1XAKA

Structure of the sars-coronavirus orf7a accessory protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
CELYHYQECVRGTTVILKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and intracellular targeting of the SARS-coronavirus Orf7a accessory protein.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords SARS ORF7A ACCESSORY PROTEIN
total genus 12
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1550 Mainly Beta Sandwich Immunoglobulin-like SARS coronavirus X4 1xakA00
1YO4A 1XAKA
chains in the Genus database with same CATH superfamily
1MRDL 4YSPA 1R3KA 3CMOH 4CVZB 1RJZB 4FTDA 3VA2C 2OZ4L 3PF2A 3ZDYE 1ODAA 1PF3A 5CILL 2XCMC 1U8MA 4UQ2A 5CCHE 2Q6WB 4PR5B 4U1IA 2YAEA 2YAMA 4MZIA 4R96A 1WHPA 4J5VA 1LEGB 3IFOA 4O2EA 5B1KA 2X9XA 5CD3A 3TWCH 2WGXA 4F7MB 2PP8A 3PQYE 1AGEB 2H6PB 4XP1H 3V0JA 4RFEB 2X6VA 4KDTC 1YN6B 4LSVL 1RZPA 1HOCB 4LF3B 1G9EA 3POCA 4FG0A 2FLRT 1B2WH 3LKPA 4RMBA 2X4OB 3HG2A 2YAFA 2AKRA 4Z7VA 1R5IA 3G5YB 5DC2A 1ET8A 2R4SH 1J11A 5ISZA 1U8JA 2IWKA 3VQ1C 1CE1L 3QHZH 4A6YA 5IFAH 2ZKYA 2R4SL 4IU3A 5H35B 1P5VA 1ZLVK 4ELMA 5AVQB 2CK0L 3SD5A 5BO1H 4JHAH 1UD2A 2JMRA 2JWYA 5ICZA 1AACA 2WINA 3MLUL 1NMCB 3MNWA 3EDJA 1RUMH 2NY3C 3RIAF 2CLZB 5BRQA 1EJOL 3PGDA 2ITCB 4OUOA 3ZIYA 5JQ6L 1E4XL 1MQKH 5F97E 2P5ED 3ZKXC 3MRBA 1V3LA 1RIHH 2BS71 3E80A 4ABWA 3ULVC 4KTYA 4TVPD 1BOYA 1TJXA 3SBWC 4XNZC 1X6NA 5T3XL 3EGSB 1DBJL 1HINL 1UZGA 3N1QC 4POYA 5FB8A 2EE3A 4WUUD 1AQDB 1D6EA 2VT0A 4HPYH 4TVSa 4JFQA 4UB0L 4YXLL 1O9ZA 1CS6A 1T0PB 3QRLA 4M9OA 4Y89A 2UX7A 3DGCR 4Y2LA 3MLRL 1MG2C 2XA8L 3PQYD 4AL8H 3CMOL 4G7SB 4XO9A 4YBHA 4IBUA 1XSOA 3VXQB 5GJSH 5BJTB 1CD0A 1KTLA 3O3UN 2G30A 3W11C 2F58L 2IAAC 2XN1A 4TUOB 3SDDD 2V7NA 4FKHA 4K8RH 3SIKA 4PRBB 4D8PB 2VN3A 4Z7UF 4FL4B 3OXSA 4JB9H 1JZJA 3V4PB 1BGXH 1S5IL 2IBZX 5FOBA 1UWEH 3FQRA 4AJ0A 2C9XA 3S96A 4CUCA 3KPSD 4QRRD 4XNUL 4KROD 4D7BA 5KVEH 1MRFL 2H47C 5MHSD 1IVLA 3L4WA 4NM8L 4NQED 1FDLL 4XCCL 3S4SA 4M6MH 3VMOA 3BPCB 3MJ9L 4LKXA 4CADB 4IGBC 1ZLUH 3TCLA 4QCIA 1IEAA 2DEWX 3Q48A 1VFAB 3PNRB 4K23H 4R7DB 1KIPB 1BM3H 1V8HA 1YVLA 3U2IA 1BG9A 3T0AA 25C8H 4U0RB 5JORB 4UM9A 2ZG2A 5LVEA 3D39A 4S1RH 3WDJA 1AR2A 5BV7C 4QAWA 2ZXWB 5AW4B 4QF1B 4W9CC 3SDCB 1IAOA 1F2XK 5JO5A 1NOLA 4JHWH 1T1WA 4Z7WE 4DF9A 5HYEA 3W39A 1KSRA 5T8IA 4PCSA 5AW0B 1G1OA 2FBJH 4K5MA 5I74B 4NAMA 1JPSL 2VQ1B 1WCBA 5IBLC 1N64H 3C08H 1WDAA 1KDIA 2AJXH 3QXVA 1G87A 1KBVA 4AIZA 4BQBA 4KJPC 4TV3A 5I74C 3BKYH 3KW7A 5J6HB 2E27H 4A7SA 4AGOA 3U0WH 2HTLC 4P2RE 4KY1H 4ODVH 4WJG3 2FX8H 2WTRA 2VL5A 4H26B 2OYLA 3NZUA 2UVFA 4M56A 2DJUA 5KSUB 3RU8H 1WPCA 4A1RA 2WLNA 4XMVA 2G3XA 5JDJA 4BFOA 2A6KA 1X7QB 3RZCC 3FN0H 4OFYA 3EBIA 1HYSC 4GQRA 1B0RA 4ZFZA 4JPWL 3UBFA 4IIQC 1YECH 4JREB 4Q0XL 1FBIH 2W0FA 2WWKT 5FW7A 3RWGA 4GRMA 4PYHA 1NC2D 1T0MA 4JG0H 1JMZA 5KBPA 3AT9A 1PKQE 3SD2A 1AGBA 4HF5H 4B6ZA 3MN8A 1EXHA 2ZUTA 2H1PL 2WWMD 2R0WH 5HDBE 4KTDL 3T0ED 1S3RA 5EBWA 3TN0C 3BH8B 3QXAA 4E9SA 2C1OA 4BQCA 3IDUA 3Q1SL 4HX1B 4NO3B 2AAAA 4N8CH 3MGOA 3OR7A 3KJ6H 5E9DB 2O5XH 3DJRA 2DLIA 1PY0A 1N26A 4BUQA 5JQHC 2BIQA 3KYKH 1C08A 1AD9B 4I5BB 4M43L 1IBFA 3TBTA 1A4JB 1KCRL 5EO9A 3HN8A 4PGBA 1JK8B 1Z9OA 1JYNA 3VTTA 2ZUYA 4LU5H 3QQ3B 1TZGL 1KGWA 2VC2B 4PSRA 2BC4A 1ZPLA 5C2BH 3V0WH 5JXEC 4E9TA 3RWFB 3VFTB 4GG6F 3ZOAA 2IO5A 1IBGL 4JCLA 3SPJA 1WICA 2VQUA 3VWJA 5B1JC 4NT6A 1JPFA 4IMKC 4JRFA 3MV8B 1HSBA 2MPAH 3EJYD 4G72B 3SGDH 4FQ2H 4P5MA 3D2UA 2GUOB 4LVHB 2JTYA 5EPMA 4ZW3A 2QFRA 3MLWL 1PG7L 4QGYA 3UBXB 3CSBA 2PF6A 2JIXB 1C7SA 3WLBA 1BBJA 1IX2A 3T2NL 2GHWB 3MU3A 2FIKB 1XT5A 2X1QA 3N1FC 1OAXL 2AGJL 5I15L 3C09B 3WSQH 5K9QG 