1XAKA

Structure of the sars-coronavirus orf7a accessory protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
CELYHYQECVRGTTVILKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARS ORF7A ACCESSORY PROTEIN
publication title Structure and intracellular targeting of the SARS-coronavirus Orf7a accessory protein.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 12
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1550 Mainly Beta Sandwich Immunoglobulin-like SARS coronavirus X4 1xakA00
1YO4A 1XAKA
chains in the Genus database with same CATH superfamily
3EHBD 3VE0B 4M1DL 2WXQA 1S7VB 3BJLA 3DA0A 1E27A 4WFFD 4PJEF 1AE6H 3U2SB 3VFRB 3CFCH 1W80A 5F93C 3L08A 3PWPA 3GI8H 4M8QB 5I76A 4ZAKB 4XCNA 4ODUB 5EF0A 3C60D 1I8LA 1MEXL 1KJMB 3CAFA 3MRPA 1CYWA 3KLDA 4P2RE 3I9IA 3HI6L 5M94B 5JNYA 4P49A 1IC0A 4N3TA 3ZRSA 5I1DB 2QQQA 1NC2B 3LD8B 3SDAD 4X9BA 3EJUA 4HZAA 3WMSA 2DL2A 4XPTL 3HIZA 1CDIA 1Q94B 4XWGL 3NIFE 2NYKA 3AMKA 1ZRUA 1I53A 1XGQB 2H32H 4LQFH 4UTBL 4HKXA 2ENSA 3TA3C 5JR1H 4V1DE 2Y69B 3WYRA 4EI5A 3LV3B 1UWYA 5I8OH 1A4JB 3HPLA 1UTDA 1G7IA 2AEWA 4FQJH 4XH2A 2UYLB 3FN3A 2IOIA 3QUZC 4ZSOB 4JFYA 3VXUB 1WBYA 2CUIA 4MQXC 3D25A 5I15L 4RA3A 3LYRA 4NO2A 3S5LG 3N2JA 3Q8BA 3VXOB 2A6KA 1VGEH 4MDIA 1YDPB 4HMEA 1FNAA 1XGPA 5C2UB 5IBTH 4FF9A 3LEVL 4QRAA 5JZ7D 1OAQL 4ODVL 1BLIA 3M7OA 5EU4B 4WQOA 1GJIA 5D72H 3A67H 2IH1A 5DT1L 1EANA 4P2RB 5D5MF 3Q6FA 5JW4N 3HI5H 4N25A 5FDWB 1L7TH 3LB6C 4HIJB 1KJ2H 4PJIE 5DC4B 1HN1A 2AJ3B 4WIQA 1PG7L 2G4EA 2ZOLB 1NKGA 5FDYA 1DBJL 2WHVA 4B5EA 1SYVA 4F57H 1AGDA 3CZUB 3D3VA 3EGXB 5K39B 3NIFB 3KW7A 2NLJB 4GKNB 4XNBA 2K3TA 4XOCA 5EUOE 2VZ1A 3ES6B 4O2FB 3DBXB 5EIQA 1MRFH 2XFXB 4U6HB 3BSZA 2AQTA 4V1DB 1IC1A 4CU7A 3K74B 4PLOB 1T20B 1P53A 3CK0L 3RFZC 1E4KA 4UINL 4O9HL 4YPGA 3FOLA 4J3XA 3HHSA 3O3EA 2GBAA 1UWGL 3IB4A 4WKXA 1MUJA 3L4YA 3MCLL 5DJ6B 3VW3H 2OAAA 3TN0D 2XUWA 3A24A 4M61A 3WFCH 4KVPA 5T3XL 1CFQA 3ULUH 2WWOA 1FO0L 2UUDH 3K6NA 1EJ8A 4YXKL 3RPIB 1BVLA 1BZ9B 1QYGL 3MV7A 3O3UN 5E51A 1KYAA 1XCWA 3BFQG 3KPMB 2E46A 5AW4B 5LKNA 1JGDB 1CC3A 2H0FA 4LL9A 4PJXB 3WHXB 5H37H 4FQCL 3W0WD 3PCYA 1YQVH 4HK0A 4OCXH 1Z6JT 1ED3B 1ECZA 4N8VB 4CW1B 4PJGB 3DO7B 3AS0A 1UA6L 4PJIB 4O5LL 1AYOA 2OMVA 4O4YH 3U1QA 4Y19D 2AAAA 3L4UA 5BNXD 4GPVA 3L9RA 2FBJH 1FGVL 2A4CA 3CSYB 3K2UH 4OCSH 1K3ZA 2WXNA 4JRWA 4QHLB 5IB3B 4HJ1A 5EUOB 1QEWB 2A74B 1KIUB 1BQLH 5DVOA 5I1EL 4MMXB 5A2KH 3EJYC 4G6KL 5LGJB 3W11D 2XV6B 5HI5C 1AKJD 2C1OA 1BQHG 2W9EL 2UZXA 2ORBL 3JZ7A 2Z93A 4OAWB 1PF3A 1V7NH 4HJIA 4GKLA 4Z78A 4NEHB 3FTZA 2CO7A 4ANKA 4C8XA 4PIRF 5EZJA 5D1QA 5E9DE 4KUZL 4MNGA 1NCWH 4NLAA 2XVGA 1TTGA 4AQZA 1MFEH 3IF1B 4ZW5A 2CQVA 1M7UA 4GG8A 1R24A 1B6UA 2ROXA 1A66A 4UOW1 1QFWL 2WXPA 4OIFA 1AHKA 4G8AC 4XRCA 2X9XA 1PD6A 3MGTB 3OQ3B 4F9LC 3QZPA 1NKOA 2IFFH 3VGEA 1BECA 3CN3A 4Z77B 4ZD3H 3FT1A 4RZCB 2H1PH 5E4IA 5E24E 3CMOL 4PYHA 4D9LH 3GXUB 3KL5A 4LPCA 2G5BA 5EPMB 5IW6A 2BS8A 3TEXA 4N1EA 1YEJH 2Q8AL 4PJHA 4OR1A 2GT9B 2L7UA 1HI6B 4JRYE 2P44B 4AV5A 3K72B 5KS9E 3PUUA 3ERXA 1JYWA 2F53E 2OXHA 4D8PB 3D4ZA 2BC4A 5AUMA 2YMXL 1SY6H 3L1FA 4UM8B 2BHYA 3UZVB 4E9LA 2QBWA 4H26A 2H3KA 25C8L 1VGKA 1LDPH 4Q2ZB 3UTSE 1SGKA 1NL0L 1FL6A 3IT8D 1I8KB 2JXMB 1K4CB 4BZYA 1FH5L 5E9DB 2DM4A 3HZKA 3ZKXB 4YSDA 4AGMA 4XTRD 4X7CC 3IS1X 5D6DC 2AXWA 5F0PB 4E9QA 3KGRA 5D2NE 1TTUA 2VC2H 4DAGL 2DI9A 3TC9A 1AIFA 3GB7A 1NCAL 1EPFA 1AI1H 3AQYA 2JCCB 3DTUB 4LL1A 5HGHB 4YLBA 2GUOB 5IJVB 3RY6C 5K9KB 2E74C 4K7FB 2XRAL 3AWEA 3VU2A 5A2IH 4KJQC 5L4FA 2YWZA 2LT9A 2OKMA 5MEQA 4C54A 3RTQB 1UGNA 4GI8A 3JV6B 3OAWA 4P5MB 3HAEH 1AE6L 2CRMA 5ABDE 3TEWA 4WTZG 3S36X 1I4FA 3GI8L 5KYYB 5CINL 3WUZA 5JHLH 2G3ZA 4JRYB 4B9GA 3BZEB 4G6AC 5ITFA 2P5WE 5G4NA 2ICES 5KS9B 3CDYA 2F53B 4NRYB 1K8DA 1M4KA 3QJZA 1FNFA 3VD4A 4G1EA 1JK8B 5CSBA 4FMFA 1KIQA 5EFIB 1LO5B 4X80H 3DVNA 1OCCB 3FPYA 4XOEA 3V79C 4MVBC 4DWHA 3R7RA 4L8SB 4UBDD 1KFAL 3F83A 2EVIA 1TCMA 1BXAA 1RZPA 4U1NA 4LLMA 3V6OA 4RGMB 1GYCA 2P1YA 4KXZH 4X99B 3VXPA 2EYRB 5D2NB 2B1HH 4K3EH 4Q9RH 3DMMD 3PAZA 5DC0A 4K8RD 1MVUB 2L3BA 3W39A 1F1AA 2VB5A 1F41A 3CVBA 1IGTA 5I8OL 3GMOA 5C8JB 3IDIB 5CJXA 5JHDE 2B15A 2D7TH 2EH7H 5D7JA 5KSAD 1CLCA 5LXGL 4ZMPA 3UTTB 3BP6A 4ZUVA 4FTVA 2CO3A 2FHFA 2NY2B 2PXYA 1ROWA 2WXHA 4WGKA 4GW4A 1Z9MA 4RX4A 1G9HA 3DV6A 4AIZB 1NSNL 1PDKB 1VGEL 2GJ6E 1H6UA 1UXLA 3CZKA 1G5AA 5L2KE 4LLDB 5IBTL 3KCPA 4AUYA 1G4MA 4AMKH 2P5WB 5FYLH 4PRAA 4FMKA 4JRXD 1FZOA 1IM3D 5D72L 5JHAA 3A67L 2R83A 4LLWB 5BRQA 1AHMA 4J8RB 3OF6A 2ZCZA 4ZFQA 5EEVA 1J05B 1B0WA 1XIWC 4ISVA 3HI5L 2D3JA 3HHRB 4RDQG 3TO4B 1L7TL 1KJ2L 1AXSA 4DCQB 3QDMA 3HAEB 2VDKH 3ZX1A 2HRGA 2IGFH 1BV8A 2BVOA 5IB1B 2WTRA 1AMYA 2BS9A 3L3KA 4F57L 2C1PA 1U8IB 4X0NA 4BQ8A 3CNKA 1XCQB 2H2PC 5EIIB 1CICD 2OP4H 4L37B 2WXMA 1MRFL 1ZKAA 5FYJH 2YPKB 2Z8SA 2GVYA 4MS8D 1I8LC 2BP8A 4XNMA 1U93A 1U0QA 2H5UA 3JWDH 4YDLC 3QO1A 5JHDB 2FYYA 1EDYA 3NPSB 3O0LA 3MRFA 5I75C 2QPDB 3B9VA 2BOBB 1ZDQA 3FZUD 3VW3L 2AFNA 4LVNC 4DP5X 3OWEA 2GJ6B 3MA9H 3QB7C 4F2FA 3ULUL 5L2KB 2RFXA 5FYJE 2PCFB 3KEHA 2Q3ZA 1A7OH 4LLAA 1CGSH 1JF5A 3MV9E 3P4LA 3U6XS 4XCEA 1JNHB 