1XAKA

Structure of the sars-coronavirus orf7a accessory protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
b'CELYHYQECVRGTTVILKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARS ORF7A ACCESSORY PROTEIN
publication title Structure and intracellular targeting of the SARS-coronavirus Orf7a accessory protein.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 12
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1550 Mainly Beta Sandwich Immunoglobulin-like SARS coronavirus X4 1xakA00
1YO4A 1XAKA
chains in the Genus database with same CATH superfamily
4N2NA 4PV8A 4TLUA 1JI2A 4X80L 1MPAL 2V9RA 3SYAA 4YHML 2Y9RT 1TSRA 1EGJA 2G0LA 3Q05A 3PDGA 1U8CA 5FYKL 2Q76A 5GGRY 4R90L 2NSMA 1RZGB 3KBPA 2XZQH 4YDJA 1XHHA 3UYOD 3FTYA 4OV6F 5BUAA 5I23A 2DS4A 4Q74A 1ES0B 2IDQA 4K8RD 1WVZA 4OD3H 3WTVA 1AIFB 3DI2B 3HHRB 1KUMA 2IH9A 3O2DA 4RQQA 1F4XL 3HW7A 4PJAF 4Y4KA 4MMZC 3WHXB 1J11A 2YD2A 4YHOL 1XR8B 2V37A 4QOKA 1F86A 5TGBB 3P4LA 5C2UB 3NYKA 4JLRA 5E7BA 3QNFA 1ZTXE 2EABA 2X0WA 4ZT1A 3X3GH 1SFDA 2NSQA 2CM6A 2IQ9L 3UCRA 5DZOA 3LN5A 5TE6H 1EJ6A 3EHBB 4NRYA 1I9IH 4HX1B 1S3RA 1PU0A 1MUJA 2A9NH 2ENQA 4I1RA 4L5FH 2NY5C 4DUXA 3TCLB 5LVEA 4DK6A 1G9HA 2MQCA 4G1EA 1KBGL 4HZAA 4QYOB 4UV4L 1FFOB 2DM7A 3B7YA 2FLBT 3HC0B 5KVDE 5KVFH 2DQIH 1HVXA 1P6FA 4KKBD 5AEAA 2J1YA 4FQPA 2GJZA 5EBMA 4YSSA 5TPWL 5C09D 3BRFA 3D4YA 1G9MC 2K3TA 4QHUA 3WGVB 4HIHA 2OBGA 1OCWH 1OT2A 3P9WB 2R2EB 2WP3T 5L0QB 1H5BA 3B3BA 4J39A 1AR2A 4JFDA 1FDLL 4ZS7H 2EDKA 2R23B 5I74C 4P9MH 4FQ1H 5KJRL 2FATL 2FLRT 3ATDA 2GFBB 3RGVD 3V0JA 3EJQA 3ZYOA 1UXSB 4N5UA 3QZNA 4XPHH 3VYPA 5BMFL 5LHDA 2A0LC 2XWBB 2G60L 2X2YA 1QPPA 4PB0L 1ADQL 4PMEA 2EIZA 4FNTA 5F21B 1I1AD 4WF7A 3F85A 1T6WA 3O4LE 2E4FA 1FL6A 2W9DL 2ITFA 3F6JA 2EUZA 5PCYA 2BCMA 4N85A 3EFOB 2Z92B 4LVOB 4Q2ZB 2Z1KA 2YGQA 2HFEB 3FS9A 4HAFA 3BI9X 3KCWA 5A2LH 2UVFA 5SX4I 1BECA 4Z77B 2OR7A 3GMLB 4FNLL 1T0MA 3OMIB 2TAAA 1H9VA 4ANVA 4HD5A 5FGBA 4E5XA 3NTCL 3G6AB 1U8LA 1CI5A 4PBVC 2MCG1 2IPKA 4ZW5A 3TEZA 2BNQB 1IO4C 4NQCD 3H0TA 2Q1EA 3UTTE 4GKZB 3C87A 1F4WH 1PPIA 2RR3A 2FT8A 2VNCA 3N9GL 4LHUA 4WSJA 3QQDA 4U1NB 3IJSA 3R8BB 5EZOH 1VFBB 5I1DA 1R3HB 1FFNB 5I5JA 5L9DH 3OKMA 5H4ZA 4RGNB 3P2BA 3DSNB 4OBRA 3TO4D 4A66A 5AW2B 1ONQB 1XB8A 2EXWD 4V1DA 1HE8A 1HILB 1WWBX 3HFFA 1X6NA 4PS7A 2GTWA 4GFTB 1KEGL 4YHYC 1NFDE 3H3PH 4RMBA 4AC2A 1DJWA 3F7VA 2YRZA 3CSPA 2KPWA 3QO0A 5KVGE 3V0WL 1Q9OA 3RWDA 2UYLA 5DMKA 3O0LA 4YE0A 4R7VA 2P5WA 3SKNA 5HYFA 3BESR 1YEHH 3U4KA 5IY5B 1NCTA 3H7BA 4CVWA 1ZA3B 3QUYC 4X7EC 1GGIL 2YR3A 2B1HH 3FUDA 1QFHA 3AT0A 2J1KA 3GBLA 2YUWA 4EZLA 2G75A 3F12A 3WJMA 1NUDA 4QPEA 4DN4H 3RVUD 2YQ3A 1KZQA 2XX1A 4MYWB 1U3ZA 1XCWA 2Z65C 1HI6A 2A4EA 3AQDA 3PDOB 3B9AA 4ABVA 5I75C 3VI3E 1NAMA 4U0RC 5AB1A 5D5MB 2NUTA 5LNDA 1YMME 2N0KA 2KLRA 1QTSA 4RLDA 4E5XG 1IGIL 4WHYH 1XCTA 3LEVL 3MA9L 4WHCA 4JO2H 4P3CH 1IGJB 1NANI 3A5VA 5HHMD 4WKXA 5F97E 1AGEA 1WZAA 3IDYB 4UIKH 5DJ0B 2WOYA 5D6CB 1NINA 1JNLH 4LHUG 5AVZB 1S3KH 3O3BB 3R1GH 3TZVD 1HFUA 4EI5B 2V5YA 2WXGA 4U6YB 5I71C 3M8OH 4I2XA 5F1NA 4J3SA 3E7JA 1AZUA 4G9FB 3E6HB 2RQEA 3FOMB 3IDXL 3OLGA 1UD2A 3V0VA 4TLSA 3C5ZA 1UACH 4YUEL 2FJGA 1TZ8A 4KH9A 1JPGA 3TPUB 3ZHNA 3QT2A 4EEEA 2Q3XA 4MDJB 2CDFB 3QC6X 3B83A 1WFNA 4JREC 4NAQA 2KERA 4OUOA 2LFEA 5GGSA 5AVTB 2DQ6A 1G7LA 1VB9A 1W72H 4PRIA 3KLLA 1GH7A 5ERWA 5F96H 3NPSC 2VABA 3H9HA 1PZ2A 4AMKL 3D39D 1VPOH 4ZDHA 4J8QA 5CEXB 2VDMB 3NRFA 4M7JH 1DO6A 2FEEL 3K6FA 3DHMA 4LPXA 3I2CL 4BKTC 3ZT6A 3MV8D 3M1OA 3FPXA 1JZEA 3WHE1 5I8KH 1PZCA 3BGAA 2YJLA 1NMCC 3FT9A 4PG9A 2EUWA 4XWOC 1QR1A 3JV6A 4NBXB 5DZPA 2EIJB 5BPPA 3V4PL 4U1LB 5KTEH 1KXTB 1RZJH 1I7TA 2XZZA 3PE9A 4BHUI 4XXCC 2BVEA 5AYQA 1AR1B 1R24B 3G6JB 4WFEE 1JNHB 3FFCB 3OHXA 2DIBA 2UX7A 4XNXL 4OZGA 1RIHH 4JFQA 4UV7L 1ZK5A 4W9HC 3FU3A 3CFQA 5GGVH 1HH9A 3N0PB 3RIAF 1NL0H 4KMTH 3ETBF 1S9WA 3NSYA 4X9FA 2R4RL 3KWUA 3DYMA 3VH8B 4WK4B 5GGVY 3UPAA 2AW2A 1MIML 4LLUA 4OIFA 1JXDA 2YK1L 5ICYA 3S4SA 1MCEA 1E6OH 1L7TL 1BFOB 1P5UC 2DQCL 1IBGL 2Z9TA 2X2HA 1H3GA 3FHAA 4OY9A 4G8GD 4KJPD 2LE9A 1CUOA 4PIRF 4HS3B 2F7QA 1JHTA 3O9WB 5C0IB 3RB7A 3V95A 5IVXB 1IEBA 1XT5A 1KYFA 2HT2C 4JFDD 4GAJH 1IKNC 4WU5B 1VGKA 1YPZF 2OL3H 3TH3T 3MRJA 3VXQB 1Y07A 3QRGL 4O4YL 3MLRL 2DQTL 2DH3A 3QCTL 2ZKMX 4L8SA 3L2NA 4YXHL 3QH3B 2L0DA 4TLTA 1P7QB 3NSDA 1DL7L 4QXWA 1XCQA 2L4OA 3TT3L 4HALA 1EJOL 2YD5A 2G3XA 1TJIH 4X4MA 1ZSDB 2ZOUA 4ZUVB 4TNWF 1SDDB 4F9LC 1MW0A 4N2IA 2CLRA 2JCCB 3QNXB 2P8MB 3FO0L 1WFJA 1MW2A 1I3RB 3B9VA 3F8UB 1CICB 1VGEH 2H1XA 1B4JH 2PCPB 5LN4A 3FPYA 2X53A 2TRYA 1CIUA 2UY6A 2OFQA 4M48L 4BXSV 1U9KA 4JZNB 4EN2A 4FP8H 4PJHB 4UINH 4PR5B 3L4VA 1CT8A 4I18C 5ALBL 4QWWD 1TQCC 4L3AA 5E8DH 1UTDA 4PLKD 1J05B 1PF3A 2AJZB 2A1WL 1RUPL 5DRZA 5GSVA 1SXNA 3T8XB 4AX3A 2JJVA 2V17H 3O6LL 3DETD 3JWOL 2D3VA 2NTFB 4LPWA 5E6UB 3QEUA 4HWEL 1FRGH 1AQMA 4KZDH 4EJ1C 1T5KA 4GLRI 4JQVA 1NMAL 4GKSA 1C5CH 2X4OB 4S1QL 5DQ9B 3GK8H 1PG7H 5I1IL 1ZLUK 4KHTH 4L8DB 3QARA 4JY4A 4U1JB 2Q10A 4Z7AA 1JI1A 1LWJA 2H9GB 1MFCL 3BW9B 2RALA 2M83A 5T3ZD 5FUOL 1KXQA 1LEGA 2H1PH 1INDH 1A9VA 5DRNA 1RZQA 1UENA 1KMGA 