1XAIA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
352
structure length
352
Chain Sequence
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDDILSYENVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDMITDLDFETLYQYMLSDKKNDKQGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
molecule keywords 3-dehydroquinate synthase
total genus 116
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xaiA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xaiA01
5BR4A 2GRUA 3OKFA 1XAJA 3QBEA 1NVBA 1VLJA 3IV7A 1NUAA 1NVAA 3OX4A 4RGQA 2BI4A 1DQSA 1NVFA 4FR2A 1JQAA 4QGSA 1O2DA 5EKSA 3ZDRA 3CE9A 3ZOKA 1VHDA 3JZDA 2D2XA 3QBDA 2BL4A 1RRMA 1XAGA 3W5SA 1JPUA 1NR5A 3BFJA 5FB3A 1SG6A 1NVDA 5K8CA 3CLHA 1XAIA 1KQ3A 3OWOA 4P53A 3UHJA 1NVEA 1OJ7A 4RFLA 3RF7A 1JQ5A 1XALA 1NRXA 1UJNA 3HL0A 5HVNA 1TA9A 1XAHA 4RGVA 4MCAA
chains in the Genus database with same CATH superfamily
4JSTA 1DRUA 3HJNA 4AUMA 5GTDA 3AINA 5C8YB 4F92B 1I5OA 3AUSA 2PV7A 2QF7A 1SVKA 2D1TA 1YT5A 3PQ4A 1V0JA 4IH9A 3PPIA 3PQDA 1HM5A 4KQCA 4NCKA 1RHQA 2VP0A 3D7MA 3ZD6A 3D7RA 4UDYX 1D2CA 4JWKA 3TOCA 1O2DA 1V7PC 1GCUA 1KH1A 3SDZA 4DCNA 3E48A 1N0HA 4FI3C 5KVQA 2QMEA 2V6MA 3QMVA 1XDBA 1YZQA 3QHQA 5AESA 2AMYA 4Z4FA 3BAZA 4FYYA 3VHLB 3TEJA 3OJLA 4Z9XA 4N3NA 2PUGA 1EBBA 1WNTA 4AKEA 3CLVA 2JDID 4BE7B 4WW0A 5IMSA 1O3YA 4EY6A 3AHGA 1NTOA 2YXPX 2JLSA 1VFNA 1XHLA 3DA8A 4GYJA 4B3CA 1K4MA 4RACA 1QTNA 2C3YA 1BS9A 2PR7A 3F9CA 4DLBA 3UK1A 2ZFUA 3R3VA 2FMUA 1TZBA 1Y80A 5AM5A 2QDXA 4YXWD 3TZ6A 2VAVA 4LK2A 1XBTA 4DLNA 5FBQB 4Y1GA 3ZVKA 1UXJA 4IZHA 4X24A 4WLEA 3RIYA 2LZ0A 5DCUA 1CUBA 1XAIA 3THXB 3GCWA 3N05A 4E07A 2JATA 3BTVA 5IKXA 1QGED 4B6RA 2P68A 3WA6A 3WQBA 3EIFA 4DR6B 5CW1A 2PKWA 1XQ1A 3WL3A 5JHGB 1NUPA 1OWPA 3LUPA 4ETWA 1AHHA 2ZYGA 1IY9A 4YR9A 1GNSA 2X0FA 1WCWA 1OVGA 2DWPA 2PGAA 1PAUA 3D9QX 1GYQA 3FTDA 3Q0IA 3L5KA 3ER8A 2FWIA 4Q9HA 4BO8A 2AW5A 3DWGA 1E9AA 4MWZA 2AK2A 2D5CA 1N2XA 2VF8A 2IT1A 2XCQA 4BQIA 2F1IA 1Q3KA 1KSFX 4OFWA 4ZVOA 4RKRA 3WKEA 4YPVA 4A1FA 3I09A 1N1EA 2L2QA 4PBTA 3L0PA 4KMMA 10MHA 1FQWA 2GGSA 3L01A 3R3SA 4MPPA 2C7GA 1E98A 4PG6A 4YGXB 2B1IA 3VBEA 13PKA 1N34B 3AI2A 3P2EA 1F12A 3CG4A 4P3OA 1TECE 1YR2A 3VR3A 1ESZA 4CL8A 2GK3A 1EFKA 1N75A 2JRCA 4BMVA 2PWAA 3UOGA 1DHTA 1F1JA 3CW8X 3HDGA 5EHIA 4UE2A 1BE6A 2BFFA 3ND9A 1I4LD 4TMKA 5LP6B 3I5UA 4DCVA 2C92A 1FXWF 3SEFA 3E7WA 4D1YA 2V4ZA 1SCNE 3G6KA 2RBKA 3DLTA 4TS1A 1QBGA 2YRWA 4DSUA 3ZJYA 4MDEA 1CC1S 2Q3DA 2JHCA 2R1VA 3I2FA 3GQBA 1SXHA 1KQNA 2O8DA 1AKWA 1SQ0A 1VKRA 1GPUA 1AUPA 2CFCA 4AQYB 2X77A 5JXHA 1LPOA 2X6QA 4U2FA 3WGNA 3GLIA 3L3BA 1XDZA 2FZCA 3AF2A 4LJYA 1ML3A 2GLUA 2AJLI 2JAPA 3ZK8A 1M6WA 5C81A 1BQEA 1KDPA 2YJGA 4EGSA 4MUNA 1H2EA 4HWRA 1OA1A 3UXYA 4EL5A 3W6ZA 5U4XA 3DZJA 1DGQA 1U0NA 4A0QA 1NUSA 2P78A 3ZLTA 4N0EA 3ESCA 5SY4A 4I3HA 2WDPA 3R24A 2NUTA 2I4TA 5AW6A 2C5LA 3Q6IA 4JLUA 4RSMA 1WDTA 3GZTB 1WPGA 4YJ2B 1XB2A 2VHTA 4AT1A 2V0GA 3DS8A 4Y6LA 3M81A 2XUZA 1FDVA 4Q1AA 1SUAA 1YUBA 1XEWY 4LC1A 5AI9A 4E5PA 1IZ8A 2ZBUA 5E2IA 2XMGA 3WXMA 1TVCA 4F7WA 3ZDBA 1Z33A 5KIAA 4LXTA 1T2EA 3PEEA 1EGHA 1Y1KE 4TS9A 3G9TA 2FUEA 3C16C 4IGEA 3FTQA 4HR7A 1ZXLA 3CHYA 3VZDA 5IM4F 1J99A 4UE3S 5KTYA 5JZSA 4QDKA 1Z8HA 5JH7F 2MOKA 1FQOA 5ESWA 5GPBA 1ZDMA 2OCLA 3SQNA 3L1UA 3ZLVA 3HR4A 1HE3A 1KJQA 3WX0A 1WMAA 3F6RA 1QYIA 3RFXA 1LSSA 3FHTA 1QG0A 2CB9A 3NT5A 4RJ2A 1VBNA 3GLHB 2CZCA 1BS1A 1BWSA 2EATA 1GL6A 2R8BA 3AGQA 5FJIA 1J39A 1Z4IA 5DI3A 2XR1A 4CKEB 2VDJA 3LXMA 4HQ6A 1NBAA 2R3SA 2C4HA 1LX7A 2P2CA 4EMSA 3IMKA 1ZU4A 1IN6A 1SHUX 2R6HA 1X1DA 4LQLA 2C4NA 3ESRA 1NN0A 2H51A 1E1QA 4MR8A 4NP6A 4PZDA 5KTKA 4CGZA 1GRCA 4G3XA 3NLLA 3GJ3A 3L7IA 4MRNA 4J7CA 3A6PC 4B9EA 4V02A 3P8ZA 1TK9A 1WVMA 5DTRA 3CEJA 3TD9A 1TJ4A 3RHFA 3IT1A 1BNCA 2XUKA 1U90A 4GM4A 3WLEA 1ESCA 1PD0A 3IAEA 2RC6A 1EUCB 3QVWA 5F9HA 2IX9A 2WZDA 2GFHA 4HSGA 3TTVA 3NHSA 3LUFA 3DCNA 1MJGM 3E1SA 3GO4A 4ZEXA 3GRKA 3BHJA 3AV3A 5ALJA 2ZTUA 3UCXA 1HRKA 3LLCA 4KE8A 1SCJA 4D9BA 3EEQA 1RNLA 3IUPA 4D79A 2NV6A 1V37A 2X8WA 5BOSB 1EM6A 1K0UA 1A9YA 3FM9A 3OM0A 4K9NA 4RHEA 2H2WA 1MR3F 4B87A 3TKLA 3H2HA 3T7RA 1Y3BE 1CY6A 4BASA 4FR0A 2O06A 2ZJ2A 2A5GA 3KETA 3WGMA 2Z8XA 4DNXA 5C18A 2I7TA 1F3LA 4FFMA 4KR7A 1E63A 3T3MB 4QKQA 2OHFA 4OVKA 3B1JA 3DEZA 3C5WP 3BCSA 1SG9A 1E94E 2VDQB 5D01A 5BUZA 5HIIA 4G5OA 4WACA 4V2UA 5L3VA 1YRYE 2JIRA 2G4CA 3A6ZA 2I2FA 4I55A 4LVNA 3ZYCA 1DQPA 4C1BA 3LC7O 3P52A 4BFVA 4W5OA 1RI5A 1G6OA 3L8FA 3FOCA 4RETA 3CZPA 1E3WA 5FD8A 4R8LA 2JFUA 4HAZA 4CUKA 2ODTX 3HXTA 3ROTA 1TNDA 3IYLW 5KVCA 2L17A 2QRLA 3V34A 2AWNA 1V16A 2SHKA 4BPBA 1UMBB 1MO3A 2C2WA 1QP7A 4JR1A 1ZL0A 4IIYA 2HSJA 1PYOA 4HNAA 4L57A 3LC2O 4UHHA 2FDXA 1NE2A 5EE0A 4KL8S 4FYKA 3E18A 2FRDA 4QPCA 4M99A 2Q0QA 2W8ZA 2HIMA 2YC2C 3CW9A 1C30A 2EEPA 1TW2A 2YL2A 2WMDA 4GPZA 4OH7A 5JBIA 4NULA 1L3CA 1O58A 3MZ0A 2RGBA 3OPMA 4Q1FA 4XSVA 3O4FA 1YU6A 1X7YB 4I08A 4BVGA 1DWOA 2VDLB 5JNWA 5K0GA 1TZCA 5BUQA 2GH1A 2HZ7A 2O0JA 4F6LA 2WHQA 4N9QA 2FGKA 3X1MA 3VX4A 1UMCB 2JI8A 3KTAA 1Y8QA 2KSQA 1RJ9A 2Z3ZA 3BXOA 4QXMA 5C7LO 8OHMA 5GM2A 2EJTA 4YP5A 5LC1A 1NJ8A 3F5DA 