3HE6A 5H8DA 4TOYH 3EXJA 3SPHA 1T22A 2NY0D 3A24A 3ULVF 5JUEH 1WBXA 4LNVA 2VDQB 1KMGA 1CR9H 2BX5A 1DN0B 1L7TH 1XL6A 2HRPL 4LRNH 4S1SH 4YE4L 5E2TL 4OZFH 3LQAC 3VXUE 4MD0A 4HCIA 5EZJA 1QRNB 5D8JH 3VSVA 1FNFA 1JV5A 3NFNA 1ET5A 2DW5A 4IOSA 5L4IA 1CVRA 5E00B 4K8RL 4GP8B 4YR6B 5KSAB 1NC2A 4FJYA 1I7RB 4UBDD 1NCAL 1YYCA 2R7EA 1HFUA 4BEIA 1RERA 2CO6B 4UT7H 2IXQA 2DLFH 4NHUA 3AVEA 3O4LB 1Z5YD 2ADJA 4TULL 5SX5H 1O7VA 1UXMA 2UZXB 2DYPB 4K9JA 2FO4A 3NQIA 2G5BA 4NPJA 2K78A 3BGAA 2X4UA 1YEFL 3CC5A 3WUZA 3CZGA 2FJHB 2YBRB 4NQDB 4Z0XB 4AZUA 4JQIH 2V2TA 3R7QA 3QDGB 1UGNA 4W9DC 1QWHA 5DWPA 5F3FA 5I0ZA 3FT2B 1NIEA 3OKDA 4MSWB 1CWVA 5DZLA 1U3HC 2Y36L 1CFSA 4XPTL 4BINA 1RUML 5EDXA 4YEEA 5CAYB 1JMXA 3BUPA 2WXRA 3HHRB 5IQ7H 4U6HB 1RIVL 4B41A 4FFZH 3QJZA 1MPAH 2G9KA 1GXEA 3KBPA 4GBXA 4YHLH 2Z0UA 1AMYA 4XODA 1U4EA 3ARXA 3FQWB 3ZTCC 5C86A 2YSSB 1CI3M 4O4YH 3W1ZA 3GBML 2ZX5A 1S78D 2B15A 2VDRB 3OKYA 3U30C 5EC1B 1HWWA 2VGLM 2YFOA 3L3KA 4NKIL 4QR7A 1LDSA 4WEUD 3EFDH 4BD4A 5E2UL 2E7HA 1CFSB 4ZNCD 2B9BA 4KROC 4LHJB 3IS1X 4I48A 1R9FA 1K8IA 3OLIA 4KXZI 2J8HA 3V5DB 3CFNA 2JI1A 2WVVA 5JR1L 1N70A 2YBRA 4NQDA 1QMUA 5D1QD 5K9OB 3ILEA 3SJVA 2CRMA 4GG6A 4NO0B 5IEHB 4G5AA 4LL1A 4U7KA 5IB1B 1MFNA 3BSZA 3D51A 1B4RA 1IC7L 2X3AA 3BP5B 4KXCA 3FQTA 4XMZA 3LKQA 2VLKB 3ZGIA 3D6GA 2D8KA 3B9KC 3DUSA 3KPLB 3P2DA 4WW1B 2XFXB 4BCZA 2R7EB 4P3CL 1GS8A 1VB9A 4YUEL 3FT3B 3P4OB 4KHTH 4NJ9L 5IW3A 3OAZH 2WV3A 3VX0A 2WHVA 1B0IA 3QCVH 3BWAB 4JHVA 2A0LC 3EG9B 4O58L 5E5LA 1USZA 1XGQA 1PJ9A 4QJ5B 3QQ9D 1EQWA 5T1LA 4YSEA 2P45B 4NN7C 1GOHA 2A6DA 1JIBA 3GRWL 5DHYA 3RHWK 2NXYD 3F7PC 4BK4A 1MG3C 5FYJD 1ZWIA 1SYSA 1ACXA 4ZNEA 4PJ7E 3HG1A 2N7BA 2ZOWA 4FRWA 1DBKH 3FUDA 4NGHL 2Z7UA 4HUUA 1Z3GH 3CIAA 5D93C 4CMMA 4OGXH 1Q1JL 1NM9A 3UYRH 5L9DH 1NBQA 3U9UA 2ID5A 5KVFL 1MIMH 4RMQA 4KITB 3JVFC 4MD5B 2P46B 2GVYA 3FFCE 4XPFH 4GRLB 1RL1A 5EZIL 4ZFGL 3WTSA 4W9GC 4NSKA 2QT6A 5EPMB 2Y06L 3KNBA 1L0YA 3JUZA 3D2UB 4ZAKB 4D0BB 4W4OC 1LTXA 1KEGH 1J86A 2F1BA 3D3VA 3T2NH 5E8PA 4HUVB 1RZKH 2BNRD 4L29A 4QTFA 2WXHA 4HCRL 3W2DL 3KWXA 3MA7B 5IG7B 3EUUA 3TV3H 5HGBA 4OQ1A 3RNQB 3UDWA 5K1NA 3VU1A 3LH8A 4O9HL 3ZMRA 4K5LA 5A7BA 1J0IA 1A9BB 4RQQB 1KF9B 3MMEB 1O75A 3A4AA 3AT0A 5CGMA 1HHGA 5CZKA 1DJHA 1I8AA 5BVPH 3I3DA 4F8LA 1PJWA 2R69H 1HU8A 2NDFA 4LLYB 2BDNL 4HV8A 4MJ6A 2A9NL 2K7QA 3P4NA 4UTAA 2FWOA 5I75B 5IIEA 2HH0L 2RAMA 4RAUA 1LEIA 4PJBB 2YN3A 2XQYK 3IVKB 4QHNA 5FFOA 5EBWB 2QHRL 3L3OA 4F58H 1KBBA 3NSCA 2DI8A 4ERSH 2D31B 1U92A 1DBAH 5DJCB 4JO4H 1EEYB 5E51A 1PZAA 1NEPA 1G7MA 4N2KA 3ZHKA 5I1JL 1JE6A 1H9VA 3PJSB 2BSRB 5CSBA 3MOAL 1I9IH 2EE6A 1HS6A 3EGXB 1RKRA 5JXEA 1F18A 3UEZA 3QZOA 4X50A 5KAQG 3UTTA 2GBUA 3GXNA 1YQ2A 3S7GA 5DMYA 2Y5TA 5C07D 1DANU 1KGCE 2BWIA 4YDLC 5F7DA 5FHAL 2I9TB 3K5SA 4ETQA 4P2OB 5D5MB 4GO6B 3TA3D 3VO0A 4DKEL 5I30H 1S7QA 4X6EB 2DMCA 2JCCA 1IKFL 3SQBB 3IK2A 1JFHA 2OCFD 2ZCKH 4JN2B 5A2CA 2JQZA 5FF6B 1FORH 2DD8L 5HGHA 1BVLA 2BNUA 2JB5H 3CFJA 3FB6B 2OYPA 3FN3A 3FOLA 4R4NC 4R8WL 1RULL 3KPRD 5DVOA 5ADOH 5IGXH 4LLDA 3EBHA 4L0PB 4X5WA 1TXKA 4PCYA 5HYJE 4IKIA 2W80C 3BEWB 2ZUXA 3OAUL 1NGWB 4HDIB 3L3JA 4XOBA 3UTTD 2J43A 5D2LA 2E6JA 2E0PA 3D05A 1TCMA 4OR1A 3TIDB 2P5WD 4YAQA 3FH5A 2X12A 5EU6E 4HKXB 4TTDC 2MRYA 1CGTA 1O6VA 2OMTB 4MA1B 2DJMA 3HR5A 3LEYL 7FABH 3VXNA 4BSVB 1BVOA 3CCHA 3V6ZA 4P07A 2XN0A 1G9ML 2EDBA 3QDME 3UJIL 1Y0LA 4X4XB 4OM1H 4B0MB 3SDAA 2FYVA 1NIAA 5CMAB 1DVFC 1YN7A 1H5BB 3FU9A 2MCAA 2XXCB 1CTOA 4ETYA 2CHDA 3OGCA 4WFEE 4GUOA 4WI6A 1J8HE 3OKKB 3LZOA 4XRCB 1I8UA 2IDTA 2ED9A 2J8UE 4A66A 1IARB 5DC4B 1GZPA 4PRBA 4NRYA 4UQ3A 2I5YL 2KDYA 4S10A 5GJTL 2D3JA 3Q5OA 