5AAMC 2KS0A 2FWOB 1EEYA 3PWNA 4HG4K 3DIFB 2X70B 4DF9A 3WI9A 4BFFA 1J0HA 1JGVH 5T5NF 5FHAH 5D4JA 4PJ8A 3WKQA 4X6EA 1UZGA 4X9IA 1GMEA 2APVA 5JO5A 1KT2B 3SYQA 1SBSH 3BPOB 3GMMB 4N9GB 2NTSP 2XKUA 4ODUB 3ARQA 1L6XA 5LWYL 5C09B 1LE9B 1MNUH 3SBWA 4Z18A 25C8L 4PEEA 4NO3A 3UTQA 5F70A 3GXNA 4UQ2A 2CCVA 3T0AA 5E5RB 1HDMA 3D2UB 2EXSA 3GMOB 1IAMA 3IDMB 1VIWA 2WP3O 3ZT5A 3SPHA 4PS3A 4R7NB 3GRBA 3LMJH 5HTSA 4AM0Q 1TFHA 1TZAA 4YX2L 1W6LA 1ZVSA 2J25A 4AYDC 1A6PA 3GZQA 3RWFA 3W82A 4F92B 5DHVB 5TE7L 4K7PH 5AB9A 1MW3A 1ORSA 4R26L 3BZ4B 3NSJA 1BM3H 1IVLA 1KJVA 2ZOLA 1AP2A 3DUSB 1MFDL 2H6PB 5BXFB 5B3SB 3JWDH 3OXSA 4K7PY 1IC0A 4Y7OC 1UWEH 4UQ9A 5C0BE 1I1AB 2CALA 1PX3A 1DEEB 2WQSA 4GAYA 2X4UB 3SGEH 4ZOAA 4MCYB 1ZRUA 4JQXC 4LMQE 1JPTL 2VQ4A 4GG8A 3SEPA 4C8XA 3OHMB 3D39E 5IFJA 3SPVB 1RJYB 1UOVA 4XO8A 4YHZL 5MEPA 4FNQA 1IGML 4F33B 2WMPA 1MCPL 4OGZA 2Y2WA 4BE6A 2F1AA 3QULA 4ELKA 1JZ2A 2IAAC 5GGUB 5E08H 1CN4A 3B1TA 1HYRC 3MV8E 2YD9A 4KKLD 4AVJA 3U7AA 3ULUH 1KLFA 1HWWA 2XV3A 1IIKA 1J18A 4LKXA 4XVTH 3VE0B 2EICA 1P6AB 5HYSA 1KIRA 2DQFB 4QHMB 5AL0A 4X4XB 3OXRA 3FC8A 2BO0A 2H47C 2NW2A 4TVPD 4PGZA 4IBWA 4NQCB 4G6AD 4ACTA 4DZBB 1DEDA 2NY5L 4OM0H 5DJAB 5IUCA 1I8UA 5HI3D 2A77L 1F3RB 1HHKA 5E9AA 3X13A 1DJIA 3ZE1F 1OAQH 4Y9FA 4D94A 4BZ1L 2CE6A 2HFFB 3BGMB 2VXQA 2R39A 3C9NB 5BV7B 1EMTH 2OMVA 3KJ4B 4YXLH 1KCVL 2GTQA 3O45B 1B88A 2SEBA 4NQUA 4XOAA 4C54A 1TFPA 1UJ3C 4XGZB 1AFVL 1NDMB 1G9ML 1FH2A 4JB9L 2JQAA 3QNYB 3QQ9C 1B0RB 1EHKB 4XHJD 4YHPA 2EC8A 4Z76A 1BMWA 4P05A 1U8NA 4I0KA 5CSGA 3BWUF 5TDPB 3SN6N 2E3VA 1VZIA 3F58L 5CNHA 4GG6B 4NC1E 1TITA 2F1BA 4YZFF 5FV2A 3SDXE 1S7TA 2A6DB 4G8GE 2EYRB 2P1YA 3HI5L 2X4QB 3HPLA 1EXHA 1T1YB 3PQYA 3HZMA 1PZUB 1BQSA 1KB5A 2R7EA 5LBSL 5TQ2L 2WWOA 2FIKA 4UTBH 2Z8RA 2KUTA 5E4AA 3UADA 1QUNA 3B7SA 1IIIA 1OZUA 4U1IA 5HYSG 3UZQB 4N8CL 2BH0A 4XN1A 3BUPA 1MH5B 2IQAA 3ZZQA 1WS7A 1U8IB 2X3AA 5HHMB 1NEZA 1T1XA 5IR1A 4K2UH 2OQJA 3QAZC 4FNSA 2W91A 5EU3A 4E41A 5DFAA 1NGYB 1PKQA 1ZTMA 4P48A 4P9HC 4ZUSB 5IMMA 1F90L 4MX7B 2H45A 3KXFE 2QR0A 4ZTOL 4F91B 4OAWB 3TZVB 3TVMB 2VC2H 4W9KC 3FCSB 2Q86B 4AIZA 1A5FH 4HIJA 4L3CA 5CSZB 1V7NH 4EBQH 3D8MA 5EOTB 1ETZB 2G4EA 2OMWA 3P30L 1QYGL 4KKAD 2VUOA 3TEUA 3V4VH 4MJ2A 4K3EH 2QKSA 5LGJB 4BDVB 4N5EC 5SX5K 2G0KA 4QHKJ 3MODH 2EEBA 3O0RH 3P9MA 5CEYB 4XMUA 5C6TH 3V6BR 1MI5E 2KH2B 4DGIH 1J48A 3NIGF 3GB7B 4MB4A 1CXFA 3NH7L 3WDIA 1N67A 4OVUA 1S9VB 4LSQL 4S0SD 2X4NA 2P48B 5FYJU 5IB5A 3TF4A 4CC4A 3ASWA 2H4EA 3HAEH 5TE4L 3GRGA 2DKMA 5CCHE 3S6CA 4Z7QB 4QYAA 1U8CB 4Z7WE 3KNBA 2A74A 3RX7A 4M7LT 4LCCA 4YDJB 2R51A 4I0PC 4U31A 2Q87A 2WQRA 2A6JA 3DKHA 1SBBA 4PGBA 1YEEL 5FO8A 3DJRA 1E3ZA 3EFFA 4RQQB 4Y4KB 4YS4A 4ONFL 2F54A 4RA0C 2ZP0T 3B2UD 1NGQL 1SXAA 4HXAL 1TZHA 4PJAE 4QOKB 4MMYA 3T0EA 3ZKNC 4DP5X 1J0JA 4LAQH 2LVEA 3FUEA 4J4PA 4JLRB 2A7BA 4L9LB 1MZZA 3LHPL 5AZEH 5IJVA 3OKDA 3QUXC 4ODHL 3LN5B 1NUNB 3GUTA 4NRYB 5FM8A 5H37A 5BO0D 1MKFA 1MUJB 1YEIL 4Y19A 4APQA 5CR1A 1HYSC 4GBXC 1N2RA 3OLEA 4I4WA 4G1EB 1XD1A 3TIDA 1TQWA 2EVFA 3VFGH 1MFVA 3R06A 4U0QB 1J1PL 2W80C 4NLHA 1UA3A 2DTSA 2J21A 4FFYH 5FYJH 1NCAH 5J57B 5I8EA 2BIQA 5C3TA 4XXDA 5KBLA 3L95A 2GJZB 5E9DE 3QWOA 1J86A 1BQ5A 2WVUA 3QFDA 4YBLC 3EZJB 4QHUB 3HPJA 1MFEH 1XF1A 2XTJD 4HIHB 3TGXA 2VLKA 5T5FL 2DKSA 2FEDD 1H5BB 1DQLH 4XT1C 2YAMA 4JFDB 2VR9A 3QFJE 3U2IA 3O3AA 2WUCL 3Q8CA 1T0OA 2Y7OA 3CDYA 3I6LD 5CEZL 4RRPG 5E5MA 3GFUA 2BY0A 1G7PA 1J87A 4XCCL 1UWXK 1DBAL 2AITA 3BT2H 3OKEA 3SOTA 3K8KA 5J6HA 3BDXA 3BD4A 1O9ZA 3L5XH 2GY7B 1ITBB 3IJEB 2EIZB 4EI6A 1XH3A 3GSVA 1DQIA 1T7ZA 2VDLH 1EAOA 4FA6A 1AKPA 3R4DA 3L3IA 5B1JC 1FL6B 2ICEA 2F8OA 3QJRB 5H37G 2YKLL 3ZIYA 1LQBC 3HBPA 5HDRA 4M6OH 5BVJA 4BRJA 4KRLB 3CSYA 5AYUH 3FOLA 3NOIA 4JHWL 2WZ5A 4EOWH 4UM8A 4S1DD 4YDLB 2PCXA 5E2VH 1T0MB 1LTXA 3GZPA 4TNEA 2FX8H 4HAGA 4E5XB 3RWEA 3HMXL 3UTPD 4ELMA 4DGYH 3VYNA 3PGDA 1U8LB 2GY5A 3BKML 4OFDA 1G84A 2IPKB 5KOMC 1EVTC 3PUCA 5JPMC 1FJ1A 1ITCA 5L4FA 1OALA 1TYEB 2H3XC 3H0TB 4FS0A 1QLEH 2X6AA 3WD5L 4LHUB 4AK2A 3G6DL 3QQDB 3IJSB 4RCAA 1HJCA 4HJJH 4G6KL 4OT1L 3BAJA 5DJZA 4ZFQA 5FDWA 1P5VA 5I1DB 2ADYA 4PJ9D 4WI0A 1T83C 2D7TH 3BHBA 2D73A 2FT6A 4B41A 5C70A 1RPUA 1GSMA 1MELA 4V1DB 2Y6SC 1JSYA 1KCRL 5AW4B 5D96C 2QV2A 1JNNL 3KYAA 2GTWB 3EYOA 4ZFGL 3O3UN 1ZA6A 4LARH 2FCBA 3F7VB 4LLQB 3QO0B 2YD7A 4PWFA 5CBAA 1Q9OB 4PJAB 2UYLB 3RWDB 5DMKB 5CR8A 1VAHA 4I3RL 2B9AA 2P5WB 4FQCH 3SKNB 3ZTJG 4FG0A 4JRLA 3CZKA 3WS3A 4WNJA 3H7BB 3D7PA 2JI2A 1HOEA 3ARZA 3GWJA 2YWYA 2G75B 4FNRA 4IRSD 4A2DA 3F12B 4BGDA 3WJMB 1DFBL 2XZCH 3RJDA 1HI6B 2D2OA 4FTVA 1F11A 5AWNH 2MFNA 1QQDA 3IETB 2OK0L 3QQXA 1NAMB 5DO8A 2BK8A 2NUTB 2UUDK 4M1CC 5JQIB 3VG0H 3ZTCC 2H26A 4LPTA 1SN0A 2F9BT 2X1QA 4NUJA 1XCTB 2Q8BH 1ACYL 1OK8A 1AZCA 3HN5A 1AGEB 1OTUC 3QIBA 3RKDC 4E41D 3WY1A 3ZRFC 1K5WA 3ZTNH 3B8SA 3ULVE 1WD8A 4F27A 5L8KB 5M7QA 2O6PA 3TCXA 3RVXD 2JXMA 4I2XB 2X5PA 5F1NB 4F7EA 3AUVA 3QIUD 3HG5A 3GMNA 2EDEA 4H20H 1K9TA 4FFVD 1J0IA 4HIQA 2AC0A 3V0VB 1MF2H 4Z95L 5DRWA 3KLQA 3C5ZB 3QG7H 4NPKA 2FJGB 4WI6A 2J4WL 1C7TA 3NABL 3VVVA 4OZIE 4TTDC 1JPGB 3KGRA 1H9DA 1BVLB 3BUIA 5MP6H 2XUWA 