1MCKA 3VXTB 4HCRA 2VIRA 2C3WA 4OW6A 1YQVL 3LQZA 4UILH 2X1WL 4EI5C 4OCXL 1D6VH 3SD5A 4X6DF 1YNLH 1RZ7H 3TBTA 3RVTD 5BVPH 4K3DL 4HPYH 5GXBB 5HGDB 1NCTA 4O4YL 5D2LA 5IB2B 3V7MA 2WLJA 2FBJL 3QYMA 3IWUA 1GZPB 1XD1A 2MTAA 3K2UL 3J8F7 4OCSL 3F01A 3HE7A 3GKWH 3H9YA 5C08B 2VKXA 3LKPA 2ZOKB 3N04A 1G6RL 2XACC 5KUMA 2APVA 4PJBF 4UNIA 4WHYG 2FQFA 1T1XA 2G30A 3GJEB 2EUVA 3BLBA 3DXAD 2VDKB 1V7NL 4NQDA 3MBEA 5AYTA 1XF4A 4NZ8A 4YSCA 4N2FA 4LVHB 4NO3A 3W56A 3MLWH 4Y4HA 1NEZA 1NCWL 3O2WH 2RH0A 1ZCRA 1S9WB 5F3HB 2BHFA 4NKMB 3AT0A 1MHEA 1MFEL 5E2VL 5AVYB 4RMVA 2BM3A 2E9GA 3H8NA 1LO3H 3UBXI 4DOHE 4GRLC 3K71B 1SMOA 4UAOB 3UG3A 3VSQA 2P43B 1I1YA 3DIVA 4RGNC 3CC5B 3GZPA 4ZUSB 5J6HA 2X44D 3ROOA 2IXQA 4MQ7B 2AZAA 5EBWA 3FQWB 2VR6A 3FK3A 3CFDA 2ADIA 3O2DH 2K8MA 3DX4A 3QUHA 4X6CF 3LEXA 4UU9B 1E4KC 2DIAA 3PPSA 3H9SA 4HUWB 3NBNA 2WXIA 3GSNA 4E2OA 1S5IL 5AG8A 3BD4A 5KBKA 5EEZA 3OAYK 2GEEA 2X4PA 2AJZB 3LKOA 3LNGA 4AIOA 1YEJL 3H2QA 2E75C 1JGEA 4X8CA 1B4JL 2CDGA 4ES9A 2BLFA 4U1GB 5BJTB 1SPDA 3FTVA 4FL4C 2HLAB 2OI9B 4Z8FH 3DVFA 3KH4A 4WWKD 3P2BA 3PJSA 3DRTA 5ID0A 1LDPL 1RK1B 3QQ9C 1JCKA 4LDCA 2WZ0A 4NKQB 1ILSA 1GS7A 4AVJA 3R7QA 2B3RA 3SE4A 1A3LH 1THAA 2VC2L 2ZUVA 4DOHB 3IEAA 3V4PH 1AQDA 2L7JA 1QW8A 2EDBA 2YD8A 1QQDA 3LZFH 3OGOE 1AI1L 5CJ5A 2YMTA 4JO4H 3TNNA 4NQTA 2P5EA 2CO6A 2BNRE 1YC8A 3O0RH 4OZ4A 1THCA 3CFKB 3JT0A 3LMJL 4PJEE 5CIPB 2OYMA 3PHSA 5SX5K 3GSQA 3QS2A 1L0PA 3VFNB 4C56D 4HGMA 1FZMA 1C5DB 1TZAA 4HSAC 1F2QA 5D1QC 1JHLH 1JXGA 1XFPA 4YHNA 2E7DA 3FTSA 5E7FA 5FF6B 3V0VA 3INUH 5AKTA 2C4XA 4A66A 4QJ3B 2ATKB 4PJFB 5JHLL 1C7TA 2BHUA 3U4EA 1S7UB 2YPVA 4WJKB 1OB0A 4FQQA 1IM9B 1KV3A 1S9XA 2J1KA 4PM1A 2DQCL 1XD0A 2ZXQA 3PNRB 3UZQB 5SWZA 5I1CL 5GGQL 1MAMH 1T1WA 3QJHB 3OXSA 3SGKA 2BCKB 1SM3L 4G7VH 1HS6A 2XBTA 1I7RB 1KGIA 5FO7B 1HCVA 4J8QA 3QEGH 1TITA 3MN8A 5I17A 2QADD 2WBJB 2B1HL 3QUYD 5AW7B 4K3EL 1FP5A 5I8EA 5I5MA 4Q9RL 3K6IA 1S7TB 4HKZA 3BSZL 3LS4H 3ZSSA 1UHVA 3IETB 5JPMC 4P23A 2LVEA 1ZAGA 3AM8A 5MHSD 4MZRA 2DMCA 2YKKA 2H0JA 4PJEB 5SWQA 1O5PA 1Y18A 4QI3A 2D7TL 2EH7L 3C6SA 3I9GH 1I1FA 1IEAA 3LKSB 2MQCA 4HIXH 2VW7A 4NUMA 4O00A 1DJZA 3FUJA 4M6AA 4ZFOB 4X9GA 1ND0B 3F2LA 3K5SA 5GHWH 5KTEH 3N41F 1MJ8L 5FKAB 1AS6A 4M3KB 4BQ6A 2JB5L 3CZLA 1IGJB 3SYOA 2XZAH 3ULSB 1IC7H 4UT9H 2VUOA 1B4LA 2WP3T 5CD3B 2KQMA 4PREA 2ZXBA 3HZMB 4HWEL 4FQHB 5D5ME 2Z0UA 4D0BA 1M6OB 1CVSC 1QSZA 1PNCA 4JCLA 4AMKL 2IV8A 5FYLL 4YSEA 1GMEA 2H0PA 3OPUA 3S4SA 1J0HA 3BVXA 3MRLA 2PWEA 1A14H 3PAYA 4MDJB 1PZBA 4HX1A 5H2BA 2AZUA 3CE1A 5I6XC 5GGRY 2GPZA 5HGBA 4D7BA 2E7LA 4EUPA 1SOKA 3CIAA 5HJDA 4JFDE 2DQGH 3TP4A 1G7QB 1N5AA 2IGFL 5INDB 3IBEA 5I1KH 1EDHA 2QT6A 3FFOA 2Y24A 4L8CA 2DH3A 2RA1A 1MFDH 1VPOH 1SBSH 4XVJL 3RUGA 3DOIA 4TM9A 5DD0L 1KCSH 3D06A 4UTCA 2NX5A 4ZMTA 1ZHLA 4FI7A 3L3OB 4B9KC 4UOZA 2XZCH 4HLZG 3TWCH 3UMNA 4Z7OB 1E4WH 3AMLA 3JWDL 3BP7B 4N2CA 4Q89A 2AK4D 1T04A 4R7DB 4DETA 2CBOA 1QHPA 2WIMA 1D9KA 4U1KA 2IALA 3QG6B 3ZVVA 2ZUYA 4NM8H 1M9SA 4FZEH 1S9YA 3MGOA 4NJAH 2W59A 1GJUA 3A47A 4JVUA 5CEZH 4WDIA 4G9FE 4IDJH 4KRNA 4ANUA 3HI1B 2XWBB 3GSOA 4DPRA 3V6OC 1TDQA 2PYEE 3GZOA 3MRDB 1O7SA 3DJSA 4JN1L 4LEOA 4U6TA 5D5MB 1QFPA 3DIFB 4ABVA 2PTUA 3G5XA 5EU6D 3G6DL 3OLGA 3R19A 5PCYA 1ZEAH 1YC7A 3CZGA 4QPEA 5C6PB 3QHTC 3RL1B 3EGDB 4DVRL 1W0YT 2VN4A 1U8LA 4EBQH 2C7UA 2X6CA 5MEOA 1JYNA 2F7RA 5GGUB 4UILL 1UJ3A 3POHA 4RSVA 1D6VL 1HEHC 1ADQA 4N0CC 1YNLL 5GRJH 1RZ7L 4WWPA 5CJXC 5IM7B 5BVPL 1R5VB 4HPYL 2VAJA 4JDVA 4NO5B 1FLRH 5D7JC 5DFTA 4JFDB 3MO1A 1WS8A 2WKOA 3QPQC 2F7OA 4MLIA 2CIKA 3O11A 2PXYC 4KV5F 1ETZA 1ZV2A 1H3GA 5C0RH 4NS0A 5AD0B 3GKWL 3CDFA 1SF3A 2I9LA 4NKDB 2Y7LA 3KYOA 2R59A 5E95B 4ELMF 2GKIA 1ESOA 2OMYB 4HH8A 4MXQC 3CN1A 2VN6A 2ZXDA 1BF5A 3FQRA 5GGSB 1I9JH 3EFDH 3EOAA 5K33A 4U3HA 4CADA 4DKFL 1LO2H 3GEWB 3BT2L 4TXVB 4ELDA 3MNMA 3SO3C 1ZLWH 1RJYB 4QY8B 2NSMA 3O2WL 4WTWA 3GK8H 5KBNC 3GTNA 5GIRB 1T3FB 3IGKA 4M43L 2R1YA 3W9EB 1A8ZA 3OTTA 4U4IA 1WGVA 2QVIA 2GK0A 2UX7A 4GUPA 4M5TA 4YWGH 3P77A 3BEWB 3BI9X 2MJWA 4WV1A 1HK6A 2PP8A 3OKOB 4NSKB 1U8MB 3EHBC 3JVGA 3L9EA 3O2DL 1U8PB 1XGZA 1FNGB 5F7FA 4F1SA 2J21A 5ISZA 2VLRA 3WEXB 3O6MH 3AT8A 3FFDA 4V11A 5CLWA 1SEBA 1KIRB 2R0LL 2J73A 3GMNA 1OTTD 4WI4A 3P9LA 3EYFB 1YVLA 5DVMA 1B4TA 5IF0A 2X1OA 1OXYA 3JYCA 2NXYD 2UZIH 5ABZA 3EFOB 2V37A 1HHJB 3Q2CA 2B4CH 4PJCA 4KJYA 3IMSA 4PRHE 1NPJA 1CFBA 3SE9H 4Z8FL 1PZUB 4FG0A 4W1TA 3SDAC 3F7YA 3ESVF 1C16A 4FFZH 3AY4A 5E8OA 1T66C 4N24A 5J9PB 3TZVA 1KCRH 1RI8A 3CZFB 4ETQB 2NPLX 4PVMA 1T4KB 1G9MH 3F6JA 5ESAA 3CVHA 4FQ1H 4BH7A 1A3LL 5HHXH 3VA2C 3PGCB 3UZEA 3HE7C 3OC5A 1LWJA 3C5ZA 2GTQA 3RWJA 3V4PL 3LZFL 4ZPTA 5DMYA 4PJ5E 4XOAA 1RJLA 1CD1A 1YNTF 2QSCL 2RQ8A 1AXIB 4JO4L 3FO9B 2C3VA 5HYQA 2CCVA 4U1LA 1CE1L 5AWNH 3B83A 5ALCH 3MBEC 2FT8A 2ERJB 4Z76B 1A22B 3AABA 5D71H 1DZBA 4WGVB 4MJ6B 4UTAA 4LDLB 2DB8A 1PVHA 1BXVA 4W70A 2DD8H 4XZUA 4Y4HC 1JHLL 1MG2C 2WXJA 4I18C 5D1ZB 3REWB 4HT1H 3T6QC 1H19A 4Z7QB 3BPNC 1E8XA 4NAMA 1WC7A 3INUL 2V0AA 3BW9B 3SDCA 2GJJA 5HHOB 4P07A 3ZXAC 4PV1C 2Z91A 3EJRA 2JQAA 5E8NB 1NDMA 1CFVH 4PRHB 3QNYB 3BGFC 2DQUH 1MAML 3M1OA 4GNKB 4KRLB 