3QVAA 4GIAA 4XNYH 3BDYL 3OKMB 4P46A 3GMPA 2JCCE 4PY8J 5AVYB 5KVDL 3BKCH 3DO3A 1KWGA 1W0YT 2UZIL 4LOVA 2CZNA 5DCCA 3VW3L 1F97A 5HYJD 1OVZA 3D3VD 1N6VA 4PP2A 2P5EB 4ZQKB 4KQ4L 4K9EH 4XN9A 1INDL 3M17A 4G43B 4IGBA 4IGBD 1JGIA 1JYVA 4MKTA 1GJWA 4DGUA 1FJ1B 3O41B 4PJIB 4M6ML 2B59B 4MAZA 4PGCA 4LESA 1HKLL 3C5XA 3KYAA 4O2CA 2WCSA 3I3EA 3SKMB 3QJUB 1U3NA 3MRQA 3V4PH 2RD0A 4F3FA 3ZKNC 3CFEB 3GKWH 2JJSC 2W07B 3P02A 4MNQE 4U6YA 5AUMB 5G55A 2ZE0A 5ITFA 5DUJA 2NSMA 4AUUA 2BIPA 1XXDC 1ZT4A 2H5UA 1AE6H 1FFPA 3VFWA 1BLNA 5LXVA 3QNXB 2OPCA 3T3ME 1TTCA 4R90H 1YEFH 2AKRB 1R0AL 3I2CL 2H2PD 1T3FB 1UYWL 4JM4H 3C6LD 3LD8C 3CFDA 2HXAA 1ZVHA 3AXHA 4QRRB 1Q72H 3EYOB 1HOCA 3U1SL 2K1MA 3SDAD 2P28B 3X11B 5CP3A 2JXMA 3ESNA 4P59L 3MACH 3GK8H 5D7SL 1A0QH 3W57A 1Z3RA 4XOEA 1F4XL 2RCSL 1WK0A 4FP8L 3LNGA 5F7EH 5E08L 3WNMA 5D70H 4FQXB 4EUPA 5BS0B 4O51B 2F53B 1TENA 4NZTH 6PCYA 4XTRD 5EG6C 1KCSH 3EHBC 1IKOP 5DD5H 4J2QA 5IF0B 4UNUA 2PO6B 2CU9A 3EFOB 3OKNB 3QI9C 1C16B 1R47A 2OSYA 3MXVL 3WO3B 1K8DA 1FG9C 2Y2TA 3QZBA 4BFJA 3CVBA 4Y4KA 3DURA 1KXTA 3QGVA 3N42B 5T1KA 1CK0L 1SJMA 3KPRA 2OLDA 1MJ7L 1WT5A 1NOFA 3EJUA 1N4XL 4QO1B 3QJHB 2PPDA 1I3RB 1F90L 4MYWB 3U36A 4K5OA 4ZNEE 5B39A 2CDFA 3SE8L 3WG7B 4ACPA 1EANA 2EO1A 3EYOA 4HIJA 4HKBA 3LZNA 1AKPA 3DMMD 5CZXC 5GSVA 5I5JA 1BM7A 3GIVB 2H0PA 4FXKC 4JDVA 1P6FA 4XNQB 3MXWL 3TA3A 3HEIB 4CC1A 3EO0A 5ENWB 3T3MF 4F8PA 2B2XL 3U1QA 2DQEH 2OJZH 4JFZL 2VLJA 2JSFA 4YDZA 3PY9A 4HT1L 2ZWNA 3MSPA 5IHLB 5M94B 1N7ML 1BJMA 4ISVB 4HWUA 1FUNA 1NC4A 1LNUB 3DJZA 3APFA 4C83A 3WFCL 2AJZB 1KNOB 3WJJC 1TZGH 5C2BL 4I8DA 3GI8H 4YGVA 1KGXA 5CJ5A 4TS6A 3HR6A 5JW3L 3BGMA 4UNTA 1MHCA 2Q9OA 3GSNH 4Z7NF 4MJIB 2VLLA 1WIOA 4XBGA 2VRAA 4F33A 3F7YA 5I19H 3WTUA 3DV4B 1PY9A 4NQDE 4O02H 2P5EE 3NT0A 3S8FB 3AWFA 4EDXB 1AZCA 2VXQL 4NWUL 4BH7B 2J2ZB 1F4YH 4IK7A 4XXWC 1MHHB 1OAYH 3PL6B 3B9DA 1OZTG 2GEEA 3IFLH 3VGGA 4PJAB 1S7SA 5DEGB 1UWFA 4TQ8A 4F57H 3VE0A 3DNKA 3H85A 5BMFH 4TKWA 4KKRA 2YEZB 3K2IA 5IMMB 3MCKA 1G9NL 5LB1A 2OMVA 2YZ8A 4LARH 3LSOB 2FT6A 3EH4B 3HI1A 2HRLA 1B2WL 2NY4B 1AYOA 3AMLA 5JOEA 5KJRH 4FZEH 1NGPH 3OJDA 1FH5H 3DROA 4XVSL 2AK4A 3MRIB 2OL3A 3RIAK 2DTMH 3QO1B 4HZLB 3U2JA 3UO1H 5I18L 4ZXBB 3E8UL 1UCTA 1CICD 4Z18A 5AB0A 2J1WA 1LYQA 1NCTA 1NPUA 4IRSB 1EGJA 3FHEA 2BM3A 4MB3A 4L9DA 4MXVE 2WO4A 3BH9B 1TQCC 2ZZUT 4MMXA 3SBQA 3K72B 1KC5H 5C3IA 1INQA 3GMNB 3VXNB 2R2BA 3G6JB 1NAKL 3EF4A 2BDNH 4WV1A 4FI7A 4GI8A 2R8SL 3HG1D 3GSXB 4G9DA 4U1LA 3X14A 3OG4B 1B3IA 1MDTA 4M5ZH 1YMMD 4UTCA 2HTLD 5B38G 2ZQKA 3WNKA 4X5WB 4X42A 5DO2C 5D1ZC 4ERSL 3K5RA 3DROB 4X8JB 5I1IH 2P7TB 4H2CA 4XAWL 3TT3L 5E24E 3EJRA 1DUYB 3UXFA 3FOLB 5GQBA 4XCNB 1FYTB 3QDJB 1T2QH 2ZCHL 4ZXBC 4G8GA 3T5WA 3O2VL 2H26B 3QIWD 4OCWL 3UC0H 3MUHL 2KPWA 1JGDB 1NCBL 2C3GA 3B8SA 3HS0C 3U82B 4ZMWA 5MEQA 4XH2A 5HI5C 1EHKB 2EXYC 4U6TA 4XXCC 1P4UA 3GD1C 4JFYA 3TBYA 1CFMA 2UY7B 1GZHA 4HWZA 4ODHH 2LAGB 3VFNB 2MOVA 4RFOL 1DVSA 4PS8A 3KLAA 4NUPA 3W0WD 5DEFA 3SJVD 1SM3L 3AZUA 1QFWM 1T6BX 4PLJD 4RA0C 1MHCB 3BGMB 3Q06A 4HUXB 4BSWB 1TQBB 1U8LA 3PJSA 2WZPD 4UAOB 1T2XA 2ZUVA 2RBLA 4OJYA 3ZE0B 3RTQA 3MACL 1ZVNA 2NDGA 5HDBF 5CZRA 5FIEA 4XNDA 4Z76B 1DQIA 4KUZH 2WBXA 5D1XE 3D0AA 3H56A 3V52L 4TNVF 3PHAA 2UWEB 5HYIA 5T1DL 4JHUA 4NJ9H 4DZ8A 3VG0L 5K33A 4CMHC 3E3QE 4JQXC 4XWGH 1KXVA 3Q01A 4X8GA 3VUAA 3TA3B 2CAKA 2ZX7A 4BH8A 1NBCA 1DFBH 2OM5A 5L7XH 4GBXD 2NLJA 3P4NB 1ES0B 5GSVB 1WWBX 4AT6B 3ZLQC 3GS7A 2JNZA 3V5HA 4QKXB 3MR9B 3LSOA 1IGTA 4G1MB 2HLEB 4LXFA 3GHEL 5EZOL 3PABB 4RQQA 1XGUB 5E5UB 3ZHFA 4XVJL 2PP7A 5I8OH 1EHNA 1SLWA 2F7PA 2RQEA 3GHBL 4L1HA 5LNEA 4WI2A 4F2MA 5IG7A 3NYKA 3KPRB 