3V4PA 3GIVA 4PAZA 4QI3A 3CZJA 3LIUA 5GGSB 1G7LB 3OZLA 2TSBA 1NA8A 3DVGA 4PRIB 4QHNA 5ADPL 5ERWB 1KV3A 1AE6L 3CX2A 3H9HB 4AQ8A 3K46A 4ZDHB 1EHXA 3TU6A 4Y5YC 1NCCH 1V54B 5T1DH 1IGYA 4AM0A 2BVTA 5HDBE 4ZK8A 4DK5A 1CLOL 4FZEL 5EN2A 3U7WH 2IWEA 1ACXA 4FF9A 5E1IA 3SHSA 3ARGD 2E47A 2VXUH 3BYYA 2Q2EB 1HEZA 5HVWA 4I1NB 4LL4A 1UM6L 1QR1B 3GPSA 3JV6B 1BFSA 2YA2A 4HUCA 1IAII 2F54D 4PSPA 1W80A 1I7TB 2B9BA 4A55A 1JF6A 2XCMC 5L6YL 2QVMA 5DURD 3T0ED 4RDQF 3ZKXC 4X7TA 1GOHA 3FUFA 1J9QA 4J4PD 3EOTL 4OZGB 3RDJA 4JFQB 2AXJA 4QRRA 3EUDA 5C0AA 2NY4C 1Y6NR 3VXSD 1HH9B 3BDBA 1LO4H 1GYWA 1TJXA 4HXBL 4NKMA 4TL4A 5EIIG 4YXKL 3TONA 1FA4A 5BO1H 4Y19D 1S9WB 4AJ0A 3FUNA 5HVGB 4APQD 2GSGA 3EUUA 1U2YA 4NGHL 3NEXA 3QXTA 2WWMD 1MHCA 1RULL 4R4FH 5ICYB 3EH4B 4HCRA 4JRYA 5LCVA 4HG4J 3S4SB 4NWUH 2FHFA 2FBRA 1B90A 4F1ZA 5IFHH 2JJSC 2XTJE 4TULH 1ID5I 4KJWD 4NEHB 2DH2A 4FMKA 1HL8A 4FYTA 2YAOA 3FQ4A 5IWLA 1D7BA 4Q9RL 4JPKL 2VLKD 2XU9A 3I6LE 4A39A 1JHTB 1RIUH 1IEBB 4TUKH 3ARPA 4X7FC 5IMOA 3AXHA 3NJXA 5DYOA 1OARH 2GBUA 1VGKB 1RSYA 3HRZA 4PJIE 3AJ7A 3MRJB 4OLZH 3R4RA 4QIRA 4ZAKA 1F4YH 4B9GA 5I8CA 4BIKA 3MHZA 4KQ4L 4L8SB 4AYSA 3PL6A 2R4SL 2DWEA 1YPZE 1JHLH 4ETYA 1XCQB 1S9YA 1K72A 4IW4C 1X5KA 4LEXL 4OGQC 3BAEH 3MJ9H 5D9SA 3N42F 5J13B 3CVHL 2CLRB 1F1DA 4XNQA 4LPUA 2K1MA 5AZ2L 2XZAL 4WJG3 2ZPKH 4XMTA 5IREA 4WNQA 2APBA 4N2LA 1S8DA 3ZKMC 3VFSA 1WP6A 2UY6B 5JW4Q 1WQVT 5B39G 4PHZA 1CT8B 4N87A 4LOUD 4NZJA 4KROD 1VCAA 3EAKA 4WK0B 5GRVK 4YSUA 2E7DA 4ENEC 1QWNA 3ABGA 1UVQB 3S2CA 5DRZB 5GSVB 5CM1A 4JZJC 4IOSD 2BSBA 5FLVA 1CVRA 3OWEA 3GSWA 4YSAA 3T4AA 2CO7A 5CKAA 3B5TA 4XBPA 2VDRB 3QEUB 1RZJC 5E1QA 1CD0A 3DIVA 2CHZA 1S2EA 1TU2A 1N0LA 2EYTA 3QORD 3UACA 1Z1WA 2R2CA 4MKTA 2N01B 5I0XA 2AXWA 4YN3A 3V5KB 2AJYL 4GKSB 1E5YA 4XCFH 3C8HA 5AW5B 2FX9L 4F5CE 1XGYH 4JY4B 1RHFA 4QHLA 1NOLA 5ICZA 5E2WH 2VLJA 5DD0H 3F7RA 5I1LA 5JNYA 4DP1X 1LEGB 2DLIA 2DMHA 5DRNB 2CBTA 3DX8A 4X6FA 1P7HL 1EEYB 3PWNB 3FCTA 2WXPA 4ISVA 4XP6H 5J1AA 1O9VA 4X6CE 4Q52A 4GW1A 1B6UA 3H53A 3RQ3A 1J88A 4GQRA 1RI8A 4PJ8B 4X6EB 5FYLE 4QMEA 3IKCA 5JO5B 4FTVD 3G04A 5HI4C 4ZMPA 4XC1H 5A16A 1A3LL 1ZLSH 4UT9L 4NO3B 2GBAA 3BVWA 3UTQB 4HK0A 1KJ2A 4UQ2B 4I8DA 1BOYA 1HDMB 3AMLA 2ESVA 1ADWA 5KANG 2HMID 1P53A 5I28A 3CZNA 1UFUA 3QIBD 4HC1H 3GHEH 12E8L 1NGPL 1ZVSB 1QFWL 4R8WL 2JF1A 2WQUA 5EOCJ 1IC5L 1TJMA 4U6VH 5F2FA 3P3SA 2UZYA 2VDMH 4S1SH 4TXVB 2ADFH 1WZ1H 5IHBA 3GJFK 4JG9A 1HXMA 1ORSB 4KKZA 1KJVB 4LP4A 3SE3A 1AHWC 1AP2B 2L04A 2N7AA 2ZOLB 3LVTA 4EN3D 1NCDH 2QLYA 5JOFA 5KSAD 1TQTA 1YPZB 4GAYB 4IK7A 1XQ4A 1BLNA 1N18A 3VDBA 4GIOA 3OAUH 1I9JH 1G7MA 4GG8B 4HW6A 5IFJB 1VHPA 5IHHA 4PJ7F 3ORJA 4M1GH 5MEPB 5I1HL 3CDZA 2WMPB 5D1ZC 4JBSA 3UO1H 4U33A 1RVFH 2O5ZL 4JCWA 3QULB 4ELKB 2DW5A 3O8XA 2XQYK 1AQKL 2IPTH 3BYTA 2IDUA 5C92A 1KLFB 5I30H 1VACA 2YC1A 3NSFA 3IE4A 3LQZA 4LKXB 5HYSB 1KIRB 1H3VA 2F7RA 2OAAA 3OXRB 3G7TA 3GSUA 2VDOB 2JQMA 5I5MA 2NW2B 4FXLA 4PWKA 2X12A 3V6OC 2O5YL 4MJIE 4YHNA 2EDBA 4HFWA 4D2NA 4IMKC 1OOAA 1B4RA 3GMPA 1HHKB 3X13B 4X5XB 3CE1A 3CFEA 3MBEA 3RPBA 4FYQA 1F1GA 1BXVA 3VXSE 3ZE1E 1DJYA 2OMVB 3ETBJ 2BSTA 2SEBB 2N1KA 2V2XA 3DURA 2Q9OA 1FUNA 3L3OC 1XGTA 4JO3H 2W1NA 1NAKL 4YHPB 4Z76B 2EJ1A 3UJJL 1U8NB 5DLML 3A21A 4DEUA 1KXVC 4FI8A 1A02N 2QPUA 3ZQWA 5B4MD 1LO2H 2WXKA 5C3LD 4FLOA 1H6EA 5HHXH 3DV6A 4Q0XH 4OGXL 1S7TB 2NZ1A 4Y9GA 2B3IA 4JRYD 3WAJA 4NZDA 5GISL 3ECQA 1M2VA 3HPLB 4YZFE 5DJ2A 3BH4A 3PQYB 2AJVH 1KB5B 2R7EB 4WCYH 1FLRL 1DSWA 2FIKB 1F1AA 5I1CL 4KPHL 3BJ91 5KYUB 1QUNB 3GHPA 3FBKA 5AOKA 5IZ7A 4U1IB 5M95B 2OXGA 1SPDA 2CMRH 4A7GF 2IQAB 1LM8V 5HI5C 1ML0A 4DP4X 4NUQA 1AMXA 1G7JA 1EZVX 1NEZB 1T1XB 1TQVA 3QSKB 5IR1B 1KB9J 2OQJB 4YDNA 5EU3B 5IQLA 4E41B 4ZFFA 1PKQB 5IMMB 3AROA 1GGCH 1P7BA 3J8F7 4KK6C 4HLZG 3MLVH 4KY1H 4AIZB 3HCVA 4HIJB 4L3CB 3WJJA 1JE6A 4JGMA 4TQHA 2HPOA 2XZQL 3QIUB 2OMWB 3LJ3A 3MYJA 2E7MA 3TBSA 1JDAA 2AJXH 3BQUA 3TEWA 4K8RH 3FQYA 1J12A 2ATPA 4OD3L 4I5BA 1RJLA 1SQMA 1TJHH 1EFQA 3UH8A 1OAJA 5AKVA 4F57H 1BEXA 3FQNA 3ZDXF 2O61B 1W16A 2B7DT 1ODAA 3FT1A 3P9MB 3X11A 3CHQA 1QUPA 5IHZA 4M5YH 1KBPA 5IB2A 1DQDH 1HIMH 3ULUC 1EXGA 3X3GL 1T20A 1X5YA 2X4NB 1A8ZA 3FK3A 3NZHH 5IB5B 4K0OA 3VRJA 1QSFE 5CLTA 5TE6L 1I9IL 3V6FA 2ZAGA 2A9NL 3ZYJA 1G1YA 4L5FL 3KNBB 2A74B 4PJ7A 2ADGA 4C47A 1IV8A 1CLYH 3B5HA 2OR9H 2A6JB 4PGBB 3U79A 1YZZA 5FO8B 5E03A 2CRIA 2CD0A 3MLSH 3OM3B 5KVFL 2DQIL 1XTMA 4X7SH 4BZ2H 4R0LA 5E6YA 1YN6B 2V5TA 4X4YA 3ULVC 2F54B 2BPBA 3LS4H 3KH3A 3NCBB 3NFPA 3RNKA 1E7VA 2Y07H 3HZ3A 3T0EB 2UVEA 4MMYB 1A25A 1ZE3C 2PWDA 4DP8X 1K2DB 2E59A 1OCWL 3OKDB 2VLJD 4I1PA 3R0NA 3ZE1B 3BFOA 3GUTB 5CJXA 4UQ3A 5T5FA 1EFXA 3NA9H 4ZS7L 4E42A 3N40P 4P0DA 5KN5A 2R69A 4Y19B 4APQB 4P9ML 4FQ1L 3AFLA 1N2RB 3W0WA 4I4WB 4N2FA 3CK0H 3NZSA 1O6VA 5DHVH 2X6MA 3TIDB 3ARBC 4JQIH 5KYYA 3I50H 4XN5A 3R06B 2IWKA 1GVIA 1WITA 4LK4A 4XPHL 5B38A 3BUYA 3EJPA 3LDBB 3NIDF 3A4AA 3G08A 4RSVA 1FGNH 3FT2A 4AH2A 4PM1A 5I8EB 2VDKB 4XXDB 3IM1A 1ZY9A 3KS0H 2FO1A 1N6VA 3QWOB 1S9XA 1XGUA 3QFDB 3GBNH 1AHMA 3IDUA 1KJMA 1J1XH 2VLKB 3D0LA 4JO8A 4AY0A 2ESVD 4WI8A 1E3FA 1KDIA 2XYBA 1GS6X 3CSFA 3WDJA 