2ZT6A 3F96A 4DQUA 5I51A 5DBIA 5JCJA 5IUNC 3KWFA 4QOGA 3NKFA 1ITZA 1F60A 1JR2A 5CVDA 4ZC1A 2XCRB 4OYRA 4X7BA 5C53B 1IOWA 4MJ7A 4KH1A 3GJYA 3P0IA 5D3KA 1NVXQ 2ZRHA 3D8TA 3OTHA 4LF9B 2FN9A 2OV1A 4KLAA 3MYYA 3WO1A 3OTIA 2Z6VA 3FOEC 3NOVA 2WJZB 1BROA 1XF9A 3JQ6A 1YS6A 3PNLA 4IJUA 2IZ7A 3OEHA 1LXCA 3PITA 2X0RA 1I51A 3UH1A 2NQ2C 5FNVB 1BFDA 1TU4A 1NONA 2QP4A 4I5EA 4M1TA 4X63A 3TAHA 3DVAA 2FEOA 3PXXA 4IGIA 4KQKA 4Q39A 1AG9A 5J58A 3K1AA 2OV2A 5IT5A 4I9HA 5B64A 3CW2A 4PAOA 2OFWA 2ZPAA 3ADOA 3I1IA 1N5OX 4BO6A 4MZDA 4HCJA 4L8WB 2J33A 5EKXA 2M1ZA 3DDSA 2X0EA 5IHPA 2CCKA 1ORWA 1NVVR 1B3RA 3WLJA 1TGVA 4MRRA 5DH9A 3HBNA 1NW6A 2P6PA 2B5OA 3O4HA 2QR2A 4LTMA 2P9EA 4QUHA 2NXJA 5CT6A 4J49A 1L4KA 3KHTA 3VOAA 5K0JA 1XCMA 1D1QA 1DT3A 1PYGA 1Y98A 2FFHA 1KDOA 2FETA 2Q4TA 3EE6A 3IIJA 3U7QA 1GGJA 3SJZA 4ALIA 3BTOA 5LKRA 3DP9A 1CP2A 1XMXA 5LQMA 1HT2E 3QWAA 2ECQA 1XCPA 3K7EA 1SHJA 4M6WB 3RFUA 4EH1A 3PWSA 4H31A 1KQOA 4F38A 1DDGA 1USGA 2AK3A 3RJMA 4Q4HA 5DCYA 4GGOA 4MKIA 1VBKA 5J40A 2CUKA 2Z9CA 3PHJA 5SYNA 3IRVA 1JILA 4CDGA 1U3GA 3D8HA 1XLVA 1ACLA 3AKEA 1FFSA 2XMPA 1WA5A 2IE8A 2XYQA 3L49A 3ZWBA 4B7CA 4BGEA 4EAAA 1IBLB 3JYHA 1E3LA 1ONPA 1YCGA 2X22A 1RFGE 2DLNA 4G8JA 2I33A 3T5MA 3T7JA 1FRVA 1GPKA 1OFUX 2XUFA 3UYLA 4R71A 3T34A 5KTRA 4B8WA 2JLRA 3HBJA 2B2NA 4JKOA 4XEHA 2PT5A 2QT9A 4Z86A 2VTBA 1FJXA 1VJGA 2AE1A 1IJKA 1ZNZA 1EBFA 3A9WA 3THXA 1COWA 1IAQA 5AK4A 1KE2A 4G67A 5I7FA 4QAJA 5CA1F 2ZQ5A 1SY7A 2GM3A 5EJ6A 1XZGA 4XOIA 3GX1A 1PEAA 3OHSX 4KN9S 2QENA 1FYXA 1S2NA 1F2TA 5CVVA 4D8UA 5BMVA 5KJFA 2XQGA 3NTOA 2JGDA 4HWGA 1QDUA 4NBUA 5K8JB 2WY2D 4FD2A 2R79A 1I7SB 2ZVQX 4OJKA 2O5CA 3RQIA 4YYZA 2OZKA 4URWR 5AW1A 2WE8A 4L95C 3IR6A 1DVRA 3NC0C 4IHQA 3MWDA 3H9CA 2OILA 2Y1XA 1JXMA 1JQKA 3FPLA 1P60A 4EKYA 1AXEA 3VTZA 2ID9A 4KPGA 4XWGA 3HB7A 1T9ZA 2QMHA 3RYCA 1MKYA 3MQ4A 2B1JA 5SZKB 1JRLA 3N8NA 1I3MA 2GZHA 2ZSHA 4FHDA 1ECLA 5F1OA 5GQSA 4C2UA 1OYYA 2FGJA 4TWIA 1UOEA 4E3WA 3HU1A 2BISA 3IJ5A 4QBTA 1VE3A 3AO0B 4QXOA 5HDBB 3ROZA 5KNDD 1Y1PA 4LTDA 1BQ4A 1S01A 5HZMA 3DF7A 4RF4A 4O4IF 3A1VA 5CLGA 1NUAA 1OBFO 1QTRA 2CCGA 1XK7A 2CXUA 2OHOA 1SVOA 3UCEA 4CR8A 4O2BB 3FPEA 1FYEA 2FW0A 3CUYA 3F4LA 4OUKX 2OK7A 1E6WA 3QEKA 1JAXA 4L8LA 1OHHA 1ZIDA 4RYDA 5ITZA 3IOMA 4YP0A 3MRSA 2J4CA 4B80A 2ID7A 4P9NA 1YL7A 3ONFA 3THWA 2IUYA 1XA3A 2QSJA 3FRHA 2M1XA 4JYMA 4JVLA 3TVYA 2QS9A 3E58A 1RE0A 2G77B 3EH2A 3IR7A 1NW3A 2C4KA 3L8HA 3ROEA 2GZ3A 1UXOA 3RODA 4ZI7B 3A9RA 3CRRA 3P9CA 1CUEA 1CDEA 3FZYA 3A4TA 2H4XA 3GLIB 4JGIA 2W2XA 3QUSA 2YJTD 1PK8A 3TIXB 4UXHA 1HNXB 3ZUGA 3TZLA 2BGGA 4EZEA 3WHIA 2C7PA 3OZCA 3THYA 1ZCJA 4E5KA 3VU1A 3GLRA 2OSBA 4KXNA 1V2GA 1DAFA 3MM4A 4NV1A 1Q0RA 2BOVA 3WLNA 2BFNA 1E7SA 3DPUA 3PNQA 4DHWA 1NXVA 3BERA 2X8AA 1H2WA 1YFKA 1FCJA 1YR1A 1FXUA 2OTCA 4KI0A 3R7LA 3VJLA 4ZYVA 1E89A 1UBCA 1ZI6A 4F72A 4MQFB 4AJ2A 1K7SN 4PFQA 3B6IA 2FPIA 3HKEB 4KNYA 3A1DA 3NEJA 4RLHA 3KTOA 1IM5A 4JD5A 5DK6A 5DTEA 5F2KA 3U37A 3U39A 4HAVA 1D2EA 5B2ZA 4DPLA 1VRCA 3HBLA 5BWLA 3T3OA 2A0KA 1R10A 2PGNA 2NPFA 2BFCA 4HZIA 4AS2A 1RI4A 3LBIA 1W36B 5IJ0B 1TOAA 1MP0A 3FUUA 2XVMA 3PNMA 3NX4A 2WM2A 1KGSA 1U3FA 4BTLA 4MUAA 4YX9A 4EHJA 2PS9A 1VA5A 1WMBA 4MR9A 1WBDA 4DANA 1ZJZA 1XZLA 4MSUA 5REQB 4OLAA 2X6TA 3KQMA 4FQ7A 2EFDB 1WZEA 2H18A 3EFEA 2VPQA 3F7TA 3QUBA 5LZ8A 5J47A 4LJ8A 4EJSA 2XQJA 4PAQA 1ZCZA 3C6YA 1EE1A 1XV5A 3F5FA 1RWKA 1ORIA 3UHJA 1WXWA 3BIJA 4RJLA 3STTA 1CRPA 2C97A 2MJLA 1L6IA 3MGAA 2WG1A 3BB4A 3IDFA 4QFCA 3LTEA 2XYRA 1B0UA 3H18A 2Z58A 3MS2A 4L5CA 3N0WA 4WFKA 2BONA 4OFXA 2VVTA 1GPDG 3PTLA 1JSXA 4RPCA 1VIMA 4YQYA 5I3ZA 3ZGLA 4N8EA 1SKAA 1I32A 4BN5A 1T2DA 2PXXA 4MGZR 1ZUWA 1C7RA 5DYGA 4BFSA 1IN8A 2IY9A 3ISVA 5M29A 4I55B 3AM3A 4F7DA 1AKYA 4QTUB 1FTWA 1UWKA 1JKJB 4GG1A 2YMMA 4YMGA 4JJGA 3OLXA 3I12A 4QEDA 1EVKA 2QPTA 1RVDA 4NZNA 4PZUA 7ABPA 5B3LA 3LDFA 4MPJA 5AW4A 1VYUA 2XZPA 2ZAGA 4RTPA 3H86A 1RXVA 1HDYA 2LE0A 1GL7A 4URXR 3ZWVA 2W2TA 4H59A 4HNAB 1Z16A 4Q3BA 5FL7A 4JXZA 3AVQA 1VE7A 3DMTA 3UIEA 4YHBA 1K5HA 1T0PA 3C7DB 1R4MA 2XNKA 1I30A 4UNSA 1SCUB 2JEZA 5K8IA 1SOVA 1BU8A 3LD9A 2XXAB 5EWLA 2X5OA 1NBHA 3EXFA 2R751 1XDDA 4MVJA 1NR1A 5KTNA 5AW0A 1CEEA 3UMRA 2GF2A 3GA5A 4POAA 3IBYA 3KE8A 3IULA 3OIVA 5DNCA 1FUEA 4B09A 1AQNA 2NZ8A 4A03A 2IYFA 3H99A 1QO0A 2VNAA 4KDEA 1X38A 1NE7A 1GTRA 5CIQA 2P6NA 3AJ8A 5ILQA 4BMNA 3BFXA 3FLMA 3NBYC 4X20B 3RCBA 3PIIA 5C8ZA 2BFMA 1NATA 2GHRA 2HR1A 1E7WA 4JWTA 4MVJD 5A0TA 1POXA 4WLOA 4MI1A 4B4KA 5BR4A 3VGPA 5DYIA 4MGKR 3NYQA 4TL7A 5BQXA 5F64A 5ETJA 3OF5A 4DWVA 5KWSA 1Y9EA 1P7PA 4W9RA 2Q2NA 2E55A 2HHLA 2NZWA 4UAUA 1QRDA 1N9KA 3TEFA 2CFTA 1K8RA 3V9AA 5C2JB 1DO0A 3AERB 3KJQA 4RTKA 1VDMA 3R8CA 3A9UA 1KO8A 1A9RA 1WR8A 3IUYA 3BCHA 3CX3A 1KZ6A 5CLLA 4KQMA 3AM4A 2EP5A 1GL9B 2FEMA 2VJOA 3AJ9A 2OLEA 2QT0A 3ZU3A 1VL0A 3CGWA 1R8YA 3FPCA 5ERXA 2IEAA 3AB7A 1E1CA 3ZHYA 1ADFA 2HA7A 4JYBA 1QR6A 3FPSA 4JLMA 2NZJA 4RY2A 1LNQA 1YRHA 1T4GA 1VE9A 4MZXA 4TLDA 3KV1A 2DFLA 1L4MA 1PSZA 4HC4A 4URUR 4RWEA 1ISGA 3LUHA 3CH6A 3O21A 4CQMB 3GCDA 2RGWA 4BGDA 1DJOA 5DJ5A 2YIDA 2RH9B 4M1WA 3ASZA 4P4SA 3UWPA 3AXSA 4LYHA 