1GGTA 1LO4H 4WJ5B 4EDWH 4PCYA 4I48A 4A7QA 5ICZA 1DVZA 1LP9A 2DKMA 1O6VA 1FA4A 4NRZA 4Y2DB 4HU8A 1KLGB 4YO0B 1ITBB 3H6AA 4HV8B 3ISWA 1HQRB 4LHUD 4WI5A 1R0AH 1UOLA 5FLUA 1P5UA 3VGHA 3D50A 4Y4KD 5E1GA 4A63A 4YHYB 1YEDA 3UFIA 1GGCH 2J43A 5LG6A 3QUXD 4E9XA 4J3OG 1AFVH 2E9JA 2X4TA 3LS4L 1JD9A 3K91A 1P4BL 5FOBA 3BVDB 3T65A 3VXQB 2D3VA 2UX6A 1EV2E 4YFLI 3NK4A 4WRLA 3U0PB 4MWFB 4XNUL 3SYCA 1MFVA 3BPOB 3I9GL 4IIZA 2DIJA 2A38A 3HN8A 3AACA 3V0WL 4JDEA 2AC0A 5GHWL 5KTEL 1O7DE 1L9OA 1O0VA 1TFHA 1ZLSH 1YAZA 2N01B 3T0BA 3CVDA 1RZIB 4KQ0A 2XZAL 2YOAA 43C9A 1IC7L 2OYKA 4UT9L 2NYYC 3GZKA 7FABL 3ZLQC 2OMWA 3SE4C 5IMMA 1MIML 3EYQD 5AVRB 5HBBA 1UCTA 3NIGF 3FCGA 2AERT 2G4GA 4KKPA 3UPAA 4WEBH 5DQDH 4HCRL 2D03H 3MJ6A 3UPCA 4U1MA 1A14L 3US0A 4GG6F 3MV11 4FJZA 1DQJA 3TONA 4I3SH 4IBWA 4Q9CA 1YG9A 3BFOA 3AXLA 4JFHD 4D9RE 5EO0B 3VGFA 4MA7L 4JAMB 3U7WH 5BS0A 3JWNH 4TRPH 3BPLB 3F05A 5I1KL 2NY3C 1U8KB 2VLJD 3NGBC 4Y9FA 1MFDL 2VDMB 1VPOL 2DWEB 1SBSL 3BVNB 3RZCD 3CN4A 1KCSL 3W11C 3LH2L 4WKZA 2ED6A 4AUJA 5J1TC 2XZCL 3GSWA 1W0WA 4X5XA 1UH3A 1MH5A 2OX5A 4NBYB 4OJEH 3TWCL 1UG9A 3V0IA 3N1MC 5FB8A 3EF4A 3JBG7 1E4WL 1BPVA 4B96A 1UFUA 3JWNE 3T2NH 1E90A 3GUTB 3JV4A 5D9SA 3KWTA 4PJ7F 2YBRA 2QGCA 3HR5B 3G5VB 4OGXL 4YHKH 1Q4NX 2ZJSL 3ZGHA 4FZEL 4NJAL 3BIKA 1M2VB 5CEZL 3SGKC 4IDJL 1GPOH 1PX8A 1HHHA 3ZHNA 3D4CA 3GMMA 4JFWA 3ILPB 4NQCA 5KVEH 4X6DE 1K4DB 2W0FB 4K5OA 4JUSA 2FR4B 1U8HA 4TNGA 4WHDA 4YEFA 4JM4H 4YHOH 3O8XA 4LXFA 3LZNA 2SEBA 4P23C 2E47A 3AM8C 3VFVA 3TH4T 2C9XA 1NEZG 5E2UH 2P48B 3LX9A 5HVGB 3OKNA 4APXB 4RMRA 1FLRL 4K7PL 5IROD 2NT1A 4YDJA 3GSNL 3NYKA 2ARJQ 4JM2F 1R5WB 5AKSA 1EZUA 5C0RL 5KVEE 2IAND 4PJBE 4EVNB 1F3JA 3MUY1 4XP4L 2VN3A 3CPLB 3EJTA 4LGPB 1AP2A 1KBGH 4I1RA 4XAWL 4X7FC 4P06A 3PYCA 2EYTB 2MOGA 2EILB 1GAFL 3WLBA 3RWFB 4DK3A 5DZ9A 1I9JL 3EFDL 1GZQB 2IAMD 4TMPA 4WY7H 1B0GB 5D96B 1LO2L 4GKZA 5F7DA 2X1QA 1TFPA 5AYUH 2ZUTA 4KRPB 4PTTB 5D7KE 3EZ8A 3EIFA 4U6YA 4XE0A 3FT3A 5TE4H 4DKEH 2C4FU 1WFNA 4XTRC 2B3IA 5AW9B 2Q7AA 5DTFA 5TD4A 2E7LC 1WD9A 4UV4H 4QIRA 3FO2B 1MLCB 1T21B 1DQML 1TQWA 2XN9D 2JK5A 3SGJA 2OMNA 4QYOA 5D70H 5DHDA 5CWSA 1IBGH 1UD5A 1UQSB 4KK6D 2D31B 4G42A 3KPNA 3R4DA 1HAUA 3KPSB 4GP4B 4ODWB 4YWGL 5I30L 3FB5B 4X6CE 3X17A 3EAKA 1KELH 1MFNA 2FJGA 3DJZA 3QEQE 3QQDB 4FDWA 3VNZA 1QR1B 1VFBA 2CD0A 3FB6B 3NABH 3KXFE 3DSNB 4OLXH 2A9ML 1AQ8A 1YZZA 5GSRA 2HUEA 2K45A 4TOYH 2ZKWA 1D9KC 4XXWA 1U8NA 3MLZH 3TJHD 3TF7C 4K3HA 4NOFA 4IGBB 4XAKD 3LZRA 1PX3A 4JPVH 5JW5B 4PJBB 5J57B 1WD8A 3Q5YA 4LCYB 2X2HA 3ZBMA 3HC0B 1N7MH 2ALAA 4GI9A 2UZIL 5HSFA 3BYTA 3BZFB 5IMOB 3LRMA 4GW5A 5IFJB 2B4CL 1F4XH 4FQPA 4NHUA 1U8OA 4TUKH 2LLGA 1OP9A 3LKNA 4UBDC 1WSST 3MLRH 4OKVB 1UJ3C 4Z18A 4FFZL 1A3QA 5FCSH 2KERA 4FLOA 5BQ7A 5T1LA 5IFAH 2IMMA 3T0WA 4I1NB 1KCRL 1BF2A 3QIWD 5INCA 5IQMA 2WWNA 1CZ8H 4NCC2 1DANT 1JFHA 1I9RL 1Q1JH 2GIXA 1G9ML 2PTTA 2FNBA 4XO3A 5KBPA 4FQ1L 1DQQA 3MNVA 3B7YA 4K8RC 4NZTH 5C0DA 4P3DB 3H9ZA 1FNSH 4U31A 5JTWA 1DL7H 4UZSA 4GAGH 5KSVB 4PRBB 3ARBD 2FT7A 2JKSA 1AZUA 3FTGA 3T8XA 2XQYA 5HHNB 4X9FA 3QEQB 3QI9A 1BGXL 3QEHA 4G11A 4KNQA 1XQ4A 1GR7A 5AWNL 4OCWH 4XPAL 3KXFB 4S1QH 2ENYA 5DHYB 2DF3A 1QVOB 5ALCL 4FCHA 5AFAA 1BCIA 1OSZA 1H5BB 3L1GA 2VJXA 5D71L 3Q3GA 1JV5A 3V10A 3VXRE 4M5YH 2IH9A 3VWJA 3ARXA 3GJFA 3LPWA 3S2CA 3RDJA 2WB1A 2ZSVA 3PP3K 5MP6H 2O6CA 2BS71 3CFJA 3DYMA 4BDVA 2HN7A 2Q76A 2XTSA 1S7SB 4WV1C 2NUPA 1CFVL 3HBZA 3PS6A 2AQPA 1YMHB 5IIEA 3STZA 4AXWA 2J8UF 2DQUL 32C2B 3DHMA 4H1LG 4XMKH 3T0VA 4EDWL 3JVGC 1GHFH 5J7CC 1LO4L 1WGOA 4PY8J 12E8L 1IAOA 3S9DB 4MMZA 2VDPL 4LSRH 3B43A 3K8MA 5IFHH 4WI0B 3LPPA 3VFSB 4OQTA 2QR0B 4X8XA 3UXFA 3AC0A 5BZDA 1R0AL 1KSRA 4LLUB 3BXNB 1GGCL 2PO6B 4E41E 3RILA 2FBOJ 1SLXA 3GHEH 4DZ8B 4YAQA 3S5LB 4XPBH 4KO5A 4G8GA 2OZNA 3D0VA 1TLMA 2R2BB 4OBSA 5BUPA 4ZTOL 1CI5A 2QKSA 1ZA6A 4P9HH 1IZJA 1J9SA 2HFTA 5DO2D 4IRJA 1SOXA 4TVPH 2IVFC 3GPSA 3AY4C 3M7FB 5IQ7H 3VVVA 1G1YA 3GC3A 1OP5H 3AADB 3VXRB 1MXDA 1PLAA 3TZVC 2QVKA 2RB8A 1OT1A 1ZLSL 4E5XA 2X4RA 3QIBD 4LL4A 4E0RB 1T2QH 3TFKD 1G7PB 5LNEA 1ODUA 1BX2B 3Q8AA 1B3JA 4OV6F 3UZEC 2V6HA 4AQAA 4XNQA 1XSJA 3C5ZC 4QXTB 5DQDL 5EH1A 1R4XA 4PG9A 1INDH 3RVTC 2D03L 3L45A 1Q9LA 5GRZA 1ADQL 4TVPE 2DL9A 1JHKH 1JNLL 3ARED 3VCLA 2ZWKA 1LL1A 4KC3B 3U7WL 4PU2A 1BD2B 4YHMH 2X70A 3IGAA 3IMUA 2A2QT 4FCAA 4N1HB 3WEOA 4BA0A 4O02H 4WK4B 4BELD 5J4MA 1U3HB 2D7QA 2O1AA 5EBLB 1FFOB 3S88H 2O5XH 2YD1A 3PDGA 4P5KA 4ZFZB 4E41B 4N68A 3SDCC 5F1IB 1FCGA 1EEYA 1G0YR 1UACH 4NP4H 5DRNA 3BWUF 3F12B 4LHJB 2HLFC 1BJMA 1IBYA 3BWAA 1JP5A 2D2OA 4YHKL 2NZ9D 3NJLA 2VJ0A 3FOMA 2VTFA 1AZVA 4G70B 4U1JB 3DDFA 2MFNA 3ZYOA 1GPOL 5LB1A 1E8YA 2IOMA 1BZ8A 4H88H 4NB7A 1LK2A 2QDWA 1HX0A 1P5UC 3MOBL 3QR1A 4ILDA 4DVBA 6TAAA 5KVEL 2N7AA 1KBVA 1KB3A 1TJXA 2GAZA 5EO1B 3MUGA 4OVVA 2V17H 4IU2A 3QDJE 3RZWA 2BSRB 2E56A 5HY9B 4JREB 4LARH 1ZXQA 1OTSD 4MCNA 4Y4KA 4JFSA 4P04A 4ELME 4KZEH 5F6HJ 1KDIA 1WP6A 4ACTA 4U7MA 3HUJA 1QWNA 1NUGA 2RJMA 1BQHB 3BUYA 1B0IA 4KI5D 3S96A 3DLQR 3QNZA 3VGAC 3KBHE 3GKZA 4M48L 4YDKL 3VI4F 1HH6B 4D2NA 3TCLB 4LPVA 5TQ2H 3TA3B 1R3LB 4Z3TA 4WY7L 4QHNB 3DDGA 2CLZA 