2X09A 1OCOB 4ELDA 3UDWC 9CGTA 3O3AB 5GZNC 2WQWA 4QAMB 1YY8A 1LGVA 5CZXC 4FZ8H 5E5MB 2H2SC 1G7PB 2Z0UA 5DC9B 1OAZH 3OKEB 4WI4A 4Y16A 5J6HB 2ZZUT 3CSBA 3QA3A 5IMKA 4WY7H 3ZE2E 2YXFA 3WO3B 2VN6A 1XH3B 3GSVB 3VRIA 3ZRCC 4CDGC 1F4WL 4KZEH 1MQKH 3SDDA 1JERA 1BF2A 1GS7A 3L3IB 3SKMA 2YRBA 4KO5A 4DIXA 2AXHA 4FKKA 2R1YA 5DT1H 2WLMA 4GSXA 5EZOL 2ICEB 1YA5A 4NFBA 1E8YA 5L9DL 4ICXA 3ARWA 5BV7H 5BVJB 4FG2A 2DQMA 3CSYB 3FOLB 1A7RH 2NZ9C 4L8BA 4UM8B 4DEPB 4XX5A 3VXMD 3RA7H 1M42A 3H3PL 4KROB 4AG4H 1ICTA 2W5PA 3IKKA 4WTWA 3EYSH 4RMSA 4HF5H 3TX4A 5DWUH 3RWEB 1Z32X 3PGDB 4ZTPH 1OP5K 1LEIA 1NGZA 3PAUA 1YEHL 3FH7A 3VMNA 1KTRL 5EBWA 3TLRA 3GMQA 3M07A 3NIGB 4YOKA 1FJ1B 3DTXA 4H88H 3TBVA 2B1HL 1KDJA 5AG9A 1TJGH 5FDWB 3DWTA 3GSNA 5DJZB 4DN4L 1P5VB 3IRPX 1N10A 3RVTC 5IHWA 2V2TA 4WI0B 3BHBB 3HZYA 3UBHA 2R0WH 3DX2A 4UYPA 3UXFA 3IMVA 3EYOB 1AS6A 1ZA6B 5F7KC 4HUMB 1XMWA 4JM0A 4TUOA 2NY6D 3S3PA 4X99A 4JO2L 5CBAB 2NXYC 4P3CL 2HFGH 1KGXA 3T3MF 3MU3A 2WLJA 2PP7A 4KAQH 1IX2A 4KRNA 4UIKL 5TK2A 3WS3B 2BWQA 2HJKA 1JNLL 4OJDH 2GC7C 1S3KL 3UZVB 1QI5A 3L2LA 3WNMA 2I7SA 2F74A 3R1GL 1ET7A 3FTUA 1TTFA 5E1HB 2VLRA 1GY1A 3KEDA 4HH9A 1NOAA 3M8OL 1G0DA 2DWSA 5E2JA 2M2DA 4FTVB 1QQDB 2BFVH 3WIFA 3US0A 4OF5A 5GS3A 4PS4H 5DD3H 2WZ0A 3EYVA 1UACL 1C08A 1QLRA 1U41A 1Y6KR 2NLJA 2H26B 3GSRA 3PS6A 4ANKA 3V9FA 4NUJB 2D0GA 2C1OA 4QRPA 5J56B 4R5XA 3FU6A 5EO9A 4P06A 2DQJH 4FA8A 4XP4H 1M6UA 1SN2A 3QIBB 1W72L 3W81A 2DJSA 4KH2A 1B0WA 2ICCA 2VAJA 4Z7UF 4W6WB 3GXDA 5F96L 1VPOL 5IG7A 2CA4A 5JR1H 1EGJH 1V3JA 1CLZH 2YAQA 4M7JL 5I26A 2Z31A 1WLHA 1KXHA 3HB3C 4FFTA 1O6SA 3BXNA 2JXMB 4MAUH 4B27A 3K6OA 4I87A 4F7EB 1F8TH 1OL0A 3GMNB 3RY6A 5I8KL 5KSAB 1QSEE 3MUHL 4IOFC 1G7IA 3BSZA 1E2ZA 4RETB 5DRWB 4D9QD 1Z9SA 3O2DH 5LKNA 4J12A 1JZDC 1URZA 1LD9A 1DE4A 1NGXA 2WQVA 1GGUA 4MMXA 4CU8A 3FAWA 3RL1A 5KTEL 1RZJL 1F56A 4R7XA 2MCMA 3GIVB 3LPGA 4LAJH 3V4PB 4OLYH 4P2OD 1BXXA 5E51A 1WBXA 1QSVA 3DVGB 4QHNB 4BH8A 3DX1A 1RIHL 1F41A 4U05A 1JTTA 1I3UA 1THCA 1CLVA 5GGVL 4F7KA 3CZFA 1IGYB 3MLUH 1AS7A 4AM0B 2JQZA 1NL0L 3TA3A 4KMTL 1A4JA 5EN2B 2VXVH 3SGKA 3T8MA 3A22A 4HPHA 1JZFA 2Y0SA 3G5VA 1QSZA 1HEZB 1LK2B 2V9QA 4TQ8A 3A24A 4DUVA 1E6OL 2VYRE 1ZDQA 2W9EH 3HS0A 3C5XA 1DUYA 1UXLA 5E6SB 3UMTA 2BWDA 4NIKB 4X7TB 3S8WA 3IAPA 2WZ6A 2G3MA 4QRRB 4AUUA 2EC9T 5C0AB 4XP5H 3PABA 4KKCD 5EU5A 3DOHA 1EFXD 3CV5A 4NKMB 4GAJL 3WFCH 1HESA 2OL3L 5A43C 4JFEE 2HTLD 1YECH 4PW3A 5DQJA 2GSGB 2RH0A 3KPTA 3T3PE 1MHCB 4NM8H 1MVFA 1IGTA 4JRYB 3FB7A 1A7OH 2EO9A 4CL7A 1TJIL 1J10A 3KH4A 5AAPA 1V7MH 2NY3D 5C6WH 5H4YA 4WEBH 1JHKL 2VL5A 3VX0A 2DTMH 1CQKA 1R33A 3S3BB 5I8OH 5E5UB 5LGKA 3D4CA 2NYYC 1VGEL 2YD6A 3B9KD 1NKGA 1B4JL 3GRWA 5IMOB 1SM3H 5DYOB 4FA7B 3HRZB 3QEHA 5I8CB 4FP8L 4ZAKB 4D0CA 4UINL 2O72A 5E8DL 3PL6B 2DWEB 5F1OB 5FO7A 1JZ8A 4OV5A 3VU2A 1S9YB 3ES6A 5DUPH 4HJSA 1NWPA 4BA8A 2V17L 5AVQB 5D9SB 2EH8H 2WYTA 2COVD 1X9QA 3EOBA 3Q6FA 3BP5A 1KG0A 4ONOA 4XNQB 2ZUQB 1U93A 3VXME 4QTFA 4KOCA 3BGFB 4IJTA 3RURA 1FRGL 1W6WA 4KZDL 3IBOA 5C08A 4WNQB 3S5LG 4AVHA 1S8DB 4GXFA 3EGDA 3VFSB 4BFEA 1E50A 1D5MB 1M7DA 1C5CL 3GK8L 1CGTA 1GW0A 1PG7L 3IXAA 4KHTL 1A8JH 3EHBC 3VXNA 3CCHA 2GBVA 2MNWA 3P4NA 5LG1A 5T3ZH 2WXMA 2VCOA 3TESA 1XX9C 4HSAC 3P4MA 2H1PL 2XQ0A 3GM8A 3MPCA 1INDL 1GW6A 2SODB 4JFVA 2EDQA 5A6LA 1S78D 3GSWB 3T4AB 4DKEH 4B60A 1W0WA 1JGVL 2CO7B 2EKJA 2PXYD 2ICWI 4H0HB 4M8QA 4XBPB 3MV9E 1E42A 5FHAL 1TU2B 2EYTB 1N0LB 3VGEA 2HA1A 1SBSL 4JFOA 4LFHD 4LHJB 4N3UA 1SUJA 3WENA 1GCYA 4KXZH 2EH7H 1MNUL 2YLHA 5D7JC 1GA2A 4QHLB 5ICZB 2FECI 1OQOA 2VLJB 5JNYB 5I1LB 2YAEA 4L1HA 4DW2H 1FFPB 2JMRA 2P52A 1S6NA 3E3QE 4YC2B 3LMJL 2RIKA 3DX8B 3P3TA 4X6FB 3TNMA 3E0GA 3FCTB 4ISVB 4ERSH 5F3HA 5J1AB 3CVIH 3DVNA 5IB3A 1FLTX 3ZE0B 1RQ5A 4IRJA 4K7PL 4GW1B 1DO5A 4YE4H 5JXAH 4U6TA 1BM3L 2VLRD 2Z7YA 3IKCB 3KWXA 1E5BA 4PYHA 3JWDL 3IU3A 4YFLI 4KVCH 2WLKA 3G04B 5E2TH 5A16B 1UWEL 4ZOEA 3TV8A 2ZQKA 3LEXA 4PLNC 4XNYH 4HK0B 1KJ2B 4GRWB 4LVOC 3TOPA 1UD8A 2ESVB 5JPNC 2Z1PA 4S0TD 5FK9A 4QRPD 4K5MA 1JF5A 2BZDA 3GBEA 1A0QH 4P2QA 3V7AG 1CE1H 4F7PA 3VD2A 2V4LA 2X38A 5DUBA 3OX8A 2AEPH 2AJSH 4CSTA 2O5NA 1FN4B 3IPFA 5E08L 3APMA 5GGSY 4LVHC 2UZYB 1XH2A 3FQTA 3ULUL 2YQGA 4XVTL 1WT5A 2OMTB 1BBDH 1HXMB 3UGXA 1DBMH 3ZGIA 2X2UA 2YRPA 2Z31D 2XN2A 4TVPH 3KYKH 1NCGA 4XI5D 3SCMD 5JOFB 1KGCE 4WW2A 3RZCD 4OM0L 2W59A 4RGNC 3RUGF 2Z8VC 1G7MB 1OAQL 1TO4A 5HHVH 1HCZA 3PXHA 4UI2A 4Y5VA 1QO3B 3S97C 4ZI8A 3CDZB 1EMTL 3N42B 4YXLL 3TC9A 3O41A 3VXMB 1C12A 1NM4A 4H5SA 2PPCA 4OLWH 2A4CA 3ZUNC 1AGFA 1E67A 3O8XB 1T7VA 3PRZA 1YY9C 4HOZA 4HK3N 2AK4E 1UKTA 1PY9A 5HP5A 4XO4A 5EZIH 5I0YA 4PGJA 1VACB 2YC1B 4EZJA 3LQZB 5IVZA 3QWNA 3KPQA 3SY0A 2EXYD 4B50A 2WB1A 3TA3D 3AG2B 1X9RA 2GABA 1BVNP 2ZYRA 5C0ND 4YHNB 2CXGA 2AFNA 4HFWB 2FO4A 3LXAA 3QIWD 4TVSa 3UJIH 3DHUA 3EDDA 3GMPB 4MCMA 4NQED 3BE1H 3CFEB 3MBEB 4JKMA 5DGQA 1WC7A 4WWNA 4N20A 3KWVA 4PGDA 1EXUA 3U36A 3HEIB 1F6FB 1HHIA 1WUNT 4LVEA 3VXOA 4ZQTA 5IJKC 1LO0H 2BSTB 1FZOA 4UTBL 3P9LB 4JAMA 3KPLA 2V2XB 3DURB 2NY0C 2WTPA 2CJ3A 2NY6B 1XGTB 3DLQR 3EYQC 3OB0H 3IDYC 4AI7A 5E2UH 2R59A 4TNGA 1OT1A 3IDJA 4K2UL 3ARVA 