 4HH3C 3ABOB 5CB0A 1Y1QA 2DOKA 2QG9A 1SK8A 3IDQA 2FDXA 1RRPA 3LT2A 4C6SA 5KREA 2DWOA 5JXIA 4GYWA 1BWPA 4N5LA 1Z56C 1FU8A 3LWBA 3DJFA 3W9SA 3FTEA 3HVUA 3HE3A 4MUBA 1EP1B 3FZEA 4MINA 4AW9A 2G09A 3AM1A 3TDNA 5C8DA 1ZUD1 4UE2A 3MERA 3N8GA 2GEBA 1RQPA 4Q47A 3ZZ0A 5IRCD 4MAFA 1N2CA 4JOQA 4M0LA 2PNFA 4DIKA 4H6XA 6ADHA 2X77A 4XD2A 4MMZB 2HWWA 1D1SA 4G1FA 2R7NA 4QPCA 5IJWA 2V4ZA 1AN9A 1KKUA 4NG4A 4D43A 2RKWA 2ZB4A 1UK9A 3CLVA 2ECFA 1XMQB 2R3SA 3LC2O 3CT4A 2ZJFA 4YMUA 3TVDA 4QULA 5KQLA 1JU9A 1S2LA 1ZMRA 1LBEA 1QQTA 5EWMA 3WMFA 4OLAA 5DBGA 3PX7A 3P9NA 4V0RA 3MRTA 2BMAA 5HZKA 1HNWB 2OPHA 3REQA 4O4IB 5F9FA 4IDBA 3VH2A 1MO3A 4EHNA 1B3BA 1PHPA 4UREA 1JLLB 4YP0A 1E4VA 1T4GA 2FPPA 4PG5A 3PGLA 4Q21A 3LC1O 4ZAXA 3HACA 3IJ5A 3TR5A 3PQFA 1S2GA 1YZLA 2HNAA 4Y9TA 5JSQA 1G5QA 1W59A 2YJTD 1U2ZA 2YY7A 4ZMSA 5L53A 1Y63A 2VPIA 3LY9A 4N01A 4KBGA 5E0OA 5AW6A 2YXEA 2PUTA 4EECA 4BCCA 5J63A 2R1TB 3GARA 4RH1A 1TTTA 1UP6A 3K0BA 4IDNA 1ZD3A 1JZQA 2IDMA 3ZXIA 3PDUA 4BDTA 3H4MA 4RIFA 4BEJA 3KTOA 4DOMA 3K0AB 1YL5A 1EDBA 4P33A 4U39A 5JMTA 2OO3A 3H13A 3Q7RA 1D4FA 5CG1A 3ESQA 2Y71A 4XE5A 2VDQB 1G0OA 2GARA 5IXYA 2HWKA 4LRTB 4ZHQB 1QUFA 4YY3B 1UT6A 4LS3A 4YR9A 4KREA 3S40A 3AF6A 2OVBA 3FPKA 3PITA 1EFHA 3H5OA 4HDNB 4J7UA 3PNBA 4UEOA 5EE3A 3H8SA 1KBZA 4A26A 3L7KA 2XB4A 4RJTA 2IYQA 3ZHXA 3RU3A 5KTSA 1XRSB 1F0YA 1NQAO 3ABIA 5TVGA 2JLVA 3R3VA 1IOWA 3I76A 3TSZA 4BGUA 2GEJA 1JZSA 2J33A 1PW7A 2XA2A 3OIDA 2EWWA 4GGPA 3DP9A 1HL3A 3UAVA 2L69A 4QBHA 3JVVA 5KTOA 3ECCA 3QHPA 3PT9A 3EB9A 4YJKA 3PQ8A 4LYFA 3UMRA 4AZ0B 4YT4A 3RYCB 2HT1A 1CEYA 4NCKA 1GNRA 4EM6A 5BN1A 5ALXA 3HNPA 4F4DA 5TQ2B 1I5EA 1OX4B 5ESDA 1TMGE 1AK1A 4P58A 5DRTA 2VH5R 3V48A 1KE1A 3PGMA 2AMFA 3PDIB 5HW0A 1EX1A 1A8SA 2DFLA 5C0OE 5IDQA 4PF1A 1E6WA 3I9V6 3ET4A 4RVUA 4TS3A 3W1VA 5GADl 2OLJA 2D5CA 3GZNA 3PXAA 4DR2B 5CCXA 1L4BA 2E2WA 1XMJA 1U5BA 2QTMA 4MI6A 4WN3A 3YASA 1FLNA 1N2SA 2I2XB 3DLBA 2W6CX 4E2ZA 1FFYA 3HV2A 3DE4X 5LBIA 1BXGB 1XYGA 2ZJBA 2HQOA 1EHCA 2ID9A 1U3WA 3O4GA 3I72A 3ONWA 4TZKA 1A5ZA 2OORC 5HK8A 1DL5A 3BF8A 1ZK4A 2H65A 1AS3A 4GBMA 5JCJD 4UMDA 2PRJA 2AYZA 3SC4A 3DAPA 4NCIA 4B6PA 5TJHA 4HT3B 4K28A 5CDHA 3BMNA 1KU0A 4P2GA 5H83A 1EGQA 4FX5A 4R5MA 4HNAA 4YRDA 1QC5B 3DXFA 2GCEA 1RWPA 3T9CA 2R44A 3I37X 4KLZA 3QI2A 4PRKA 3K5WA 2HLDD 4QUAA 4O1IA 4P3XA 5AVSA 1L5FA 2BDUA 3HYRA 4C0LA 2H16A 2C9DA 1RAIA 3KOUA 3E9ZA 1N78A 1Z12A 4KX5A 1V4NA 3A1SA 4JLDA 2C31A 1Y8ZA 4TMXA 1ZVVA 1M33A 3H0KA 4LWQA 3ZJ5A 4IOJA 1BROA 3D3WA 2QM0A 5ADHA 1OT3A 1E1DA 3B3FA 1Y5NA 1UDWA 1GY8A 3K1AB 1E1CA 1XMSA 3DPSA 2XDQA 3A0RB 5EE5B 1EQAA 1O87A 3K5HA 2D3TA 2RAUA 3BGIA 4TZTA 4TWAA 2BGJA 4F86A 3WQRA 4AS2A 3Q9NA 1MPXA 5FV7A 3R6DA 4ZCLA 4DYHA 1Z15A 5DHPA 5IN5A 3RQSA 2TMGA 2RD2A 3ICEA 4ZT7A 1NLUA 1RAHA 4AXBA 5JV5A 1WSDA 4HSEA 2P6RA 5ITZB 2O2JA 3THXA 5CDGA 1UPUA 2F6RA 3JZAA 2KQUA 4K9DA 1K6EA 1MC1A 2NVUB 5KTTA 1H9CA 3BQ9A 3NIWA 1NMQA 1CRZA 3R44A 3UAOA 4S04A 2FWPA 4MRNA 3AP2A 1GYRA 5DBHX 3UAGA 1Z06A 2ORVA 2V6BA 3VBEA 1CYEA 4PPGA 2QPOA 1FW6A 3CW8X 1KDRA 2XUFA 3HN7A 3DBLA 3JVUA 5JHHB 1FTYA 3PFFA 4S24A 1UOOA 3U19A 1A2KC 2HSGA 4OBWA 4IM7A 4JI8B 2I6QA 4A0FA 2HMVA 3C6QA 2I2AA 1UFVA 3L1JA 2V5VA 3DEAA 1CS0B 3SS7X 3TKAA 5C5EA 3I6YA 4J43A 1F0PA 3AUTA 4MA5A 1RABA 1RADA 4LWZA 1UAYA 4J3FA 3TLBA 2QOEA 1W6RA 4TGLA 3V9PA 4CPDA 4PQEA 1GLGA 1UZNA 2AZ4A 1CC1S 2JIZD 1T9ZA 3BYZA 3KTAB 6REQB 3DR3A 4MARA 1I1QB 3KEGA 1DJLA 4L9WA 1RACA 4TV8A 2H2IA 5AM5A 4PFKA 3RKSA 3E61A 4XWTA 4ERXA 1GPMA 1UKZA 1RI5A 2VXOA 2ZSIA 5EPEA 5J2TF 1VLVA 1XSEA 3QU2A 1MHPA 4RX1A 1W5AA 1MX5A 2DWCA 2DQSA 2PVCA 1J0XO 3DZCA 221PA 3KSZO 4E5KA 4YRGA 1M2VB 2RGCA 3G9XA 3LKZA 4KHPB 3IV7A 2JHFA 5CRIA 2HMUA 4HAUA 1L5NA 1UBSB 3OUUA 1JG4A 1MX3A 2ZCJA 4L9SA 5DN6A 3I5XA 5AJYA 1NYQA 3WNBA 4LJRA 3C2QA 3ODGA 5J4KA 2WJHA 4AO7A 2Q5LA 3E2MA 3FCSB 3LYLA 3OWOA 3GUUA 1NUPA 2FMXA 1O6ZA 1QOZA 4IY1A 4IIUA 4WKPA 4UVIA 1E2NA 4NULA 4N1AA 3HK2A 3G9ZA 1RMTA 2VATA 4H6PA 5EKXA 2EP8A 3B3QA 3ICVA 3VYWA 1MW8X 1LPBB 5K99A 3L5OA 1WJGA 3FM9A 3H0CA 4YNBA 3RSGA 6YASA 3QSYA 1NDQA 4QYSA 3IVRA 1D1PA 5HJ2A 