4KTEH 4NO2A 5C0ND 4BXVA 4DGVH 5E8PB 1ZIBA 1TEYA 2VW6A 1UZ6F 4J8QA 1VZGA 3C2SA 4PJFA 5MEPB 3OZKA 5L2KD 2Z8VC 1O7DE 5LN8A 3C5ZC 3ZQ9A 4UQDA 5HHVL 4NENB 4G6JL 5IF0A 1QNIA 2G3NA 1B2YA 3A5VA 4FNLH 4NC1E 3DX9A 4QXUH 4F33B 4H7VA 2VMDA 2IQAB 5TF0A 2NZ1A 4MJIA 3PDOB 1H15B 3WELA 4GLRH 3X12B 3JVGC 5EU5A 3RVWD 1EAOA 3L4VA 3GZPA 4FFYA 1ODUA 1IZKA 3ARBD 2JXMB 1XXFC 4XE5B 3K91A 3OHXB 4IOSD 3WIFB 2ITEA 4H88H 1OLZA 3HJ0A 3FULA 4QRRA 5DRNB 4BFNA 2HLFD 5DHVH 1M7DB 3JV4A 4WCYH 4AV5A 2MFNA 1MFCH 4GAAA 3FSZA 4WWNA 4WW2A 2EC9T 4Y4HB 3SKJL 3VM5A 4PV1C 3S34H 1ORSB 1UD3A 2AJ3B 1Z3GL 5HJBA 1XGQB 2Z4QA 4BZ1L 4DN4H 4U3HA 4PI2A 3BQUA 1R3HB 4XNZB 4F80A 2PABA 2Y3NA 3D69A 3QYCA 4U0QB 1N8OE 2CDFB 5JW3H 4MA8H 5C0BB 1AZNA 3BPOB 4AYFB 1ZHBA 4YE0A 2TSBA 4WI0A 4KFZC 2VDPH 1NGQH 4UT9A 2WXQA 1YAZA 3MRQB 1WZ1H 3QJHA 3CV5A 4JANA 5MP6H 4HIXH 4JRYE 3VFRB 3DXAE 2C7FA 5FGBC 4IS6B 2W95A 5I0YA 5L2KE 3RFZB 4F8NA 5TE4L 3D2UD 3O6KL 5EIVA 5FUCE 3EFOA 3OD3A 4FL4C 4B9IA 2Z65C 3J8F7 4GG6B 1FIGH 4FFVC 4XVUC 3VSQA 4PP2B 3AM8C 4HWNA 3FCTA 4PJEB 5ACLA 4ESKA 5FEBA 1MEXH 3QJFA 5TQ2H 1ZVSA 3Q13A 5IW6B 5I26A 4WIQA 4AV0A 3T0DA 3FYIB 4YJZL 2ADGA 2VYRE 5AW5B 5J1TC 3X13B 4MNGA 3ATEA 3NRQA 1LO5B 1KIUA 4WI4A 3U83A 4L4VA 4R7XA 1KPRA 5FO7A 1J5OH 2NW3A 3CK0L 3BPOC 3F7RA 3MV01 5KANG 3MCLL 3MXVH 4B97A 3F65A 1R5VB 2XWJB 2JKJA 2COQA 5E6YA 4ZMLA 4ZUUA 2ITFA 4HJJH 5J4MA 3D25B 1Q9OB 1BLNB 3QC6X 1YN7B 4ZW7A 4NFCA 4L18A 3MGTB 2JLPA 2SEBB 4X99B 3RZCB 2W88A 5I75C 1JGEA 5C08E 3BKML 3WS6C 4PJ7F 2Q76A 4A2HA 3SKMA 4BZ2H 4XBEL 1AGFB 4LLAA 7TAAA 5J6GB 3S37X 4OFYD 5JPMC 5JPNA 5H37H 2PO6D 2BRQA 5IQ7L 2XQBL 2VLMD 1KY6A 2PUQT 3EYQD 3MV9A 3ILPA 3NSXA 1GHFL 2X1WL 2MJWA 3O45A 1MCDA 4UYQA 1TO5A 5EF2A 5DQDH 4N0FA 3H54A 1NIDA 3FTUA 2G60L 4PJHA 1OM3L 5BRZE 4QPEA 2HFTA 2MPAL 1T0NA 4EN3C 2CO6A 3LHPH 3O9WB 2PCPB 2NY6B 3NABL 3QXDB 3H6JA 2R27A 1F6LL 1T21B 4YR6A 4P5SA 1IIKA 3SO3C 3V4PL 2FQGA 2VXSH 1ZT1B 5CM1A 4H0LC 5AZ2L 3SQBA 3FQXA 3UDWC 4MVBC 2H6UA 2YRBA 4PREB 4Z7VE 4P9HC 1PFOA 1FNHA 1S7QB 1MFVA 2X2UA 2ZAIA 1VF5C 3IFPA 4OJAA 1QO3B 1RZIA 4QI3A 4LHUB 2LTQC 1X5ZA 4FABH 4ETQB 2ARJB 1SQMA 3WJMB 1QYGL 4WJ5A 5DA0B 4PY7A 3OGCB 3ZU8A 1HXMB 4FI8A 1TTRA 2Z8RA 3DMMA 4NQUA 1OE3A 2G75B 3NH7L 3O2DL 4Y16D 4LVHC 1DVFB 1Y0LB 3IF1A 4L3FA 2TRHA 1CGVA 4NIKB 4OBRA 5GGQL 4YE4H 1UASA 3MODH 2X6CA 4C58B 5C0BE 3AREA 2ZWZA 3RFRA 1QFHA 3BVUA 4PBXA 2OR9H 3T4AB 4OI8A 4YAQB 3TIDA 3IWUA 1I9EA 1U92B 2ZWKA 5T1KD 5TD4A 1E4WH 1ZCRA 4FXGA 4NQEA 5I2IA 1U3JA 2X42A 5GZOD 4JRYB 4IIQA 1AZVA 1OGAB 4F7EA 2P80D 4F93B 3BRDA 1DQVA 4FQLH 4KH2A 3QUXD 3CE1A 3MV8A 1YUKB 3B2PA 4JKPL 1G6RB 2B1AH 4L1LA 5AQ0A 4HHAA 4CW1A 4ES9A 4OZFG 2P26A 3VWJB 4Z78A 5HYSG 2YN5A 4TQEL 2ZTBA 1AXTH 1IFGA 5IQLA 3U4KA 5HDBB 4TQIA 3MC0A 2G9HB 2L04A 3SDDA 5JIMA 3QFJB 3FB6A 5B38B 1RUQH 3DVNA 4PLKD 4B95C 3EJYC 5FF6A 1U8IA 3RB5A 3UZQB 4I18A 1P5UA 1A4JA 4JN2A 1NEZA 3APMA 1A7PH 3OB0K 4BA8A 4NZ8A 3FPYA 4KNQA 3D3VB 4MJ5B 1JF1B 3C6LA 1BBDH 1YNTA 2K6WA 2EECA 4NO3A 1L7IL 2H6OA 5C3LD 6PAZA 1R17A 4R7VA 5E4EC 1IIIA 3ARYA 3BH8A 2YGOA 4K7FB 5LAXB 3VXMA 1NCHA 1MLCB 5T1JA 4PJ8C 4YDVB 2AJVL 2MHAB 4UMSA 4JPKH 2PPFA 3WMQA 5CEXB 6TAAA 3Q3GB 3VXRB 1MF2H 3B83A 4TUKH 2G3MA 3SOBL 3WKMH 4OLWL 1FC1A 4HUUB 1FZOB 4R4BB 2IG2H 5I1GH 2AJSL 3HG1B 3QJTB 3FSVA 4KO7A 1G43A 2B20A 2Q87A 3ZT7A 2V3DA 5E08H 4I0PC 3GSNL 4B53A 3QUKA 2JLLA 4YC2B 5F9OL 4KI5C 3CZJA 1ZPUA 2W59A 1HX0A 5F0MB 5LQBH 2J44A 1ECZA 1SOXA 5E2JA 1KGCD 5AAWA 4Q6IA 4GW5B 2Z4TA 3CDZA 4FFZL 3OJVC 4JFOA 4JO3H 3MLTA 1CF8L 1FYTD 4X2UA 4FAAB 4Z77A 3VI3E 3BQVA 3HFFA 4GQ9L 5GS0L 4X7SH 3DK2A 4M3HA 3MRDA 4ODWB 1IC4H 2Q5BA 1GTNA 