4JB9H 4HUUB 5G5DA 4JFFA 5AYUL 1CBVH 3L4WA 2F9BT 4AIXA 5TE4L 4HF5H 1X4ZA 1OP4A 3NZHH 1F4WH 3FNKA 3QUZB 4PJ9B 4UV4L 1KGXA 4ANXA 3NCBB 3C5JA 1ZTXE 1QLEB 3L5HA 5D70L 1JRHI 2UY7B 2BMKA 4CBZA 1IBGL 4S0TD 1ORSA 1KPUA 3GHPA 2EXTA 1AOZA 3EOBA 5E99H 2X05A 4XI5D 5F7HA 1YN6B 1ILUA 1V5JA 1UENA 3QDJB 4I0CC 1KELL 2E8ZA 2JKJA 1EA9C 5AEAA 3NABL 3QUMA 4W9JC 2F0CA 5E8DH 2F7QA 2VLJA 4HVBA 4NHCL 5D7HA 1YEHL 4TLUA 2AQ3A 4TOYL 3MLZL 1JSYA 4UTAL 2DQIH 1YNKL 3FYIB 2J6EH 2PPCA 2X6MA 4QXGL 4JPVL 3WU1A 1CFSB 1BEXA 2R1XB 2YWYA 2EEXA 1LD9B 4ZMOA 4WHTA 5DQ9A 4KKAC 1N7ML 4JZOB 4NIKB 1MHHB 3DUHA 4PJAF 4Q8BA 4TQ8A 5E1IA 5F7KC 1OCOB 1N64H 3SPJA 4W4OA 1XGRB 1F4XL 5FHBH 3VD1A 2BOCA 1BJ1J 3L3GA 2K0RA 4TUKL 1W6WA 4A7UA 1WH0A 3O8XC 4WEUD 3MRNB 3QA3A 3VXNB 4HS6B 2JIXB 3SDXF 4K5NA 1R19A 4ALAH 3U46A 3RFZB 3C6LD 2QPUA 2QADC 1CZ8L 1Q1JL 1CGTA 2ODHA 1CD9B 1LO0H 2NDGA 1UGKA 4J3OF 5DS8B 2J5LC 4PJDB 1TVHA 1FNSL 1NICA 5EN2A 1DL7L 4GAGL 2BXYA 2FX7H 5KVMC 1KY7A 4L1HA 4U49A 1OM3H 3MRQB 5IROA 1U2YA 3PGDA 4ZOBA 1QA9A 2X2YA 4OCWL 4S1QL 3IGUA 1WDAA 2LTQC 3HMWH 3DOHA 1E42A 1QRNE 2EECA 3VXUD 2X87A 3D52A 3HG1E 4RAVA 3TO2A 1L3WA 2XG4A 4FQXA 4YBLC 2XVKA 4M5YL 2CWRA 4QXVA 2YEQA 3IJSB 3POCA 1FH2A 5TDNA 3T3PF 5BRZE 1EBPA 5D6CB 5EO9A 4RGOH 3SGJC 5MP6L 1H0DA 2IAMA 3L3HB 5ETUA 4I0PA 3ARFB 3NDZE 3P4OA 1ODAA 3RBGA 2CCWA 1IL1A 5GS0D 2X1PA 2ZYIA 1DO6A 2CO1A 3I6GB 1MI5B 3L4XA 4ZO6A 4WFHD 5E6ID 4Z0BL 3VRIB 4BFRA 1KGCD 5ESQA 3N91A 5IQLA 4XMKL 2CHZA 4PW3A 1GHFL 3OJDB 4UDUB 1XZ0B 4HWBA 1X7QB 4P59H 4JG1H 4LSRL 5IFHL 4XXWC 4FNSA 3SBWA 2UUDK 3FSVA 1XEDA 2XQ0A 4NPKA 2F7IA 4S1DD 3T0EA 1XAKA 2ADJA 2G3NA 1IEBB 2FLRT 2OSWA 1RZKC 1RJCA 4YHIB 1DVUA 2EO7A 3ECQA 4U3SA 3V5KA 2BZDA 2WOBA 3ECVA 1HAWA 4L4TD 3PJLA 4XPBL 5IB5B 3X2QB 2Z7ZA 2I32A 1SDDA 3QXUA 4KK5C 1OE3A 2YR3A 3BVTA 3GHBL 1SZNA 3TT3H 1NA8A 5HYFA 1QRNB 2XWJA 3HG1B 1KN2H 3M1BB 4HIHB 2DW5A 4TVPL 1KBPA 5IQ7L 2ENQA 5FWRA 3I75A 1IGYB 1CIDA 3GBEA 1GOHA 1ZA3B 1L9SA 1N0LB 3O9WB 5EU7C 1T2QL 5JMRA 1L6ZA 1WTLA 4F7EB 4GG6E 4PI2A 1HWGB 1U92A 4WHYH 2QPSA 5CCKH 3RWEB 3F5WA 2Q2EB 1UWEH 2WXLA 4HHAA 3RWHA 3F7QA 2MCG1 2XG5A 3DC0A 4HUNB 1M7XA 4HFUH 1DSFH 2DICA 3F6IA 1N70A 3L9YA 4W9GC 2GIMA 1UOWA 3UPRA 4P46D 3QFJB 2QMJA 3FQXB 3GBLA 1A6TB 1ZSHA 1M53A 5D93C 1SLWA 4PS3A 4YHML 1XGYL 4LKXA 4JCWA 3DGCR 5HGGS 4O02L 1H8NA 35C8H 1BMZA 3O6LH 2GCYA 3BSHA 3VWJC 1IT9L 4NI6A 4R9HA 3S88L 4QHPA 2ADYA 3OL2A 3THMH 4LIQL 4PJ7E 4X9HA 5CEYB 2BP3A 3ARVA 1YAIA 1GOGA 3RWIA 2ZE0A 1UACL 4NP4L 4UF7C 4PW9A 4OZFA 5I1AB 1HTYA 7PAZA 3H3KA 4K7PY 2LLNA 3U6RB 3X12A 2WD0A 2XY1A 2X0WA 1PY0A 2ZZUT 3D85A 5E6YA 4MMZC 1MFCH 3GMLA 1ZVNA 3IJEA 4LCIH 4G8EA 3HZVB 4H88L 4GG6B 1N2RA 2ZWNA 1UD4A 2A6DA 3VQLA 4Q97A 1G7MB 1CQKA 2WM0A 2OL3B 1JE6A 4TSCL 2V17L 4HXBH 5A2AA 5IG7B 4O2CB 4NQUA 1CT8A 4NRXB 3FRUA 2HVKA 2MRYA 1IZKA 3IK2A 4CN6A 4Y16D 2LLLA 1PQZB 5D7LD 3ZKMD 1NAMB 2O5ZH 2R4SH 1HNYA 5I2IB 5IREA 4KZEL 5DRWB 2ARJA 5IJBC 1KXTB 1S9VA 1KPRB 3BHBB 4X6FB 3IMVA 3NTCH 3CIQA 2X12A 4CN1A 1NCDH 4CGUB 4ZFFA 1J5CA 2W38A 2QFRA 4PJ7B 4F5CE 3EGSB 1XGTB 1J11A 2YAOA 4Q0XH 5TQ2L 1T2JA 1ZD6A 5ACZB 4LP8A 5JOFA 3IRZA 2BDNH 3PWNA 2YGVA 4JB9L 1Q1PA 4APQD 1G5GA 3OKKA 4HDIA 4HF5L 5JLZB 5B4MD 1KULA 3NZHL 1F4WL 3U9UA 5EOCH 4A7GA 1XL4A 1A02N 3G7TA 4O2EA 4AJVA 5LHDA 3C9NA 4M5SA 4G8IA 2J4WH 3H53A 2E9IA 5F7YC 2VXVH 4XVSH 2RACA 3FF8A 5E9AA 3WEAA 1BVNP 4UWQB 4N0FB 5E99L 4A37A 1VAHA 4L1LA 3H0TA 3QJVB 2XJLA 5J3HD 1Z0NA 3MR9A 3S34H 1KGYE 5MERB 2JQMA 3ZYIA 2Y6SD 3DX8A 5JOPD 4DKDC 3DHJA 2AEOA 1XIWB 2W1NA 1BIIB 3CHQA 5IJCC 3IDJA 4I2XB 2DQIL 2PW1B 2J6EL 2OMBA 5C0CE 2K78A 1E27B 4UB0H 2YUVA 1BYPA 2VL4A 5CZVH 4ZXBB 3CU7A 5ANME 4D3CL 1N64L 3D09A 5DS1A 5EF1A 3EDDA 3PWPB 3QARA 5I76B 4P57A 2O72A 4UOJA 4DGUA 1RUMH 4LFHD 1DTUA 4QRTA 3UEZA 3VD9A 1ZHBA 5I1IL 2EIZB 2A83A 2NY4D 3MRPB 4F27A 2IDFA 4HWBH 4ALAL 1D7FA 4Y4KC 5DYOA 1ET7A 3FDWA 3GUFA 2WGNB 3UTQB 3QUXC 4QRPE 1JZ5A 2BP0A 4Z7VA 3IE4A 4DW2H 2RR3A 4PGBB 4LVNB 2AVGA 1M7DA 4FLHA 3M8OH 1FNEA 4Q6YA 3VI3F 4P9ML 1R75A 2FX7L 3D3VE 3RGVD 4RWHA 1FBIH 1OM3L 3TIDB 2BY0A 1TJIH 4KZ0A 2H9GA 5BZXA 1SFDA 4HWUA 4F7CA 3UGEA 1JPSH 4YIQA 3DETC 3UTTD 1E5CA 3IPEA 3HPLB 1D5ZA 4JY6B 3D30A 3V4UH 4OF7A 4XH2B 5F6IC 3EYQC 3R0NA 1UOKA 3K7UA 1E5UI 2DTML 4JFYB 4WFGE 3V95A 4RGOL 3D25B 5AVTB 3BO8A 1ZK9A 3W38A 2AABH 4QOKD 2RTTA 1PG7X 1BSIA 2J8UE 1XHHA 2OSYA 2CLVB 2A6KB 1VACA 3D7PA 4JJHA 5ANMB 4MDIB 5AOZA 3TJPA 1GTFA 1HZKA 1YEIH 3IKKA 1XGPB 2BVPA 1VENA 2NMSA 1YMME 2JTDA 3FUMA 1QZ1A 4GINA 4GEIA 1ANUA 1JPFB 2XDHA 3ZUNC 4CC0A 1JXJA 2IH1B 2VL5B 3MJ7A 5ICXB 4L8BA 1DQKA 4EOWH 2D9QB 3FU0A 3NSXA 4P59L 3Q6FB 5DUPH 4JG1L 2XYBA 3RZCC 2JH2A 2BSSB 2HG5B 4Z7WA 4QRPB 3ETTA 1GVIA 1TYEB 3NACL 3HS0B 4A6YA 4XP6H 4E36A 3VTTA 2PCXA 3L95B 3E6FA 2CHDA 4DF9A 3UBXA 3K8KA 1S7XB 3D3VB 1RULH 2RQEA 2YSSA 4TQIA 5DUBA 1KYOK 4GRLB 3CSGA 3RA7H 3WUWA 3IDMA 1FFTB 2YGOA 3FO0L 3BVWA 1P7HL 3N1PC 3TT3L 3UBFA 2KPNA 1YEEH 2M26A 4F2EA 1E4XH 5JDJA 2HMIC 1ZWIA 1KN2L 4UT6A 2E6QA 4PLJC 4PS8A 3FQYA 3CQQA 4BFIB 4M29A 4R97C 3HPJA 1FG9C 1PJWA 3KPPB 1DN0B 1MFMA 2VMJA 1UUNA 1MUJB 2NW3A 4K2UH 2J8UB 2G5RA 4M61B 