5DM2A 4CF6A 1JQBA 4B48A 3SDSA 4E1AA 4F5DA 3EAFA 4NARA 4R1UA 4U0KA 3SZOA 3FNBA 3H1EA 3I9KA 3SCZA 1ZMOA 4MB6A 2PUBA 3OQIB 3N8GA 3NDBB 3AP3A 3U7JA 2P5TB 4DR1B 4B0OA 2BW0A 3EUFA 3LQ4A 3AETB 4K3VA 4JU8A 3MELA 4OU4A 1CB0A 1EM8B 4JH0A 4PO9A 2WSMA 1IDOA 3OQMA 3K8QA 4FFWA 2JGMA 4DDUA 2WM9B 4Z53A 1JVBA 2GJ8A 4LMPA 3W9BA 4W7SA 5KDLA 1C29B 2C00A 3RM3A 2IYZA 1RAGA 5HJ2A 3U26A 2GTHA 5A02A 2UXBB 3GJZA 5EP4A 3PRJA 1ZK2A 2JNWA 3A1FA 3BMOB 1IEVA 2X86A 4FBGA 4GMKA 4ZOLA 4BP8A 4DR5B 5T8KA 3QSYA 4CEIA 2ZDQA 4D82A 2JL1A 3U44B 2JCGA 4L4RA 5C3UA 3LMKA 1ZM4A 1BN6A 3IX7A 4L5YA 3QXCA 1HQKA 4MA4A 3RGGA 4ZHQF 2D00A 5A3QA 4HDRB 1KBZA 3E23A 3H6KA 4UTZA 2GJSA 3EEBA 1TM4E 5IZ4A 4BNDA 2AG1A 2W2OA 3PC3A 5A71A 2QLMA 2UZ3A 3HCPA 1LS1A 1Z2DA 2BGUA 2C3PA 2QN1A 4ZV7A 3AVYA 1HDXA 2MWMA 2PWPA 3VH2A 1JDBC 4ARAA 2P3OA 4DQLA 5IT9A 2R62A 1QE3A 3AEKA 3WBJA 3SR3A 3OZDA 3JWPA 2XUAA 1P7YA 4IEEA 5ICCA 2QUIA 3B6KA 4I1IA 4P58A 2NGRA 2F3UA 1LVUA 1IXRC 3DFKA 3N8KA 1BWPA 4CGYA 2ERCA 4TKVB 1SHZA 3AEXA 3MILA 1XHFA 2BEWA 1J1UA 1L8QA 4L7VA 3EOBI 3CLTD 2OYSA 5I7EA 4E14A 3CLSC 3DBOB 3LT5A 5B6JA 5FOQA 4GPAA 4L4UA 3QTBA 5JNTA 2GN6A 4MICA 2IF0A 1YXMA 1O5IA 3K2QA 1H0RA 5ED4A 1U8XX 4KUEA 4RQTA 5BMVB 3KVOA 1A71A 2VSNA 3KJEA 3KQSA 1KETA 2ZZKA 3O4JA 1OMOA 1PLLA 2GFIA 2BSAA 1RYYA 1AE1A 1Y7LA 3A1CA 3ANYB 1HDCA 3MIZA 4RE6A 4UZEA 3SGLA 3A3KA 3HEBA 1R0LA 1GSOA 2FEKA 4MAFA 3KTDA 3JALA 5CA0B 5FV4A 1DZ3A 2NWQA 3KZOA 1QLHA 1Z2EA 4WOKA 1YO6A 3MK31 4KQJA 3GLUA 3IP8A 3Q40A 2ZJBA 3O9ZA 2QD4A 4FILA 2P65A 4KBGA 4QOJA 1K7YA 1RAFA 4KMSA 2OXTA 2I71A 3EAGA 1NAHA 2A58A 3EC1A 3FBTA 5KZMB 3M1AA 1RWQA 1XPUA 3O8OA 2HLHA 1KEEA 3AVUA 4M9QA 1DEAA 2YH2A 4RHFA 3MTEA 1Y1QA 3HNRA 3OTGA 4DCSA 2GN0A 4K6FA 4IR7A 4Q4HB 4QULA 5TNXA 4YMVA 2OAQ1 1PNOA 4M8LA 5EC8A 5EMLA 3RUEA 4X60A 4OATA 3N53A 2BUBA 1P0MA 2ZS7A 5FHQA 3RT7A 4CLRA 3TOZA 4JOBA 2XCTB 1N1DA 3CKKA 3HVKA 2XNHA 4IX1A 2PN1A 3U31A 1A8QA 2GNAA 1TCUA 4IIEA 3V2UA 3E3OA 2QYHA 4IZ6A 2VHCA 2Z9DA 1QRAA 3AHJA 1YDWA 4I36A 1DE0A 2C59A 1QIDA 4MVWA 3T4XA 3QPUA 4AP9A 4RY9A 3PI7A 3WBFA 5K8LA 1IVSA 4ZI7A 4OHXA 5LNK6 1CQXA 2H1CA 4DLYA 4G4IA 4UJ3A 4XUCA 2PV0A 3DKRA 2RK4A 4TTQA 1AGYA 1CETA 2VNSA 3MTQA 5ULLA 4DIEA 5HCIA 4UU8A 2ENWA 2VJMA 3O7MA 1OILA 4INJA 3IIEA 4GD3Q 3RTAA 3SZLA 1O1YA 3HJUA 3T9FA 5ARBA 3NVMB 4ZEMA 4I8XA 1DAGA 5FT9A 1YB4A 2WFLB 2C4WA 1FUIA 3A10A 2JD1A 1YMUA 2BFBB 3DE7X 1WDWB 2B94A 3N86A 4WNIA 1ZOSA 4ISCA 2FTKE 3ZV6A 1T5HX 2N42A 3KL4A 1I5EA 3M4YA 3PEWA 4R2JA 5CB4B 2VJKA 4DMKA 4C5CA 4GMXA 1SU8A 2OA0A 2F43B 3KEQA 4PX2A 4CFZA 2J5XA 4V0MA 3OQ6A 2QTRA 1D5CA 2V7WA 3G23A 3ZZTA 5AKEA 3HKCA 1TB4A 1RWBA 2XB4A 4AY3A 4XTRA 2FOLA 2VSXA 1YZFA 4L8GA 1SZDA 3ELWA 4M49A 1I01A 1N2GA 3FKJA 3MS4A 4P5PA 5AHWA 3E9EA 4HZUB 4N1AA 3EHDA 4LDAA 4W8OA 1UBFA 3DEYX 3UN1A 3UAZA 5CDFA 4PC6A 3U1TA 1WSWA 5CXQA 4AUNA 5JSQA 4CKCA 3T1NA 1OT3A 3VZPA 4C0SA 1EA7A 1JXOA 5JANA 4X6YA 3WK7A 2I8LA 2NN3C 3N70A 1RQGA 1JFFB 2RFLA 2WT4A 4INZA 5BRNA 3U1VA 1B76A 1BXKA 1K89A 3IOYA 5AKZA 4KPFC 4XCQA 3CSSA 4MCHA 5AVWA 5A6SB 1HNZB 2C9BA 2PD6A 2VHVA 2JS7A 3KJHA 3TLMA 2HNAA 5J2TA 1UKVY 2XB2A 1YCHA 1YNOA 1MOSA 3WNZA 3AU8A 2GEKA 2DZDA 2ZAIA 1MABB 1ZUIA 4FDUA 4RHXA 3WADA 3RKSA 4PZLA 3W06A 1Z15A 1UPCA 2LD4A 4FYWA 2GJKA 3O82A 4JB0A 4I6GA 4NH0A 1N7GA 3TNDA 5CD9A 3JVVA 4XX0A 4FLMA 1CQIA 1V7CA 3NDIA 2G8LA 3QXSA 1BHO1 4GZMA 2XE7A 1N3IA 4KQWA 2XI4A 4RL4A 2NVUB 2YWXA 3HHEA 2AWOA 4Z0PA 2Z43A 2Q4BA 4KO1S 4DNQA 3NVDA 5CDHA 4XXHA 4RFSA 3NWJA 1V7QA 3F78A 4V03A 1LDMA 1Q22A 3LQQA 5HBGA 2FSVA 2I78A 3PP8A 4ZZ2A 2Q5LA 1P73A 3O83A 1QU3A 2TMDA 4JI8B 3ULKA 3UG6A 221PA 2AHOA 5TGZA 4CJXA 3ZDFA 1F8YA 1R3UA 3GUZA 4R9RA 4R68A 2XNJA 4INPA 4BKQA 4S05A 2MSLA 3V33A 4LYAA 3THOA 5HWSA 4BO4A 3VNQA 1CDOA 3FWHA 1P62B 2CUNA 3M6UA 4JXXA 5HRUA 2V5UA 3HY4A 4O4JF 3B5IA 4YUAA 1DBWA 4GO1A 3WL6A 1JIQA 2ROQA 4MEAA 2OENG 3L2OB 4QX6A 3SQDA 3EZFA 3JZDA 3GC6A 1FF9A 1N5MA 3LHFA 3FVTA 4C22A 1UXGA 2NVBA 3T7SA 2A5JA 5LCXA 4EG0A 3DP7A 3IVMA 3A0RB 3RHZA 1ZBDA 1I7QB 2ZPUA 3H2JA 1MB0A 1C1XB 2G5TA 4NZOA 3VVCA 1B93A 3M34A 1C0KA 4ZOBA 4XIYA 4GUDA 4L3OA 4Y98A 1JEDA 4LRTB 2W90A 2PX2A 3EC7A 2HDWA 2NPOA 4ILKA 3DF9A 1KFEB 1P3JA 1V48A 1X1QA 2NXEA 4R9UC 4CIWA 4BRUA 3UBTA 1TTTA 1WXGA 2IS4A 2G36A 2VT6A 3AETA 2RGGA 4KXVA 5E0OA 5KYGA 2NTYC 3E5RA 2HMUA 4Q00A 3GARA 4PHGA 1O94C 3BEOA 3PCRB 1CRWG 4IVRA 4C05A 3OOSA 3L1VA 4JEHA 1VXRA 4X3CA 2NU6B 1VE6A 3EARA 1C3OB 5BSWA 1QUFA 4DQVA 5LQCA 2NU8A 2Q3HA 1XLWA 2I2CA 1KJIA 2OESA 2YY6A 1QQ6A 3OZTA 4QQNA 1DS6A 4L7QA 4EY4A 4OB8A 3GFTA 4BKPA 1YE5A 2Q9AA 2OGWA 1WVIA 5KYYA 4NSNA 3ZE9A 4YB8A 3WXBA 2AKAB 3DCJA 4FMCF 4LKOA 4S35A 1VJRA 2GAIA 2AC4A 2H1IA 2R86A 3OFSA 4M88A 4R0VA 3LYLA 4YI3A 4IDOA 1JG4A 1I10A 5K3FB 5BN3A 3X43A 5JRDS 3PLAE 4H17A 1XDSA 3C4JA 3LPNA 1CY7A 3OOWA 1MEEA 4LXHA 5DIZA 1G55A 4DCTA 3DNPA 1J42A 4RKEA 4EHAA 2ZIUB 2C7RA 4DAEA 4XE5A 5JBNA 4YCNA 3D7KA 3IAS1 3MG9A 2XKJE 2HA3A 3TB4A 2QN8A 2AN5A 1J8MF 2YINC 2HMAA 5JMTA 3NHPA 1IY1A 1WLYA 3WK4A 1GJRA 4GWKA 3ZH9B 3ZWWA 3AW8A 3B1ZA 1XE3A 3AZOA 3MSXA 1L7DA 4R1QA 4REOA 3TXAA 5HF9A 3WOVA 2HCBA 4D56A 3RC2A 4DMLA 2RI6A 