5LBSH 1AQ8A 4MAUH 2Y07H 4C8XA 3SE8H 2DM3A 1R3LB 4W9LC 9PCYA 4JFFA 5D96B 1RK0A 2LE9A 4JR9L 4U33A 4ZAKA 1RVFL 4OLUH 2FJUB 4LCWE 1DJYA 2ETWA 4ZW6A 1BMWA 4KRNA 4PI0A 4R9HA 1YNLL 4JZJA 1IM9D 1E7VA 2HA1A 1A6AB 3UTSA 4FA6A 4K7PH 2XZAL 1AY1H 2P5WE 4DUWA 4XVUD 5JIQA 3TS8A 4UNVA 1TFHA 4HWEL 3L3KB 3UG5A 4NRZA 4R83A 5BXFA 2XV3A 1AFVL 4UQCA 1Z5LA 2EINB 3RX8A 1FGNL 2N59A 4E2OA 4IJ3C 1O0VA 5DHYB 4FZ8L 1QTYT 3EYFA 4GT0A 5FYJL 4GBXB 3KHOA 2V2XA 3JSSA 1NGYB 1MJ7H 3MFGB 4GFTB 4Z7UE 4JGUA 5K9JH 1KCBA 2R0LL 2XDHA 2FL5B 3L2MA 8FABB 4TUOA 1HHJA 1CFVH 2B7DT 2I9LB 2ZCLH 4JHBA 4JO8A 2DAVA 4QHMB 3AS1A 3MGAA 1FIEA 1TIUA 5AL0A 3OKDB 4MSWA 1BF5A 2XKNB 3UMTA 2NY5L 3C5SA 3WOVA 1YJDC 1DLHB 3CC5B 4AVHA 4C47A 4IMLB 3ESUF 2NX5A 5GGTL 5B3JF 1T7VA 3DWTA 4TVPH 5F93C 4PW4A 3TWYA 4KAQL 5CILH 1IBGH 1SXZA 2ZX9A 2AJYL 1N2RA 2ADJB 3PL6D 3LXAA 3QI9B 1YDPB 2ITCA 4ONGH 4QHKI 2XWEA 3D7PA 3CFMA 4DW2H 2F7OA 2OMZB 3OKOA 3QR0A 2GJJA 4JG5A 3FB7B 5GRVK 4UIMB 3FMGH 1CDHA 1QHOA 4Y9BA 5AYUL 1WGVA 1BWMA 3EF7A 1RIUH 3G9AB 4P06A 2D9CA 4U2ZA 1ZVYA 4P5RA 4A04A 2X09A 2PPCA 4JDEA 4K8RD 1ADQH 4LEOB 5G4MA 3ULSB 2J4WL 3KYNB 5IHWA 5F9WB 1KJVB 4FOMA 4WKZA 1VGEH 2HFEA 3MNZA 4ZXBD 3FHQA 2X4OA 4NZJA 1MNUH 3FB5B 3FCSA 3CWGA 1RLWA 1KTKE 4IRSD 4LF3A 4P2QB 1V10A 5LN4A 2PTUA 4OSUH 5DFAA 3THML 3IDXH 5EBLA 2H6PA 4MJ2A 1ERNA 3DPBA 3VGHA 1P69B 2XVLA 5IEKB 3REWB 1MFMA 3BT0A 1KBGH 3O9WC 5D7LE 2WKLA 1VKXB 4AQ1A 1CC3A 1U8MB 2VSCA 4UQ2B 2BNRA 4AMWA 4XNMA 4Z0XA 3LB6D 4I1RA 4OLXL 3KLHD 4ZMAT 1RQ5A 5FGCB 3CFQA 1SBSL 1RUQL 5AD0B 1EDQA 2J71A 2NTFB 43C9A 5GZOC 3BUQA 4XHJD 5G4NA 3FF8A 3V9FA 3FZUC 1IAIL 3QDJD 3QQ4A 4TVPE 1DE4A 2IANA 4IBQA 1I7RA 4P48A 2P8LB 4IRJB 3S37H 2GFBA 3QWRD 5I17B 3HS9A 4UQIM 3R1GL 2VRQA 5IB4A 2XTJC 1TQTA 3AADB 3Q0HA 5I71C 4QRQB 4G11A 5SWQA 2R1YA 3LEYH 1V55B 3WAKA 1B4JL 1CLYH 1LK3H 4HUMB 2DD8H 3ARGD 5T1LD 4P4KA 1OOAA 4M93C 1NZRA 2HVBA 2H9GB 1S7VA 4RRPA 4C4UA 4P05A 3PRZA 4BA0A 1VLXA 4E5XB 3RVVD 1KCVH 5BUAA 1AGBB 5F3HB 1NGZB 1NANH 4A7GA 2EUVA 1F6FB 2OMXA 2FGWH 3DXAB 4NIYE 1E4WL 4YDJA 4HOZA 2EVFA 4ZFGH 1B0RB 1IQDB 4ZFZB 4NQXB 3MJ9H 1BBJB 1ZLWH 4HLEA 2JIXA 4XGZB 4DQOH 4NQEE 1FVEA 4CRPA 1X7QA 4V1DB 4JDZA 1JJUA 2ZOUA 4IBTA 4JKKA 4RWYL 1X5KA 1Z5LB 3N91A 4J23A 1QABA 4JO5A 4P5MB 3OPZL 3SPCA 3NA9L 2DWEA 4MB1A 1MW3A 4RIRA 1DLFL 1RZGA 4NQDD 4CILA 1W72B 4X6DF 3V5KA 3UGUA 1WT5C 2ZXDA 2YGVA 5LCVA 3RJOA 3LRMA 2IFGA 5F21B 4E0RB 1TTBA 2W38A 3DECA 5ANMB 5DWUH 3HNTL 5LHDA 1N12A 2IBBA 4GAGH 3P9LA 1Q9KB 4YDMA 4KNSA 5AAMC 3RGVA 2YOAA 5CGTA 4UTAH 4OW6A 4BZ2L 3VB8A 3MQIA 2GITB 15C8L 1J5CA 4WGVB 1EA9C 5JIDA 4H0GA 5JO5B 3NZHL 3OZ9H 1JUFA 1RZFH 3R1GH 2ATAA 1KGUA 4WWKC 3TBCA 4BUHA 3UERA 1EZUA 1YEJH 3IJHB 3LRSA 5KSAD 1RZJH 3F6IA 2C9UA 4F7PA 4ZTOL 2AVFA 5DO2D 2HUHA 3ME0B 3QQDB 4TF4A 4L3EB 2AQQA 3TBSB 2V33A 4WU5B 5IR1B 2WP3O 2K6ZA 4LDLB 5I6MA 3SY0B 3LXCA 4PJCF 4A7QA 4ELDA 1C12A 5HYJB 2R1XA 2VNCA 4XNXL 5ACZB 2YD0A 1ORQB 4WGKA 2CWRA 4CN1A 1XGRA 2R69L 2CQVA 4OY9A 1DJSA 1YQVH 3NSYA 3HLAB 2XIBA 4JW3A 5EZIH 3QUKB 3C60A 1QNZL 3MOBH 3EZJB 3QZWA 1CFNA 3I6GB 3INUL 3WJLA 1MIML 5EHFA 1P84K 3BGFB 4PJHF 3FU8A 1WGOA 5EO0B 5FOBB 2CJTA 4JG1L 3T6XA 3TV3L 1NIFA 2CJ3A 4S1DC 4LPYA 4F20A 5IR1A 3NJLA 1FIGL 3QDAA 4X98A 4XP1L 2O5ZH 2VDKH 3UPCA 5DSCB 2IWFA 3P11L 3QCTH 1MAJA 1S9WA 2Y3AA 4Z0BH 3S36L 4OCXL 4XPFL 1T03H 5T5FH 4Y19E 1U95B 5FFGA 2FBOJ 4HG4K 1L5GB 4MJ5A 5JQIB 2Z1PA 1J1OL 3MRHB 5DHEA 3T3PE 3BN9C 5M7QA 3OWEA 2ZAGA 4BFRA 1WIPA 2A9DA 5T3XD 3P77B 3ZHNA 5CJ8A 5TQ0L 4AE0A 1Q9KA 1SDDB 4FULA 5TQ2L 4KMQA 4XMWA 1HI6B 3T0WA 1AQKL 5C0RH 1C7TA 1JNLH 1CJYA 4GQZA 2OKMA 5F6IB 3QAZC 3KBHE 1EZLA 5ANMA 3ZK0A 