3ETHA 4BMYA 3OKPA 1PJ8A 2QAGC 1MIOB 4OXRA 1ZD4A 5I9TA 1IB6A 3K70D 3GQBA 3L8ZA 2OZEA 5G40A 2QL6A 3AJ9A 3DBHA 4GX2A 5L40A 1WPXA 1YWGO 1KOFA 5TJ9A 4PICA 3RVOA 1Q95A 3EZ9A 4PHCA 4HXEB 5JBNA 1SRRA 1CULC 4YJ2A 4MIOA 4KQ2A 3UMCA 1OKKA 3UJAA 1K63A 1EK6A 3FYTA 3KZXA 2OAGA 3X1JA 3H1EA 4F5WA 2FQYA 3EFBA 2GCPA 3T4PA 3FI0A 1CWUA 3J7AC 4BB0A 2UYOA 1VM6A 3RH0A 2GN6A 4NK4A 5DM2A 5KVQA 2R1VA 3LHIA 1YH3A 3B8HA 4DQUA 4EJ0A 2HHAA 1BA2A 4ZHSA 4JLPA 2UYHA 2JARA 3PC2A 2GEUA 3AYZB 5EXXA 3H5VA 2ZRLA 3AONB 1XA0A 2UYQA 3INTA 3N59A 4LNHA 4UNNA 4EZBA 5K09A 1I5OA 4DMHA 3ORFA 2HADA 1NBWB 4ID3A 5CNJA 3H75A 3ZEIA 1HT3A 3VPBA 4CN8A 3WMWA 4NWIA 5C53B 1ZS9A 3A6KA 3UGQA 2CUKA 3DE5X 2EJVA 4YCLA 2ZUBA 1H2XA 2H4YA 5TDHA 4RF5A 3FNIA 1ZJZA 4IZHA 3RK0A 4B76A 3M34A 1AD2A 3ZWDA 5FA8A 4BE4A 3FRIA 1SOWA 5CA1F 5ITWA 5MF6A 2PT5A 5ADWA 3I8OA 4PHFA 2XYPA 1EGHA 1K8XB 2FPOA 3D5EA 3ZDEA 2CB0A 5CA1B 4U0JA 2WQ6A 4Y9RA 3WLNA 1XGKA 1UJ6A 4RYLA 3RWOA 1XMOB 5C51B 2X8LA 1QPGA 1BXGA 4J2TA 1AG9A 4ZO9A 2QZJA 4KRGA 1VMAA 5T67A 1DP4A 3VNAA 2N75A 3WK9A 2VK4A 4KDFA 4YDQA 1LCIA 3IDAA 1JEDA 2JHCA 3WDMA 2UUCB 3JQGA 2Z8XA 1QZTA 5DDIP 1VL2A 4D4LA 2W6ZA 4JU8A 5A2QA 1K7EB 5JS1A 3JPWA 2Y4OA 2ZITA 1I5RA 5GZ1A 4OU4A 1JQ3A 5JQGB 1FJXA 3A4YA 1IEVA 1DNPA 3HUFA 3V32A 5C5CA 1A04A 2WM8A 1TLLA 4OG2A 3AFHA 4S0XA 1QVZA 3G8AA 2DXIA 4Q4JB 1IOVA 1EQ2A 1PBTA 1E99A 3DTVD 2X58A 1ZMTA 3HXLA 4O2AA 4QPNA 4RJIA 5EUCA 2H8GA 4ACAA 3U3XA 3TS1A 1UOPA 1S7CA 1CNMA 3V80A 5KC9A 4W1SA 4RIHA 4JDUA 3U56A 2W2OA 3C1UA 2DFNA 4FGZA 1OFHA 1NHGA 4EW6A 2NVOA 3WKEA 4O02B 4QUGA 1UDRA 1CNFA 2VDOB 1QYIA 1ZICA 1VIAA 2FWBA 1V6AA 2OGWA 4GRIA 4FZVA 5CUQA 3TIXB 4D3FA 4U2GA 2BBTA 4QYWA 2WUVA 4DAOA 4EHLA 4JFAA 1XIVA 1USIA 2AOUB 2EJBA 4RKWA 1XTJA 4C7JA 2RE8A 1VCMA 5C1IA 3B13B 4PSUA 4G97A 4JMLA 2A0WA 4WXYB 2O8NA 2Z09A 3WV4A 1GPAA 1DIOB 4IMPA 4GPD1 4PPQA 4BGIA 5BV0A 1GV1A 2LDXA 3VPSA 4YCMA 2WHYA 3HCPA 5IVDA 4MR8A 3IEVA 1E9BA 3B5JA 5AUOB 5JRZA 1A71A 3RC2A 1XDBA 3E9NA 3K8ZA 1EVEA 3EMDA 2PM8A 3MT8A 2VTEA 4YRLA 3U9LA 3G02A 1DAMA 3IQFA 1CUDA 3VM6A 4YQFA 1T4DA 4JT4A 1ABBA 4EHHA 2KX7A 3HYLA 3OH8A 1WB4A 3VUEA 2WSYB 2P5UA 4MW4A 2A9OA 4XKJA 1BRMA 3EVTA 2MSEB 3NCTA 4OHFA 4GEKA 3BIJA 4ZMRA 1C4KA 1OT5A 4ALMA 3KZCA 2BHSA 3A9RA 5AR1A 3CBGA 4AKIA 3B1KA 5DI3B 2WB4A 4KVFA 3EN0A 3RNLA 5CFRA 4AJHA 3IV6A 4R54A 1WHTB 4WKNA 1QFMA 5HIJA 1M7GA 1CYDA 2W83A 3CEPB 2FRXA 3WHLA 1U8AA 3T1VA 2XUAA 1Q2UA 2OHFA 3BCHA 1SVLA 2H52A 2HXYA 1ZISA 2OHHA 1YIAA 2AG1A 3CCCA 1IWBB 1TCCA 4NFHA 4ZC1A 5TX7A 3NWOA 4F91B 5FV4A 2ZUUA 1Z6QA 1N7IA 5THQA 5M7EA 2IT1A 3N2EA 4UEJA 1WCWA 3FYCA 2X8JB 4HEHA 4DY4A 3RJMA 2I2DA 4WN9A 2P2YA 3I3SR 3SDSA 3DCYA 3V1TC 1PX2A 3PKJA 3AKDA 2NU7B 1B8PA 3BC1A 3TW0A 2IZ5A 2Z5VA 1WD7A 2R60A 1BDIA 3E8XA 1MAHA 4AJKA 1SVKA 1L7EA 3BILA 3IVXA 3OURA 2Z2IA 2ZE7A 4FHFA 4MK4A 4OHUA 2C61A 2PWBA 3BL8A 4KHZA 4PGMA 4PV7A 3VO1A 1HQYE 5KNLA 4AG5A 1VJGA 4W1QA 1PFWA 5KKAA 1F06A 2VP0A 2C8LA 4EA8A 5HMMA 4PYRA 1KJQA 1J25A 3E3AA 3CM0A 2PD4A 1KIFA 1O6FA 3K1YA 3QVMA 1RM3A 1U1FA 3L79A 2G8NA 4LQLA 4G5OA 4QUKA 2BI4A 3CBQA 1AO0A 4RXTA 5LQNA 3KJHA 2VRNA 2ODQA 1F51E 3FMFA 5E9AA 1D2AA 3CINA 1TCAA 2H00A 2WVGA 1GZSA 2GKOA 9GPBA 4ZGWA 1VKRA 3E15A 3IB6A 3MOIA 2CF6A 4LZPA 4OKNA 3V4ZA 2FFJA 5C52B 2OFWA 4EIWA 3L6DA 2WIJA 4N18A 5AVRA 1NPDA 4M8SA 4E1VA 3THRA 4CFYA 1IIBA 2XTNA 3L92A 2MSWA 1GXSB 3Q3HA 4F5DA 2D2FA 1G4HA 4C7VA 1XTVA 2M6RA 2BCEA 4O3MA 1KNQA 3HGMA 2FXVA 5D3KA 4ZDWA 3BHJA 2Q0QA 1UP7A 2HU2A 5FFMA 4F93B 4RTKA 2FCAA 4FGSA 3RT1A 3GJ5A 4V3BA 3ST7A 2V0CA 3I9FA 3TQCA 2E4WA 1YBHA 3AEYA 3UV7A 1XL0A 1D9XA 5DP1A 1MG5A 1U2SA 1U31A 3LW8A 2XUOA 5LDDC 3G88A 3IDSA 2XZOA 2ZIXB 2FSSA 3V46A 4WLFA 4CI9A 3C43A 1OUMA 3RREA 5DTEA 4D81A 5JDIC 1U7ZA 3PC4A 5DCWA 4S1WA 5GOTA 4DBLC 4ZCTA 1NC3A 3E82A 1FDTA 2A58A 4QRIA 3AL2A 2IYPA 4BX9A 3PRJA 2PU7A 2HU5A 4Q9HA 2H4XA 4F9GA 3AR5A 2VUUA 3T3IA 4EELA 1YQ9A 1DX6A 5D5HA 2WU0A 1USWA 1P2TA 1YA4A 1Q7CA 3D8HA 4K26A 4KFSA 3I9KA 1N6IA 3VU1A 1JEEA 1GITA 1PJ3A 1ZY2A 4HMQA 4KQ9A 4PLVA 2ZE5A 2R6HA 1EVYA 3OE4A 4Q39A 4BQPA 4ZQFA 1LSOA 4NTZA 5AKIA 5KNDD 