2FCAA 2D7JA 4IKOA 4DLTA 4FS3A 4XD7A 2RBGA 4EW3A 3GXOA 2IUUA 2ZKIA 3D3WB 2IEBA 5DIFA 3S2FA 2O23A 1ZJJA 1YASA 3MFQA 2FZ4A 4JUCA 3TRFA 1CJUC 5DTIA 3WMEA 2AXNA 1FU8A 3KYDB 2XT6A 4EEKA 1AX9A 2H0RA 2WTAA 3W8RA 2GVDC 1Z06A 4FYPA 3IAHA 3V4OA 5J2UA 2IIPA 1OC4A 2EFJA 2AFHB 4HQFA 1VPWA 1NW4A 1QR2A 2QHXA 1G3MA 1L5FA 3P26A 4F6RB 1AK9A 2XGSA 1UJ2A 1E8MA 1MTZA 2PT7A 1N8NA 3EYWA 3NQ41 3I6BA 5F35A 5K0NA 4HNRA 2ZR9A 1TU0A 3EJWA 3P4YA 5TRTA 4CKWB 4XB6B 4A23A 1XTQA 2X0IA 1XA0A 2P4QA 4NICA 2NXCA 2QMZA 1YZYA 3CT4A 3WWOA 5KC9A 3SIXA 5ALUA 1H2RS 3DWIA 4FDVA 5DGHA 4GVXA 5F4ZA 3AH8A 4PR3A 3MWEB 3CPSA 3DZBA 3RAPR 5D5QA 5GJVC 2KM1A 4GEKA 5KNCH 1QH1B 1J2TA 2D3WA 4Q3KA 3ON5A 2GTPA 3KQWA 1K97A 5LXTA 1Q17A 4RD2A 4DFDA 1AJEA 1MVNA 1UIRA 3HFJA 3NAGA 4EK9A 2DUUA 4XI9A 5FBWB 3U0BA 3U6BA 4ZO6A 3HFGA 1QV6A 5I4KA 4FVTA 4PYOA 1NYQA 3CJQA 4PM4A 3OKFA 2WMNB 3K9CA 4HSEA 4OB6A 1R6VA 2QSZA 4J0HA 4M0LA 3R8FA 1UWCA 4M55A 4F04A 3KKQA 1B6GA 2RHTA 2A84A 2P75A 1F20A 2PYIA 4NENB 4FJ0A 1X74A 3WIOA 2XODA 5CFNA 4YO8A 3FWNA 2NOAA 3HK2A 5CP8A 5L3SA 1ENOA 3T61A 5KNBH 1BVHA 1FUKA 2OECA 1ISPA 2GWHA 3PQ7A 2P9QA 4MOWA 4B84A 4PG8A 1F9AA 4IM7A 4ZV4A 3LY7A 3CCBA 1IHYA 2C20A 3ZQUA 2AKEA 4BZXA 1HK7A 3COWA 3D8BA 1JVNA 1HE4A 1TX4B 2FNAA 1PG5A 4JELA 4B6QA 4YQFA 4YFVA 1P5JA 1PEDA 4IIVA 2ZBQA 3JAKB 4ERNA 1JU9A 2WUWE 3QI7A 1UBRS 5CT9A 2UYCA 3HJFA 3FSGD 1JMKC 1ZRNA 1YJ8A 3GFGA 3ST7A 2N75A 5IBPA 3OQJA 3ZIDA 4BB5A 5AXDA 1YVDA 3TH5A 3DHWC 2WJWA 3KXKA 1PJBA 2HPAA 3QBTA 2EOAA 3TZBA 1NQXA 4WDRA 1N5KA 3GRFA 2VO1A 3LWNA 4K6GA 4YALA 2IIVA 4D6YA 1XAGA 5IXJA 4M54A 4B4DA 4OD0A 1JA0A 3FNIA 3O2JA 2JIPA 1EX9A 3BE5A 3MJEA 4HLDA 3WNCA 1OXMA 2NYAA 2YW2A 3VYRB 3BWVA 1JLLA 2ZBDA 1KPIA 3LOQA 4L5BA 4B4VA 4YV1A 2IHNA 3VAYA 3AUXA 3WGHA 1OBOA 4J1TC 4P6VF 3OCWA 1D2GA 3DFIA 1XU9A 1V1MA 4FXPA 1P1BA 4GT1A 4V0NA 3TW6A 2JANA 3IVXA 2FRDC 4LZJA 3W3AD 1EJBA 3WHLA 3DV0B 3ZWMA 3KLMX 3FWKA 4C2BA 3AEQA 4P3NA 3NVKI 2ILVA 1II8A 1SU6A 3RIGA 3GQBB 1G9SA 1YR3A 2QW1A 1KYZA 1N2HA 2CB0A 1E0JA 4UFPA 3RVSA 4U1RA 1T2VA 2QTBA 4EUNA 5JFTA 4MDFA 4MI9A 4Q12A 2CWWA 2XF8A 4BRZA 4I9NA 3NNNA 1EJ2A 1I6KA 2CDNA 3LVRE 5TS3A 1AKMA 3C45A 1HE8B 4WSOA 4YCAA 5AI6A 5HYVA 3GPLA 2J9YB 2NYVA 5JCOC 3LUJA 2FFRA 2C31A 3D7NA 3GLSA 4TSKA 1AV7A 2ZYAA 4BECA 4CMIB 5K0LA 2TMKA 4IOKA 4WKPA 3WYFA 3HM9A 3DE0X 3MTDA 3WL5A 1KAOA 3L6RA 1V9SA 3HNPA 1KJNA 2AB0A 4DKXA 2QA5A 2A3RA 1DT5A 1FRFS 1DUIA 3LPMA 3E22B 4KXXA 4PXYA 4HDNA 3N75A 4G1FA 1ZK4A 3BWCA 3ZY2A 4DQ0A 5ISMA 3NV7A 1UFRA 1FNSA 3NWOA 5A6SA 5KWIA 1P7CA 1Y4UA 3QIAA 4MR8B 4XFKA 5DNVA 5LNK1 2VSQA 3MJSA 4U7FA 4TLCA 4FZJA 4KI7A 1IHDA 1N2CE 2C0QA 2GCOB 3DLIA 5CHYA 2XTMA 3TTXA 1F5NA 3K9FC 5THQA 2A7QA 4LRSB 3G2NA 4M98A 4FPXA 2WZCA 5T4BA 3ZY5A 3IT2A 3MUEA 2FKNA 3HKBA 3OMLA 4D9CA 3HJCA 4YCCA 2G80A 4XM2A 1X77A 2VCEA 4AZ3B 3QNMA 2HMSA 1DRVA 1NRWA 1FL9A 2P27A 1TUEA 3JD4A 4MUYA 3SYNA 3QEAZ 1S2GA 1BU5A 3R7FA 1LLCA 1TMOA 2HYIC 1E2QA 4J16C 2WJJA 2ZE8A 5B55A 2VDNB 2B1RA 1WB4A 4NNJA 2IZ1A 4WA8A 3SIWA 3HDVA 1Q91A 5D85A 4FB4A 1RRVA 2FQYA 4QOHA 4QUEA 1U0FA 3SS9X 1I33A 1RLOA 4J7AA 4B2LA 5TLSA 1XFAA 2O2CA 3D1LA 5IDVA 3AGPA 3O4VA 3B36A 3LDHA 3NT2A 1DBSA 2XOEA 3H4MA 2D6FA 4B35A 2OAP1 3OJFA 2ZZNA 2KWIA 3LVQE 4MQEA 5WRFA 1CY1A 2GLTA 5EIBD 1Q0ZA 1RMYA 1WB5A 4D3FA 2XGJA 5B7PA 1PJ3A 3LT0A 4PLCA 2FDRA 3FFAA 1CK4A 1WTAA 4C1NA 5C34B 3DVAB 1B8UA 4QVIA 1DHRA 5DNEA 4AY5A 2C1ZA 3T41A 4KC0A 3PUJA 2A5LA 3MPOA 2VRBA 2Z1DA 3PNBA 5LB4A 3H5RA 1CFZA 1WQ1R 1QOPB 4LISA 4D0LB 1NDQA 2C3MA 4BFCA 3D02A 1L7EA 5LXTF 4C78A 4PC2A 3A4YA 2M98A 4OQNA 4PZZA 3RRXA 1RWNA 1ULZA 1SG0A 4MUBA 4S1TA 1M1NA 1IQ0A 4IDCA 4NJEB 2NAPA 1U94A 1NFFA 2BMFA 3GRCA 3GFQA 1SBQA 4UC0A 3U09A 1US8A 3D5QA 3GDWA 4EOGA 1R0RE 3GLHA 3HZRA 4MQUA 1O87A 5JC8A 4GPTA 1EGVB 3AP1A 3PG5A 4QQRA 4I5DA 3U19A 3FHJA 4B8YA 1NMQA 1TVMA 4O8CA 1FYVA 2E89A 3QQPA 2QR5A 1TMGE 4EELA 3GUCA 1IN4A 2QTVA 5KYUA 1TKAA 2VAPA 3VR1A 3WTBA 1UK9A 1L4BA 4QZVA 2ZIZA 3KHSA 2XMCA 4GRAA 4TM7A 4R84A 1UKZA 3DE2X 3KVYA 3GMIA 3WL8A 2DR0A 4O3FA 1UBJS 2XDQB 2Y92A 4UVDA 4NCNA 3UQYS 1MRNA 3M89A 2DERA 4ZVNA 4OMFG 4IXNA 1RYEA 3B82A 5DX1A 4OP2A 5MGBA 4HAUA 1GG8A 1NLYA 3P0RA 2VUUA 5HZKA 3T3NA 1E2UA 2W8BB 1EFVB 2FRVA 4N5DA 1RM0A 5B30A 3AG5A 4G56A 4CMAA 1YQXA 1USKA 2OORC 3LRXA 3VR4A 5TB5A 3AR2A 2YY5A 3UNXA 1AS0A 2WF7A 3U60B 2DUMA 3P7MA 2JGDB 5CDGA 1A5BB 3UAWA 4RTJA 3DDUA 1CQZA 3RVKA 3ZHXA 1D8AA 4GGMX 1R6DA 4L5IA 4K6HA 1M8FA 3PZRA 1QIKA 4FNMA 1A0OA 1C1XA 2CL7X 4B7ZA 1V2HE 2R8XA 3I3OA 4DLWA 3CPHA 5L7WA 3FTFA 5D7BA 1OH5A 4OLFA 1P2GA 2UUPA 3CS3A 5TEWA 2DP4E 1A1SA 1K08A 3D0QA 4O1HA 5AR1A 5AK3A 3AJRA 3ZE8A 1C9JA 1BAPA 3N2IA 3RVLA 3R6LA 2IITA 1BH2A 4EA8A 3CFYA 1XK6A 2CUZA 4RZSA 3PWKA 1F4PA 5FIUA 4C5AA 2Q07A 1N1GA 1RQXA 4OL9A 4RIGA 5IP5A 1KDVA 4CT5A 3AVWA 2ARKA 1QIEA 2QZ9A 4V1CB 2RIRA 3ZOKA 1Q7RA 3HCNA 2Z95A 3S2IA 5E2BA 3RYFB 2V5VA 4K1LA 1XZKA 1QNLA 4N3GA 5IRCD 2AE2A 3A1EA 1KWGA 2ETXA 4G4SP 1HETA 2CVHA 3VR3D 1OWNA 4ZGWA 3LW8A 2JLUA 2VXYA 1ZONA 1TO1E 2AG5A 5JCZA 1UDXA 3S0JA 3KFLA 3N6VA 4U3JA 4ZAWA 1E2GA 2WILA 4G2NA 5LP6C 1L4FA 1JA1A 3EDYA 4LGCA 3KLOA 2PGIA 4MV1A 