4EI5C 1U95A 5D7IF 4F7CA 3SQRA 3DV6B 1JGLH 4P46A 2VC2L 5J3HD 1KNOA 4MTMA 1BP3B 4M3HA 3KLAA 1A5FL 4CNIA 4EBQL 1V7NL 5HHPA 1M2VB 1XH1A 4NERA 1RUKH 5JDJA 4OKDA 4LEBA 2IMNA 1XSJA 4PG2A 1NLDH 2XYCA 4Q9QH 1KGJA 4M4RA 3V4VL 3FQRA 4K3EL 4CN6A 3WEXA 3UGUA 4IIQA 2OXGB 2Y7NA 2D0HA 2YPLA 3PP4H 2IOIA 5DO2C 3MODL 3O0RL 1AZVA 3KPOA 5C6TL 4HS8H 2EDWA 2WPGA 1UD5A 2QELA 5EOCH 4DGIL 1G7JB 2V33A 2LU3A 4J7RA 4N2GA 4ZFFB 3FT4A 1GZHA 4WWPA 2ZE0A 4JHBA 4M43H 2PO6D 5T1LA 1YJDH 3HCVB 3L7FA 3SYCA 5KEZA 2ZX9A 1ZD6A 3MYJB 3TBSB 5FUCC 3BQUB 2VDRH 3ILQC 2ATPB 2EO7A 1E3XA 4I5BB 1SXBA 1RJLB 1IC4H 1M4KA 4F7TB 2BDNH 1ZDSA 1NANH 3BAYA 3FQNB 3BVUA 3X11B 3I3BA 5JQ6H 3MBWA 1CTMA 4BH7A 2W8CA 3LNDA 3WE6A 4KI1A 5IHZB 5IB2B 1YCSA 4LAQL 5HDOA 3ZDXE 2X6CA 4M93B 3V0DA 2EVHA 1T20B 5TTRA 5AZEL 4Z3HA 3LTVA 3RUGA 3ENEA 3VRJB 4KJQC 3QI9D 3V4UH 2GI0A 3ATBA 4MQSB 3V6FB 1I8LC 2HVKA 4PJ7B 2ADGB 3BWSA 2NSXA 1ZT4B 3T1FA 4PUBH 4EXKA 1TVDA 3LV3A 2WXRA 4WSGA 2G9KA 1QRNA 3D33A 3VFGL 3N44F 4E9QA 2VDPB 2Z3FA 4X4YB 3FH5A 1TF4A 1P0SE 3L6FA 3NQIA 4FFYL 4R0LB 3KHQA 2FD6H 1NCAL 5FYJL 5B7MA 3ZW3A 4FFWD 2CNZA 1TUPA 1I7ZA 4K55A 1G9NH 1PY0A 1TETH 3DVFA 3NFPB 4X98A 3RNKB 1JZHA 5EH1A 1CFBA 1KELH 3O9WC 4I9XA 4JJHA 5IT2H 5J6SA 4X6DE 3WSQH 1CDJA 1MFEL 3K4AA 4FC3E 3B5GA 5D7EA 3DX6A 3QVAA 2AXGA 5I6LA 1DQLL 2BRRH 2DKUA 1EZSA 4UQ3B 1SFHA 2BCKA 1I1CA 1CU4L 1EFXB 2P8LA 4E42B 5KN5B 4JDZA 3HBZA 5FOJA 3GBMH 1VERA 2IOMA 4P23C 3HZVA 4M9OA 1RZKH 3B2PA 5KYWA 1JV2A 4JY5H 4AL8H 3UROR 4W9CC 3BT2L 4N25A 5KYYB 4IRJD 3IDNB 4I0CC 1LNUA 1UUNA 2OI9C 2HWZH 3BUYB 3LZLA 5B38B 3G08B 3FFDA 3FT2B 2NY3B 3L5XL 4XP1H 5JA8B 4QRPE 2UWEF 4EDXA 2FEEI 3NIDE 4EZMA 2J5WA 2E8ZA 1X6LA 3Q5OA 4Y4FA 2VDLL 3K3QA 1S9XB 4DP7X 1XGUB 5D7IA 3LH8A 1KJMB 1R1CA 3PAVA 4LHQB 1F13A 3D0LB 5FW6A 5IBTH 3EKCA 3FSZA 1BJ1J 1KEMH 2IF7A 2QLVB 2YQ2A 3MA7A 4LF3A 3WEMA 3FN9A 4M6OL 1YC8A 4OCSH 3U6RA 1TNNA 2IAND 5AYUL 4EOWL 2O1AA 1T66C 4NUPA 1YY8B 5E2VL 3AC0A 2QGCA 2BP0A 3GXFA 2AANA 1YNTF 2I07A 3MC0A 4JHUA 3EW3B 4HMEA 4N0CC 2FX8L 3DMMC 4OF0A 4Y16B 4DGYL 1JK9A 1UT2A 1MRFH 3DX9A 1IAIM 2VDOH 1UWXH 3QA3B 5IMKB 5ESAA 3NSCA 2OMNA 1XAKA 4K8RC 1CWVA 5G2NA 4Z7VF 3N1PC 4ONHA 5F7NC 3VRIB 4B9CA 3SDDB 3WU1A 1QLEL 1TCMA 4OFQA 3SKMB 3IXTA 2R1YB 4HJJL 4ZX4A 4R4BA 4XTRD 3SGDI 1QBAA 1IC1A 2D7TL 4N24A 3RVWD 1N8OE 5LXGH 1MCJA 2DIEA 4L8BB 4TQEH 2K3HA 4Z3EA 2AEWA 2V7HA 2VN5A 2WXIA 4LARL 4TSAH 4BM7A 1PG7X 4YVNA 5AW1B 3X12A 3H9SE 1M53A 3O81A 4QNPE 5C07A 3NMEA 4NQEE 1LEIB 2C1PA 1F58H 1GR7A 1NGZB 4FQCL 5IM7A 4RGOH 4Y9BA 5EBWB 3GMQB 1JIBA 1HN1A 3DTXB 1OP3H 3TBVB 1CFTB 1T6BX 4WGKA 1P1VA 1Q94A 4Z3TA 5AAWA 2V9TA 3GI9H 1E4XH 2LFGA 1MY7A 3GSNB 2EECA 1QBLH 2XZCL 4EUPA 2V2TB 4NZRH 4RAVB 1BZ7A 5AWNL 3CZLA 2AV1A 2FX7H 2DJUA 4GKLA 4RFNB 3VG0L 2P42B 1BPLB 4DP6X 4TUOB 3V0IA 4ZSOE 3VMOA 4X99B 4B97A 5A3ID 2H0EA 3PP3K 1JNJA 1X5FA 3ZZLA 3V0HA 2K8MA 1ZAGA 1BX2A 2ZWKA 2UXTA 3F2LA 1HU8A 4PRDA 4LSUH 4ZMVA 2HJKB 3PFQA 4WTQA 4BWTA 3RHWF 3ZTNL 2F74B 2YD0A 4Y89A 3CIAA 1EEZA 2BSDA 1IKOP 4MGXA 1OT4A 3MRBA 4J3BA 4E9YA 5I18H 2VLRB 4ZYKA 3PJSA 1I1AC 3GS4A 4GLRH 1FC1A 2PYFA 4XCEA 1V3KA 3GDCA 4H20L 5DWPA 5K93A 5L7XH 2Z35A 3AREA 3WIFB 5DMYA 2ZUWA 3VXRE 1MF2L 1LXMA 2AAVA 1I4FA 3EYVB 3QG7L 3MNDA 1QLRB 1MHPH 2NLJB 3GSRB 2MIZA 4AENA 2UUDH 5C0RH 2Y7LA 4WHYG 5LLIC 2YPLD 1M71A 2C1OB 4QRPB 2H32A 4S2SA 5EO9B 1PYWA 5MP6L 2R1WA 1LO3H 1GGBH 4R7LA 4V11A 1T1WA 3WAKA 1WWAX 2HJLA 2VR7A 2UX6A 4FNUA 5IG7B 5KAQG 1URLA 1FC2D 1NCCL 2XV0A 1S7WA 5IP4A 2JJTA 5T1DL 3TJHC 1YEJH 4Z7UE 2Z31B 3CSTA 5T1LD 4N90E 2KKQA 4O2FA 1NUFA 5KANI 4PJ5A 1O6SB 3BXNB 5IF0B 3U7WL 1GJIA 4UCFA 1TIUA 2D3LA 4IRZA 1KCLA 3WXWL 3ZL2A 2ZAHA 4LLWA 2OSWA 4L29A 3RZCB 1Z6JT 1G7IB 2VXUL 2EDYA 2VUKA 1IARB 2AERT 1Z9SB 1M3IA 3OV6A 1LD9B 1DE4B 1NGXB 1YNTA 2A9AA 3Q9QA 2B0SH 4JMNA 3KJ4C 4MMXB 3EBGA 3NCJH 3RL1B 2NY2D 1G6RA 5L4IA 3WE1A 1OOWA 5EU7E 2AQTA 4QO1A 4XPFH 1DJSA 1N19A 1A2YA 1YEGH 2CWRA 4E2OA 5JIPA 1WBXB 3LB6C 5MENA 1ZVYA 5B3JF 3OKYA 3HG3A 5JHDA 2EEAA 1DFXA 1T7YA 3HHMA 4BH8B 2C3VA 2HKFH 4NZUH 2CCWA 3QQ3B 1G43A 4MXVE 1QMUA 2J2ZA 3VD9A 4PJ6A 5EG6C 5H37H 4IU2A 5JLZA 3CZFB 1WFIA 5IQ7H 3MUZ1 1LO4L 3EJSA 3L45A 1TVBA 3TA3B 5JIIA 2WHVA 5BO1L 4KTGA 1A4JB 3SE4A 3LCYA 3IPBA 4MSWB 2VUYA 4JFFE 2OL3A 3B37A 3D25A 2EIDA 4MQ7A 1QRND 3JXAA 2ALAA 4JRWA 1HL4A 4R4FL 3ASOB 3WKMH 2FQDA 2CKBA 2NNRA 3O6MH 4NAMA 4NWUL 1KENH 5IFHL 2VDKH 4QJ4B 2YJQA 1IZJA 2JKRM 2D0FA 3HS0B 2NX5E 1DUYB 1EEQA 4TULL 5KUKA 4TTGA 2ERJC 3JWNE 3BN9D 4LXFA 2ZXWB 1EEUA 4EI0A 3NJVA 4B9FA 3CN4A 3I9GH 4HQQH 4KMLB 2UXFA 1RIUL 3PABB 5E70A 3T8VA 4AIOA 3T77A 3AQXA 3VFNA 3SJVA 1MFMA 2PABA 3CFTA 5EU5B 2J8HA 2Y25A 1OARL 3VB9A 5KVMC 3TVMC 4OLZL 4L1LA 1F4YL 5DQJB 2JB6A 1JGIA 2X4TA 3P2DA 4YJZL 1DANT 2NYKA 1JHLL 3CQPA 1IGTB 2Y1YA 3FB7B 1Q90A 4LIQE 4MXQC 1FYHB 3DYPA 1SHWA 3ARDC 1FAKT 3LN4A 3BAEL 3MJ9L 2BHZA 3E1F1 3JV4A 3ROLA 3T3MB 2W81C 3RI5K 4DOHE 1G94A 1KFGA 2VL5B 3RVXC 4IDJH 4HWBA 2WKGA 4Y4FD 2IANE 4ZUTA 5IHLB 4RISH 1KCSH 4PH8A 2UZIH 4PTTA 2ZPKL 4ZW6A 1UD3A 2FYYA 2EILB 5DXWA 2Q3ZA 5CU9A 1CL7H 3QEHB 4HUKB 1IGFH 3GS0A 4S1RH 3LRMA 5GIRA 4D0CB 3JVFC 4PRPE 