1GYAA 3IJ9A 2NW2B 4PLNC 5C0EB 1Y1UA 1NAKH 3P4MA 1DJWA 4L4TE 1KIPA 2UXVA 3CNKA 3SGKA 2LVEA 1IGIH 3MRLA 1J1OH 1MCPL 1YYLH 1KC5L 5B8CB 2DWEB 1ETA1 4HIXL 4HT1H 4RIRB 4P3DB 4JFDE 4W70A 3NPSB 4JRYA 1NDMB 4U0RC 4NQEB 1Z9MA 4OCRL 4U1HA 1NL0H 4DSYA 4J8RA 1QLRA 4NQCD 1AKJD 2GBTA 2AC0A 3HUJF 3ARDD 4PJ5B 3L5HA 3ELQA 2EAEA 4K0OA 4KXZH 4QNPF 5DGRA 4NI6A 5IESH 2E9GA 1A3RH 1YN6A 3W9DB 2OW7A 1CURA 2KHAA 2OMBA 4L3CB 3US1A 2FYYA 2YPLD 4R96B 1O7SA 3SYCA 3KZ8A 4N1HB 3ZE2F 2Q6WA 4YXHL 2FX9H 1NCUA 5LBGA 2R1YB 1MNUL 5T3XE 3B6SA 1F2QA 1I1AA 1JZFA 2CRYA 3EGSA 1JHLL 1Z1WA 4KI5E 2QGCA 5B8CC 1R3KB 4M8QB 4L5FH 3DI2B 5T3ZE 1ZLEA 1WH0A 2AHIA 1GY1A 4HULB 4NPYA 4JPVH 3D0LA 4OLVL 1DFBL 3E1ZA 1QKZL 4JQIA 4KRPD 5KSBB 4KZEH 5LBSA 3GXIA 2Z1KA 3GSQB 2ZP9A 1J10A 2DF3A 4M6AA 1MWAH 1MFAH 1L6PA 1WBZA 2BY3A 3H4FA 4UB0H 4NC2B 1MCJA 5C0DA 3MA9H 1L9QA 3VFGL 4NERA 2G0LA 3I2CH 4JM4L 2WQVA 3VWKD 1KB3A 5GGTH 2BNRB 3TU6A 3QWQB 2EE0A 4OIBA 3BVWA 2GW5A 4AYID 4Z7VB 1MI5E 1E6JL 43CAB 4MRCA 1LO0H 3MCG1 3EJPA 2HT4C 4O5LL 2J25A 5IEKA 1I1FA 1E4XH 1SLXA 1G9HA 4X9HA 2WLZA 1M57B 2APTA 2SEBA 1HXYA 3LZLA 4FNLL 3Q8CA 1E8WA 1UJ3A 4IRZL 1BZQK 5DD3H 4F7MA 2V9QA 1OSYA 3ZYZA 3D25A 1OTTC 1CD9B 4G1EA 5I8KH 1GAFL 5DR5L 1CE1H 4QYOB 4MAYA 4HXBH 4NWTH 3TOPA 4APQB 3LJ3A 2W0PA 1UB6A 2DICA 3M1BA 5KOVC 1INDH 3GXMA 2BINA 3UC0L 2CUIA 2PKDA 3BAEL 3DIFA 5KYWB 5DK0A 4R5TA 4KK6D 2BSSA 3PGCB 1FHNA 4GNKB 5D7IF 4HOWA 4MNGB 3FB7A 1JXGA 1HESA 2OL3H 5T5NG 2HJFA 2M26A 5D70L 3LRKA 3BDYH 4L48A 3QT2A 1EXGA 5D1ZA 3RY6A 1UOKA 2YD6A 3K0WA 4XC3L 5IVXB 2H0JA 1D2PA 3FUNA 4WNQA 4I18C 2H2SC 3JWNE 4WEBH 4C59B 4OJCA 5EU3A 4ZS7L 2YKLL 3E6FB 2ZPKH 1A7BA 4X5RA 2IVFC 4P2OD 4KU1A 2CMRL 3H55A 3A67L 5IJVA 1JNJA 4KX7A 2ZCHH 1YC8A 4DVBB 3VFRA 5DO8A 1CD1A 2XKNA 3KXFE 4UANA 1WEJL 5AW8B 4LVOB 3IMSA 2B4CH 3MRFA 1N19A 3P40A 4OZIB 2NY0C 1EJ6A 2YIHA 2A74B 1S7UA 1JPST 2ZXAA 2I9LA 1G7JB 1K72A 4NC0B 3OZLA 1K3IA 4GI9A 2FL5A 4UAHA 5KSVA 3SCMA 3JQOB 2NY0B 4M48L 4U3SA 2X1OA 1NGYA 2RHEA 1NAMB 4M7ZC 4ZMPA 3O11A 1DQJA 2YD7A 4OVVA 5GGRY 5KBKA 5CCGE 3ULUC 1M7DA 3Q8BA 4HWBH 1ZGLP 4ZUWB 4KHXL 1G9NC 4KROB 3CN1A 5BXFB 3QG6A 2NYYD 4YDKL 2IJ0C 3NUKA 4PWKA 4ALAL 3BWUF 3KLDA 3KVQA 4YX2L 2AAVA 5HGDA 4BV1A 1J18A 3IN0A 3L9RB 3WJLC 5GIRA 1IC1A 3OXRB 1K3ZA 4KKAC 4TUKL 4K3DL 1E5ZA 3RUGE 3VFMB 2WYZA 1A2YB 4J1UB 3WFHB 1SY6L 1LP9B 1FFNA 4MNQB 2ZSVB 3T8VA 2J8UB 1K6QL 3L3DA 6CGTA 1GS7A 3GSNA 3KVDD 4R6UA 3PWJB 1KY7A 1AGCB 1BJ1J 2FZ3B 4DGIL 2CBMA 5EUKB 2CPUA 3ARDB 3MRDB 5EU4A 2QTVA 4BGLA 3FUKA 2W60B 3KCPB 3PABA 1OB1B 2GJ6B 3CBRA 3V5HB 4YFDB 3RUGA 5GZND 1XR9B 2HN7B 4IJ3B 1ITCA 4DP8X 4N5UA 3WL9B 4DKFH 2YRLA 5C7ZA 2V7HB 4OZGA 2VR9A 2BMKB 5DD0L 3UO1L 5I18H 4QY8B 4R4FH 1P2CA 3WIHL 4V1DD 3CFBB 5DGQA 3M45A 1T20A 1BSIA 2R59A 5DC0A 2XV6B 4JFHE 2YJQA 2WNXA 4G9FE 4XBEH 2VAAA 1TZAA 2V5MA 2Q1EA 4TLKA 4LCCB 5E7BA 3TA4D 1U8NB 1F00I 1EBPA 3C5ZB 2AMGA 1QVOA 4N8VB 1QOKA 1D6VH 3DHJA 4Y4KC 2MQCA 3RDTB 3ARDC 1PLBA 2XOTA 3QPXL 3JTTB 2VXQH 4HS8L 4I3SL 4NWUH 2QV4A 2N7SA 5E9AA 5LAXA 3V0GA 1Y18A 5FDWA 3KLAB 3KLLA 1IKFH 2BNQD 3PWVA 2A3TA 1BGXL 1S5IH 4LSVH 3RWIA 2UY7A 4MXQD 1ETZB 1VSCA 2VDPB 3ZQXA 4X7FC 2Z93A 1CLVA 3GMMA 3FBQA 3QFGA 4RAVA 4OZIF 3LOWA 3KXFA 4EAEA 4LPXA 3EZ8A 5KVFE 2XICA 5DZJA 1NEZB 3GJFK 3N50A 5EIQA 2V5TA 4PJ9A 2XA8H 4HH9B 3QFJA 1E43A 4QTIH 3TBWA 4B9PA 1BXUA 3OQRA 3WIIL 1DUYA 2LHAA 2JJTC 3K2UL 3V0DA 5DJ0A 3WN5C 5GRZA 4R2GC 3BW9B 4X8JA 2E7MA 5DYOA 4V1DE 3UJTH 2YPVA 4ZUVA 3GSVA 2EDJA 3HZMB 3MRJA 2NSQA 5AZEH 3O8XA 5AVTB 3ZDZB 3HS0A 1WAAF 2E6QA 4LSQH 5F89A 4G9FD 5GRWA 2OXHA 3VD3A 2X41A 3LS4H 4LOEA 1D7BA 3UTSE 5D7HA 1LD9B 1MW0A 2EDDA 