2IEDA 1TAUA 3EIXA 3AEZA 3GN2A 5DNAA 3GELA 3FTNA 4MAMA 4YRFA 4INOA 1UJ4A 4ZOBA 3ROQA 2ZBPA 3ON5A 4ZIRA 1XTQA 2J45A 2J9YB 6CHYA 5A62A 4JUCA 4BVJA 5J59A 1ZGZA 4TKVB 1NRJB 5F1YA 1ZBDA 1OC4A 1MJNA 4EGSA 1L7VC 1T6NA 2QRZA 4LOAA 4RU1A 3HMKA 3HKDB 2F55A 2KMLA 4E08A 1AMUA 3ZJTA 2D8AA 1MB9A 5FDFA 3MWLA 4BNNA 2ZIVB 1V8DA 4WIAA 1IC6A 3COPA 1CBUA 2X40A 3DV9A 4G0UA 4AXXA 1ZL0A 3T35A 2JI4A 1OTHA 1P0MA 1NZDA 2ZTHA 3HVIA 1F3OA 4YONB 1II8A 3REFA 3RYCA 2JI7A 2A0FA 5TPZD 4WXMA 4WZBB 2BEWB 2E18A 5BN4B 4E7PA 2MMCA 4MMXB 1AGRA 3AJEA 2HPHA 5PGMA 4B6EA 1CUZA 1QKIA 1RMQA 2ZIXA 2F9FA 2H11A 3KHKA 4I6JA 1HFKA 2AZMA 3H5NA 5E8RA 3W90A 3IP5A 4URXR 1G8KA 3T4UA 1KEWA 2PRZA 3MMPA 3R7WA 1SQSA 3ONFA 2AFHA 3PC7A 3BS4A 4MTLA 5ICMA 3JQ7A 4N03A 4JLBA 3ZZ1A 5LL6P 4JD5A 5BYAA 2PS3A 1YGPA 2J7PD 3B6EA 2D2XA 3KDAA 1YUBA 5CDYA 2PXXA 1UBGA 1J1UA 3X1XA 2W2PA 1G1AA 2WJWA 2AR0A 4F11A 3KQYA 2CVZA 1NUQA 3TNLA 5I7VA 3I61A 1VLJA 1RCUA 5ER9A 2EW2A 2GAAA 2OYCA 3ZUPA 4ZJPA 4WHMA 4MRPA 4QQNA 2DULA 4WKBA 4DY6A 3A2NA 1L5GB 3OJCA 2YQZA 4H35A 2H18A 4KQGA 4KMRA 2CMGA 4KR2A 2CB9A 3D6NB 1D2EA 2O2YA 3NTVA 3TQQA 2AFIE 3VISA 1BJKA 1YRWA 1LDGA 4NHEA 4R4JA 3PQEA 4M1ZA 3NHSA 5CNKA 5E1OA 1OZHA 4URVR 1OA1A 4FBGA 3JAKB 1U2QA 5A7FA 3T3OA 1PEYA 3PTLA 4RPKA 1GFIA 3CNQS 1GCIA 2HREA 3E81A 3RSCA 1G42A 3NYRA 5F5NA 1L0BA 3A6ZA 2C03A 1QYRA 4HLQB 4M7WA 2AUMA 2NUPA 2AG0A 5GIOE 1DOZA 4P4TA 4BHTA 2OMKA 2NU9A 3AG5A 2JH9A 1ENPA 4M7PA 4QGAA 2UZ4A 4O4IF 3KNZA 2DG2A 1BH2A 1QJ4A 5B37A 3ZYZA 2AHRA 4N7JA 4PO1A 3QELA 1DV2A 1DXOA 2PKXA 3KX2A 2Z6UA 1IY2A 3TQFA 4LX0A 3MGBA 3REOA 2BDTA 1USKA 3BB1A 4M1QA 3G0BA 2GZHA 3K96A 5C7LO 4TYYA 4N5HX 1FSFA 4UAVA 3R20A 1RKUA 1MDBA 2BEJA 1SCAA 1RM5A 3C8DA 4DDKA 3OZCA 3T5CA 1LX7A 3W7AA 4FW8A 5KU7A 5K0EA 4W5OA 4AK9A 3CSUA 3CLTC 3ZV5A 3CUWA 2N42A 5GINE 4DR3B 3SX0A 5LYJB 3UGKA 3NXSA 1QG0A 1NXVA 1L7BA 1OYYA 1S1MA 3PEUA 4LTMA 1TADA 4WOPA 1UXJA 3K15A 4YALA 1QFJA 3LLSA 2BFFB 4H59A 4I9HA 4MUGA 2WTBA 5B58C 5K4GA 5KTKA 3CKKA 4RJJA 2HUNA 1Q84A 2KI5A 4JX8A 1O4WA 3FCAA 4ALIA 2P90A 4E22A 3L6OO 4Q48A 4E31A 2I6UA 8ADHA 3EGXA 1L1RA 1L5KA 5BWOA 1U0NA 1NT2A 1WR8A 5TE9A 5KHAA 3BGDA 5AWFC 4DV3B 4A16A 3PEWA 2Q4DA 2TYSB 1FJ2A 1TIKA 4F1KA 5JS8A 5CVCA 1NC1A 4H0NA 5FLEX 3RROA 3OZSA 3P26A 4FGWA 4OKIA 4UFPA 2YV3A 4D4GA 4QTZA 5LLTA 2P0AA 1K2WA 2OV6A 5FPTA 1I1OA 4BMSA 2ZATA 4BVAA 1YL6A 4WCFB 3R7SA 4KFCA 1TW3A 1EZ4A 2CK3D 5JY1A 1N5DA 2YVLA 3CWCA 4QGSA 4CEHB 1EFVB 1VKZA 4NARA 3EIHA 3KJQA 4EGCB 2FR8C 2PBZA 4L6CA 3TZLA 4QAQA 3FJYA 3K9QO 4Y6OA 4DDHA 1P4RA 3SVTA 4JL5A 4GLLA 3UMFA 4DLPA 2IPOA 1S02A 4ENSA 2JL1A 1CRLA 3A6HA 4W5WA 4ZO8A 2VF5X 1X1TA 1T3LA 2HIAA 1LDYA 4QYTA 3QEAZ 3QUQA 1FNNA 2G5TA 5FBVB 4P4SA 4BPBA 3M0EA 2CDNA 1ZVMA 3USCS 3WTBA 4P7BA 2BP7B 1GGKA 1WXQA 1ZJ6A 3C7CB 3IAS6 4CLXA 4C30A 3RUEA 2ZIGA 4IH4A 2VDMB 3LQKA 1UPTA 1AXGA 2FG5A 2W4QA 4DC9A 5C1PA 3B6KA 4FC6A 2R87A 4KGDA 1CY2A 5I4BA 1KZ1A 5IS2A 1XHEA 3CVWA 3U13A 1T6BY 2KE5A 4D56A 4GOJA 1XBTA 3JQ6A 4URYR 4AMYA 1SPBS 3UT0A 5HTOA 4EG3A 2D1SA 5M2QA 3N2KB 5CJ2A 1R16A 4ZT2A 2IOYA 4X60A 3BK7A 1WF6A 4FJ1A 3C8HA 4OFWA 4KOAA 5TGTA 3TJMA 4JJAA 4NDZA 3A4VA 3ACCA 5T3YA 1BX1A 1BMDA 4AJ1A 1SC3A 3OMXA 3S0JA 1ORRA 1Q1QA 2ODEA 1DAIA 1YAHA 2O7NA 3D3KA 1SBQA 2ECQA 2R6CA 1HL7A 2R6FA 2JHGA 1F4VA 1I7LA 5SYAA 4DSUA 2GVZC 1J09A 1THGA 4MUIA 5G41A 3V4OA 1N5OX 1CJKC 3K20A 3PHHA 2HMAA 5JAMA 1HLFA 1MVOA 1S6YA 2CE2X 2IIPA 3D4NA 4MKFA 3QPCA 2YFHA 4ARZB 1M1ZA 3ACDA 3O9MA 4UPVA 1NUUA 5CYFA 1B76A 2RHJA 3U0VA 4KO3S 4I4CA 3PR3A 4KE9A 3BKWA 4LSMA 2WJGA 3QPBA 2B98A 3O3OB 3QVGA 1T6XA 1KGSA 1ZIDA 1RSZA 2VSQA 3D6VA 1CY6A 3RF6A 5JATA 4EKIA 3UW3A 1YD7A 2C07A 5AM2A 1B3RA 3ZQJA 4ZWNA 3H84A 2R2GA 1TGVA 4JQOA 3SKXA 4X66B 4EY6A 3D8SA 2E9SA 3Q8LA 5KNBA 1E0JA 2OZLB 2XOKD 3P2OA 2JJMA 2GXQA 2PXAA 4E33A 4RVDA 1JDBC 2JIBA 3KKMA 3L7CA 4QDTA 4JUFA 4W5HA 1CQWA 3HSSA 2NSLA 3IVCA 2Z4TA 5EA2A 4BJ3A 5FP0A 4MGEA 1EFCA 2VP6A 4BJ5A 3IAEA 1KTIA 4P5PA 2C8KA 4YDHB 2PPLA 3TR0A 3TECE 1FY2A 2WWHA 2OG1A 5B7GA 4ODIA 4R1QA 2OBBA 3TLAA 5BSHA 4EPVA 3MWDB 1TAHA 4FYJA 5F3RA 1CJMA 2F1KA 2H8KA 