1QDEA 3QH4A 2H5LA 1D9XA 4MV5A 1WSAA 1OLXA 1PU2A 4BNWA 2I4IA 5D5PA 1ZNWA 1UUFA 3CX4A 3K0FB 2XB8A 3WSVA 4MX8A 3RQSA 5BQPA 1T9GR 3STVA 4XYBA 4GAEA 3C98A 4LV8B 4RY8A 1XNGA 3BZWA 1UXIA 2VDMB 1KYYA 4WXRA 5KNLA 1ORRA 3T5BA 2Q1XA 3RVPA 3DMDA 1JEQA 1HOXA 3UKOA 3WK6A 4DXHA 4TVKA 1J5XA 3BVPA 4QXPA 4EIWA 3LLMA 3LK6A 4ZO9A 3WGGA 1NSFA 1G17A 5KQSA 2XCSB 5G4KB 4NENA 4F4CA 4U63A 2PDAA 2EYUA 2LCFA 3HO1A 4MPDA 5K4AA 2CEKA 2WUVA 3GPIA 1TEZA 1AF7A 1CUFA 3PHCA 5C4IA 1BOOA 3ZHSA 1DC8A 4GSLA 1NJ2A 5JAZA 3EPKA 5F9FA 2OG2A 1U1CA 3ZD8A 1P91A 4EPXA 3GJ6A 5IBRA 2HA6A 3E8XA 4WASA 1BA2A 2RHRA 3DKPA 3NIWA 4ME6A 3NM5A 4RNDB 2JGKA 5DCWA 5IN5A 1KYQA 2ETVA 1WOMA 1E99A 2HB6A 1E3JA 4KLZA 4UREA 4IX9A 4YAOA 1XUOA 3F9RA 4EUKA 3EG5A 2XCUA 4JBHA 4D3XA 1QYXA 2VJLA 4OK6A 1B8NA 2X9GA 1QCCA 4EF6A 1C81A 5KCZA 3ORYA 3KQLA 3PPYA 2NZ2A 4N8SA 5IYZB 2WUGA 2A1TR 5KVSA 4P5EA 3CRZA 1E9RA 1LKZA 4KYUA 5D6NA 3D59A 1CF4A 2WWXA 3QUCA 4FEYA 3DMGA 4EB6A 3RSZA 4I55F 1IIBA 2FFQA 4HADA 1Z25A 2JIDA 3RKUA 3KXPA 3GLHE 3FKSD 2UYGA 5IN4A 1AQYA 1KRXA 4DB4A 1ODCA 3EQ6A 4K9DA 2D2EA 2QX6A 3V97A 4DXDA 1SHTX 2BHNA 4OUDB 4ITVA 4LI3X 1NIJA 1ODTC 1VHJA 1YA4A 2X1HA 3O47A 4K2AA 3L6BA 4YRJA 1Y8CA 4ZAFA 2HFJA 2QRHA 3O92A 5SZIA 5CDYA 4CLOB 3WB2A 1GL3A 2BHSA 2HUPA 3REQB 3C8UA 1DAHA 2DQZA 3BORA 3RPEA 3RYHA 4BCCA 4DBLE 1ZRSA 2ATIA 2BP7A 1E4EB 2VDPB 2WWIA 2XADA 3MTIA 3OLYA 4TKUB 5TC4A 3ZPXA 1RWMA 1U8FO 1XWIA 3HJAA 4MI3A 1PRYA 1P9WA 4IIUA 4TVBA 3OESA 4MHOA 1LBEA 5AYVA 4U2EA 4F4HA 1QGDA 2VP6A 2WSSD 1BDHA 1X94A 1SUBA 5G0WA 1CR4A 1WQ3A 5FTMA 4N5NA 2E37A 2PT9A 3GFOA 3QF7A 3A4MA 4M9RA 1WULS 1JXAA 5TGTA 3TQOA 4Z2AA 1TM1E 1IY8A 4FHEA 4G5QA 1MJNA 2RONA 1Z29A 4HY3A 4J0IA 3VVBA 2VHYA 4KKVA 2AL7A 4GOND 1E7YA 2ZXFA 2Q6KA 4X92A 3RFTA 2OWEA 1XZMA 1B8PA 3QE0A 2CVFA 2VLIA 1J8DA 1N7HA 2BR3A 2XOXA 2R1TA 1YRAA 1A98A 1ZVQA 2HEIA 3H11A 3OQBA 3JQ9C 3SQMA 2JFPA 1ECFA 1TA9A 4BJ6A 4X95A 4CN8A 3K35A 1KYXA 1E79D 3F4KA 4E2WA 4BX3A 2GBCA 3V7WA 1II0A 2ACVA 5JCXA 3LUGA 3HWX1 5DF1A 3VYUB 3TLZA 4HAIA 5FPKA 1KJJA 3DAHA 3INGA 2YHUA 1LDYA 1PTJC 2OBXA 5T67A 4AF6A 1CZNA 2UUAB 4H6WA 5IH7A 2G7ZA 4IJWA 1SC9A 3RFVA 3TNJA 4CKBB 1Z2CA 3GK3A 3JCZA 1MB3A 3BL6A 1K4KA 4MW9A 3T1VA 5JS8A 1QP4A 1U8ZA 5KOHA 1ADGA 2O8EB 2RI1A 1R8JA 1T5LA 1B0ZA 4AK9A 2XE4A 3G0DA 1FMJA 3QYAA 2P9FA 1GTMA 1SUDA 1D7AA 4HMOA 2FW9A 3HACA 3JWHA 2HGZA 4OA5A 4YAJA 3SBOA 5CK4A 2G4LA 1C1HA 3O8QA 1SBNE 1XRSB 4RSHA 1NUHA 1YZUA 2ZREA 3ZX5A 5K3AA 4Q6BA 1Q0HA 3NPAA 5J5VA 4KE6A 3VSCA 2CLLB 4DUPA 5DI9A 4PLYA 5CCDA 3OPQA 3RFFA 5JAIA 5TIIA 1OD6A 1GNPA 4OLJA 4QO7A 5FUVA 1CLUA 3KM0A 2DBZA 2PCLA 3DUFB 4NCIA 2WD7A 3U4MA 5FORA 1A7AA 3DLPX 5AOCA 4AU1A 4BTVA 1TUGA 4YASA 1K7CA 2FSSA 2WJVA 3D3QA 2ZRBA 2HV9A 3HCWA 4U2BA 1TXGA 5BW6B 4AFNA 4C87A 5GP1A 1U9ZA 3G8DA 1GKKA 2IP1A 5BN5A 1W85B 3HADA 3PLRA 2QX8A 3DZFA 5FWDA 1QCDA 2CGEA 4ND5A 1Z0UA 3NYIA 4P80A 3V46A 1RPNA 1S0UA 1CF9A 3GCGA 3JQRA 1QQ5A 1PQWA 4ANFA 4XPIA 4CI9A 4RJTA 1LDNA 1Z5OA 2PKRA 1R0YA 3B2EA 1IONA 5KSYA 4I66A 1VI6A 5JXGA 1MRZA 2YRFA 3DT8A 1AVTA 3E7XA 3MBIA 4KTVE 4JJAA 5DTJA 4BBPA 4PGFA 3VSBA 3MT7A 4QYWA 4YCLA 2ZBEA 1FW6A 5JS7A 3MCVA 4C2TA 3LAWA 1U2PA 3DT9A 4HV4A 3NB0A 2K87A 1X1RA 2FWAA 3FMGA 4GX1A 3AEUA 4P31A 1R6AA 3E2MA 3JQ9A 3K6RA 4XSHA 4U9UA 5ALOA 3CEMA 4LHXA 1IPFA 1K92A 5LP6F 2QTNA 2J08A 3DOCA 4JFAA 4TWAA 5CVCA 2Z57A 1SULA 3I9OA 4GMGA 2YXNA 1NY5A 1DOAA 3ZE1B 1QS0B 1R5JA 2O2GA 1RI2A 3NDPA 1EFVA 2W2VA 3EVBA 5LUBA 3I39X 2OCAA 3COZA 4ZYZA 3VDQA 2BV3A 5ADVA 2GKGA 4BJ1A 4P4NA 2VAMA 4G07A 4IFTA 4BIIA 6REQA 1FE8A 4I5GA 3CKLA 3VR5H 5ITSA 2PYZA 2ODQA 4PNEA 2FP4A 2PS1A 3P9PA 3UJCA 3ITKA 1G18A 2YJ3A 4QTTB 5C7IO 2P2NA 4V2IA 1JHAA 3RROA 4KLNA 4CXMA 5F76A 3CUEF 1ABFA 4MYSA 4HXYA 3G2LA 1U2TA 4KSBA 2CXRA 5GONF 3WA7A 3D8RA 5KSWB 1U7TA 1Z8DA 1TO2E 2QX7A 3LQYA 3P5SA 1KMMA 3WWDA 1UAGA 2CD7A 1LDEA 5IBQA 1Z2AA 2VYND 3X1WA 3Q7EA 3AM5A 4O4IA 3RHSA 4RKQA 3URKA 3UH0A 3T94A 1U9IA 4XCXA 4XLLA 5C31A 4YBRA 1AUXA 3O2SB 3RNLA 3LX4A 3UAVA 3ZJ5A 4YUZA 3SWWA 1SXIA 3RASA 1N6PA 4RZIA 1YL5A 4DLAA 1EUZA 2Z1NA 2QUHA 4FTWA 1SBZA 5H83A 4B5KA 5A4DA 1H9BA 1S7CA 1SO8A 1Y6FA 4WLNA 3EVTA 4MV6A 3IDAA 2X58A 4RTRA 4PC1A 3OAAA 1H2XA 2R7NA 3ES9A 3PL5A 2O2EA 2G72A 2XD9A 2A0UA 1RMTA 4IQFA 3N2LA 2O50A 4GFDA 3BGSA 3VAAA 3VOSA 4BGUA 4D9EA 2J6BA 4P53A 1ZVJA 5JAHA 1J07A 3IHKA 4CQMA 4BFZA 2HL6A 3T38A 4PE5B 3IJRA 5F33A 3O8RA 2YV1A 2EJWA 1OW3B 2FG5A 2CKDA 2OPBA 4N40A 2PUAA 2X2OA 4Q3DA 2H00A 4TXJA 2OCXA 4D92A 4ZOCA 2HJHA 2CJFA 3PNSA 4UHKA 4RV4A 3Q10A 1OLXB 3DEFA 4P22A 3RNOA 4F71A 1JEYB 4IY1A 4PS1A 1XLUA 2I1WA 4B7AA 5AI8A 3GA7A 5IW8A 2OC9A 4YCJA 1W2WB 5K0SA 1IRXA 3BYZA 4A8JB 3COYA 4ZOQI 3OCUA 1P2BA 1EB9A 3MGBA 2Q1SA 1JEQB 5KS2A 2J7KA 1L9XA 1Z4LA 1XJWA 1L4UA 2QG6A 2VIIA 3AYXB 3WL7A 5A3SA 3PD7A 3WAKA 1RWVA 4A0HA 3GP8A 2H1OA 3KKZA 2ZG6A 4MP3A 4OI2A 2YJ5A 3QE3A 4DA6A 3RAGA 3HKDA 2SBTA 3GLFE 1UKEA 3AL3A 5E8RA 5JPCA 2IYYA 4OQEA 4R8RA 1G5HA 5TF0A 1UZAA 1YQGA 2NQ8A 1DQYA 1W29A 4E2XA 4E7OA 2FSFA 2DPLA 4RNCA 3ZKWB 1T3ZA 5KU7A 3CZ9A 4R9VA 4I1OA 3VSEA 4NS4A 3D8UA 4Y6SA 1YS2X 3QVMA 4FQ8A 4BMDA 5JTTA 4Z7OB 3KJFA 