2ZG1A 5F1SA 3LY6A 1NDGB 4LOFA 2F8OA 3WFZA 2A6JA 2Z7YA 4IBSA 1DVFA 3IF1B 4NNPH 4AYGA 4XN5A 3LVEA 3DVGA 5DTFB 1QD0A 3CDYA 4XX5A 2GSGA 1W0VB 5B1JA 1MQKL 1BAGA 2VDOL 1S6NA 3GUFA 3PWUA 3VW3H 1X5JA 3HAEA 5A16A 4PY8I 5H37G 2VXTL 3BKCL 3QORD 1MI5A 4F9PC 4PREA 5ICYA 3F84A 2KMWA 5FUZH 4GSDL 2Z31D 4MNQA 5JA8B 4JRWA 4ODXA 4P46C 1ZT1A 3H9HA 4YZFF 3T8MA 3W5MA 2RR3A 1EGJL 1JYWA 1JL8A 4PJCA 3PDDA 3WLWC 3C6EA 3Q2VA 2X4PB 3CHPA 4LLUA 4UM8B 1V3MA 3ZHDA 5KVFH 3TO2B 3MYJB 3FTYA 5E6IA 3APCA 2LU3A 2P1YA 5CJOL 1ZOXA 3ZL4L 1UM5L 2QVFB 2UUDK 1F1GA 2GK2A 1BXAA 1TVHA 4PJEE 4CU8A 2E7DA 1K4CB 1U3HA 4HQQL 4KKLC 5JPNB 2OQJB 1BZ7B 5AOZA 1SMAA 3MLZL 3ARGB 4FCAA 2ICWA 3QIBD 3QRGL 5HDQL 2R9HD 1RIVH 4OBSA 2EDEA 3PAUA 1BYNA 3FRPB 4JQXA 3D1MC 5C6PB 3TJHC 1JGLL 4B3EA 4X99A 3RZCA 4R0LB 3ZBMA 1HWHB 1UUSA 3PXHA 4FG6D 1HCYA 1S7UB 1J8HA 4OF8A 1F58H 4OT1H 4RDQF 3TZVB 1E2VA 5D2NB 3KPMB 3CSFA 3VFOB 5FHBH 4UDTB 3BZEB 1Q9WB 4R0LC 3GBLA 3GIVA 4DETA 2JVUA 4OGQC 3PGFL 3BSHA 1E2ZA 3PIQA 5FO7B 2ZP0T 4Y5VA 2JKXA 4Y16B 4Y5VC 1BZEA 3MLSH 3QRBA 3VVVA 4M7LT 4OQTL 4JFDA 3OL2A 5I0DA 3ZRSA 5E94B 5JPNC 5JPMA 3HMWH 1MY5A 1NKRA 3BFWA 3BVXA 1ZVSB 5JIPA 2W5PA 3C2AH 4ADIA 1AXIB 4MQSB 4L4TA 1ASQA 4MRBA 1NBZA 5EIIG 3DURB 5ANME 4JL1A 1S7RB 4DERA 4YMPA 4G6MH 5C2UB 1JZ5A 1TUPA 3PIQB 2HMID 3ECWA 1UB5A 1FORL 3TPKA 4IK6A 2TAAA 4H40A 2YFNA 1TLKA 4FYTA 4Z7WB 1PZCA 4M5YH 4GXFA 4JANB 1R3JB 2XWBA 4FFWD 5LBVA 4B5EA 3WHE1 1WG3A 1PX8A 5CR1A 3GTTA 2WN3A 4WI0B 4QXTB 1OSPH 2IMMA 2F7IA 4X9FA 2HFFB 5HHMD 3MLYL 4UV7L 4JRXA 5FHAH 1NQBA 4NXSA 2D0FA 3LN5A 3QUXC 2GTWA 1EFXA 5F7BA 5IQOA 1KBPA 3CUPA 2V17L 3FXIC 4ENED 5CHNB 5KYYA 1GGIL 1C5DB 3NZHH 3OZ9L 1GMEA 4I87A 2CO4A 1OF2A 1L9OA 1VEPA 3CFTA 3VQ2C 3LNFA 2ZNXA 3KL0A 2QDVA 4Q58C 2IAMD 3ZE0E 2ROXA 5BRZA 2W07A 1AO7B 1GGCH 4PB9L 1CXLA 3HAEG 4Z9KB 3ZDWA 1VGKB 2E56A 5IMLB 4RNRB 3CSPA 4UM8A 4W9IC 3PDOA 1PEWA 2DV6A 4MB4A 4NPYB 1RI8A 3A6CL 4YQXH 3RVVC 3FT1A 4KPHH 2CA3A 1YEGL 2R15A 3QISA 1W0WB 3GB7A 2YUWA 1BP3B 4M00A 2O5XL 3BD3A 4H2AA 2ORBH 2WAQA 3M17B 4KY2A 4OCMC 5D8JL 4CDGC 5I6OA 5TK4A 5L2JB 4OI9A 4CAGA 2I25N 5F1NA 4HUNB 2LU4A 2F9BT 3E7JA 4O9HH 3ML8A 4YPGB 1Z9PA 2ADFL 4CN6A 2OA9A 2HRPH 4LRNL 4XXWA 1KN4H 2VDKB 4GKZA 4X8CA 3EO9L 1OSZB 4IYKA 3DYPA 3QJRB 3UCQA 3DC0A 4JMXA 4PRIA 3OKMA 1U41A 2R56L 4RMUA 4JO4L 3N40P 3NPSC 4YHMH 4WW2C 4F57L 1E40A 3C6LC 3Q6GL 2JKSA 4UQ3B 5FECB 5HY9B 1OAZL 1UA3A 2UXGA 5AVXB 4A7UA 5JZ7C 1CDJA 1FL3B 1HVXA 2I07A 3OPUA 1EDYA 1M7IB 4FTVD 3S3BB 4FN0A 3BIKB 3FC8A 3NDZE 3WTXA 4L4VE 4FNTA 2Q8BH 4WWKA 3B3BA 5F6IC 5K93A 3KGTA 5CMAA 5IFHL 1OP4A 2A6IB 4NQCB 1UD8A 3RTQB 4JRLA 5I5IA 4XZUB 1DANT 1VFBB 3BISA 4YBLB 4A37A 4HUXA 3DRQA 3TYGL 3HG1E 4HUCA 4PJ7A 2XYCA 3V7AE 5CP7A 4N0UE 4W9FC 5CWSB 3GTVA 4Z3TA 3CZUB 1JGVL 1GW0A 3O3DA 1HAUA 3LIZA 5DJ8B 2W9EL 3VFNA 1AHMA 3MFFB 1RUPH 2VDRL 3P77A 4Z6AT 1FG2A 4Y4HD 2VLKE 4FERA 4DIXA 4HKJA 1ILSA 4ACTA 4OKVB 4PRPD 4N25A 4ONFL 4HFUH 3L45A 5IJDC 4WTQA 5I8KL 3QJOA 5AW6B 3N9GH 4FNUA 1HOEA 1CYWA 3TEYA 1BVLB 2BNUB 3CFJB 5EF1A 4HK3J 2PYED 4ZUTA 2ZJSL 2Q3AA 2FR4A 3OAZK 2IANE 4N3TA 3ARRA 1CK0H 3QULB 3C8HA 2XYBA 5EO0A 3RX5A 4QRRE 1NINA 3SJVE 2YGNA 2JKTM 4AVJA 4AC2A 3T65A 1D3CA 4RRPM 2W9EH 4KMLB 4U1LB 1UWEL 1T20B 5DRXA 3VWKB 5I66A 3P0YH 1SYVB 1CIDA 4I7ZC 1XDTT 3QZWG 4L8SC 4WRLA 2DEYX 1NCOA 5BW7A 4U1MB 1BVNP 4YN3A 3BEVA 3GBMH 3DSFL 1AP2B 2FJFA 4H8WC 4NFDA 4UILH 3KYOB 1G7QA 4KKLD 3GYRA 3ZIMA 4RAHA 2V8MA 1DEEA 3ZKSD 2IH1A 3BH9A 3BKYL 3H1ZA 1LMIA 2DWDA 2WM0A 3MRGB 1B9ZA 4FQ1L 3MYZA 3MJ7B 3HBGA 5IQMA 2ITDA 1MUJB 2OL3B 5SX5K 1QLEL 4HV8B 3MLZH 4MJ6B 3L3DB 5SX4I 3RWJA 4OF0A 1RZ8B 4EN3B 2YD8A 5GRJH 