1CFQB 4KXAA 4M56A 1R3JA 3H9HB 3TYGH 2DLIA 4F80A 1DSFL 4Z7UF 3S8WA 1BVLB 5IROC 2E3VA 2YFNA 4FOMA 4FL4B 5F0LB 3BCDA 3IFPA 1KYUA 2CHWA 4M6NL 4HK0B 1OOAA 4HCGA 1SJXA 3BZ4B 3RVVD 4FQXC 1P4LB 4NN5B 2IPTH 3O6LL 1T0PB 2EADA 4GFXA 3VXSE 3IAPA 4JO2H 5C08D 1M3IA 3WIHH 1LE5B 4TUOA 1COBA 4QJ5B 2IAMC 1WHOA 4I0PC 2WLIB 2L7EA 3KJ4B 4XBPA 4LHUG 5LN8A 2IDSA 4PJHE 2TSBA 4S0HA 3MCG1 4POZD 1I85A 1RL1A 4N5ED 1OGTB 5EOTB 2FDBP 5DJZA 3O4LA 1NGYA 1WF5A 1EFXA 2QEJA 2QSTA 4OH2A 3H2WA 5CILH 3MPCA 1T22A 1C5BL 2UZXB 4PB9H 3KYMB 5GS2D 5BCAA 1ZGLA 4Z78B 3QFDB 2BFGA 3IU3A 1MFCL 3SBWC 2VDQH 4OD2A 5ERWB 3T0EC 5CF3A 2OPCA 5L2JA 1JAEA 3MREB 4LPYA 4HXBL 4M7KH 4X7SH 5BUAA 1R47A 1DDTA 4FI8A 1MJJB 4GG8B 3WMPA 5J0BA 4P2QD 3QUML 4YHLH 3TJHC 2H8PA 4S2SA 3HE6D 2O5ZL 1ECYA 4XRCB 2R4SL 3WELA 2F2HA 4C4KO 5I16A 5KAQG 4OM1H 3WG7B 4I7ZC 2MSPA 5B21A 2YO3A 3Q2VA 5KSBF 1TSRA 4NNYA 2I5YH 5E1AA 3VI4E 5F3BA 2XLLA 1KG0B 1UXSA 3VXSB 3NTCL 1DVSA 5E9NA 1NCDL 2MKWA 5GRVL 4Y0GA 1X3DA 4MQSB 2VLKA 4ESKA 5IW6B 3MV8D 1SJEA 4TKWA 1JXFA 4PJHB 4KHTL 5JPMB 2BC4B 5IVXF 4OZHF 1IBBA 1DLFH 5F7WC 2Y4SA 2AHIA 2XN2A 4H26B 1JMXA 4BUQA 5EOCL 3FSOA 1VGKB 2R9HD 1GTNA 1JTTA 1FYTA 2OZ4H 3UAJD 3RDTD 4X4YA 1FL6B 3P69A 5FO9A 1X4YA 1ZT7A 2VXVL 3IRCA 4XVSL 2ZCLH 1BVNT 4YN3A 1ITCA 1EXHA 3V9FA 5D7SH 4JHVA 3LY6A 3V6OE 5IEKB 1NDGA 1I3UA 1HOCA 3DWTA 3UTOA 2D3NA 2JTYA 2CO4A 2UXTA 3S34L 3VO0A 3LZOA 1AIFB 1JVKA 4FULA 2HT4D 3LNFA 4Y89A 1D2OA 4MD4B 5GSVA 1I7UB 4QO1B 2FJSA 5IQ9A 1XV8A 4CL7A 2A9CA 4BEIA 3CQPA 3KL0A 5I6XB 4PJAE 1G1KA 4J3OH 1WWCA 5CU9A 2LHAA 5JQHC 3L3DB 3UROR 4Z7NF 3PWVB 1Z2KA 1MWAA 2Q1EA 2R7EB 4AM0B 4UB0L 5CZVL 4ADGA 5HPMA 1J1XL 3SDXE 1I4FB 4MNQA 3DRQB 2K4AA 2WKLA 2VQ1B 5DHVA 3X3GH 1IQDA 3N85H 1J7VR 3OHXA 3QXVA 4HWBL 4YGAB 3ZL4L 3VFTB 3RIFF 2BVQA 5K9OA 2HFEA 2VRKA 4GJTB 3ETBF 4WW2F 4AT6A 4DW2L 4XCFH 2EYSA 5DDHB 1U4EA 1F4YH 3K5RA 4U0QB 4HKBB 4U1NB 4F3FA 3M8OL 1RZJH 3A4DA 1D5IH 2XKNB 4WU7A 3ZK0A 4KJWD 4Y16A 4TNFA 2ADGA 5CCGE 3IBOA 4B60A 4NCDA 1WVZA 1TJIL 5DO2C 5B7EA 1S7QA 4JFOA 3DARA 3ME0A 3INOA 2XT1B 1QG3A 3DX7B 3MRIA 4KY2A 2WP3O 3T3PE 1JPSL 3UYOD 4BFFA 3T2OA 3DJTA 3GMOB 3V4UL 4PJAB 2R23B 4WFFE 1RUQL 3ZYJA 1X5MA 2RIKA 1F3DJ 4ZUVB 4FTVB 2WZ5A 3ZJAA 1I8IA 4WI6A 4GW4B 3T3MB 2AABL 1AO7D 4IHOA 5A7EA 1NPNA 2HX9A 1NZRA 3ASWA 3SDXB 1YEIL 3KLHC 4KQ3H 3EDKA 3KCPB 1C08A 2ZAHA 3IXAA 4N9GB 4FKHA 3KVDD 3B2VL 1FZOB 3QNFA 3LDBC 1TEYA 5IKCA 3FONB 4Z7IA 1BWWA 3JV5A 5DUPL 4H8VA 4ISVB 5EEXA 5FGCE 5FR3A 2H7WA 1J8KA 3SO3B 1O9WA 3PE9A 3QJSB 1A7BA 3BQVA 5C92A 4XP6L 5L88H 2DPKA 1JTPA 3GRBA 1G6VK 1F2XK 4KDTA 3RA7L 4DP9X 5D4QA 3M6DA 3C6EA 1ZS2A 2BHZA 1UJTA 2DYPD 1EVTC 3QQXA 5ESVA 5GGTA 2EDOA 3EHBB 1YEEL 4XNMB 3U1SH 3KH3A 4FNLH 3QO1B 3V5HA 1DVTA 2XICA 4IEFA 3JTTA 3MRFB 2DQMA 2WTOA 1VHPA 1JF1A 4MLSA 4JL1A 4K2UL 3EJZD 2FL5B 3I85A 4OZFG 4RQQA 3HCVB 5LAPA 1R5IA 4UDTB 1ERNA 5AW1B 2B77A 4XCEB 1IGFH 3SPVA 1DVFD 2CA3A 2EDRA 3IYLW 4ES8A 1ZLWK 2VIRB 4YL4A 2JB6A 2I85A 3SDAB 1BBJA 4LPUA 3LN4A 5FGCB 5A16B 3TBTB 4NQXA 3QIUD 1CLYH 1U8CA 4ZS6D 1WFJA 4ZG1A 1LEIA 3SY0B 2R2HA 1MRDL 3BP4A 3ZQWA 4CN4A 3NVQA 3WIHL 3R18A 4K55A 4OSUH 1OAUH 3HE7B 2ED9A 3OC8A 2AJUH 4M4PA 5DI8A 1F8TH 3CDZA 3LKPB 1MCEA 5AALA 2UXFA 1J0IA 3L4TA 5CILL 3T6VA 4NN7C 1TZ8A 1R3KA 1FUNA 1T1XB 1MDTA 4PB9L 4BKSC 3MBEB 1XF4B 1XR8A 2JSFA 3OJMB 4N9OB 4XI5C 2VDQL 2XNAA 2EDXA 1OARH 4Y5XA 4Y4HB 1NEZB 3FH7A 3EH3B 1BFSA 4I18B 1HINH 5EBMB 4M5ZL 1XF2A 1JPGA 3BPNB 3NMEA 4HJTA 1UZ8A 3L81A 4JVPA 5TJWK 1MHEB 4YXLH 2QPEB 2XWXA 4M7KL 2WBXA 3W0WE 4HWNA 1G7LB 1P0SE 5SV4A 2H0EA 3GZQA 4DUWA 2EQDA 3MCKA 3KPRA 2GY7B 3GRWA 1KY6A 3GPEA 3ROOB 2IXQB 4K15A 4Y19E 1BFVH 3BGFB 4MA3A 3CFDB 4U6VH 3N1GC 4PWHA 3EBIA 1YYLL 2I5YL 3LEXB 3LVEA 3ARDA 1OHZA 3H9SB 4E9TA 3HLAA 4E42A 4GIAA 1WFIA 4FQIH 5J1AB 4PRPD 3ULVD 3HG5A 1ES0B 2LFEA 2X4PB 3QPXL 4PHXA 4OZIF 2A99A 3NEEA 1JGEB 1QBMH 5C0IB 2D3LA 2CDGB 5DHVH 3C6LC 2A0LC 3B9EA 1MRCL 1GJWA 5F9OH 2ED7A 3BD3A 4NPYB 2X40A 5CZXC 1HSAB 3GMPB 2PWDA 3HG2A 5HI4C 3DBSA 2O30A 3PJSB 1RZFL 3DRTB 3C08H 3TN0B 2ISDA 2FECL 3LRLA 5K1NA 2FX8H 4ODXA 2CKNA 2ZCLL 1OD7A 1J8HA 5JDSB 2OK0H 1GMIA 3GM8A 4HMDA 4U1HB 5D7SL 2XV2A 3IKCA 1SLVA 3ZDZF 3MUZ1 4H1LH 1DBAH 2YBGA 4ADIA 1ZE3C 1WA2X 2H47C 4Q9QH 1QQDB 3F7VB 4YXHH 4JFED 3Q8CA 1OLZA 3OKEA 3TNNB 2YFOA 1CFMA 2CO6B 3IMWA 4ODBD 4QAMB 1AGCB 3ECWA 4LU5H 3RWGB 2X3BA 4B41A 2EDQA 1ML0A 3FN0H 1FAKT 3GSQB 4PAZA 3QORA 1T80A 1FZMB 4S1SH 4KO7A 4G5ZH 1SJVA 3M46A 4MKTA 2G0KA 4NBZB 4HD9A 5EU3A 5HHOD 4MAYD 2ESVA 1HJCA 5FA3A 1HEZA 2HX8A 4PR5A 5AL0A 3RHWF 4XNDA 5HVHB 1D2PA 2I7OA 5DK2A 1OHQA 5D4JA 4E9WA 1CF8H 3WGUB 5CCJA 3F58L 4MS6A 4AYFA 1A6ZA 1H8OA 2VXQH 1EERB 4LSPH 2MTPA 1FN4A 2NTFB 3VI3E 4KXZI 1AG0A 2YUZA 3LRSA 4GAJH 4Y2DD 3CFUA 5C0AD 3G6JF 1L5GA 4IIQA 5G4MA 5I74C 4XCFL 1F4YL 4BQBA 4ZUUA 3RIAF 2QHLA 1RZJL 1D5IL 3FQUB 3FTUA 1UD3A 3QHZH 1ETA1 5JPNA 3NSJA 2ZWSA 5IV2A 2ZNWA 5I8EB 2VR9A 5ICUA 3FSZA 4HKZB 1KLFA 5C07A 2EVGA 2Z4QB 3FH8A 3B9AA 4IJ3C 2R29A 1TZGH 4UT6L 5SWQB 1OWWA 1Y18B 2YAEA 4HUXB 4JKPH 3C6SB 5J6GA 1I1FB 4YBQD 3O3DA 2VMCA 4HYTB 1G84A 2H6OA 3CLEH 5HPOA 4H1LB 2FVNA 1KCVL 2QMKA 