2PX0A 2Z8ZA 3GRPA 3OIGA 2XTAA 4NMMA 3QOWA 2PJZA 3Q4GA 1OFGA 4MARA 3UW3A 2BHRA 2I3GA 3VI4B 3PF9A 1IM2A 1D0VA 1FDRA 3ONDA 4NU8X 1MBZA 1W34A 4R7ZA 4X6LA 1DB3A 4GXTA 1HEUA 3GBVA 2IY8A 2RHBA 1GIAA 3I28A 4FI3F 2V6BA 1Z8NA 4ZRDA 1W88B 5EP1A 3RTEA 1C14A 3IBCA 1SXGA 5DW0A 3D4LA 3B5EA 3HJBA 3E27A 4Q1CA 4BQQA 3EOZA 3T1OA 5DK4A 1NX9A 2LUOA 4WFQA 4HX5A 3TL6A 3WGYA 1E6LA 1ZN7A 4HGOA 4D7AA 2P9HA 3OLWA 4XRRA 2XE6A 5AQEA 4A6XA 4S1PA 3S7TA 4DCGA 1MVOA 1KEVA 5LYJB 2WHYA 3B3FA 1QFSA 5HF5A 1X13A 1I7DA 2TYSB 3BD6A 2XQFA 2ISCA 1EWQA 3BMQB 5IUKC 2COUA 4M89A 2BUAA 2QQFA 4JLVA 1ORTA 1TKRA 4K9MA 2XKAA 3OJCA 2PPVA 3AL2A 4ROSA 4L6CA 2I22A 5IJAA 2R00C 4GPBA 1SGWA 3F6YA 1IMOA 4WUVA 5BSHA 5JNLA 1KJWA 4UQOA 1RJEA 1X9HA 4Y18A 4Q9DA 2G3YA 3OCJA 2CL6X 4AURA 5ALEA 3WSWA 4ZD6A 4DXAA 2JLBA 2B21A 1XVTA 3BPSA 1P19A 3KB8A 4KQFA 4FC6A 3GUHA 3R3WA 3RKRA 2B3TA 2KB0A 3GGDA 1ENYA 5KX5A 4DSZA 4DJTA 4OQDA 1JPVA 3VDMA 2A1TS 2JH3A 2NX2A 3PA6A 1UL1X 4BJ5A 3USES 1SK8A 3ND6A 1FX0B 4L3WA 5ELMA 5LL6P 4G23A 5DPMA 1JG6A 4EKDA 3NHAA 2VSOA 1JLRA 4Q4AB 4BFWA 3LCJA 2YVQA 1TPZA 3CBGA 3GWZA 4JMLA 2AJDA 3D64A 4JYPA 3F8SA 2OD2A 4W1RA 3SFVA 2H3EA 3DB1A 3K0KA 3K9GA 4WJKB 3VYSB 1VRWA 2P2DA 2FUG6 4I9GA 3NPMA 4Y9RA 5F7ZA 4N41A 2G9RA 4Q3LA 1TE2A 2FWPA 2BGLA 3R0JA 4G0XA 5CB4A 2CDRA 1QF6A 3M6XA 2P8JA 3PIRA 5EGNA 3LVFO 1RADA 1DX4A 1FP4A 3K0BA 4O4JB 4KYIB 5LP1A 1PTKA 5ERGB 2D13A 1A72A 1TRHA 2W70A 3LUBA 4ZT3A 2ZTHA 4IDQA 5CNKA 1NSYA 4Y9TA 1Q74A 4EHLA 5LP6A 4N7JA 4OHKA 2GOYA 4HZUA 2YYAA 1Z4KA 2JGLA 5C51B 2QTAA 1GAWA 1GUYA 4TX1A 4X1KB 4B44A 4R3UC 4V38A 3QITA 2W11A 5GINE 4KXUA 1LI7A 3CR8A 3W5DA 1N0VC 1PL7A 4RZHA 4BGIA 1N2ZA 5HVNA 1GZ5A 3I8OA 5BSUA 3WIEA 5FPTA 4JKYA 4N0MA 4Q34A 4HN9A 4NCHA 2ZRNA 3QVTA 2CXNA 2IH4A 1WVGA 1ZSNA 4TWBA 1QO0D 1HYGA 2F8MA 3OPYB 4UAVA 2G1AA 1HT0A 4JZYA 3AHDA 3UMBA 4CEHB 2VPYA 2C78A 4FIZA 3A1NA 3K53A 3L7NA 5DXFA 3X1ZA 5AW8A 2Z4RA 5J23A 4J6EA 3PUXA 3BRSA 1D1SA 3LH5A 3DW3X 4R2HA 4D8YA 3NUGA 1JYSA 3AHEA 5FULA 1MC8A 5DGDA 4DPMA 4EKIA 2BZ0A 3VKFA 3ZOZA 1W1IA 4EYOA 1CR2A 1R6TA 2IUTA 1B4DA 1PZMA 4WT7A 2ZRMA 1TRKA 3EH1A 5HMLA 3KQOA 4CM6A 4WBNF 5AUNB 5YASA 1VKJA 2WTNA 3INTA 3KSBC 3VYTB 5NLLA 2QLBA 4I1PA 2QX9A 3QX7A 1YB5A 4ZAYA 3QWIA 1UMBA 1MRSA 2VJBA 4I5FA 2Q9UA 2NU8B 1ZINA 1W4LA 3PYLA 2C5BA 4J07A 2POCA 3LSTA 2OB1A 1BXZA 5JBQA 3K70C 3MOGA 2HAEA 3VKHA 5TMEA 4MQ4A 4YJDA 3L8CA 3VZBA 5TVKA 2KE5A 1EWKA 2VZLA 4BLQA 3FPJA 3MJVA 2RCYA 4E2FA 4JX9A 4LOKA 4TV8A 1EZZA 4R5MA 1G5FA 5CVUA 4KO8A 1CNEA 3ILVA 5JT1A 4KVZA 1CU1A 2ZRCA 3CBQA 1ZKMA 4LF6B 1J56A 3FCCA 1ZJWA 4IRUB 4P84A 1ZMBA 1UJBA 2QL7A 2F1RA 2I99A 1U5CA 2PLFA 1U8CB 2BGNA 5D3MB 4Y2XA 3CF6R 5EMJA 3THSA 3UK2A 2PU7A 4U8HA 4C0HA 2V7UA 4HDKA 4TRNA 3G17A 4UVGA 1XO1A 3UMGA 3QEOA 2I3ZA 3T15A 3L4BC 4QPDA 4YJ2F 2PZJA 1RHJA 1Y6QA 3PZBA 3L1KA 3UPTA 1M8KA 2RH4A 4Y2RA 2HBYA 5IK2A 5IWAB 5IVKA 2WHRA 1VE5A 1TEVA 3C6QA 5LMNB 3PVZA 2O8NA 4ONEA 3LXUX 1HQDA 5TQ0B 2AN1A 3AQ4A 4FR5A 2FH5B 4PSUA 3NBMA 3VR0A 5TEVA 2D8MA 5CH5A 1G7CA 2C2MA 2JIZD 2VJNA 3CX8A 3KKEA 2P2ZA 4JYZA 4GLBA 3R6WA 3EF1A 5I9BA 2EGHA 4PGMA 2GK6A 2I6GA 5HFJA 3SK0A 4G5XA 4A6EA 3MHTA 3SP1A 4OXXA 4TV8F 4HDMB 5HMMA 3GLFB 1A7JA 2J3HA 2H7XA 2P62A 1MN6A 1EAYA 3W7AA 3V00A 1BN7A 3G88A 2JGIA 3OEYA 1MOQA 4J16A 2AMLA 3LBAA 1XWWA 1ZN2A 3ZXXA 5IC4A 2IX3A 3PGVA 1G8GA 1LEHA 2J32A 3G2IA 3IQEA 3EX7C 3RSHA 2R00A 3EG9A 3GAAA 1H3FA 5H16A 2WUDA 1CBUA 2EW1A 1CERA 2BTQA 4YJ3A 3WYNA 3TIFA 3NFRA 1VB5A 2DAPA 1EXMA 5JMPA 1E1MA 1MW9X 1AK1A 2PJUA 1BMFA 4OY3A 3SXPA 4AJ9A 4R9NA 2MR6A 4WOCA 4UEWA 2WWYA 3V80A 1SKYE 3L06A 4MQ6A 5AVZA 2BM8A 3ZE6A 2EL9A 1CY8A 1YC5A 2FLVA 2VNKA 1U7UA 3EGOA 4AIRA 4UCQA 3YASA 2PH1A 4P3YA 4R3WA 4Q9LA 3UMVA 5B4UA 5LDDC 4LY3A 1AMNA 1OH8A 1N2CA 5IDQA 1PZEA 3QV2A 4QODA 3QOYA 3WBBA 4HVLA 1IZZA 1KYVA 1LU9A 2HI0A 3HA7A 4J4HA 4G4JA 2NT3A 2IK8A 1LA2A 4HMPA 3TLBA 1HEYA 3P9QA 4ABYA 1M6VB 1W52X 1UM8A 3WIVA 1VYTA 5DYNA 5A06A 3I53A 3GJ8A 3H2KA 3OD5A 1K5PA 1E3TA 4I1YA 3KPWA 4MUEA 5FR1A 2J31A 4YRTA 2FZVA 4ZU1X 2PIAA 4WH0A 4IRXA 2CLMB 3E05A 1JE1A 4JOSA 2C5GA 2EJBA 4U39A 5ALZA 4ZYXA 4QD3A 2E3JA 2PYDA 4X0EA 1L5GB 4LYEA 2LCIA 2X76A 4Y2SA 1R6BX 4UMEA 5BN3B 4NESA 2XKKA 1XAJA 1VL2A 3FWYA 3JZFA 1W73A 3NIDB 3TQFA 4DREA 1WUHS 5I9NA 3TW8A 1VB3A 4NJMA 1SWWA 1NBEA 4IF4A 1BIFA 5EPUA 4BVKA 3DR3A 4PZYA 4W7HA 4CT4B 3P71T 1GUDA 1MENA 3BKWA 5AK6A 1RW4A 3H8WA 3OU7A 2ABWA 3N6RA 4W63A 1H5QA 5CFQA 4NBLA 4MLZA 3K9HA 4E2ZA 3W2IA 1L5WA 4G81A 3QPDA 4GX5A 3AESB 1PFVA 1JW9B 2QPAA 3SEZA 4F86A 4DV0B 2OHXA 4XIGS 4D8TA 1EK0A 2MSEB 3AFOA 5D84A 1Z73A 3S3TA 3G9QA 1F1BA 4WUTA 2G5CA 4FB5A 2AFVA 4RMGA 2HA4A 1G21B 3PUHA 4FFBA 3S44A 2YKGA 4Z6KA 2Q8PA 3N8IA 4EUHA 4DR2B 1YA8A 3GD7A 1UPBA 2B1QA 2A88A 1AN9A 1YZHA 1ZS9A 1KVQA 3MB5A 4KRYA 1KI6B 1RI3A 4IICA 3HLTA 3L7YA 4O4LA 3DZHA 4QHSA 5CH3A 3TM4A 4E11A 4F97A 3SFTA 4UNQA 5KNDH 7ADHA 2UXCB 2X3UA 3GW8A 3ILHA 5EXXA 4F6RA 4HVCA 4Q1DA 4DS3A 1XVLA 2DEUA 1KH2A 2X6RA 1KZ4A 1J8YF 3EGEA 3MXOA 3NVAA 4R6WA 4RJKA 1PFGA 4WOJA 3ZW9A 1JJAA 5LMUB 1KAEA 1M1XB 4G84A 3VJMA 1TI7A 3IKJA 2QIPA 3MTBA 3V4VB 3EZGA 2W0MA 4XUEA 4ZDWA 4II3A 