1Q0XH 3W1ZA 3B2MA 4UIMA 5FO7B 4TVUA 4AYGA 4OV5B 3B43A 2NUPA 3AT8A 2GSMB 4GT7A 1N6QH 2XWRA 1DVFD 3PWJA 3ES6B 1NPUA 5F7YC 5D2LA 2ATAA 1JFHA 2RB8A 4F3FA 1QHQA 4MAYD 1P4IH 4XAWH 1LYQA 3EOBB 2X1OA 3BP5B 3Q6FB 4Y4KC 1KG0B 4URTB 4Z3IA 3CAFA 4HSCX 4PJDE 3V9CA 5FR3A 2NMSA 1U93B 3T65A 3U1QA 4PP2A 1UEMA 5F8QC 1MG3C 1AI1H 2YPKA 4DFIA 2ED9A 4DHLA 5C08B 2B59A 1I9RH 3QPKA 4K94H 4ZJ9A 4ZMYA 2L7QA 3EYUH 4NAJA 3OPUA 1AXIB 3EGDB 4ZD3H 4XCFL 4K3DH 3R7QA 3S36H 3IXAB 1XGYL 4UNVA 2CR3A 3M45A 3VXNB 3CCHB 5E2WL 5DD0L 2ZOTA 2EEXA 5C1MB 5DSCA 5C07D 4HEPG 3P4MB 1FI8C 2J6WA 4YK4B 4CBZA 1A66A 3T0WA 3QUZA 1LL1A 3L5WA 2PR4H 3FRPA 1IE4A 3H55A 4XP6L 4BUQA 4F2MA 1W0WB 4Y1TA 4POUB 4M8QB 3BO8A 4IGBA 3BAWA 3A6BH 3TIEA 2KZKA 2OV0A 4FXGA 3QAQA 4JFOB 4XC1L 3AS2A 2BVYA 4KQ0A 1ZLSL 2MSPA 4PJGF 1E9OB 4JHVA 2HYMA 1T04A 4F15C 2LOEA 1WSST 3P02A 2BNRA 2Z7ZA 3EFDH 3DUUA 3B56A 3LXCA 5JHLA 3FUMA 4J3OG 4HC1L 3GHEL 1MAMH 1BFVH 3TNMB 2HH0H 4YSDA 1ILSA 1OSEA 4U6VL 3HE6A 2Y1ZA 3QJHA 5F3HB 5GHWH 1Z5YD 3DVNB 5IB3B 2VDML 4S1SL 2ADFL 1WZ1L 1YEDA 2XA3A 4IRJB 3WJLC 4G7QB 4R83A 1FNHA 3PWUA 1OY3B 4PJCF 5JDSA 3UZEC 4OQTA 4FEMA 4HOWA 4Q8BA 4FHJA 1NCDL 2YPLE 5JYMA 3IU3B 1QHPA 3O6FA 1EANA 4KUCF 2VR4A 3BVXA 1B3JA 3MRDA 3LEXB 3K71A 3PJLA 4R2GD 1ZS8A 1LJMA 2NOYA 3OAUL 1I9JL 4LSRH 3ZX1A 4N0FA 4EPSA 4XCNA 5FK9B 4M9PA 4H8WH 4P2QB 4YDLC 3LXBA 1UA7A 2VN4A 4M1GL 4F7PB 4QWWC 5DUBB 5HHOE 3OX8B 3IF1A 3UO1L 1RVFL 4CU6A 5FGBC 2NZIA 2VRAA 4MS8D 5CSBA 2IPTL 4KXAA 3FQTB 1TTAA 3VQ1C 4UAOC 3SKUD 5I30L 3VNZA 3DETC 3C5JA 4LSTH 2NYZA 4HCGA 5LGHH 2OZNA 2VZ3A 4ENZA 3CH1A 4ZNEE 1NC4A 5DFVC 2FB4H 5ICXA 3BD5A 1CXIA 2XG5A 2QADD 4WW2B 2ODIA 4FABL 4FQLH 3DJSA 2O4EA 4NX0A 4H25A 4WSKA 1L7IH 5F7FA 3KBFA 5BS0D 3U46A 1QVOA 2R0LH 4YBHA 1IFHH 3N04A 4GS7B 4JM2C 1M1XA 5KYNA 3FZUD 4UOQA 2YRLA 4Y5VB 5BOJA 4I7ZC 5JHBA 4WGWB 2VMFA 4I85A 1NIFA 3O41B 4KJYA 1C12B 5MEND 4H5SB 3GJEA 1GYUA 1AGFB 2WO4A 2AF2A 3IMUA 1RP9A 3MJ8A 5KSBE 2KDYA 5FYKE 1GMIA 3NP4A 4UTBA 2VWEE 5HY9A 5K9OA 1PEZA 2RCSH 4NKIH 4JO3L 2R9HD 4AIXA 5D93C 1EHAA 5IVZB 4B9JA 1QRNE 1KGWA 3KPQB 3SY0B 1IBYA 1LO2L 3OKLA 1KYOJ 2R83A 2CDEA 2AQNA 2IPUK 1BXAA 5JYLA 5HHXL 2FO4B 4Q0XL 4HCRH 2F7PA 1D9KA 5LCVH 1B4LA 2Z4QA 4LQ1A 4WO4D 3NK4A 4JHZA 1WC7B 3K72A 1KSRA 3OKNA 1EXUB 4PGDB 3U36B 4AVKA 1T89A 2AJVL 2GKIA 4L23A 2OX5A 3K6IA 1HHIB 1X5JA 4WCYL 3VXOB 4JPQA 5SWSD 4LCYA 3FKUS 1FZOB 4U3SA 2DV6A 3ISYA 3KPLB 1XD0A 4HUNB 4JAMB 5DDHA 1AYOA 1RXLA 4MNHA 5L88H 3LD8B 4J23A 2V8MA 3HG1A 3OAZH 4HWZA 3V4VA 5JXEC 1DZ0A 2CMRL 1MG2C 3VQMA 4MDIA 3O6KH 3SJVD 4F80A 3Q9PA 4FQXA 3NACH 2C7UA 4BFRA 1QFPA 3IDJB 3QDME 5D1XA 5EUOF 4I9WE 2IEPA 4M8UA 4L8CA 3HE7A 1U95B 4F7CB 5B8CC 1YG9A 4PJGA 1GGCL 1Z0NA 4W9ZA 4PBDA 4P46B 1EZLA 1KNOB 3MLVL 3LRHA 3BZFA 4KY1L 4YIQA 4CNIB 1U4EA 1JGUH 5HHPB 3IGAA 1E28A 2CBOA 5BNXD 3CFKA 3ET9F 5FM4A 1YQVH 3C5ZC 4HDIA 2LHAA 3GGWA 4WV1C 2AJXL 4M4RB 4K8RL 3ISWA 3FQRB 5BVPH 3VGBA 2GCYA 5EZPA 2M1KA 3WEXB 4Y1AE 1CDIA 3LNGA 1TJHL 4Z7OE 4IIQB 3FYEB 2VERN 2YPLB 4F57L 3KPOB 3V2AR 4PJCA 4QTIH 1UFGA 5ENWA 1KCKA 4M5YL 5AG8A 1A3RH 3FT4B 1DQDL 4NO0A 1HIML 4FJ6A 1KYAA 1EPFA 2J8UE 1YAZA 3NIFE 2CK0H 3NZHL 3VXUE 1OGAA 1FORH 2IVFC 4F93B 5T1LB 4G6AC 3BPCA 1KULA 2X9ZA 3N6YA 3L7FB 5HI3C 4A2LA 2Y22A 1CLYL 2OR9L 3GINA 5L8JB 4P4KD 5A2BA 3SZ6A 2P45B 2F08A 2Q0ZX 3MLSL 4X7SL 4BZ2L 4FQJH 1R4XA 2NY2B 3LS4L 3OHXC 3MNWA 1VFOA 1WEJH 3MBWB 4BH7B 3WE6B 4AYBA 2Y07L 4L0PB 4WQOA 4JPSA 5K9JH 1ET8A 3W9DA 1ECYA 3ZT7A 2G2PA 1M7XA 4GEJA 4JANA 4IU3A 3RUGB 2ZXGA 2Y23A 5I1JH 4HKZA 1M7UA 1MCWW 1D5BA 1XR9A 2HVKB 3Q5YA 4OKVA 5FA4B 5GZOC 4E9RA 2NCEA 3T1FB 3FJTA 4QY8A 4ONGH 2N59A 5TJWK 3BH9A 3IFNH 4CSSA 1ROCA 5JW3H 4LP5A 3CK0L 1BQHG 3LV3B 2K9UA 3V52H 3ZY7A 1QRNB 2F8XC 4JQIL 3I50L 4IGBD 4NBZB 4QUOA 3WY3A 3L6FB 5FECB 1PNDA 1FGNL 2WN3A 3BLBA 4X98B 3QO1B 1GKOA 5I9QC 4AGQA 1KJ2H 3GBNL 3NG5A 2DL2A 3CXDH 4GRWH 4IBYA 1J1XL 5AOIA 4GRLC 2AJ3A 3V5HA 3ZBMA 4POYA 5GRUH 3DX6B 2AXGB 1WA2X 2XN9E 4AIEA 3GT6A 2BCKB 3LPPA 1CZ8H 1E5UI 2P8LB 1R19A 4L8SC 4JDZB 4U4BA 5IBLD 3HZVB 4X8XA 3PNWA 3STLA 5KYWB 1JV2B 4FZ8L 5DF0A 3HE6D 2X0VA 4GO8A 3ZHLA 5LBGA 1OAZL 4NZTH 5FEBA 4OI7A 4LDOB 1LNUB 2XSKA 3M88A 3FFDB 4WY7L 1JFQH 3ZGHA 5J0BA 2IXQA 2H0JA 3O6FD 4C4BA 5FUZL 5TQ0H 4EDXB 1XF5A 2K70A 4LCWA 4KZEL 1MQKL 2WSPA 1OANA 4Y4FB 5I6XC 3T5WA 5D7IB 4LPCA 3UBXG 2UWEE 2EACA 5D1QA 5DT1L 2ZXCA 5JA9A 3WTYA 1RIVH 3VI4F 3K4DA 7CGTA 3MA7B 4FN0A 4LF3B 5EU6E 2QL1A 2Y3NA 4W1TA 4YO0A 4AQEA 5BV7L 1GZPA 3MKKA 3AB0B 5I16A 3ISRA 3NA4A 4PI0A 4FLRA 1XDTT 5D7LA 1A7RL 3STZA 3C6SA 4X4ZA 1Q8MA 3RA7L 2B20A 4Z7IA 4AG4L 1YYMH 2J5LB 4YR6A 1YJDC 2I07B 3FB5A 3EYSL 3DPDA 4TUUA 3TASA 3ZK0A 4WFGD 3T4YA 3KLKA 4HF5L 5DWUL 1JK9B 2F53D 2IAMC 3DX9B 4ZTPL 5BS0E 4RX4A 5ESAB 1IZKA 4J1UA 2XX0A 4WFHE 4L05A 4H88L 4ONHB 4G7RB 4AOFA 1IL1A 3B2UC 3IXTB 1XB3A 4BFGA 1ESOA 3Q7JA 1EX0A 1TJGL 4FMFA 4R4BB 3WUWA 4Y4HC 4Z7VE 2GIYA 2C9AA 2JNZA 3VAEA 2I24N 1PX4A 5LDSA 2R0WL 4NN6B 1SRDA 3GLEA 2X1WL 4C58B 2KDGA 2VH5H 5E8PA 1AO7E 2V7HB 4UB0H 5F7DA 1NGWA 2D7MA 3KPMA 4XN8A 3X12B 5E7FA 1AIZA 4GP4B 5C07B 3S5ZA 4JRXE 2HFGL 1N6UA 1JG9A 4Q6YA 3IMBA 