6FABH 2WVVB 2Z64C 2FWUA 3WUWG 4N2IA 5F96H 4P46C 5KYXB 2FQDA 4PREB 4UV7H 3ATEA 4KQ3L 4MD0A 4PRIA 4XMWA 4D0BB 4M8UA 4Z3EA 4NFDA 1P7QD 3EO0A 4ERSL 1IC5L 1MQKL 1ZT1B 3W82A 4G7QB 2ZWYA 4XN9A 3WKYA 3VI3B 5B7FA 5ILTH 3NN8B 2QKIA 5CHNA 5HGBB 1WBZA 1YPZF 2EC8A 3I9PA 3T77B 1K3IA 3EJSA 2UWEF 2PYFB 3MTRA 4H8WC 1ORQA 1VA9A 1RP9A 1N5AB 4K94H 5EZLB 1SXZA 4S1RH 1PYWB 1AR1D 2CHXA 2KL6A 2X28A 3LOWA 4CDGC 3X1BA 5KVGH 3RPBA 5FYKU 1CFNB 3MLXH 4L1DA 3RKDD 3REVA 3AS2A 3RUGB 3UTPD 4PGJA 4RFNC 4L3FA 1ZHLB 1E2ZA 1I9IH 3GRGA 2QQLH 1F11A 4HFWB 4NWTH 2NSXA 3UC0H 2WZPA 4XBGA 2C8NA 3OHXC 3SOBH 1AR2A 4WU5A 4LOVA 3G04A 1D9KB 3SKJH 2IALB 2ZOWA 4QHKI 5KVGE 3EO1A 4Z7UE 1C5CH 1S9YB 1ETJA 1SN0A 3FB8A 3QULA 4WDIB 1WCBB 2Y6TE 2YQGA 2R8SH 4XO4A 2KYIA 5F9AC 3B9KA 4JRXE 4LEOB 1IV8A 1WIOA 2V33A 4Y16C 3ZE2B 3ZKMC 1UCBH 5F1SA 2IH8A 3VTMA 4AYID 4EIUA 2Y2WA 1E4HA 2AMGA 4QHMA 4BJLA 3OZ9H 1IGFL 4ABQA 1QR4A 3U30C 3BKCH 4ZQTA 3FO1A 3CZEA 2C7UB 2FIKA 1AH1A 1L4IA 4FKEA 5IK3A 5E00A 4FFWC 3WBDA 1CLYL 1FORH 3AS3A 2XC8A 1HJBC 3ZQ9A 4I5BA 2DWXA 1BZ7B 3GXPA 3DMMB 3L7FB 1ETZB 2P24B 7CGTA 4OSUL 4F9PA 1IGIH 1OAUL 1MAJA 3E6HB 2AJUL 1G7HA 2CZNA 1BQSA 1F8TL 2BWQA 2F1BA 4FNRA 4APQC 4GMSL 4JFXA 5DGRA 1HHKA 5CNHA 4WWID 5ACLA 4PWIA 4U6XA 5KSAB 4ORZC 4Y1AD 3FQRB 4PJCE 3TNMA 1R33A 1IVTA 3CDGA 2V5SA 5J13B 2BXZA 1R1CA 1S5HA 3VGBA 3PXJA 3KWXA 1WO2A 1KJVB 5CMAA 4B9JA 2ZXAA 4Z7UB 5J3HC 1OARL 3PDOB 2GY5A 3B2PA 3GDCA 1S8DA 1SMAA 1HINL 2AP2A 2Y6SC 3KPSD 2Z8WC 1IM3B 2NSQA 2Y5TA 4RNRA 2R1YB 4DEWA 4OCRH 5KG9A 4YSRA 4HJGB 1HXYA 4KDTC 1NOFA 3P77B 5KSBE 3GSXB 2P9RA 2Y22A 4ICXA 4NQSA 4ZX4A 1FFNA 3HFML 1BFVL 4IBTA 4TNVF 1NC4A 5J12C 2OYLA 4B3EA 4U6VL 4CVXA 4H8WL 2VXUH 4IGBD 4FQLL 2VLRB 4JFPB 1RJZB 2JMRA 5LBGA 2R1WB 2Q87A 1MHCA 4FNUA 3HNTH 3QQ4B 1F4AA 3QXAA 2QVTA 4FQIL 3GMNB 3F84A 1JFQH 3P9LB 5FW8A 4OZHE 3JYBA 1MOEA 1XAUA 2FH8A 3ECUA 3VRJB 5IF0B 1GSKA 1KPVA 2NY4C 1QBML 2X10A 5CP3H 1EBAA 4PBVC 3BDYL 4DESA 3U36A 2ZKXA 2BX5A 4LRNH 5F9OL 4PJCB 5AQ0A 4KJYB 4J4PA 3T9WA 1Q9KB 4IMLA 1OKEA 3F7YB 4G3YH 4OFYA 1C16B 3C08L 3TEZA 2EDWA 1YJDC 2FX8L 2BSTA 5IJKA 2H6PB 2DEWX 4FNQA 3MCYA 3TZVB 43CAA 3RGVC 3FFCD 2OK0L 4HQQL 1QEXA 4M8RA 5IGXH 3CVHB 2VM4A 1MG3C 1Z7JA 3C5ZB 4J28A 3WLWD 1HKLH 2N0MA 5T1DL 4POUB 4YXHL 5KSBB 1Z32X 4TTDD 4Z7NE 3BH9B 4PGDA 1RJLB 3ILQC 2AVFA 4Y9CA 1A3ZA 4LU5L 5DJDB 5HYQB 1V27A 3S8FB 3QXDA 1VFUA 3FN0L 4F93B 4KX8A 5CXPA 4XPHH 3DTXA 3SN6N 2ILLA 1CDGA 1H6FA 1MCSA 2OV0A 5LN4A 4Y5XC 4NN6C 3GBNL 3CFEA 4ZUTA 1EO7A 5HHQA 2J71A 1A6PA 2VR8A 4UYQA 3ZPDA 1WC7B 4AQEA 2JELH 1U4FA 1HHIA 4ONHB 1WISA 5DJ8A 4N8CH 1HT6A 4XPGH 3K6SB 1FVEA 5B1KA 4WFED 2Z7WA 2ITDB 1DQDH 1OP5K 1OOWA 1CO1A 4UOQA 3OJVC 2I27N 1F3DH 4LSPL 4B6ZA 2GTWB 3WJMB 2J88H 4GAJL 2QGEA 2DWTA 1MCDA 1TOXA 1LP9B 3F8UB 1G1OA 3KNBA 4PFEA 3Q43A 4PRNA 5C0BA 3RWDB 2IBGA 3JXAA 3WAKA 3ARDC 1CDYA 4NRZB 4FLSA 1GRWA 2ZONA 3TEYA 3QHZL 2VT0A 5T1KA 5I0YA 2XBDA 1X5ZA 1EFQA 1YEDB 3CLFL 5AL8A 3U46B 1JNJA 2F54A 1F58L 1BVKA 2WO3B 5SX4H 3N40P 5FOBB 4F1ZA 5GGTL 2CKBA 4C56E 1NGWA 3IDNA 3MXWH 2FJHA 2XWTA 5DJAB 2YD3A 3I3EA 5H94A 4N4YB 4DP6X 2C9QA 4DKTA 3AS1A 2NCEA 5CO1A 1MCPH 3CLEL 5CBAA 3GI9L 6FABL 3MJ9A 4PUBH 1OV8A 5EC1B 1D7BA 43C9B 5C0EB 2E7HA 3GMQA 2VDLB 3FTWA 2OMWB 3VGAB 5IMMB 2WJ7A 4I3GA 1NCBH 4HHWA 4UV7L 3VFOA 3M45A 1JUFB 5JORA 1A4AA 3RVVC 1RZ8B 4U1MB 1Z3GL 4LBEA 1BD2D 1VADB 3NG5A 3TIEB 4LFHG 5ILTL 4OI8A 1U95A 5CGYD 2BFVH 3L2LA 5DZPA 4WTXA 4K94L 3QORC 2GBUA 1CLZH 4JQIA 4S1RL 3TFBA 5E1QA 4HPHA 5KVGL 3WL9A 3HN5A 3MLXL 1T7XA 3MRGA 4DN4H 2MQGA 2P7TA 4AEFA 2VERA 5MHSE 4HC1A 3HMXA 5TF0A 4P2OD 1I9IL 4FEMA 1FAIH 1CF1A 2HJKB 2QQLL 4X5XB 1HWHB 2OX5B 3UC0L 2BWIA 4WCYH 4KZCA 3WO3B 1Y1UA 2JKWA 4C56B 1REIA 3V4VA 5FB8B 1LE9A 2EICA 1IFHH 3CC1A 4JY5L 2CLRA 3SOBL 4GO6B 5D9SB 3FUFA 4MAYA 3IE9A 3P4NA 4MAUH 2VSCA 1EZVY 2XA8H 2YBRB 1NCUA 1V3LA 3SKJL 3GLZA 2O5YH 4P05A 3BIKB 5I73B 2YOCA 5TDPA 4IIQC 4OF6A 2R8SL 1QLRA 2OR7A 3FS9A 4D0DA 4YR6A 3M17A 3BT0A 5T3XD 4Y2LA 3GMMB 3HE6C 4W68A 3V52H 1UCBL 4DSYA 3W9DA 5DUMH 5JPNC 4OT1L 4EXPX 2X9YA 1D5BA 3OZ9L 4POYA 3BKCL 5TH2B 1QTPA 2GHWB 2GK2A 4BSJA 4AGLA 4WTQA 5KJ7E 4M1CC 3VFVB 3I6KB 2L04A 3D2TA 3JQOB 4X4XA 4PHZA 2QADB 5HD8C 1HU8A 3AQXA 1J0KA 2K9FB 3QISA 4YDJB 2QTEA 1Q8MA 4NO0A 3N43F 2R4RH 4KK9C 2VR5A 3O6KH 4I89A 1IGIL 2BNUB 2J5LB 2ZP9A 1PZAA 5AW8B 4FEIA 1Y07A 4QHUB 1JGLH 1AP2B 2A6IA 3TA3D 1HILB 3PY9A 1J86A 2AK4E 5GJSH 3H7BA 2C9PA 4FXGA 2QJDA 3VH8A 3WLBB 1W91A 2R9HC 2WLKA 1RUAH 3AVEA 3I6LD 4OGAC 1EEQA 3A5VA 4XNAA 5JXAH 3GJFK 3Q9QA 5DVKA 4GKZB 1M2OA 5F7DB 3QUZD 3HVNA 4D9QD 3ABGA 4YBLB 2QKIC 1KTBA 1M71B 1X6NA 5DC9B 5D1ZI 2V7NA 3B8YA 3W57A 3FAWA 3NQIA 5EU6E 2EAEA 4EZKA 1K8IA 1P69B 2HT4C 4YSAA 3IAQA 4QYOB 4NC1E 3NFPB 1JERA 1RH8A 3OLDA 5CWSB 4OCRL 4HJUA 3BKMH 3G5ZA 4G42B 1HXKA 3MUJA 4ETYA 2F74A 2I7SA 5EU5A 3W5MA 3FPXA 1BIHA 2FJGB 5K5YA 1VFAA 5FS5A 4LCVA 4MDRA 4G9DA 5JO5A 4W6WB 1T0OA 2B59A 2FX9H 1SUJA 3U48A 3CSFA 4R4ND 4OZIE 4LZKA 3FB7B 1KLUB 3D0LA 4WENB 3HNTL 5KYUA 5TE6H 4DQOH 4OIIL 4GXFA 2CR3A 4Z6AT 1JFQL 5CSGA 4YLCA 4KI5F 2VLLA 4QD2E 4EKXA 2XSKA 1RD6A 1YRKA 3FQ1A 4R4FH 1RUKH 