1MC5A 3M70A 3TCNA 4CKBB 4FE3A 4NYIQ 3VDNB 1GL6A 2PKQO 3CKMA 4FOLA 5KWEA 3ZIAD 2VWQA 4M8KA 2WWIA 3PIDA 2V3VA 5GJBA 2QQ5A 1LA2A 4RYDA 3JARA 5DBIA 5PNTA 4YIHA 2FK7A 4WNAA 3PEVA 4O0MA 3QKSA 4A03A 4O4LF 3SI7A 3FCXA 4HN9A 2X9VA 1Y37A 1CJSA 1PEKE 1M2GA 3HGQA 4DUPA 4EENA 3E03A 1FYVA 3HP7A 4IDAA 5JYBA 2O3TA 3FX2A 3E7WA 1J8VA 1NE7A 3AIOA 3CLRC 5DASA 4H18A 5AK6A 3DVRX 5F76A 8LDHA 2WU8A 1KWKA 1BX0A 2A86A 2QLMA 2WM2A 5DWQA 3PENA 2Q6OA 5C5IA 1D6MA 1U63A 4BFUA 1FVOA 1Z2EA 3HWX1 4LHXA 3DMYA 5HKAA 4BB9A 3QGMA 3C3DA 3EGCA 1IK6A 3JQ8B 2BTQA 3A6FA 4UZFA 4E2YA 5EQDA 5H02A 2AD1A 1VG8A 3MFYA 1TAQA 5KTNA 3CLHA 2A1TR 1WDKA 2HDNB 3LNCA 1I3NA 3WDKA 1FNMA 3ENZA 3ZQ4A 4Y2YA 4EG6A 1PP4A 1VC2A 1D8AA 4MR9B 3O1LA 4FJ0A 1R8QA 1C8KA 4BY9E 3T9AA 3B6IA 4BAUA 1NM5C 2ZI5A 1Q1EA 1SG9A 2GPAA 4B85A 2F8MA 1FRNA 1GGMA 3DGFC 3HKDA 3NBFA 3RUPA 5LP6B 1C30A 1DE0A 1T9KA 3MJSA 4XRRA 3V1MA 2P9EA 5DGCA 4QHTA 3ZD7A 1SBYA 2DPGA 4DDMA 3SMQA 3NX4A 2XCLA 1CR1A 1J0CA 4FX2A 4V24A 2V7QA 3EC1A 2IYFA 1QH0A 3AWIA 1T26A 4L73A 3KFXA 4KPFC 2CXUA 4OYHA 1BGVA 4JAVC 4PONA 2X1VA 4Q9NA 1HLGA 1MAWA 4RK0A 1BMTA 1GTRA 2V98A 4U7HA 3LOUA 3PDWA 5JADA 1OIVA 1T1RA 1D7AA 4DMUB 3FGZA 4KH0A 1SIBE 1QUEA 1OIXA 3ANYB 3AVUA 1KL7A 1RLMA 3CJRA 1I6LA 4ZARA 4C3OB 3DMGA 3H1FA 2H5LA 1T35A 1F4LA 2BFNA 5FNZA 4HQRA 2P27A 3GT4A 3ET5A 1ZCFA 3M81A 2FETA 1ILWA 1YDMA 4L5BA 2V7UA 2JIOA 2BBWA 2VG8A 2DRIA 3BWEA 4IRMA 1R4AA 1S9HA 1TUBA 5TPZA 3DMPA 1A8IA 1ZR2A 1M1YB 2QVBA 1SB8A 3GH3A 3I2JA 1BS1A 1L8AA 4IF4A 2YVUA 2JLRA 3A27A 3IE2A 4QD3A 4BN4A 1JBQA 4UBOA 2PSEA 5JQGF 1Y1LA 1ZH8A 2FSVA 2IXFA 4EZEA 1NU8A 3BRSA 4CTOA 3DO6A 4WLEA 3GDGA 1MH9A 3ANTA 3TL3A 1T1SA 2A4KA 2AE2A 1ZNWA 1F2TB 4FYKA 2W6QA 1EM8A 3TMYA 1B0UA 3OKAA 3WWZA 4OQMA 2YIMA 4HD8A 2OXIA 4E3WA 4FFWA 1P73A 4PZZA 2WNIA 2E4UA 4B5KA 1ZUNB 2ZJ8A 4K9OA 5E4JA 5EIAA 4U7GA 1HGXA 4QJ5A 2WBLC 1UPXA 1A7AA 2ST1A 1VIDA 4KJXA 3V1YA 3F3MA 2DR2A 2AMVA 4CTMA 4EG0A 1ZD8A 4US2R 3BFJA 1E6KA 3ROGA 2G77B 4H6WA 4DADA 5BW4A 1LK7A 3NAQA 1CZRA 1GNQA 3LH5A 2IDJA 3LUFA 3Q72A 2GM4A 1HDOA 5KWIA 1LNZA 2RK3A 1UPCA 1XCGB 4LXHA 3MHPA 4NENA 3F7MA 3FOAA 3QKSB 1GSAA 2LDBA 1KJIA 3PD0A 4MLDA 3O4RA 4Q3LA 4WZBE 1VDZA 1RYMA 2LZ0A 3GY0A 4XX0B 5BW8A 1YR9A 2FRVA 2QXYA 1WMAA 5FAXA 1PQ4A 2VBCA 1EFAA 2G9ZA 3NWPA 1V43A 4MV1A 4CMCA 1ZU4A 2OECA 3NOOA 4GC5A 4Q1BA 2QR5A 3IRVA 4ZC8A 3FGNA 5LYYA 3RF7A 1IJFA 3UYLA 3B7PA 2JAPA 3BTUA 4HTFB 2PAAA 5A4IS 4IQ0A 2ZTMA 3KJEA 4Q6WA 3B3JA 3LT4A 1SN7A 3ONVA 1UWLA 1CQXA 2W37A 4NPAA 2Q2WA 1DX4A 3O75A 3IAFA 4F4IA 4B3IA 1DBIA 4FKZA 2PXHA 3D4OA 4DC0A 1YA6A 3A2LA 3DZIA 5FPKA 3CTPA 4XWYA 3LY8A 2IIBA 4BN5A 3AHFA 1VFPA 4Z4IA 1XVLA 3R75A 3ZWMA 1VBKA 1YJCA 4IDFA 1MQSA 1Q1NA 2OBXA 4XIYA 1KPGA 1BFUA 1G3MA 3EBPA 5KQMA 3HCOA 3BA6A 2OZLA 4CLHA 2B4TO 3F47A 4HTAA 1E89A 4OFXA 4PO8A 3HXMA 5HKKD 1NVMB 4JUDX 1LS1A 1N5MA 3D64A 5BSKA 3RGGA 4WD3A 3ONDA 3H4IA 4E88A 4YUZA 5C5DA 5LQAA 2Q7XA 1DO8A 4JJFA 2ANCA 2GN1A 1D2RA 2ZWPA 2AKEA 4KNVA 1SCUB 4C4YA 1QDUA 1SR8A 1X1AA 3G9QA 3GEDA 4TMZA 4WX2B 4LIPD 4EARA 3D7NA 3L7AA 4AO8A 4OXXA 1ZCJA 1ZHFA 4B40A 5NULA 1V11A 4JI4B 1VLZA 1UK6A 1QZ3A 3BTSA 4JCOA 3PDJA 2ZTSA 3FPFA 3MLBA 5EJAA 5JU6A 1A9ZA 1LGYA 1DPFA 2A92A 2QIPA 3K2BA 3P0HA 2Z98A 1CIVA 1BE8A 3GJQA 1RS0A 4G0XA 4Q34A 4Y6LA 2VAWA 3VKWA 3RI3A 3UHOA 3JASB 3E5HA 3TLYA 1DBPA 4GF5A 1PGQA 1TE2A 1J4AA 2GETA 4UU0A 1GNSA 3MTAA 3OBIA 1M2WA 4KAFA 1ZD2P 3U3DA 4TKLA 4MIYA 3REQB 1XYYA 4E5MA 2DPHA 3ZHVA 3DTNA 3OT1A 1II8B 1NQTA 2FK8A 4EHJA 2B7CA 3SFZA 4UHHA 1NG1A 2WWYA 5EIBC 3SX4A 2ARKA 3EEFA 5EXSA 3VHRA 2NZVG 3DPIA 1NF8A 2H2WA 3KJZA 4D0RA 5KOIA 1ZQ1A 4K0RA 3SYKA 1JXOA 1E1QA 3GFTA 3O0DA 1H1LA 3HO6A 1P1KA 2C2ZA 3FSEA 1C1DB 3D6MA 3KKQA 2LRHA 4RTQA 3RIXA 2XCSB 3CNEA 4LZNA 1E94E 4GRDA 4MI9A 5I9SA 5ALFA 4G5SA 4N40A 5DTJA 4YXWD 4C5AA 4HAYA 1DFGA 3SKVA 2FWJA 2RC6A 3PJGA 1RWKA 4RS4A 4C0AC 4I4NA 3HADA 3K4QA 1Y4DE 5GONA 1DXQA 2QZPA 2XUIA 3O2SB 3ICPA 2YUIA 2CHFA 2EBWA 4GAEA 2NUAB 3ZNPA 3JX9A 4KSBA 1COWA 1UF9A 4REOA 3TFWA 4RBNA 2IDKA 4QA9A 2PZBA 4WK4B 1I2ZA 3BRQA 5IDXA 1XCOA 1XTUA 2PX3A 4PR3A 5K3BA 2IC5A 