1F9EA 1Z4QA 5LWHA 2XRFA 5IHXA 2UUBB 1YB6A 2H65A 1RCTE 1M76A 2EBUA 3GPCA 5F1YA 2JLCA 2PMKA 4ER5A 5IDYA 3ANSA 4LXUA 1KFCB 3H3JA 5CB0A 2UUOA 1MO4A 4IHAA 3WL4A 1P1CA 1PDWA 5FDFA 4BWVA 4UXIA 2C3OA 5FPYA 3NM6B 4ZQFA 1WM1A 2ONCA 3OY2A 1N6OA 1YS7A 4PO1A 3I8XA 4HH0A 1XMQB 4N39A 4P0TA 4TV9A 1RC8A 4OX9B 2GUGA 3OE1A 3IAM1 4TQGA 5KSPA 3GYBA 1C9YA 4YAUA 4UBLA 1RXUA 2B6NA 1GN9A 2GSWA 1AK2A 3E22A 2M6SA 1DKRA 1EIZA 2Q5HA 1G19A 2EBWA 2H5IA 2PUEA 4D6PA 2HRZA 1PDVA 3PRHA 1E6MA 3PHHA 3FG9A 3HPRA 4INAA 3Q2IA 2A6PA 4ZIRB 2WLSA 2DFTA 3IMEA 5J2UB 4XW2A 5LVAA 2RHJA 5F3DA 2OYCA 2UYOA 5F23A 2OBYA 4X1KA 5EESA 3I2GA 5F7XA 5JJ5A 1IHUA 4FDTA 2PBFA 4AG6A 4EPTA 1D09A 3QYFA 2ZE6A 1TK3A 2OFXA 3ORQA 2FVXA 3D6NB 4JJ4A 4OGWA 2PMBA 4ATNA 4PINA 4RE5A 3A6EA 4ZVQA 3U7EB 1OGYA 1Y4DE 3SDBA 1YBAA 3TBFA 5AW7A 1JT2A 4DUGD 1UK8A 3FYSA 1ZVKA 2GDJA 1A9XB 4YH1A 3B38A 1T3LA 5KI6A 5JPIA 4Q01A 1Y3AA 5JH7A 2Z08A 1Z7BA 3DB2A 2XUGA 4YRLA 4XQ0A 5F21A 1LCIA 3R4VA 1MV8A 3SX0A 5KTPA 1HSZA 1XEXB 1P2UA 2VJCA 1RYMA 3AIIA 3E5NA 4I4TF 4NNPA 2WUEA 4ENVA 8AT1A 3O75A 1R1DA 2C4UA 2C5AA 5LYJA 1T6BY 4QG3A 5DBFA 1GZ3A 3D6HA 1MH9A 1OI2A 3LI2A 4XGKA 4U2CA 2DFNA 4XRGA 2PVPA 4CIYA 4TZTA 4UHJA 2DQSA 2OAEA 4UTPA 1LB1B 2RGAA 4BQEA 1XELA 1X8XA 1VZ2A 2C8KA 1QM5A 1TF2A 3V7FA 4UCXA 4TTJA 1GN8A 5FBVB 1TJ5A 1V4BA 1JNXX 3B2QA 3DCYA 2C9OA 1EVZA 4MRVA 4DOMA 4NPCA 2Q28A 1SQFA 1FBTA 4FOOA 3B53X 3ORFA 4EUSA 3BSYA 3PUVA 1U11A 2J0UB 3KOWA 4OQZA 2IEZA 4ZYYA 5JSFA 4WZBE 3ZZMA 1G8SA 1WTCA 4AG3A 4B3IA 1NMXA 1SQ6A 3ELDA 5AP9A 4UBMA 2LBPA 1NUUA 3QKSA 4ZICA 5KOYA 1M6NA 2QM7A 4RAQA 4JL5A 1B41A 1GDDA 2FFAA 4NONA 4X7RA 3WIBA 1SAYA 3W1WA 3VH1A 1ZAKA 4H7DA 4BLTA 5L53A 3UATA 2MT9A 2O9JA 2JAUA 2XYHA 3G1WA 4CM8B 4CDNA 1RWXA 1DPGA 1YBVA 4OA8A 1XVVA 3ZZ0A 2C2ZA 4J0QA 1KQPA 1OFHA 4HNSA 1L9KA 4MS1A 4Z51A 2VNHA 4IJVA 1JTEA 2H6EA 2WA2A 2ADOA 4BP9A 4X62B 2GT1A 3R0VA 2VXCA 4HN2A 3UVEA 4YRKA 3LT4A 1GU0A 1ZM3A 2MSCB 1G16A 2GEJA 2Q5FA 3OIDA 4OO3A 3QSGA 3KKKA 5GVSA 2QV7A 1J2RA 1IZ0A 3N8DA 4EKEA 4EJSC 4A0RA 2VPWA 4KR2A 2GYWA 1V3UA 4FNAA 1H6CA 3VNAA 3HCAA 5SYMA 3RC9A 8ABPA 3PQ8A 2XZOA 4MR9B 1JEAA 3V2IA 2XMRA 1KHTA 1RRPA 3BMXA 3BXEA 4GZLA 5A3VA 5CJ2A 3ZNPA 4CBVA 3KQNA 1XHEA 4N18A 1D0IA 1DWQA 3G5LA 4HL6A 4IDDA 4R2WA 4B46A 5BVGB 5FI5A 2HNBA 1U0JA 3BGVA 2VNJA 3BJRA 3I2JA 4KBYA 1WIWA 5F7OA 3ROXA 3BDAA 2PRSA 3CVVA 1EIWA 2J9RA 2FU5C 4P34A 1ZW1A 4AZVA 1CULC 3NTQA 2OM2A 5D1HA 2HV8A 2QAJA 5KYVA 5C1PA 4DMHA 5FA5A 1MX3A 5H70A 1ONSA 3OCYA 4TROA 1DAPA 1AZSC 1VYHA 3C15C 4BDTA 1CR0A 5K20A 2QW8A 5JD4A 1HURA 3K4PA 4B43A 3BGOS 4LY9A 3RG8A 5EWJB 1WHSB 2FFJA 1NXPA 1YZVA 2FJPA 1K6MA 4AS1A 4E15A 4I50F 2BYTA 1Y7PA 2FYTA 3KYBA 5FCDA 4NAVA 3RVOA 1N77A 3T7TA 2Q2VA 4M60A 1W36D 2WHXA 2XV1A 2YIMA 2SKEA 4U2KA 3EFBA 4TKZA 4ZANA 4XD7D 5BN4B 1CD5A 2DB3A 5L4LA 3BMNB 4KRXA 5J59A 4NBVA 1SBYA 2JAOA 4UD6A 4P4UA 3OH8A 3ZNNA 5K0BA 1DTWB 1CSEE 2ZIEA 2JLYA 2B37A 4L02A 1DBPA 3MT8A 1Q6YA 3TXXA 4QBKA 3TUZC 2ODEA 1Z0SA 3OEHD 4M0CA 1FLVA 4C6TB 1WPXA 4QXQA 1BG6A 4COKA 1FP1D 2HEGA 2PX8A 1UBSB 4OFBA 1UMDA 1R8XA 3DGFC 1NDUA 4EAQA 1HXHA 4FINA 4YJGB 4ZEWA 3TSWA 1KNXA 1HNNA 3ETNA 4RVOA 1BHJA 3UPDA 2CVOA 3WIUA 5JDCC 4AX8A 1QUEA 3C6MA 3IE0A 7YASA 2PTHA 4BFXA 1C0LA 3ZWYA 4UTXA 4FWTA 1RQ2A 3DMFA 1RYBA 1XQ9A 2SICE 4JSYA 4IHJF 3U7GA 1D2MA 1NZJA 2LDBA 2O2JA 3C43A 3OUZA 4MV7A 3NATA 1MA0A 1OYVA 5GGYA 3L07A 5U1PA 2IU0A 1PBTA 3QJGA 4EYGA 3FJYA 5F12A 4FN4A 4ALNA 4HRXA 4GL4A 1RMQA 1E18A 2O6LA 5AI4A 1LV8A 1XFDA 3I5YA 3QHPA 5BSGA 1E9BA 3FOWA 4GMDA 2DHQA 1TIBA 3LG2A 4C3UA 3OY7A 2PXCA 4RIHA 3WLSA 1J0CA 3HEAA 4EYSA 1ZUD1 3B1KA 5B1HA 3A6FA 2C95A 4TYMA 4BHTA 4EG6A 5JWOA 1FDWA 3U3RA 3JVEA 2XQIA 3V7YA 5MN4A 2GYVA 1WW8A 3S40A 2NU7B 2YV5A 3NUQA 3SEQA 2CYCA 4DA9A 4HYQA 3I30X 2XWPA 3HVJA 1ILEA 3ZV5A 3THRA 4MS3A 1HI9A 4PYIA 4B2PA 3JVUA 3P9YA 1I7NA 4O2BF 1K68A 1JQ3A 1M8PA 6GPBA 4PICA 1Z0AA 3A58B 4M1YA 3OLZA 5KYWB 1C50A 2C83A 4TL6A 1YKGA 2JVIA 3U3XA 5I3CA 1U0OC 2CJYA 3C2QA 4ZMRA 1E5XA 2ACKA 3I32A 2F55A 3O3OB 3BA6A 2GBFA 3I01A 4KYTA 3V1YA 4OUDA 1VXOA 4PRYA 4ARCA 1CE8A 1HH4A 4ZVTA 4BO9A 4CL3A 1AU9A 3EDOA 4P0PB 1Z4NA 1MFZA 1PTJA 1RAAA 2NO9A 3ESDA 4Z9FA 2XUQA 3ZS8A 2VQSA 3MJTA 3OI7A 1F5SA 4YY3B 2GPSA 3TNFA 1IULA 2CXXA 1SB8A 2DPXA 1N0WA 4B73A 3P2YA 4WCFB 3B13B 5A4KA 2Y68A 5D6OA 3RRMA 2BP7B 1NG1A 1G20E 1XU7A 2WOJA 3CISA 3GFPA 3QFFA 1S2OA 1O54A 1B73A 1H2ZA 2WW8A 2HQBA 3CZCA 2VA9A 3QA3E 1ISSA 4MI6A 4TZKA 5CFZA 1WU7A 1Z2NX 3VKUA 5IT4A 1CV2A 2QRZA 5THKA 3TVTA 1LDBA 2H52A 1CXZA 2BEVA 4QTYA 3W3AA 4ZKEA 2Q5CA 1WOYA 2Y6VA 4PLVA 2X40A 2OXCA 3KYCA 5FBKA 1XQWA 4IQGA 3K0FA 1PT7A 1PZHA 3F6SA 4FKBA 1KPGA 1M3SA 3HU2A 4Q7QA 1YQQA 2WWVD 1NT4A 1PSWA 1LLFA 3J7TA 3CUWA 4REQB 3ZEAA 1BD4A 3BF7A 4XYMA 4H0NA 2E6UX 3IEXA 4NAHA 1N9GB 2C5FA 1XZJA 3LA6A 2Y77A 3MAGA 4EB3A 2OLKA 3IUMA 4QDUA 3TMAA 3V4ZA 1KVSA 4CN9A 3PGMA 1O97D 2IE0A 3RVNA 2IU4A 1U3VA 2ZJ3A 5DM4A 1DO2A 4Q4CA 4Q1VA 4FMDB 3IERA 3K9BA 3DULA 3OJOA 4OQLA 1JEOA 5AVTA 5DMXA 1VBMA 3QKWA 4PX3A 4MKGA 1SG6A 2CJPA 4HBZA 1HL3A 5LIRA 3M6WA 3RI3A 1FFCA 5HIKA 1LRJA 1EK5A 5I7HA 5ITWA 2O54A 1MIOA 3JD1A 