3J27A 2BNUB 2C1PB 4Q4IA 4K9EH 5IM7B 4KAQL 2FIRT 4TV3A 1UT9A 1IKFH 5SWSE 4W93A 1MQ8A 4PJ8C 1EJ8A 1Q94B 3I3DA 1GAFH 4FX5A 4RESB 4P4RA 1G9NC 2X89A 3UYRH 4EUPB 4O58H 3SBWC 1BZ7B 1X5IA 3ECUA 1U8PA 2BFVL 3QB7C 1UD6A 2AV1B 3U83A 4PS4L 5DD3L 2J72A 1MREH 4RWHA 3ESVF 3HG1D 5I6OA 1CF1A 3QHTC 4HUWA 3EIFA 2Z0BA 2QQNH 3TH4T 1ASPA 2DQJL 3D2TA 4XP4L 1BX2B 4ALAC 3FQUA 3BP6A 4PWEA 5AB2A 2PPDA 3G9VA 3QFGA 3HE7D 1IEHA 1F4AA 5JR1L 1EGJL 1NCUA 3UP6A 3W2DH 1EEZB 4F8PA 1CLZL 4N86A 3IMWA 3MRBB 3RL2B 2DEWX 4ZYKB 2ZAIA 2VTFA 4MAUL 3D52A 1F8TL 3QZWG 4XCEB 2PYFB 4XPTH 2Z35B 2AQ1A 5IESH 4QYOA 1I4FB 2KZ1B 2R29A 2A0LD 1XF3A 3O2DL 4YDIH 4AENB 4X9HA 1KTCA 4F9LA 1HAWA 1M71B 4YDKH 3N41F 2V9UA 2H32B 4S2SB 3LY6A 2R1WB 4OLYL 3IS1X 2UWEB 1T1WB 4KUCD 4P5TA 2HJLB 5ECGA 4RZCA 4WUUA 2LR4A 3MLUL 3VI4A 4O2FB 1E2VA 4I18A 2Y5QA 4PJ5B 3B7RL 5JW5A 2IO5A 2VXVL 2EE3A 3CU7A 3WYRA 5B7FA 2V3FA 5ID0A 1XL4A 4LLWB 4L29B 3ZMNA 4BSWA 2KYIA 2H6UA 4LOVA 2VDPH 4HSQA 1UGNA 4PRHE 3VFWA 1HT6A 3TH2T 2QTVA 4OH2A 1YNTB 3QJFA 5D7KD 3DPBA 3T2LA 2A38A 3CLWA 2W9EL 1G6RB 4NXSA 4GKOA 2A9CA 1AHKA 4FXKA 3K6SA 4QO1B 1A2YB 5MENB 4AQZA 2XLLA 5JHDB 3FAXA 4NENA 1O7DE 4KY2A 2C3VB 4AYMC 4WU7A 2J2ZB 4XP5L 2NCMA 1C9SA 4OZFA 5B3JE 4IU2B 4RSYA 1UWGH 3OD3A 5JLZB 4L3FA 8FABA 2R69H 1SMDA 5IQ9A 2Z92A 1TVBB 3WFCL 1N70A 4X0NA 5FW8A 2JLPA 1D6EA 1KTLA 3KPSE 1YECL 3H85A 3EH2A 1NIEA 2C4FT 3UAFA 3QJTB 3D25B 2VM3A 5CJOH 2OW6A 1QFWI 3OAYH 1RK1A 1Q1JH 1PFOA 4HEMA 4LLVA 1A7NH 4MQ7B 4NM8L 4WO4B 1A7OL 5K33A 1QABA 2CKBB 2MHAA 3HLKA 2IMMA 3QUYD 4IQHA 3NP3A 3KDPB 2A9DA 1SMOA 3ESUF 1V7ML 2J1WA 1MWOA 4QXUH 1SQ2N 1J9TA 4WEBL 3MJ9A 1BXUA 2DTML 3AWEA 4HIPA 3ATAA 5I8OL 4QGTA 2EKSA 3QE5A 3P3UA 4P2CG 4PN6A 3K2IA 3FT0A 3UFIA 5I2IA 5F7MC 2BLFA 4UBDC 3T77B 3SJVB 3VFNB 4ACPA 1SM3L 2VW6A 1BCIA 1NFDF 2CBPA 3FRUA 1JP5A 3L4UA 3KL3A 1PY4A 2C3HA 3WDHA 2JB6B 1FNFA 2X4TB 2YUVA 1SVZA 2VJ0A 4RMUA 1PVHA 4DESA 4OJYA 4UQCA 2VWEC 5DUPL 5EA0H 2G2NA 3LN4B 4JR9H 2AZUA 2JKXA 8CGTA 3JV4B 3ROLB 4ZMOA 3S3DB 2HRPL 1BZ8A 2EH8L 3IDIA 3ABZA 4LCWD 1OGPA 4ZUTB 5DHYA 2J12B 3RILA 3HG0A 4PTTB 4AEIH 2DB8A 5FCUH 4DJMA 3ML8A 1CXKA 4L4VD 2BXYA 4FQQA 3VI3F 1FH5H 1L9NA 1TEYA 2FYYB 4JQXA 5CJBA 5MEOA 4GSQA 2YEQA 4JFHD 2WNXA 2F53E 1IQWH 3L48A 4OJAA 5CFAA 5GIRB 3VD3A 1QBMH 3DARA 4KNSA 1JZ7A 2ZCLH 4UIMB 4NS0A 5T3ZL 4BA0A 4DKTA 3X17A 3X1GA 3AXIA 4LCCC 2NUPB 1HL9A 3BIAX 5CEZD 5IV2B 2P49B 3PWJB 1PIFA 5FM5M 4RX4D 4OJEH 3QEQA 4Q89A 4F3FB 4GAAA 1INQA 5D4QA 3NUKA 2LLNA 5DJ0A 4DKEL 1NSNH 3DJZA 4HISA 3T65B 3V10A 3GSNH 3NZ8B 4PP2B 1DVUA 4MASA 2IH3A 3TEYA 4JG1H 2YPKB 3WEBA 4A63A 2X6VA 2B59B 3U4AA 4U6YA 2O5XH 4J4PC 9PCYA 4XWOD 2E56A 2EH7L 3ASNB 4NRXA 4QAWA 4IKNA 1SJMA 2ROYA 4NCC2 3US9A 2WANA 4APQC 2LAAA 5AVXB 1EO7A 4LRIA 5DSCB 2QJDA 2PCYA 4LPVA 3MROA 3QUZB 4NQQA 3RIFF 4FLQA 4RGMC 5E99H 3L5WB 3FRPB 3O4LA 4PB9H 4ERSL 4MB1A 1V3MA 3LDBC 3CVIL 4HC1A 4F2MB 4KXBA 1RLWA 5FS5A 1ID2A 3BO8B 4IGBB 4NP9A 5JXAL 4YE4L 5MHSD 2BS8A 2X89D 4AKPA 3TIEB 4TOYH 3SQBA 5E2TL 2VT0A 4KVCL 4FXGB 4UUJB 5EOQH 4XBEH 1BF8A 4NHCH 4XNYL 1T04B 4XNZC 4EO5A 3OR6A 1A0QL 1TENA 1CE1L 4JO5A 3DUUB 4RFEA 5BOPA 3UTTA 2AEPL 2AJSL 5GJSH 4AJVA 5BUPA 4AWJC 1R3IH 5D2NE 3FTXA 3HE6B 3QJHB 2HT2D 4D9RE 2WGXA 2GW5A 2HKHH 4FFZH 4IK6A 1BBDL 1DBML 5JMRA 3ILDA 3PWUB 1CIDA 4TVPL 4IYKA 4GJTB 5JDSB 2OCJA 3KYKL 3P3YA 3HRPA 1WBYA 1CTNA 3O6FB 1NFDA 3BSZH 3C6LA 4GMTH 4ZFZA 3VA2C 3MRDB 1L5GA 3K71B 1ZS8B 3B2XA 3UBGA 5HHVL 4N0FB 4XCNB 3SDYH 5IKCA 4S11A 5I15H 3UJTH 2EDNA 2XV6B 4LOUC 3VW3H 5B1AB 3IF1B 3LNFA 1Z9LA 4MJJA 4OLWL 2YO3A 3DDFA 2PW1A 4MYPA 3NT0A 1MDAA 5FWRA 4R97B 1NDTA 2JKWA 5EZIL 3TJPA 2BSRA 4WUUD 3C5JB 3FT3A 3N0AA 2F53B 3ZDZE 2K78A 3W56A 1ANUA 4C56D 4KKQA 3CH1B 1PLBA 1NC4B 3VI3A 3GKWH 4XHQA 4N8VA 5ICXB 3UBFA 1YMMA 4OBSA 2XG5B 3RB5A 4D9LH 1UB5B 4FGMA 3UJIL 4XP9H 4L4TE 5DR5H 3ARSA 3QH3A 4H2CA 4K94C 3BE1L 4N0UE 3U46B 3FTGA 1QVOB 3S35X 2A9BA 5KG9A 1M1XB 3KYOA 5DEZA 3BZEA 3LRKA 1LO0L 3KM1A 1NC2A 1MFBH 2ZUXA 3TV3H 2XBZA 3A3YB 4KJYB 5A40E 1F18A 4TQIA 3GJEB 1ROWA 3MJ8B 4N6RA 2XN0A 1KWKA 5HY9B 5K9OB 1FNAA 4AV5A 3PJNA 5CN1A 1WZLA 2NNCA 5E2UL 4MNGE 2QPFA 4ESKA 2VKWA 1AXSA 4BJLA 1D7CA 3CN3A 5CZRA 2F61A 3OKLB 2B4CH 4IBUA 3ZHFA 4PR5A 2XVLA 4A6YB 1DLHA 1BD2E 3MNVA 2Z4QB 5HJDA 4X9YA 1C16A 3VFRA 4CU7A 2I5YH 1B0GA 4GBXA 2VC2B 3K72B 3DO7A 1RUKL 2CJTA 3OKNB 5LXVA 2OX5B 1CGYA 4RMQA 1NLDL 1TXKA 4LCYB 5F9JA 5GGQH 4Q9QL 4PV9A 4U3SB 5DS1A 3DHPA 5DDHB 1MCOH 4OFYA 3WLWD 4LNVA 4MNHB 1CB4A 1LDSA 5FFOA 1SOQA 5D71H 3HG1B 3V4VB 3AWFA 3PP4L 3GRWH 4MDIB 3SSGA 4HS8L 3TFBA 3O2VH 2XY1A 5EOCL 4FQXB 5CD5D 2C7UB 5CCKH 3QZBA 4B53A 3ZPDA 5D1XB 2ALWA 3D4ZA 4L8CB 1YN7B 3FHQA 3HTLX 3HE7B 5ID1A 4PJGB 1Y1DA 2ENSA 4U1JA 4M43L 4UF7C 5EUOE 1BYNA 5I74B 3BZFB 4IJ3C 4YIQB 1YJDL 3C2SA 3IGAB 1E28B 3CFKB 4HT1H 3BX7C 2FJSA 1K85A 4L4VE 4MHHI 4HDIB 3GGWB 2ISDA 4RBPK 3K80A 5KSUA 1QX1A 2VDRL 3MO1A 4GP5B 3UC2A 5CMAA 2GCYB 2X70A 5ECJE 3V0AC 4M3JA 1IC4L 4KDTC 3NRQA 2BDNL 3CZUB 3DX7A 3MUJA 5HGBA 3VD1A 1UH3A 5JQ6L 4BZ2A 4PJCB 3VU1A 5I82A 3K5SA 5ENWB 5CEZE 5B1JA 5J11C 3QQ4A 5DFWH 3PYCA 4LP8A 1OLZA 4E9WA 3DK0A 3JYCA 3O2WH 3EXLA 