3DTVA 3V4PB 3AEUA 3AKZA 1V71A 2DR3A 2Q41A 1BTOA 4G8DA 3BTVA 3URMA 4F04A 5HRAA 2XB2A 3F5DA 5I7SA 2BTEA 5A3JA 2EKBA 4DUZB 3LP5A 1X8JA 1FUIA 2RI0A 3WYBA 4HN4B 5ALVA 4CM7A 5IANA 2VNHA 4Y98A 4FWTA 3GJ3A 3I62A 3F96A 2XUHA 3CVVA 4M21A 5JCOA 5EVJA 3SYRA 5CR9A 3UN1A 3VPGA 3ZBTA 3CH7A 4CEHA 3UOGA 1FQWA 3DG9A 4NE7A 4XCXA 1ZQ9A 3BAZA 3Q7PA 4UHDA 3EPRA 2IPNA 1W88B 1ATIA 1NN1A 4Q3OA 2R5NA 4MQFA 1ORTA 2P75A 2AR9A 1W46A 4NQZA 4OI4A 5TQ2A 2ISSD 2XB6A 3V7YA 2C3MA 2HBQA 5INTA 3PFGA 5GPBA 5K3EA 5FPSA 2SECE 2R00C 3FWZA 4YFYA 4DZRA 2RGNA 3AV0B 2JDID 2O2ZA 4HC4A 4HDAA 4NBUA 2GJKA 2PCLA 3M6FA 3AI3A 5GVRA 4AECA 4C3ZA 3UHAA 4G01B 4OQEA 3MT9A 2QMOA 4HX2A 4G0QA 1CUEA 1M0EA 4Z8XA 2BRUC 2EBFX 1VPLA 2CGEA 2GO7A 2XMCA 1UBHS 2ZRIA 1J99A 2AN1A 3FJ1A 4YO7A 3GO4A 3OAAD 3PXDA 1UADA 3Q9SA 1OW3B 1T1GA 4IICA 4TXMA 1NG9A 1W0KA 1WXDA 2HCBA 2VQ3A 2XNSA 3MLAA 4LK3A 2O2GA 4AZSA 4DBZA 3TZBA 3DTTA 1P3Y1 1ZSNA 3E27A 3L0IB 1YJBA 4PRLA 1IBLB 1O0SA 1SWVA 4UHBA 1KY3A 1OREA 4EG5A 3Q0IA 3S2UA 1CR0A 1HR0B 1P62B 3WLSA 1XVAA 1Y9ZA 3V00A 1X39A 1FTSA 1NF3A 2YY5A 5IW8A 1OH5A 2CJYA 4OQPA 1P2UA 2A9VA 1XDUA 3BH7A 3U7QA 4B2YA 2P7HA 4ZV7A 3QEOA 2AXNA 3GRFA 3WLQA 4BQFA 4GEGA 2D7DA 4LHYA 1M0WA 3MD0A 3R3UA 4ZZ3A 3TVTA 3KOXA 4K05A 4G23A 2MYTA 1ICEA 1IIRA 2DBRA 4OLJA 1UM9B 2QD5A 1XAJA 1E1NA 1T5SA 1JR4A 2GLXA 4JB2A 5AIAA 3RYTC 1CV2A 2D6FA 1DKLA 4FDTA 4UM9D 1MX1A 2VQEB 2PSDA 3EQ2A 3MGKA 2B1IA 2ZYSA 3FMVA 4IG4A 1ECBA 5EHIA 5LUBA 4IJQA 1Z2PX 5AW0A 3F6PA 4YJ3F 4LYYA 1YKGA 1U3VA 4RD4A 3OA2A 2NU9B 1KZGB 1VE9A 3F6SA 3MG9A 4U0KA 2Q5QA 3HU3A 4XB2A 2WUFA 4DIDA 4FHCA 4F6RB 3ZNQA 1ZGJA 1ADCA 4FVTA 2X8BA 2Y68A 1QCCA 1USVA 5AHWA 2YS7A 1Z08A 3BQNB 4I36A 3E9EA 4R3UC 4BJHB 4MYUA 2CYAA 2CNDA 1N25A 2W8BA 1JHDA 2WJAA 5DXAA 4ZVVA 2PSJA 1P2VA 1M6YA 3K9GA 1PTKA 2WR8A 3ERCA 4FMBB 5BUCA 2RMKA 1UT8A 1WUIS 5AM4A 2HQRA 3IULA 1M72A 1DO0A 1EINA 1SIOA 3OO0A 2PQ2A 4NBLA 4WH0A 4OIMA 4R2XA 1PBNA 1SY7A 4KLCA 1XWWA 3HB4X 1Z3CA 2R8ZA 4BNZA 5FBKA 4QXMA 2CN1A 1HURA 1HXHA 4EYEA 3HZHA 3ENNA 2REOA 5IH3A 4F7WA 1Y9EA 1NKTA 2BZSA 3REGA 3EIOA 2WV7A 4BNYA 4CKEB 4L0CA 1A1SA 1UMDA 3EXHC 3RU2A 5HFNA 5CB4F 3QY9A 1Z0FA 4ENWA 2OFPA 3WYDA 5JYDA 4A6PA 2DF8A 2ZT7A 1QLJA 1DXHA 3AHJA 1RTKA 5IYZA 3D8BA 3IP9A 2Q8PA 4RK6A 4JN6B 4MCHA 1U3FA 3R6LA 2IY9A 2Q2NA 3QLJA 4Q1DA 4AS1A 3SOPA 2RGDA 3KQNA 2IPXA 5CDTA 2BGUA 3ZWQA 2H54A 3EUAA 4R41A 1WSAA 1YQGA 2PMWB 1NW3A 4CQMB 3EW7A 1ISJA 2BCGY 2WF6A 4KCGA 1Y6ZA 3SQLA 1XZKA 4EO7A 2QPAA 3BWXA 4NJEB 2RAVA 4M86A 4EB8A 4PZPA 1MVLA 1PR2A 4K1LA 1QMPA 4N6OA 1HI9A 4BCDA 5KDDA 2JG3A 1SM4A 5AXCA 1NBHA 1IDOA 1U0GA 4LV6A 1URPA 2NU7A 3LP8A 4LF6B 3P4XA 1EWKA 2P35A 1JTEA 3GA0A 1YVPA 2QVZX 3LX6A 4MYTA 3DZ8A 4ITRC 4TT3D 2IHNA 3ND5A 2OAEA 5FOVA 1O9GA 5FBZA 5BSTA 3ZIAA 3GRPA 2KW5A 4K87A 4QELA 3T1TA 1PR9A 1UK7A 3O8NA 4ID9A 1PJSA 1RJ9A 3UPTA 1YRLA 3AQIA 4UBIA 3ZV4A 2CV2A 5E9JA 1FTQA 4YJ3A 3N76A 1A2OA 4LHEA 2R6DA 2P9JA 3HP4A 1KMHA 1TO2E 4HDMB 5K6AA 1V3UA 4GMFA 4JC8A 3B38A 2HZ7A 1LX6A 3WDSA 1YVEI 3ILVA 1HF3A 3SVZA 1AKEA 1K08A 3MCWA 2Q7DA 4CFZA 2QYHA 2A1IA 4NEGA 5A9TA 3MRSA 2RI1A 1FDSA 1KSFX 3RIYA 4Q4HA 3I4LA 1I2BA 2WYWA 3FAKA 1LSJA 1JIVA 5JZBA 5BN4A 4MUMA 2HJ9A 3WIUA 1LTQA 3UUEA 3UOAB 3PWTA 1DDGA 1L4HA 5E1MA 4F8JA 3OCXA 1OU0A 4MR8B 1Q5PA 5SY6A 3VHLB 3NGMA 2WOOA 1PSWA 1RRMA 3GWZA 3NAZA 5I9BA 1G5HA 5JSYA 4BRUA 3FR8A 3KD2A 1VECA 4CYMA 4UU8A 3QVKA 3ZDDA 4HSGA 1OROA 4C01A 4QO8A 4D4IA 4DW8A 2XNCA 5K0BA 3JYOA 4U2EA 3FCCA 4ENPA 4AX4A 5TNXA 3MTIA 1JN0A 2V7QD 1YBFA 4GPIB 1DQNA 3V3KA 1VSTA 4YMGA 3WMGA 1F14A 4IEFB 1ZM7A 4KPUB 3M89A 1Y1TA 3GZNB 1BE1A 1TW2A 3OOEA 1P0PA 3IALA 2AEEA 4WUVA 4BMNA 4UMFA 1L8LA 3SM9A 4ZYVA 2HD4A 3ZDXB 1EEHA 2O0LA 4US0R 3DOFA 3WBFA 8ABPA 5JNWA 2GEKA 2B30A 3BT7A 2B92A 2A6PA 1LY1A 3NANA 4ZAFA 5IJAA 3TZ6A 2M6LA 4AI6A 1R5BA 3PPIA 3QRWA 1O5IA 3WO1A 3ZG6A 1B8UA 1TC1A 2ZS7A 4QU0A 4BC0A 3MMNA 1O6GA 1Y7HA 4NQRA 5JD4A 1TK2A 3ZVNA 1ZJ5A 2H2AA 2QAJA 3KT0A 1EUCA 3D8NA 2F43B 4IHJF 1AUVA 4J8PA 4LZOA 3F8TA 1VBFA 2I80A 1NXXA 3BZWA 3NTQA 2CLCX 1JMYA 2E85A 3BL6A 3FVRA 3QLUC 1BXRB 4OHWA 1MLDA 1F1BA 