5JIKA 4LRNL 3DTDA 4KJPC 3QCTL 4X98B 3LKNB 3MLSH 1QACA 3KL3A 4L23A 2X9WA 3RX8A 1RAMA 3ZDZE 3TBSA 4BUHA 1EVUA 1U6AH 3L17A 5INCB 3WKPA 2YXWA 2PTTB 4WW1A 5IGXL 5EULV 4MCZB 3WGVB 2W9DH 3LNHA 3MNVB 3NCJH 4HEME 5BRPA 4F9PC 4UM9A 1L9RA 2KBGA 3OVUB 5L4IA 3QDGD 5C0DB 3DX2A 2OTUA 1QAWA 3P3SA 3HEIB 1NAKH 3FTGB 2YAFA 1SN5A 3QZLA 4I4WA 2FRGP 3T8XB 5FM5O 1F00I 3CHPA 2NY1C 1MNUH 3FTYA 2FGWH 4OLEA 5DF0A 2DQFB 3JWOH 4MX7A 4N87A 5D93B 5I1GH 1A1OB 2DBLH 1IAIH 3ATDA 1OSZB 4HD5A 2N7BA 2XYCA 3E8VA 3GO1H 3Q3GB 4YDVA 3U2IA 4ZMLA 4GAYA 3O2VH 2FWOA 4L3EA 3VWJB 1T6WA 1ZIBA 4MJ4A 4OUUB 2X38A 2Y36H 1M7IA 4HIEA 1E5AA 1IAKB 1A5FH 3HN3A 5CFHA 3L6FA 3EJYD 1T83A 3CFJB 5E1HB 3MACH 3MRMA 1MI5D 2HN7B 1S3KL 4N8CL 2NY5C 5FUCC 2R2CA 4IRZA 3L5WA 3G6JE 4KKCC 4XPGL 5HI5D 4F8TA 4QCIA 1DQDL 3PQYA 1YN7A 2DJ4A 4AXWB 3QYNA 2DJUA 4PQXA 1JV2B 3QUKA 4GT7A 4XXDB 3TXAA 1DUZB 1OAZH 1MPAL 2IWEA 3N9GH 2WXFA 4TNWF 2J88L 1EHNA 4JGNA 3UG5A 2YGPA 1IAOB 1TO5A 4UIKH 3S37H 4MMZB 1BAFH 1S4IA 3AB0C 4EQ2A 3P0YH 1SXBA 5T1MA 3R1GH 2XTLA 2I69A 2LU4A 3H3PH 3HMXH 5I1LA 4CUCA 2C7FA 3ZHKA 5MEND 4B9IA 1L0QA 4YHZH 1EGJH 4OZGA 1E3XA 5SWSD 1I75A 4F7PA 5E0FA 1I3RA 1OCWL 1INQB 3PF2A 1NFDA 2IOOA 3MXWL 5E2WH 4PYGA 1WTGT 4KKRA 3T6ZA 5GGVL 4J4PC 4LASL 4KOBA 3EG9A 1O9ZA 3V0AC 5JYMA 2WUBH 4NQED 1IFGA 1ETB1 3EJZC 4JFTA 1UURA 3H3BC 1MCPL 4KNTA 1IB5A 5IJKC 3LPGA 1Q9WA 2MEJB 5MI0C 3NCEB 2FD6H 4GW1A 3LSOB 2RBLA 2WVTA 1DVFC 1NCBL 4OV5B 4AQAB 1IC4L 1GZHA 2FO4A 4I0KA 4XNQB 1PTZA 1DQVA 4BFNA 1DJWA 2Z1KA 4KKZA 1YPZE 3QFJD 1VF5C 1RUPH 3G6JB 4PG9B 2GYSA 2UWEE 4OBRA 5TE7H 4ZS6C 1YUKB 2V2XB 2YD0A 3CFTA 1TJHH 4U4BA 1QLFA 2WMPA 4X9IA 3VCLB 1IIIA 5E8EA 4U2YA 2BFVL 4U2ZA 1BWMA 4L9LB 4KTYA 1WIPA 2I9TA 3VG9B 1N0XH 1CLZL 3ARUA 3IGAB 3WN5B 3PG2A 2JKXA 5C0NC 2IADA 3HUJE 2WCGA 4RRPA 1PG7W 4DN4L 1G9EA 5IWLA 4FFYA 5E2TL 3ULAB 4IOSD 1J0ZA 3NIFF 4IYKA 4MSWA 2K9UA 4WCYL 2X4OA 2F68X 2DLGA 3BAKA 3SCMA 4KJQD 2MCPL 1TTRA 1EO8H 2LU3A 1J9TA 3LPFA 4BKLA 1P4UA 1SN2A 4K3JL 1GC1C 3OJ2C 5PAZA 1QWUA 4MAUL 3TBWA 3ZDWA 1TVBB 5GRVK 1N4XH 2O5YL 1WEJH 3LRGA 1S7RB 4Z5RB 3FOMB 1XH1A 3D39D 2V2WA 4CSSA 4J6IA 4TN9A 1L9MA 5DHMC 3B3IA 3RX7A 1O6SA 3KWWA 4OJYA 3ULUD 4G6AD 4DVBB 2NY5L 4FMVA 1MHPH 3ZE1E 2GAZB 4JFHE 3VYPA 3V7AG 4WF7A 4N0UA 1CJYA 5AG9A 2UWEB 3CD4A 3R06A 1AZZC 4J3VA 2VH5L 4PJXF 3N06B 4BV1A 3IAGC 3C8HA 4MVBD 4BWWA 2BIQA 2VLJE 3P0GB 4LHUB 4L29A 4J6RL 2WN2A 4PJGF 4Y4KB 1JTOA 2DM2A 3HJEA 4BH8B 1N59B 4PJIF 3QUXB 1ASPA 2R4RL 3HUJB 1XF5A 3O6KL 1DBKL 4RMWA 1LHZA 2HT3D 2DJSA 4GLRH 4JHWH 1JGLL 4Y8AA 3K1DA 5LGHH 2AGJH 2FNWA 5GJSL 2GABA 4LOEA 4QF1A 4ODTH 5HYJD 5B1BB 4HW6A 1RUAL 1GGBH 5JXAL 2G5UA 5G5DB 4JFFB 4RIRB 2OW6A 1TVDA 2EVFA 1OF2A 3OX8A 2VZVA 5F6IB 1BQKA 2OXGA 2R2EB 3G08A 3HLKA 3O41B 4MXWH 5C3LD 2E4FA 3C5JB 4JPQA 3PAUA 1IBFA 3F00A 2YEVB 3QJQB 5EC2B 3VMOA 2PCYA 1ORSB 1KPUB 3BKML 3EOBB 2CJUL 3ZE1B 1A4KA 2XIIA 3TJEH 1H9DA 1FYHB 2VM3A 4K9EH 4ZTPH 1U21A 3HVDA 5D8JL 1J1OH 2Y5QA 2DAVA 3IMRA 4S10A 3PWLB 3I3DA 2VLJB 3Q06A 1A9EA 2LAAA 2Q6WA 5FK9B 2IANE 4L3CB 4MAYC 2F7PA 3RZCB 1WAAA 2HKFL 1MDAA 4CSTA 4RH4A 2WSDA 4DQOL 1FQ9C 2B5IC 4YK4C 1B4RA 2CE6A 1KXQA 3KLLA 3HKZA 3PWPD 1JPEA 3NK3A 1DFXA 3V0HA 4JVWA 3QQ3B 3QCVH 4NXSA 2CBQA 1Z5HA 5KVFE 2N4IA 3D69A 4Z3GA 3Q1SH 1BPLB 3DGGB 4JCMA 4R4FL 4AE0A 3QDHA 1BF8A 1EHKB 4ZNEA 4E9SA 2CK0L 3HNSL 4IMKC 1FJ1A 2BOCB 4X6EB 5GGRA 1VFMA 3O45A 3QJTB 2FSEB 3QA3B 2CJ3A 1T4WA 2N56A 2QHRL 1OAKH 2XN9E 4G71B 4H44C 4H0IA 4MTMA 4R7VA 5DZAA 1FO0A 2NY0C 2A73A 5D7IA 2XVLA 4R97B 5CJBA 1II4E 1T1YA 4K23L 5DK3A 3DO4A 4AX3A 2W9DL 4JN2A 3DSFH 5E5RB 2L8AA 3BMVA 1I1AA 1PIGA 1TVHB 5IVZB 3H42L 3QE5A 4CMHC 2JCCF 3FCSB 3EJQA 3VD7A 1NAKL 2Q10A 4EI5D 4UQ3A 4MHHI 2WLHA 2AV1A 2DWYA 1MNUL 3PABA 2FGWL 4XAKE 3WAJA 2IANB 2DBLL 1IAIL 1FZKA 1NIEA 4HIQA 2XG4B 4FQXB 2VNCA 3G9AB 3GO1L 3TO2B 5C6WH 1DEDA 4AGQA 2YPLA 3O2VL 3EADA 4KDVA 4PY7B 4N2DA 4J3BA 1QUNB 3WENA 1EAPA 1AIZA 5A2CA 4JFVA 1H0DB 2PMZA 1A5FL 2IAMB 4M7LT 5ETUB 4JKWA 3RURA 1A9VA 1B0RB 3P4OB 4IBLT 3NDYE 2DQDH 3IPFA 3SDDA 1DYZA 5I0XA 1IL1B 3SOTA 4IKLA 4Q14A 2W92A 5E6IC 1KB5H 2WPGA 3H54A 4ZPVA 3QPKA 5GPRA 2JE8A 1OAZL 5ESQB 1RSFA 1AR1C 3N9GL 4W4NA 5GS3A 3VE0A 1MCHA 1NJ9B 2ZP8A 5IMLA 3DYOA 4UIKL 5DWUL 3RKDC 3S37L 4JQIL 3RWCA 4RAUA 3MVSA 4X6BA 1C7SA 1PKOA 3NJMA 1A25A 3VFRA 5FOJA 5LQBL 5ITBH 1CN4A 4M8QA 3C09C 1OTUD 4ZAKA 3R1GL 4ODUA 2ADJB 4G43A 3H3PL 4HC1L 3HMXL 4F2MA 4U3SB 4HISA 4YHZL 1EGJL 1PLBA 4RGND 2V2TB 3GIZH 4F8NA 3BUPA 2PR9A 1G7JB 4DIXA 3DHUA 4GOSA 5HJGA 5E2WL 1SDDB 4Y4FA 2WUBL 1MCWM 1J0JA 2GIYA 1NC2A 2VISB 2N1KA 3WEBA 2QTVA 2XWRA 2ZYSA 3I75B 1RZGB 4PVNA 1Q94A 3BISA 5B38G 3NJHA 4FP8L 2FD6L 4GQZA 4AENA 3X1FA 1XGQA 1F86A 3G3LA 1NCIA 4ZO9A 3MV7D 1HSBA 2A5UA 3RWHB 4FS0A 5FYLD 3OKMB 4ZMNA 2O93L 1RUPL 4QXWA 2HLEB 5TE7L 3UYRH 5JHMA 4ZFGH 5I0WA 1UB5A 3NCCB 1TJHL 2YJQA 1PU0A 4PG2A 3QQ9D 4MCYB 4ZSOA 5BO0D 1ZLUK 5DJYA 2DQTL 4F7MA 2JQZA 5IBLC 3P3TA 1N0XL 3FU3A 3V0FA 1RURH 4HUMB 4LKXB 3VXOA 1YDPA 2Y3NA 3ARBB 2FLBT 4JM0A 2GCYB 2TSAA 2OCCB 3IDYB 1PAZA 2LR4A 2X42A 4QWWD 1BFTA 1FDLH 2CUAA 1I7ZB 1N67A 1PAMA 1WWAX 1T83C 3WTTA 1KB5B 2HG0A 5CUSH 