1VI2A 2BBTA 2NZYA 3KV3O 1SD2A 2QL6A 5FYQA 4REMA 1EFRA 1DJQA 4L9WA 1L8OA 1T2UA 4PHCA 4A26A 1J70A 1J0BA 3OG9A 4MLPA 1DEXA 2GRAA 4X3PA 1AGXA 2E85A 2FPMA 3CH4B 3SN6A 2GXSA 4L50A 4J0FA 1JHRA 2F17A 2J87A 1JQLB 3HQ4O 3OP1A 4UHDA 3UEOA 3ER9A 3FI0A 3JALB 1KKMA 1L5HB 4F2DA 2BGRA 2BGIA 1AUOA 2DX7A 4WLFA 3VU0A 1JIJA 5K45A 4BDSA 1RRMA 4OQYA 1V1JA 2NXWA 1H1TA 4K8RB 1OIXA 1ZQ1A 2AOUA 2XQKA 4HRAA 4AMZA 3MUOA 2CFSA 2GCGA 4EQZA 3IVGA 2O8CB 2IJGX 4FZ3A 4A8HA 2WV7A 3BCUA 1NYTA 4WTOA 4QJ3A 4JP1A 1E1RD 1JHQA 1R6XA 5I7RA 1JN0A 3AF6A 1NQAO 2QJFA 2WD8A 4D9FA 1PKEA 3DZ8A 4LW8A 5AOVA 2Q45A 3REQA 2I2XB 3AV0B 3U4IA 4N3BA 3KVNA 1PKXA 4MRMA 5AXCA 3BH0A 3VC1A 1OCEA 1UZMA 4X54A 5T8KC 5B37A 5B6PA 2PL3A 1EVIA 2Z5GA 3K9LA 5JWHA 5E3HA 3I62A 1NW5A 1SBIA 4BMPB 1Z6GA 1NX6A 1KVRA 2EZ4A 1JDTA 2RMKA 3HR7A 4F4DA 2XE8A 1MC4A 2FVYA 2ZYSA 2B99A 5B2EA 1N92A 2ODNA 4MH0R 3HZOA 5EWMB 3NT4A 4CMHA 3OZIA 1X7XA 3CR3C 1HO3A 2ZCVA 3LHIA 1FVHA 1EDEA 4MEJA 4AD8A 2HDHA 4MTLA 4KIWA 2OO7A 5A0FA 4HB4A 4ZN6A 1J23A 1KDTA 2WPDA 3W2FA 2XNDA 2FA9A 4LNUA 1GNLA 1T6ZA 1BCSA 1R15A 3Q9SA 4WDQA 4UBOA 4NDAA 2FOIA 2OZVA 4Q7MB 2A4MA 3ZDXB 1WD5A 3TLJA 3P2MA 4BBZA 2OOSA 4EA7A 1M6HA 2ALJA 2W6ZA 2BGTA 3DMTC 4G8BA 1NW8A 3ANMA 4UHEA 1Q0LA 4JY7A 2OG1A 1XX6A 1MVLA 3NS7A 3QELB 1SOMA 4MAAA 3KPYA 3KKLA 4MVJP 2O8VA 4F60A 2ZUSA 4ZOLF 3PGLA 3WBKA 4CM9A 4QM7A 4DM3A 2QUKA 4GWGA 4DZZA 3MLEA 1VIAA 4DLLA 1QPZA 2WKWA 5AVSA 3E8SA 5SICE 4HT3B 2ZJ4A 4K3UA 1PR3A 2FFBA 4OI1A 1A7KA 5EWJA 5C3MA 5CXUA 2XMSA 4FT2A 1TQ4A 4L0DA 4U7HA 4D4MA 4KE7A 2H17A 1A9OA 3HPQA 2O7NA 1B3BA 2E4YA 4WECA 4E22A 4HWOA 2VPTA 4R1MA 1TW3A 1G9TA 4Z2YA 2AD5A 3PX7A 3WZMA 2G1UA 2PNJA 1N3LA 1E7MA 4X00A 2GZMA 3TFWA 2K7FA 1IY2A 1XN1A 2BCJQ 2EFYA 4Y2HA 4BBJA 4RXUA 1CUVA 1U0RA 3WC4A 4AKHA 3KJNA 1U6KA 2I7CA 3AI3A 4GPD1 2NU6A 4ZI5A 4E5MA 3CZ4A 3ZZ1A 2IS6A 3T95A 2LKDA 4UVEA 3RB8A 5IT0A 4OBXA 3KQUA 2Z5LA 2A9OA 1WSDA 1BW9A 1Y9JA 2OORA 4JBYA 2WHEA 3WK9A 2ATVA 2ZS9A 4MUFA 3BIXA 4JR2A 4M86A 3JU3A 4P7BA 2OGZA 1H9CA 2XWSA 2PRYA 4BKOA 5CG1A 2QZJA 3DV2A 2B5WA 4F21A 2AHRA 5D5HA 1P45A 3LL4A 4RORA 3HYSA 1QS0A 1EFTA 2QU8A 2VDWA 2O2IA 1M0TA 2XF2A 4JA0A 1EZ4A 3T7IA 4E6PA 1QSGA 3UXHA 4AUKA 3H5OA 3AUYA 1QHHA 5DX0A 3T5DA 3WLAA 2Y9PB 4IQ8A 1GA1A 4D0SA 4MS1B 1R9NA 5EKTA 1NYLA 3KDSE 1BFUA 1FVXA 4PIMA 4V0LA 4BX8A 4JT4A 3J7AC 4NQRA 4LZNA 1E5QA 1PDOA 2HHHB 2HLDD 2B61A 2DUNA 1R4ZA 2HBRA 3FMPB 4YRFA 5HJ7A 1JKXA 3WDSA 4ETNA 1BVRA 1YRBA 3S28A 4EATA 3QTTA 4K9PA 4HQLA 5AHKA 5JDIA 2EKLA 4XGNA 3OLQA 4J75A 4ON9A 1OSNA 2J5QA 2VCYA 2VPPA 1E5LA 3IA7A 4MUIA 1YKSA 4OQFA 4QJBA 4D80A 4E21A 5COQA 5EZYA 4OJNA 2WMYA 3JQAD 1K2WA 4RIFA 4M9CA 2XKBA 3LHKA 3ZHZA 1UWVA 3MTJA 3M6AA 1C30B 5FOXA 3PQ3A 1WB6A 2E5WA 1PZXA 3NYWA 5KJ1A 2D06A 2RAUA 2XGOA 3BC1A 5EMKA 3C1UA 5K09A 4ZA2A 2GM4A 1TZMA 3JVIA 3DV9A 1QYCA 3BG5A 3PK0A 4OLHA 2Q6IA 2VDRB 2ZT7A 4C3ZA 4CV0A 1W581 2H31A 4RELA 3RYTC 5KWJA 1O6FA 5KNBA 2CT8A 2VPXA 1DRWA 1EP1B 3VGJA 4BB9A 2J09A 4BZZA 1NLUA 3FOZA 3CUSA 4S0ZA 4J94A 4EPYA 3HB4X 5KPJA 2JHAA 1AGRA 3AWDA 3PR3A 5BP7A 5C7OO 1TADA 3GXBA 3OZGA 4KIJA 3O0TA 4IYRA 2QJRA 2WJGA 3PDJA 4R6XA 2A9VA 1LK0A 4IMRA 3ZQ4A 1HG0A 4Q15A 4JLPA 4JI7B 1RVV1 4BNLA 1T1JA 2AMVA 1X7DA 3M3DA 1Y8ZA 1JG3A 1N6IA 4NBWA 1GFIA 2FQXA 1Y63A 4KN8A 4IDEA 4MO2A 2EFEB 3BQ9A 5JTUA 4G97A 1DDOA 3K73O 4OM8A 2YVKA 3F2VA 5ALTA 3TR6A 2MCFA 4N3CA 4C29A 3J81k 4DVGA 2JGRA 1SMKA 4XQ9A 2LWIA 3HVUA 1MF7A 1V41E 4W6QA 4DZTA 1YD7A 3L8GA 3R23A 2GPTA 4WVLA 3DO5A 3WGKA 5JAMA 4ZDJA 2ORVA 2FJ0A 5LLDA 1DIRA 3TQRA 2ECOA 4F9GA 3PFFA 3R7DA 3I61A 4IV0A 1GY8A 3FE2A 1YGYA 4UASA 3Q12A 1E1DA 2AZ4A 3UT6A 4TT3D 2R8RA 2ZDHA 3W6NA 4UJ5A 5TPWA 4M6WA 4D43A 3CONA 3FKSA 1Z88A 4RABA 3IBGA 2I4RA 2AI3A 3DNFA 1J8VA 1P9RA 2A35A 3D4PA 5EJ7A 3RC7A 3CMMA 2HWUA 2YYSA 3D8SA 2C82A 1GNTA 4B31A 3OQVA 1EDZA 3DVQX 3G85A 1T1GA 3RD5A 3OO1A 4L3VA 4Z0TA 3CSUA 4HGPA 1I36A 4PPQA 4N65A 1DEOA 1F2VA 1GLGA 4L4ZA 8GPBA 1AHPA 1NMZA 2C5HA 1V8FA 4ZZ3A 3A26A 1JIVA 3QG1A 3H1FA 3IUBA 2PM8A 4B6EA 5JJCA 2OL4A 4B75A 3UW1A 1M2VA 2P30A 1L5OA 2HDNB 1IDN1 2QE7A 1H1DA 3GFFA 2C1XA 2DG2A 3EWIA 1KC3A 3V7UA 3SSMA 2EVWX 5EHXA 4QUJA 3S1LA 3FVVA 2OQ2A 3K0EA 2XPCA 3FSJX 4UDXX 1R4NB 4R8SA 3UAYA 4XWOA 4RK4A 2HA0A 1AZLA 1JPJA 4L9SA 4XCVA 5FXMA 1SBHA 5CYGA 3O1JC 2VOJA 3D0KA 3LCVB 3FSRA 3LIPA 4MS3B 2ODAA 2CUTA 5FWXA 3KE9A 2FK7A 5CB6A 3VZSA 5EIBC 5FOSA 3W5HA 1GPYA 4W5HA 3LF1A 2FWJA 3HSSA 1ID1A 3S7ZA 4BUJA 1POWA 1CUIA 2PD4A 16PKA 1GCIA 4E08A 3P2JA 2UKDA 3U6KA 2Q1TA 4BZWA 1PS0A 4NY1A 4W6ZA 3B85A 5H0IA 5KWEA 1Q3HA 2PGDA 3FSEA 4HK4A 4HQRA 3V1TC 3V6MA 4W5TA 2NM0A 3M4NA 2VS1A 1ZH4A 2H1RA 1L5VA 4JLOA 4JI0B 2FW6A 3DFFA 1M2KA 5FX2A 2AN3A 1W5SA 1Z0KA 3JQ7B 3KXDA 3MOIA 3RBVA 4P0QB 3BOSA 1Z39A 4MGHA 1MQ9A 4GI1A 4BEWA 3SM3A 1VMEA 3IS3A 1WY7A 1DKOA 1OXBB 2XJ9A 1ZGBA 3FAZA 2NQTA 5DHQA 2G40A 3SSOA 3PHLA 1FYWA 3K5PA 2E82A 1F8GA 4OMDA 5J5AA 3ADBA 2X2FA 2JVJA 2X3YA 3MHPA 3QA9A 4J0KA 1G5IA 3WQQA 1PHRA 4DDKA 3T5PA 8MHTA 2DFVA 1BXGA 1JE0A 3KHUA 1U6JA 4IDNA 1XXHA 3BHIA 1OBHA 2J0EA 4R9SA 5FF9A 4N82A 4ZQBA 3WTCA 3WSTA 721PA 3AVXA 2GCOA 2RSLA 3M70A 3OT5A 4RANA