3IP3A 4ZYLA 2WTXA 1MAVA 1JKXA 3NTRA 1EVZA 1R5NA 2PTHA 3HVJA 4KLNA 3K94A 1Y33E 3L84A 1MOPA 2SKEA 3OU7A 3P9ZA 4BAZA 5M5BA 2GZ3A 1RYNA 2BKEA 1LDBA 3M83A 4FFRA 4XGQA 3M3PA 5K8IA 2ZWAA 1WABA 2FTKE 3IUYA 1HLPA 2ZM5A 2XE6A 4P7JA 5EHGA 3WZMA 1GPNA 4AF7A 1PDVA 1VJCA 1B26A 4X24A 1U2RA 1SVOA 2VT7A 2YWEA 1G8PA 1PI3A 2A8YA 1M6WA 2ZP1A 3IOYA 4C7OB 4ZQCB 2OUIA 2WYUA 3MIZA 1IHUA 4AJPA 1QIDA 3RUHA 1PFQA 4E46A 3TTUA 1ODTC 3LSYA 4MRMA 3GU3A 3VYUB 2ZRHA 3NKFA 4IFIA 3T41A 2AOXA 2TMKA 4CWAA 2XKKA 4YMWA 2R1TA 2Z4SA 4E14A 2BM9A 1J7JA 3D43A 2F8LA 4HY3A 4XXHA 1ZSVA 5BP7A 1WE2A 1YVUA 3CX6A 5IKOA 2O8VA 3CS3A 4X94A 5BURA 4EL0A 1C80A 4G0NA 4MWGA 2IYLD 2TMYA 1RCFA 2VA9A 3EVCA 1E2GA 1EG2A 2WG0A 4JIGA 4QBIA 1NRIA 5F7ZA 3DEFA 3WLPA 4BGEA 5I8WA 5K0GA 1GSHA 1MUUA 4H0FA 3WNCA 1HYHA 4FQ5A 3KAPA 2WC1A 3H2GA 4UC0A 5FTWA 2OOKA 2ZI9A 1E2JA 5FB3A 3LSTA 1N6LA 4OQNA 3ZK8A 1G20B 9ATCA 1ZM3A 3D1VA 5CXQA 3DB1A 4N0PA 5BXQC 4CQLB 1F0KA 1VIMA 3OIVA 3B5IA 4LJ5A 3G7UA 4ZU1X 2W48A 5P21A 5HGJA 1ZN2A 1K9VF 3EF0A 3KOYA 3GLTA 1AQNA 1O89A 3BGVA 2GUGA 3LGSA 1E1KA 1R0SA 1DFIA 4MW0A 4TTRA 2XGGA 4R1OA 2HNBA 3O26A 2C8VA 1E96A 3R76A 1PU2A 5IBCA 1JR3E 2YICA 3F5SA 2O2XA 4PZ9A 3W6OA 1Z4QA 4HEA1 2BFCB 4EWLA 2PKEA 3GEIA 1T9GR 3HZOA 3BQMB 3HCWA 2QP4A 2C82A 2L18A 1QHIA 2GEDA 5DO9A 3KL4A 1NX6A 5E6RB 5IUNC 1RI4A 3ELBA 4JK3A 3FUWA 1N6OA 4L5AA 1QWSA 4M88A 4U2FA 2G6BA 5ALYA 5ITZA 5K0TA 2C2XA 3WSTA 4P5DA 4GW3A 4B8ZA 3TOCA 2I33A 4UTOA 4FI3F 3L0YA 1QIGA 3GDFA 4PG8A 5TEWA 4BAGA 1LB1B 1XZBA 4F38A 2Z30A 5IAGA 1VE3A 1QZUA 4CLDA 5KYYA 1EDOA 5F3WB 1Q15A 2G08A 1BH6A 5EIWA 5FWYA 4YUVA 3K70B 2AMYA 4MLZA 2HJRA 3CEHA 2MMGA 3U3KA 1XVVA 3I2KA 1G60A 1Q16A 3EG9A 4OB6A 3NORA 2YS6A 5A7GA 5KINB 1O94C 1RYBA 1ZGAA 4IOMA 3OLCX 2E48A 2QZZA 3HSYA 4MLPA 2XGSA 3TK1A 1Z74A 1MZPA 3GHHA 5L4SA 2A5LA 1DTWB 1A4UA 1G21E 5EWJB 3WKBA 2PR7A 1Y6FA 1QH8B 4X1KA 5AJWA 3T7EA 4BLRA 1B2RA 3A1EA 4Q02A 2Z1MA 2GPJA 2HGZA 1TI7A 2DZDA 5FKJA 2AFIA 4FT4A 1EFKA 3B12A 3S70A 2WTNA 1CQJB 3ZHQA 5IKEA 1C0IA 4RH0A 4YP1A 5BRAA 2Z1DA 5C7OO 3E22A 1OB5A 1V5WA 2J9RA 5ALKA 2JHPA 2NAFA 2WU4A 5LC1A 1XCMA 1U0JA 3BMQA 4M9RA 1X8LA 1XYVA 1TK9A 4RM2A 2D5IA 4P08A 3KPVA 4OQ4A 6Q21A 4Q4LA 4XR4A 4OHXA 2NXJA 2JLBA 3IQWA 4D9CA 3DD1A 5TB5A 2GOYA 2XOEA 1H2HA 3ITEA 4ARSA 1GUAA 1DKUA 4KG7A 4TQAA 2AW3A 4D46A 3LQ2A 4Q3BA 4MOWA 3GUVA 4W8GA 1R0XA 3C7TA 2QW0X 3D0QA 1Z7GA 1C2TA 1OY1A 2EBUA 3PQ3A 4MPPA 4FLEA 3FDZB 2D2EA 5AJTA 1NHWA 4WECA 5ICFA 1XALA 1ZJ4A 4MICA 1FMCA 2WYIA 2FGKA 1PT9A 3HXKA 3AUKA 4IIGA 1W6UA 2YBEA 1MOQA 3COWA 4QOSA 3LG2A 4FYHA 5FOUA 1BO6A 3L9WA 4NYJQ 3SHVA 5FR2A 3ETEA 1GPH1 2CMKA 5ILOA 4I0WB 1C0EA 1L4YA 1N8TA 2Y3IA 4DV4B 4MUKA 1I6WA 3RHTA 4JCCA 1GKYA 5DK6A 5CDFE 3N0WA 4GZ6A 4Q82A 4B80A 3CEJA 4M60A 3RRYA 2CV1A 5A2GA 1ZD5A 3EH1A 2CNWA 2YWFA 2QBYB 3D81A 1R0KA 4RFVA 4RF4A 1IRXA 4M8LA 2GK6A 2HA0A 3FSGA 3IMFA 4L08A 5ES4B 3HB7A 1YQWA 1W1IA 3F46A 1PKXA 5CGQB 1ZUHA 2WAAA 4HFJA 4Q1CA 3UB4A 3JVEA 4HDKA 4Z2YA 5A06A 2C1EA 1J56A 1PS0A 4W9NA 4JJKA 3UC9A 1UWKA 3D7SA 2LE0A 3R5XA 3ZLTA 2OCYC 4TRMA 3HL0A 1EK0A 3KPUA 1GYPA 2VIIA 2IV3A 1RXSA 3ZCQA 5IFKA 4DV7B 1H8HD 4ATNA 1ML3A 4LRWA 1MD9A 4U3JA 5KNBD 2EJUA 1VHWA 1AQUA 1JHZA 5ICSA 3A4MA 3I52A 4GMXA 3ZGZA 3AKEA 4KO1S 1SXGA 2QG6A 1LLUA 5L3SA 2O5CA 3OM1A 2E7ZA 1MRZA 2CLSA 2PGOA 3A37A 3L7YA 3OPNA 5E4TA 1UODA 1NXWA 1C3JA 1IXRC 1ZGBA 2C5HA 5DB4A 1PS8A 1NJGA 5EYPB 1MEJA 3KOMA 2XEXA 1NV9A 2WKWA 3KCQA 3KM0A 2E5WA 4O63O 4XYEA 4A3SA 5FBHA 4LDAA 2VUIB 4B4UA 4IDDA 1BFDA 1CB0A 2IPLA 4P0PB 1JAIA 5L3ZA 4Z51A 4XJVA 5EUBA 2HRRA 3UANA 4DAEA 4C1NA 1QAMA 2RHHA 3IHWA 4KVAA 4OHOA 4WT7A 2GCGA 2NYVA 3TM4A 5EIXA 5C31A 3WGJA 3I12A 5ICGA 4XPIB 1ACLA 3NDPA 4IIXA 4MTCA 4X62B 4UUBA 2O2IA 3JQPA 4MZXA 4R2HA 3IA7A 3ED1A 3OUZA 2GDJA 4WK0B 1UKCA 3BD7A 5G0UA 2NO7A 3HY6A 2CE7A 3CGWA 3QVGB 1KO4A 1OV4A 1JHVA 2I8CA 4HZGA 1EGMB 2BKUA 3T1NA 3CH6A 3L8EA 4M1TA 2I65A 1J0EA 4RK1A 3OOSA 4DABA 3CLTD 4ZPXA 1SQ5A 3RTCA 3WRYA 4BKRA 1DKRA 2O2SA 3THWA 3K6SA 1J00A 3EY4A 3H16A 1PJ2A 1QIFA 1V7CA 3V8RA 3TQIA 1H3FA 1WDMA 2A5FA 5L3SB 4FC7A 1BOOA 4EYKA 5D7NA 