2WO2B 4P2RA 4TSAH 3RWIB 2NQCA 4LPWA 4JANB 3WCYA 4OZFB 4QRUA 2VLMD 4PCTA 1OAXH 3TA4D 2AJ3A 5F7AA 1C8QA 2HAZA 4FZ8H 1RFDH 2ZOLA 2DDQL 1WEJL 1YYMH 3ZW3A 4IS6B 5D1QD 4OFQA 4N0YH 1OSPL 4AG4L 4ZO7A 3MOAH 5K39A 3IJEB 2NLJA 2B20A 4R96B 1ZV9A 1MFAH 1OCZB 1LJMA 3ES6A 3KE0A 2ICEB 2A6DB 2XFXA 4U6HA 1MHPL 4V1DA 3ARGA 3WNIA 3RGBA 4HPOH 3WO4C 2MOVA 5BO1H 5HP5A 1HE8A 1LWRA 5CLXA 1CT8B 1UEMA 3CUPB 4DEPC 4BQCA 2MQ3A 2HVKB 3UX9B 1EAQA 3IJ8A 4U0RC 5IOPB 2UV3A 2VMDA 1SXAA 1PLCA 2ARJB 5DJ6A 2H4EA 3BESR 2YQ3A 2H32A 3NH7H 2GSIB 3Q1EA 2CXGA 4L5FH 5IJDC 3PHQB 3EYVA 4I85A 4KBPA 3D87B 1BZ9A 3FSAA 4JHWL 4WUUA 3RPIA 4W9CC 1FE8H 3ZQXA 1F90H 2YKLL 3BKJH 4UUJA 2AGJL 2E9WA 3KPMA 5LGHL 1UYWL 2LU7A 3FCBA 5FYJU 2OYPA 3IGLA 1GZHC 4JKMA 4ODTL 1NUNB 2R69H 4AI7A 1GGBL 4GSUA 4N8VA 4XBEL 4CW1A 1XR9A 5JOFB 3QIBB 2CR0A 4LVEA 2HT2C 3E38A 5FWQA 4WHCA 4FA6A 1TQCC 1KYDA 3CSYA 4FJYA 4ZRGA 2E7BA 2ZPKL 4L3AA 1TCRB 4MXWL 4O2EB 4ODSH 4QHLA 3C9NB 5BXFB 4W6YB 4G8IB 5EUOA 1QEWA 2A74A 3DPDA 4OU3A 4Z7VE 4MMXA 4WUKL 1KBWA 3ZR5A 5IWLC 1AGBB 2F5AL 2W60B 5LGJA 3TJEL 4KRMB 2VITA 2MHAA 3AREB 3MU3A 3N40F 4JPKH 3P73B 2XETA 4K9EL 4URTB 4A2DA 3MR9B 4ZTPL 1KJ2A 1XVSA 4OAWA 1T7ZA 3DX8B 3DNKA 1TQTA 1GH7A 3LDBB 2I24N 5BV7H 4XMXA 1VZHA 4G8FB 4FTDA 4KI5E 3V0JA 3BAJA 3IDJB 3AUWB 5JYLA 4Z3JA 3IF1A 4Q4IA 4LF3A 4XOBA 1DZ0A 3EXJA 5CP7A 4ZW6A 2UXVA 5DRXB 3AZUA 1NGZB 3PV6A 2IWFA 3Q1SL 1F4HA 4AMXA 4P57B 1GS8A 2ETWA 3FUIA 1ZDSA 1XGUA 1UKQA 1ZHBB 3D39A 3AWGA 3ROLB 4ZMWA 1NTDA 3W3BA 2A83B 1OAKL 2CRYA 5I26A 4Z77A 4RZCA 1I7TA 1FV1A 2HFFB 4N85A 3GD1C 1GGIL 4FYRA 1YUHA 1CCZA 3CV5A 5AENA 5EPMA 3HKFA 2VRAA 3MV01 5KYWB 2IBBA 4Z7VB 2EE9A 3MFFA 5H37A 4NQQA 5LVEA 4GY4A 4CKVX 5IQOA 3OPZH 3D34A 3RI5K 6PCYA 3PLYA 3WTVA 5HDQH 4UM8A 4Z7AA 5HYIA 3TPUB 3UZVA 3PL6A 5JIMA 2H9GB 4LSDA 1BQUA 4N0CD 4LMQE 1N5YL 2EXSA 5D7JD 1I8KA 2JXMA 4AK2A 3LS5H 3BDXA 3QPQD 3ZMNA 3U83A 4FTVD 3BIBX 2PXYD 1JCVA 5IBUB 1JZDC 2F6AA 15C8H 2IDQA 3NPZB 5HYJA 2TRYA 1HKFA 3BO8B 4KMTL 1B90A 4TF4A 5ENWA 4EI0A 1DJHA 3QH3B 4PJFF 4YDNA 2DQDL 3OMAB 4K7FA 5LNDA 4KVCH 2J2ZA 4YEEA 5GGVY 5CGYC 4PD4K 3NFNB 3OF6D 4FHKA 1BW8A 3NSDA 4JQVA 4R2GC 3S3PA 3UJIH 1DLHB 5J11C 5JA9A 4DO6A 3I6SA 3FU6A 3RTQA 3P54A 4L8BB 3VYOA 4KZDH 3QDMD 3QAQA 5DYFA 1D7CA 4RRPM 1ZHKA 3CVCA 4OCLC 4ICWA 3BUQA 5IQNA 4Z7WB 4ZMXA 2ZYRA 1L9QA 1SRDA 4AQ1A 5KYYA 4A6YB 4FFYL 4JRYA 2X09A 4JZNB 4PP1C 5DLMH 3BZEA 3CQFA 1K5WA 2YUXA 3E6FB 3QAZC 4NRYA 2F53A 5KS9A 3ML9A 3GIZL 5GS0H 5DUBB 1JK8A 5AZUA 3VXUE 1LO5A 3N55A 3WUWB 1D7DA 2RCSH 3F64A 2ZXCA 5CJQL 3IDMB 1MLBB 1AS8A 2QELA 4KO6A 4YDZA 2VABB 3UTSA 2YUWA 5I6MA 4L8SA 2FQGA 3SKNA 1ZWIB 1AD9A 2DM3A 4FN0A 1A6AA 1L0YA 2Y1AA 1S6NA 3A6CH 1R3HA 2E27H 3FRPA 2X5PA 2VZSA 3HPJB 8FABA 3T4YA 3E3QC 3TBVB 1SY6A 2NW3B 4G2AA 4R7XA 4YSTA 5E6ZA 2CDEA 3SODB 4WFHE 1I1AC 1KGCE 5E6SB 1WFMA 3WDJA 3B7TA 3WTSA 4KXBA 3IDIA 4GS7C 1JNNH 4H13C 3C6LB 3RY4A 1T66D 1EXGA 1Z9SB 2WB7A 3MNZA 1KCBA 2AF2A 1F1GA 1RURL 3MNDA 3R8QA 3E80A 4BWTA 4L4TE 3HE7D 3IJ7A 4TLSA 1HHGA 1Q0XH 1N6QH 2P5WA 4WSKA 4TUOB 1FDLL 3K2IA 3MLVL 2APBA 4LLWA 5CBEB 2AKRB 4QDGA 5CUSL 3VX1A 5I0DA 4TSAL 5CKGA 4ZYKB 1J05A 4XPFH 3SDYH 4RBPH 4Z7OF 3O4LB 3TO4A 4NQDD 3MBED 1OAXL 4DCQA 1P1ZB 4HEPG 3HAEA 5ICYB 1T22B 1RFDL 1ZT4B 3BH8A 4FZ8L 3N44F 3QWQB 5IB1A 5JIHA 4A7TA 1JDAA 2WLMA 2OR9L 4Y4HD 5JHLA 1BA9A 4N0YL 2Q86B 3LRKA 5CEZD 3IU3B 3MOAL 5E94A 4NXKA 1MFAL 5E6UB 2Z35B 4PJXE 4Z9KB 2DRUA 4ZAKC 2D73A 2X6UA 3GXDA 4QT5A 2HJLA 5L2JB 2AI0L 4HPOL 4PJGE 1XL6A 4R4NC 2R51A 2D7OA 2BW4A 5JHDA 1A7QH 4A2MA 2H8PB 4GRWE 4S2SB 2V8MA 2WCPA 1J5DA 3KW8A 4Y4FC 3CX5J 2BOBA 4P2AA 3UIYA 2NNAB 5CZRA 2KPWA 1X5GA 3H9SD 2W80C 3LD8C 3FF7A 3ESOA 2PETA 2VDOB 2Y7NA 3DVGA 3NH7L 2GJ6A 3NZSA 4L5FL 4UMGA 4NNYB 3CMGA 5E1AB 5I74B 5B3NA 4L4TB 5L2KA 2BCMA 2PCFA 1CXLA 3Q9PA 2GC7C 2LU5A 1FE8L 4PJ8A 1E50A 3BKJL 3P0VL 1RK0B 3S0PA 2HSIA 3VXTA 5B1JA 2Z92B 4ZZFA 3OKDB 4OLUL 3D9AH 3G6AB 5I8CB 2VR4A 2BP5M 4PG2C 2K6YA 5FIEA 3F6LA 3GXTA 2X1XR 1DJIA 4H0HB 1KN4L 1YEKH 2KHAA 1K5NB 2VM9A 2NYYD 4LCWD 1PLGH 5TGBB 4AGNA 4X4YB 5FO9B 5EB9A 4U05A 2B1AH 4CMMA 3WFDH 4WI3A 1I1CA 3PIQA 4P46B 4H0GA 5D7LE 4JPKL 4X4KA 4DZBA 5DFWH 3UCRA 3GJEA 2QZ5A 1SQMA 1X9UA 2P5ED 3IXTA 4LT7A 4NYLA 1HQ4A 4FHBD 5AAMA 3HR6A 3VWKA 3P1VA 2FLMA 4GRWB 5GSVB 5BV7L 3SBQA 3B8SA 1S7WA 1CLOH 2GC4C 4YSSA 2NY3D 3UL4A 1S9WA 5F3HA 5C9KA 4I3RH 4JUTA 4NKMA 5F7EH 5B8CA 1OZTG 4X5QA 1ZJAA 2C3HA 3KDPB 1EIBA 4ACPA 1KJ3H 1MWAB 3ZMEA 2DY2A 3MV9A 3K71A 2XJKA 1ZPLA 4EDXB 3KR3H 5HPMB 4RFNB 3ULVF 3ARGC 4NZRH 3T2PA 3VAEA 2JI3A 1ZOXA 4GO9A 2XZQH 1OANA 4PW4A 3FQWA 1TQUA 2HTKC 5SWZD 5DJ0B 2Y25A 2W81C 1IQDB 4AVHA 1E6OL 3BPCB 4KMLB 3OHXB 3SPHA 2ZUXA 5LJYH 2BVQB 1UZGA 3Q44A 3FC8A 3JV0A 3R0MA 1QFWM 2B0SH 2FEDC 3QXTA 2JCCE 1H3PH 2YZ1A 5EWIL 2V5YA 1IBZA 4HIIA 4F3FB 3OPZL 4WU7B 5BJTA 2IQ9H 1J8RA 4Y16B 4LP4A 5D7LB 5FGRA 3UH8A 5KANG 2ADGB 5JOPE 2HLAA 4X50A 5HDQL 1BM3H 2ZUWA 3B5GA 4P23D 5A2LH 5ID1B 3N42B 4EN2A 1V7ML 4D0CB 1S7QB 2DWSA 1RK1A 3BCFA 3MRIB 4JFOB 3SHSA 5C2BL 4LBAA 3LS5L 1YO4A 1HCZA 4XC1H 1HL9A 1WQVT 2EDYA 1UC6A 15C8L 3UP6A 4JX0A 2GTZA 2AXJA 5F21B 4XC3H 3AITA