2H0FA 2YQBA 5ACMA 1BJMA 3V4UL 3EF7A 5GGRA 3BPCB 1B9ZA 5EULV 2CHXA 4Z7NE 3CNKA 2CQVA 2W07A 3EO9H 2HLEB 3QEQD 4PUBL 3LKRA 2JKLA 2BSSA 3RGVA 3AGWA 2F5AH 3F6IA 1WA1X 3LPWA 4N2AA 4LU5H 4QXGH 4JQIA 2FD6L 3MNWB 4A67A 1G9NL 1TETL 5AW0B 4IBSA 3JT2A 3OZ9H 4GXUN 2WKOA 1KELL 3W9DB 2HVBA 1YO4A 2OMYA 5IT2L 2FEJA 1T83A 3WSQL 2CAKA 3FL7A 4JANB 2FQGA 3SPGA 4IU3B 4A37A 3GUFA 4WRLA 2BRRL 1SOSA 1T22A 1XR9B 3DYOA 2WVSA 4OKVB 4YHYB 1OW0C 2VO5A 3EDJA 3GBML 4QY8B 1RZKL 2HJFA 2IBZX 1ZVHA 3ALWA 3BH9B 3O4LD 4G5AA 4JY5L 3UTOA 4AL8L 4NJAH 2J71A 5GGUA 3ATEA 4Q58C 4DN3H 5IQMA 1NCBH 1IAKA 4AQAA 4LGRB 1QWUA 3EJYC 2HWZL 1QI3A 3QUYB 4LDLB 5EFIA 1SHXA 5KJ4A 4XP1L 3MTXA 1R5WA 4LIQH 1QATA 3MJ6A 1XXFC 4JDEA 1CGVA 2AQPA 3P11H 4WTXA 2DQUH 6TAAA 5T8IA 2X1XR 2AJ3B 3JTSA 3V5HB 5IBTL 2CR6A 3QXVA 4BCXA 4Z23A 3I9AA 3MBXH 2WUBH 3W9EA 1KEML 3D6GA 5I75B 5I1EH 4ZAKC 3C08H 4OCSL 3TO4A 1JJUA 5E8OB 3VCLA 3PL6C 3UTTD 5AFAA 3ETSA 1PAMA 4AYEC 3PNWB 1PEWA 3STLB 5GJTH 1CD9B 2APXA 4WK2B 2W9LA 3CC1A 1DCLA 1MRFL 5I1AA 2VDOL 3RWGA 5F1IA 5KS9E 4MA7H 2IH8A 2IXQB 2ZUQC 3SDXF 3JWOC 1N64H 2XVGA 5TH2A 1XF5B 4LCWB 5E5LA 4I3SH 1GOFA 3GEWB 3WGUB 1G5AA 5I71B 4UANA 4ZUWA 4C4UA 5D1QB 4ZS6D 4GNKB 3O3EA 1SXCA 5E1GA 4YO0B 3QUMA 5I16B 5LXGL 1GZPB 4JEGB 2XA8H 3BD3A 4MNQE 4HKXA 4XE0A 5D7LB 3STZB 4N5ED 3C6SB 4TQEL 4C56E 5I1GH 5L2KD 1GXEA 2C3WA 4TSAL 4YR6B 3FSAA 1XGQA 3CN2A 3FB5B 5ISZE 4YBQC 4JREB 3UAJC 3T4YB 2VJ8A 5DFTA 4MA1B 4KXCA 3DGCR 1KLGB 1B9KA 1F58L 3LZNA 4RGOL 2NT1A 4J1UB 3K74B 5H35A 1YMMD 1Q0YH 3WMQA 2CM5A 4V33A 4PJFF 1HHHA 1IL1B 5DMGD 3QZOA 3GI9L 1E4XL 4JGUA 4N2KA 3WUWB 1S9KC 3BSGA 3RIFK 1RCYA 3U30C 1QBLL 4J6RH 3QPXH 4NZRL 2C34A 1KB5L 5INDA 4DP9X 1NMCB 4HJEA 1G6VK 5CFHA 2YMXH 2L3BA 1NC2D 2D7NA 2FX7L 5EHFA 1I8AA 3WFBH 5E8PB 2DIJA 1WPCA 5F7DB 4MA8H 1NGWB 5CLWA 5LGJA 1CGXA 3KPMB 4YC2C 4HFUH 3WNLA 3DDGA 1MXDA 5CP3A 4N1EA 3ZKND 4HEME 3GTNA 5C0BA 4A2EA 3VSQA 4LSUL 3QUXD 3GB7A 5CWSB 4IHOA 3W38A 2AVFA 2KQMA 2QPSA 2X1PA 3D39A 5CXPA 4Z7WF 5D1ZI 5A6IA 1HYSD 5I18L 4GBXD 3MUGA 4P4RB 2YXWA 2ICES 3BWAA 1U8PB 4ZBJA 3MV8A 4N68A 4AEFA 4BE5A 4GH7B 2DMBA 4OFYD 1MHPL 4LDCA 3OF6D 1Q1PA 1HL5A 3IJYA 5J89A 2WJ5A 4HUWB 5C0RL 1KGYE 1FAIH 4S10A 1J5DA 3GBDA 3D5OF 3GXMA 1KYDA 1FNLA 4BK5C 5I6KA 2C9RA 1LO3L 3CFBA 1GGBL 2CHDA 3FQUB 2BS71 3BP6B 4GB9A 4PRNA 4WDIA 5TD4A 3IRCA 3QDJE 1LDPH 3ZMEA 4BFJA 4PI2A 3ZR6A 4L9LA 2IFFH 1JXKA 4I77H 1MDTA 3AMKA 4W70A 1YEJL 2ZUYA 1RUMH 3ARFA 2D3NA 1BAWA 1XO8A 2RJMA 4WFED 2ZXAA 4ATTA 1BVNT 1MCFA 3FN0H 1H3TA 5AVVB 2I7OA 3G5YA 4OLUH 4M7KH 3MRNA 1XF3B 5J7CC 1G9EA 4L9DA 3ALPA 2B0SL 5BQ7A 1RL1A 3NCJL 4EIZC 3WNOA 3O8XC 4GUCA 4XPFL 1YEGL 2XY2A 1WZKA 2ZOOA 2EADA 4WKZA 4ZO8A 4XO5A 3SDXA 2VSDA 1T21A 4G8GA 2IDSA 4P5TB 2HKFL 3QEQE 4NZUL 3S37H 4B96A 4RZCB 4WUUB 3MFGB 5IQ7L 3VI4B 4C56B 4I18B 2JJWA 4N3TA 1NBVH 1TQCB 5JW5B 4MRBA 2HX9A 2ZWSA 3P0VH 1T3FA 3TEXA 4PJBF 5ID0B 4E9VA 4BSWB 3MBEC 2WBJC 4NQDD 5J5EA 5TK4A 5D2NC 1BG9A 3WKML 4JZJA 3VFWB 3KJ6H 3TN0C 1JAEA 2HLFC 4L18A 3O6ML 3QJFB 3CFUA 1KENL 3DPBB 4ZG1A 4CVXA 2VDKL 2R0ZH 3FTZA 2CK2A 2XWZA 4FXKB 2BIPA 3K6SB 3K6NA 4QRTA 2AI0H 1BJ8A 3GNMH 3KXFA 43C9A 4ZMXA 5LDUA 3IJEA 2XIIA 4Z8FH 5K1NA 2LTQB 3CLEH 3AM8A 2BJMH 4NENB 3I9GL 4WI5A 4HQQL 2AQRA 5AOZA 1T5XA 3LNHA 4WU7B 3EDEA 4UDUA 2J7LA 1TQSA 4OZFB 2Y6SD 2CIKA 4HKBA 3AVEA 3KVDD 1MCDA 8FABB 1K3IA 1OAUH 5DK2A 1NBYA 2XC8A 2YZ1A 5IQ9B 1JZ5A 3FYIB 1D6EB 1OB1A 1KTLB 3DOIA 4KUZH 4PD4J 3T2QA 5EEVA 4IM8A 1OAXH 4CMMA 1A47A 4YEFA 3KPNA 3ZHKA 5EB9A 1RK1B 4LLVB 5EUKA 4EIBA 2AV7B 3WLBA 2DY2A 2MHAB 4FCHA 4JDVA 1MI5A 2QVIA 3OL2A 4J2QA 1CGSH 3RTQC 3ZDYF 4IDJL 5GRXG 3MV7D 2WNGA 3K4ZA 4JS7A 4RISL 1KCSL 1EAPA 2UZIL 2EKSB 3UX9B 1N7MH 4JFSA 4PTUA 3SPJA 1SYVA 2I60H 4Z7WA 1XWVA 5I2IB 3K2KA 4YFEA 3L3DA 4M1CD 4MJ5A 2MCAA 2OA9A 4YQXH 5HVHB 1H3PH 1CL7L 2ITCA 2D7PA 4BGLA 3FRUB 4S1RL 1IGFL 4ODSH 1CVSC 4D0BA 4WHTA 7TAAA 4GQ9H 1Q0XL 5KJRH 3ELAT 3RGHA 3MDJA 2XRAH 1KV7A 2TSAA 2XKNA 4LLQA 3FF7A 2ZYSA 1OTUD 3RKDD 1N6QL 2RFXA 1BGXH 4ZOCA 5H8DA 1L9RA 4IKKA 4PJAA 2AEQH 3BQUC 1YEKH 4GUPA 4DQAA 2ZF8A 3MJWA 1P4IL 3IDIB 4XAWL 1SJXA 3Q13A 5JIKA 5FECA 1CYXA 3J7HA 4L3ED 5DHYB 3V0GA 5L2KE 4PLOB 1AHWA 1SY6A 3FN3A 4OVVA 3Q8BA 2Y7QA 2O30A 3HR5A 3FU0A 3P54A 1AI1L 1G1KA 4KK9C 1I9RL 4K94L 1KC5H 4FQQB 4M93C 5MEOB 3EYUL 4QDGA 1TYJA 5HGDA 1UJTA 1UG9A 4YHIA 4ZW8A 3KPRE 1CD8A 4ZD3L 3JUZA 3IETA 4K3DL 3AW5A 4TTDD 3GEFA 3S36L 1EWHA 4G7YH 1INEH 3CHPA 2BIMA 3BWZA 3CGTA 3WFEH 4XB7A 1A3QA 5EEYA 3CMGA 5A1AA 3MNZA 4ZMNA 4G83A 1R3LA 3D09A 1TO5A 1DDHA 4NP4H 1TG8A 3F7LA 5E9DA 4NPYA 3QEQB 2PR4L 2XI9A 1QD0A 5KOVC 4DERA 3ULVF 1INQB 1UXMA 3NEOA 3ZSSA 1OHZA 3WN5A 3Q5TA 4AUJA 4EUPH 2IH3B 3QFJA 3A6BL 4GO6B 1X5XA 2WBXA 5B1KA 2DBJA 2J73A 1SVCP 2WLHA 4OZIF 2NNAA 4NRXB 4KKCC 4OF6A 4UOZA 3THML 4XX1G 3GXIA 3AZUA 1SXSA 1AOHA 4OGAC 5CD3B 3MROB 3LZPA 2EVJA 3EFDL 4WI9A 1BVLA 1Q72H 5C0BD 1MAML 1BFVL 2HH0L 5FFGA 3WY4A 4ANWA 2G3ZA 3O4LB 2NY4D 1AJ7H 1CFVH 3PHOA 4UNTA 5GHWL 2YXMA 3RWJA 1OAKH 5BOZG 3D0VA 4F58H 5HDBF 1BEYH 3NN8A 2D9QB 2V5MA 1KPVA 3APFA 3SQBB 2LLLA 1H6FA 3L1FA 3UG5A 3D87B 3D05A 2GJ6E 3KW7A 3H9ZA 3Q1EA