4R40A 1FFXB 1G8YA 3QUBA 1Y98A 3B7WA 3EZYA 2EW8A 1SD2A 1CS4C 3HWRA 1AZTA 4C7XA 1XTIA 2ZRJA 3OZRA 1VMIA 2NQTA 3WWEA 5JAQA 1V5FA 5CVJA 2G5PA 4MS1B 4TX1A 1CF2O 3GHYA 4KC0A 4OREX 4BO3A 4R68A 1M6NA 5CHYA 1M2KA 5AW1A 1Z28A 2IBTA 1RQNA 2HA3A 4YV1A 4LMRA 1OYVA 2PD3A 2D13A 5EI5A 5FWXA 1J6UA 4F0JA 3PCXA 3R5JA 3BGSA 5E0KB 1B15A 3P2YA 4KIJA 4PXYA 2WINI 4UUMA 4BOYA 1U02A 121PA 3W8NA 2W2LD 2QGZA 1TQ6A 2IFTA 3K8YA 2MYPA 2RG1A 1AXEA 3FPCA 3W5VA 1GZ3A 2X8AA 4CKCA 2YX1A 1T3ZA 3DYVA 1OX5A 4BWGA 3R9XB 1RI3A 1QWOA 3MJHA 1QRTA 2XVYA 3Q5GA 2O59A 1RQ7A 2QT9A 2VPXA 3DMFA 3PD7A 4JEUA 2MCFA 2OAQ1 4YBZA 4JBNA 4UHJA 1YFLA 2ZKIA 2ZVPX 3BZUA 3G8DA 4G8BA 3T99A 1EIWA 3LHSA 4ZEMA 4HMOA 1FK8A 1DBQA 3CJTA 4TM7A 2GK3A 3HEBA 4DPMA 3WNDA 1VPVA 2HL6A 3RYFA 5AW8A 4DV2B 4CMGA 3Q8WA 3WX0A 2D0IA 1QGUB 4IIYA 1FS4A 4BO2A 2VYVD 3TPFA 4OSEA 4EUEA 1OGIA 2IU3A 3P2MA 3L82B 4WCFC 2JIMA 1X86B 4IUCS 2EFEB 4WKOA 4WK2B 5DXJA 5ILGA 2I9KA 4MS4B 4D0NA 5C1BA 1YQDA 3FIUA 2G0AA 2XB9A 2Z5LA 1XPRA 2EZTA 4MUNA 1XZNA 1P1FA 3U4IA 1EQUA 2GA9A 2A9FA 2ERYA 4PIMA 3PXGA 3ND9A 4AP6A 1WXWA 2YR0A 1JNXX 4AQ7A 5B1EA 1G5RA 1TM2A 3R8FA 4XFJA 1Y82A 2OD2A 1W581 2CVPA 1GN8A 4QOGA 4RCVA 4E09A 3SWWA 3PLAE 2ZUDA 4C5CA 3MUNA 1TKBA 4LCEA 2IH5A 4ABTA 3DPUA 1CETA 5JFTA 1KERA 1LWOA 4RA6B 4F56A 5FTLA 3CMMA 1E7SA 1Y7PA 3H8WA 4HG2A 5H16A 4QQRA 1T2DA 1E2QA 5KS2A 1CUXA 4NNOA 5KVAA 4BBJA 1U99A 1HETA 4OHVA 3RC7A 2CFSA 4PTYA 1DOHA 3C5HA 1MN6A 1U2DC 4EKEA 2P67A 4ND3A 4HX5A 3O6VA 3OZBA 3BFXA 4KQJA 2WF9A 1DXYA 3K72B 3L8MA 3SJAA 1ZR4A 2UZ3A 1F6WA 2BFPA 1ZXBA 1W19A 4Z1MA 4N6GA 4MP6A 4IV5A 4YJDA 1HDCA 1LPMA 3ZGLA 2ENWA 3FZGA 3IELA 4IMIB 4RC9A 4YS6A 2PFSA 4AUKA 1RC0A 1S2IA 2O3SA 1E0KA 3O9ZA 1Y3HA 4F12A 2FW7A 5IN4A 1CDDA 5LQCA 2NW6A 3A1DA 3PFBA 4GYJA 4YR7A 4HDOB 5GGYA 3MM4A 2EARA 1L5HB 2H5IA 2YNMD 2NXEA 3W2GA 4ZI2A 2RB4A 4POAA 4PVDA 3IQXA 4AMZA 2IP1A 3BF7A 1ARZA 3QVTA 3I1IA 3NASA 1SUEA 2MSNA 4NBTA 4WRRA 4Z8YA 5I4CA 3ODPA 1IG0A 1VKOA 3B9PA 2JJ8A 4IGEA 4N5NA 2ZJ4A 3MCAA 4Y2GA 5H8WA 4P81A 1SJ9A 1V3VA 3EFOA 3GUZA 4RHFA 4CQLA 4QDKA 4XWKA 2L82A 4Z1MD 1XROA 2Y76A 3ETGA 3PE4A 4B1FA 2Q3JA 3HB5X 1DWPA 1XU9A 2ZB8A 2D59A 1O97D 3EIFA 3RVRA 3SJZA 4XYLA 1UFOA 3TXAA 1XL1A 4NBSA 4V2UA 3KT6A 4KYIB 5JCXA 1FXSA 1PNOA 5IJ9A 2LKCA 3MS4A 5FOSA 3ZE6A 1I7QB 4I3FA 2EKPA 3HDVA 4GPBA 4PG4A 3IP8A 4X85A 1N9ZA 2R96A 5KYUA 2J5RA 4E5VA 4FJ2A 1FYFA 4L22A 4JXXA 5AJVB 1E7WA 3VR2A 5AVVA 5KPJA 4U4AA 1JEAA 4AG6A 4N7BA 2PS1A 1VXOA 3DWFA 5ELLA 3Q3GE 1IN8A 2VDRB 3KSMA 1NYLA 5LXTF 3SYTA 5BWLA 1PLKA 5HJ7A 5I01A 5LOVF 3UXHA 1MO4A 3IVGA 4LV5B 4MKIA 3LT0A 1CUJA 3Q1KA 4B31A 4CLRB 2VYQA 3AU9A 5DGXA 2K2WA 2QZ4A 3B1XA 4A0QA 5EJFA 2CFTA 1NY5A 4CKWA 2DJIA 2Q4OA 1SXJC 4S0ZA 1E3TA 3I01M 4NG5A 4DCPA 3F97A 2IX9A 3OTHA 1JVNA 2AJDA 1RKQA 2HPZA 4KYVA 5D1HA 3UMGA 2BI8A 2RDMA 3T0IA 1U28C 1PUIA 2OSVA 3HKEA 3QBVA 2C54A 4XVHA 5IJ0A 1GTL1 1ZP6A 2G28A 2PL5A 1LBIA 3BJIC 3JQFA 2R7MA 3PBKA 4G63A 4GVPA 4BV8A 2ZJ5A 3IQGX 4D3YA 1ZESA 4UE6A 1YQQA 2ID8A 4RCZA 2P4QA 1KRXA 3VR2D 3AY3A 2HJHA 1H5QA 1JV2B 2QUJA 1Z2DA 2XE8A 3MTEA 4ICIA 6LDHA 3P96A 2EWVA 2XA9A 3COZA 2FSGA 2D2IA 3NIGB 1YQTA 4RPJA 1A77A 1U4SA 2L42A 3VHXB 4A0HA 1IY1A 1U04A 3A9UA 3GLFB 1HDZA 2ZR7A 5DI9A 1EK5A 2ACVA 2BM0A 4I4TB 4TV8F 2JVJA 4QQKA 4D98A 3RS7A 4ZJYA 3H9BA 4KPYA 3KAQA 1JIQA 2I7DA 2OE2A 3DLAA 3HKBB 4X45A 4ZQBA 3NVMB 4DLWA 3IKTA 1PX0A 1BG6A 2AK2A 3BE6A 3GRCA 2FQ1A 1V16A 2FRDC 4FYMA 4GUDA 4PGAA 1T29A 3ANXA 2BEVB 2GZDA 5TT1A 3UXEA 2MSDB 1JEQA 1QVRA 2C9CA 2PLRA 2H2FA 1KQOA 3KQMA 5EJ4A 3W6UA 1QBGA 3X2EA 4CKYA 4AB1A 4UM9B 2C7PA 2OENG 1G5FA 4BNWA 2B4KA 1XTSA 1UXGA 2V7WA 4A9AA 2DPMA 4F6RA 1WUTA 5DW3A 3DO8A 2F9MA 1GSIA 5FA5A 3VVMA 3P20A 1KDYA 5LP1A 3VNVA 3WDLA 3L1HA 4MRRA 4P6VF 5CX1B 3PUXA 2OBNA 4AP9A 3IPRA 4NVRA 1R50A 3JCZA 2OZPA 4PYIA 2J6CA 4NU0A 5UKDA 3ZI7A 4O6VA 3NETA 4MB0A 3AUJB 4P5EA 5JQGA 4I8DA 3EFOB 3OESA 1RC1A 1U7DA 2G06A 2J9XB 2OV2A 2ZULA 4JJ6A 3W8FA 2PUCA 2YYYA 4DWWA 2XVZA 4HNGA 2GHRA 4QFMA 5AVKA 4LJ8A 2W6ID 4PLCA 2QT1A 3ZOKA 4U5XA 5HF5A 2IUEA 2PBRA 2QMYA 2QXUA 3H8VA 3D31A 3L6CA 4IXWA 1XLWA 1P2BA 1ZYUA 4AJJA 2OCBA 4BMVA 3MN1A 1WNTA 3EVZA 2IYAA 3ISVA 1C7QA 4LWOA 1VYHA 4L6IA 3I2HA 2J4DA 4C0BA 5JZSA 2O8DA 4V0SA 1F4PA 4BBZA 3HJAA 2EG9A 2WNSA 3LYAA 3JU3A 2FX3A 5JISA 3C6BA 3V4LA 5ECGC 2UDPA 1YHNA 2PQMA 3GG9A 1PR3A 3MINB 2YHIB 1HK7A 1OLUA 2VT3A 4CMHA 9MHTA 2JI9A 1NQOA 3OQPA 4LZWA 4OHMA 4TQ9A 3OJEA 4RQBA 1KDZA 4L76A 2V7TA 2FW9A 5T8KC 2QNIA 2BGRA 5CLHA 1XFDA 1RPZA 3LT1A 1P7VA 3PXXA 3GL9A 2NUTA 4CT5A 3AETA 3DZKA 2UZ1B 3FVTA 5EWLB 3ITDA 2AA3A 4O08A 3RRFA 1HDIA 1V8ZA 2MYUA 2VPQA 1PV1A 1Z45A 2WWVD 4J49A 3ORSA 1L2TA 2FSUA 2QD2A 3P9YA 1QV6A 1TTHA 3MPOA 2V6MA 1LF5A 3K5IA 4CTJA 3GLGE 2NAPA 1XA3A 3GGGA 4H3HB 5FUYA 2FKAA 3U49A 1EWTA 3WIDA 4DUGD 1PWYE 5KQGA 2DX7A 2H1RA 2RAPA 2H85A 4E21A 5KYXB 1CB7A 3WL3A 4FTWA 2BMJA 3B78A 5DT2A 4ALLA 1ENZA 2PN1A 1KK0A 4BNVA 1IM5A 3D4IA 4G4SO 2NP6A 4ZDIA 4I55B 3DXXA 1FLAA 2HTEA 4DWOA 4KR3A 3TBHA 1XEXA 4YJ2B 5TF4A 4I55F 3BWVA 1DTWA 2AZTA 2NSDA 2XR1A 5L3QB 3OIFA 3GRAA 4E4TA 2XHEA 3EGXB 5ERYA 5LA6A 4I5FA 3OA0A 4E7OA 2LV8A 3D5QA 2VNKA 2XNDA 2LCIA 3VR3A 4PLYA 4FFMA 1K4YA 2PWYA 2WAMA 4IFTA 4RKFA 5HFAA 3UKJA 2JFUA 4A5SA 4WBNF 1J8FA 2WU3A 3RJ9A 4B2PA 5B3AA 4I50A 4KQCA 4P4NA 1UZLA 2FWRA 3IQDB 3SICE 3WRVA 3HZRA 1GXSA 3QTLA 1V1JA 4FGLA 1MRSA 3QX3A 4B6JA 2FAXA 1GZ7A 5JNTA 1L4NA 4ZXPA 4G4GA 4CMEC 1PNRA 2ZYTX 1YO6A 2P2CA 3D0OA 3M6IA 1PVDA 1GZUA 4QDOA 4ZQHA 5U9CA 5FOTA 2DFPA 3M4NA 1JPUA 1Q7BA 2NOAA 2QVCA 3BXFA 1QBKC 5IX8A 1TTPB 2QJFA 1VPWA 4P54A 4A92A 4IDGA 5TIIA 4M22A 4MEJA 4BU1A 4Q7QA 3OUTA 4CM8B 3CSDA 4ZJUA 2IEZA 2BGIA 5IU6A 5KVSA 1D1QA 4JU9A 1I4EB 4K9KA 1TGYA 1VQ1A 4CMIB 1PAUA 3LLMA 3CWQA 1KYZA 1X80B 3PUVA 1WVGA 2Q6TA 4G4IA 5IVPA 4FZ3A 1ULZA 4Y6PA 4FBMA 4U63A 2G9NA 2PUBA 2REQB 3J7TA 4AWXA 1XD8A 5FWDA 4WESB 4QWWA 3TW8B 1UPBA 3BXEA 3LUBA 5LP6C 4AZWA 2X9NA 2O0HA 2ZJ6A 1K8QA 2IPAB 2VDKB 3QY0A 5DX1A 4EFKA 1R6UA 2G1JA 1H23A 1EE2A 1KR5A 3I4CA 4PIPA 4CM6A 5EIHA 1TM4E 3CUYA 1I32A 4MV8A 1G8JA 7ADHA 5T7BA 2AEFA 2IY7A 1BJTA 1U4NA 5FL3A 3RLFA 1TF5A 2A3RA 1J8QA 2QM3A 3R5HA 5AQ1A 3ZK9A 5DVZA 2AOUA 3GLIE 2R68A 4F3CA 3MOSA 3T5TA 1T1EA 3L3BA 3PWKA 4DNOA 2XHZA 4PSVA 2VJNA 2ZSAA 5EJMA 1HUQA 3HG7A 3PQ7A 2CCJA 5ALQA 3ESDA 4GZLA 5F64A 2NV2B 5ALOA 2NTJA 3KJNA 4PRYA 2NVUA 1KMMA 5I5GA 4HLNA 4JLKA 2OEPA 2W42A 2A14A 4Z3OA 1OBFO 2BAGA 2OB2A 3GLQA 3RUCA 5HHTA 4ROSA 3WISA 1TQ8A 1WZCA 2R5FA 4X64B 3A4IA 4XOUA 4HNVA 4O2LA 1NFRA 4F4FA 3V8VA 3CIOA 2XAUA 2BELA 1FVFA 4EG8A 5AW3A 821PA 1X7ZA 1DBSA 1ABFA 2QJRA 4RD3A 4YC7A 4LVOA 1JTFA 3W05A 5JHGB 3U4MA 4G9BA 3DC2A 1FP4A 3OBBA 1NVVQ 3W5JA 4ZCSA 5ECYA 4MYSA 3VQTA 4IIJB 5AOBA 3NHUA 4WZAA 1ZI6A 3E3NA 3P9RA 4HPWA 4LSZA 1FMTA 4M89A 4BVKA 2HKIA 1XEXB 2XOXA 1DAPA 2CMHA 4IDCA 4ND2A 4KQKA 1TUBB 3U44B 1CQIB 1G7TA 2Q1YA 2QRUA 3BN3A 4AURA 1RWBA 2JGEA 3RU7A 5DGDA 5JOQA 3DVQX 3LIPA 5JZMA 2O4CA 1K92A 4H17A 1YBMA 1YJAA 4Z99A 2AZXA 2JFPA 3ZJ4A 2PZKA 1RT9A 2A5GA 2WFZA 3BMNB 3STYA 4AJOA 1G291 3FCOA 2XKAA 5ALWA 4QVGA 5F51A 4DJFC 3K2EA 4O3FA 2VXYA 5JJCA 2I29A 1GTG1 4IL5A 1TA0A 1K7SN 5BSUA 3EXEA 1NLFA 1OZ0A 3G8CA 1U90A 1WTCA 2I4NA 4WL0A 4D92A 1QX4A 1GGJA 4JJ8A 3L41A 3R0ZA 3A3KA 5EZQA 5EKSA 1IUPA 1QO0A 4MQ5A 4BMCA 4C07A 4EHDA 2EATA 3EIEA 4W5TA 4F8YA 1Q50A 2VPZA 2Q8QA 3PF8A 4HVAA 2ISCA 5K9ZA 1OH8A 4UUAA 4V1CA 1H4VB 2V65A 2W6OA 2XB8A 4MI1A 3TE7A 4IRXA 4F4CA 2HA4A 1IPEA 3V5NA 3UBTA 2I55A 1PQWA 2QAGB 2HLHA 1QU2A 3PD1A 4KXUA 5K6AC 5DNYB 1E2BA 3OF5A 1W52X 2F1RA 1NUSA 2PA3A 1MB4A 3KZNA 1LQTA 4HOYA 3ZHYA 3OZEA 4DCSA 4K88A 1P7CA 1Q7RA 3C70A 1EFUA 2OO5A 3QG1A 2BTQB 1VCHA 3AQ4A 5DHTA 5BR8B 3VR5D 1PUJA 2RGWA 4HGQA 5CFPA 2Y99A 1ORIA 1O6BA 1GG8A 5JNVA 3WL7A 1RVDA 5D01A 4BKMA 1EJ6A 2Z2YA 4RVHA 3X1ZA 1SU7A 3CV3A 4B8YA 4IYRA 3Q2OA 1GT6A 2PFGA 3A1TA 1CCWA 4EVSA 3A6PC 2GJAA 2AW5A 4QEKA 3PS9A 3O93A 1Q0HA 3PYLA 3LRTA 2WJIA 3TR6A 1KJ9A 2HI0A 3GX1A 2NTEA 4B74A 3R3HA 2CC2A 3OC6A 4XTCS 1AKWA 1CEXA 3R40A 4LHWA 1XFAA 3GPIA 5HILA 1KHHA 1XRMA 1U0LA 1J9EA 3LZCA 2I71A 3PQ2A 4FFDA 5AUNB 2C5EA 2FUCA 4MCAA 3WYAA 1KH1A 1CQZA 1LLCA 3O1HB 2PZAA 4NBVA 3BEDA 2VP5A 3NOQA 3R1IA 4HB0A 4Y2UA 5F4ZA 5B57C 2I2CA