1R33A 2UYLA 2OMVB 3DGGB 3Q2WA 1SRDA 2PYFA 6FABH 2ARWA 3LRHA 3O0RL 4RZKA 1KT2B 2X4TA 4DEPB 3U4BH 4JG1H 5CEZD 3FF7A 4OV5A 3FRUB 1RCYA 1IGFH 2Z0BA 2Y1YA 5KN5A 3QP3A 3K1DA 1YEIH 5HHXL 1JZ7A 5T33L 3B2XA 4G6FD 1NUNB 2GEQA 3A47A 4GRLA 4NUMA 2X2YA 1GZQA 2ZX8A 3NGBB 3LIZL 4JN1H 1J48A 4WWPA 1NAMA 1VEMA 3GSOB 3O9WD 1NFKA 3D87B 3T1FA 4NQCE 2MCG1 5F8QC 3VH8A 5CINL 4C83B 5F3HA 3FO1B 4A38A 4PV8A 1TJGH 4G82A 3VXOA 1KYOJ 3QFJE 3ECBA 4YO0A 1WQVT 2ESVE 5A2FA 3I6LE 5DRWA 5BZWB 3FTGA 4G7VH 5GGUB 3WU1A 1D5ZA 5AG9A 1JFQH 4LPWA 4QRQA 3QORB 1CB4A 1F02I 1VACA 4LOUD 5KYXB 4DOHE 4HU2A 4OCXH 1MW2A 2X7LB 4G8GE 3P9MB 5HI5D 5TH2A 4PPTA 1Y7VA 2KLRA 2VOTA 3G5VA 3P4OA 2NUTB 1OAKL 1NDTA 2WQWA 4KUCD 4OCLC 4X80H 5E9NA 1HEZA 3D33A 1OP9A 4PTTB 5FA3A 3KPLA 1HHKA 5DJ6B 3DXAD 5CEYB 3S35H 2RQ8A 4CGTA 2VR5A 2DQCL 5CLWA 1CIUA 3L9BA 2V3FA 4MB5A 4QO1A 1ADQA 1YMHA 3NA9H 3JWDL 5DYFA 2RALA 3CGTA 3L6FA 1ROWA 3HNVL 5DHDA 1BQHG 3IGFA 5FCUL 2PWFA 4UAOC 5H94A 4FQCL 4QIRA 5I8CB 1KWKA 4ANUA 2H1PH 2ZUQB 3U0PA 3OKNA 2EIZB 5KVGE 4Q9RH 1EH9A 1OTTD 4OF5A 3KPNB 1M05B 5ALCL 3VXSA 5LO7A 1NCBH 3ECVA 2WBJA 4IBVA 1CMOA 4NUGH 4AQ1B 1XCQB 1K6QH 4E9XA 3REWA 1UJ3B 5ERWB 2IGTA 2D2CC 4GQPH 1ACYH 4AYSA 2CA4A 5E4IA 4QRPE 4X6DB 1AD0A 2BRRL 4TUJA 4HS8H 4I0CC 4I3SH 4I88A 4J28A 2AV7A 4P2QA 5MENE 3ESVF 3UEQA 3CHQA 4MFHA 1H6UA 2Q86B 2E7LC 2YD9A 4DZBA 3DX1A 2X2IA 3RVWC 2X4QA 2I85A 3KYNA 3V0FA 1R5WB 5I16B 2YPVL 1EAPA 5EC2A 1KJ2L 3IDNA 5J13B 5CSGA 2P8MB 3A6BL 1RP9A 5F96L 3Q44A 2ZXQA 3PWNA 1OXYA 4OCYH 4UIMA 4C4KO 2GSIB 3OKOB 4U1NA 4HJTA 1T6VN 4DKFL 2F2HA 3QI9A 3QDGA 3O4OC 1E5AA 1OCWH 2W9LA 4P2CG 3ZKMD 1IGMH 5BV7L 1SXAA 1J9SA 4M8QA 3OPZH 4GUCA 2Q7YB 4XWOC 1WA2X 1X6LA 5CU5A 1UM5H 2FO4B 2E7BA 4GP4B 1FPTH 1MVFA 4R97B 2WXPA 3GGWB 2APWA 1ZLSL 5D5ME 3FBKA 4OVUA 5SWSB 5E6RB 3GHPA 5HDWA 2QADD 3CHSA 1WWWX 5L8LB 3GMOB 2EDMA 1A3ZA 1BMGA 1NC2B 4K5PA 4XC3H 4JX0A 4D0CA 3HC3H 2X6BA 5GGQH 1WZLA 2EVHA 5C1MB 5GISL 4AH2A 4ZOBA 1INEL 3TF4A 4Z7QF 3OKKA 1KCSL 1XF4A 1QPXA 4RA3A 2CM6A 1B4JH 1XF1A 1CE6B 4YLBA 4ALAC 5I30L 1BPLB 2EQDA 1V7NH 3AXLB 5DVKA 1WBXB 4N6QA 3SZKC 1DVUA 1BZDA 1H5BA 1NDMA 1E27B 3KM2A 5KBMA 4A2GA 1T04A 1IAKA 3KHQA 3H2QA 1NFDF 5C0BD 3QUYA 4XMTA 4XMKH 4HWBA 3G08A 5ID0B 4P4KC 1A6ZB 1QHPA 2EJ1A 2VKWA 2J1ZA 1HSAB 1TETH 2FQDA 4AENB 1Q1JH 5ESQB 5HDQH 1Z32X 1A1NA 4R90L 1UT1A 1MH5A 2C4XA 1AS7A 1OL0A 2XV2A 4K73A 3L3JB 1W16A 4PJDE 1RPQA 2AXGA 5DMJB 5I9QC 3QYNA 5DZVA 5GGVH 1UEMA 4KKQA 1RK0B 4TUUA 1R3IH 3KWWB 2NY5C 1KYOK 4X5XB 3ZN6A 1T89C 5FAAA 1E42A 1WFOA 1WA1X 3VFTA 3ZL4H 3WY1A 1KLGB 3PJLA 3A67H 4IHOB 1MWAL 2ZPKL 1V3JA 4W81A 1BEYL 3O81A 1JTPA 1KYUA 3QJXA 5IHUH 1XR8B 4N3UA 5GRUL 4LPTA 4C4KT 4YHNA 5K1JA 1XD0A 5F9WC 3WDIA 5IOKA 5EEYA 4MZ2A 4K94H 2P4AB 4PUBH 4LIQL 3GSWA 1WBYB 3FTZA 3PWPB 4FTVB 3VDBA 1OEZW 3AUWB 4OF6A 1JXJA 3F2LA 4ZQTA 1XHHA 2V5SA 3ZE2B 2GCYB 1FVDA 1MWAB 3C60B 2AZUA 1OLLA 2G2NA 1AG6A 3IDMB 4IRJC 1QUNA 1WZMA 5F7EL 2XN2A 1KZQA 4ZYKB 4PJIE 4UTBA 3F7KA 3IMVA 1DFXA 1ORQA 4ZOCA 3UROR 1KPUA 5FWQA 1OKEA 4KJYB 2V37A 1SZNA 4AQ8A 4NN5B 4EI5A 4TNWK 5CEXA 4G6KL 2O1AA 5F1IB 5DJCA 3P54A 4DJMA 4NKIH 2J55A 1IUZA 1RVFH 1V27A 3FFOA 2DYPD 3IDMA 3SQRA 4UDUB 1CZ8L 1UYWH 1W8NA 5EORL 1H8OA 5D72L 1P6AB 3CH1A 2LLLA 1LE9A 1OP5K 5D55A 1K85A 3NIDB 3HBPA 2VLRD 4AIEA 3UMNA 3HI5L 2NTSP 1JHTA 3WO4C 5I73B 4RAUB 5GRJL 1URLA 4FG4A 2UZYB 3CLFL 5GS0H 3LH9A 3V6FB 5IROD 2FUQA 1T6WA 1GGBH 3HKZA 1NANI 2DRUA 2E86A 4GAYA 4ADJA 1QW9A 1QPPA 3EFFB 3S5LG 3ZO9A 4JO3L 2APSA 3SPVB 2X40A 3CVIL 4YHPB 4L37B 5D7LB 1UM6L 4OF3A 4BK5C 4W9ZA 1KLUB 4GAYB 4NQVA 4BSJA 4FQ1H 4Q74A 5HGBB 4DP5X 4ENEC 3REVB 12E8H 1MRDH 4NAJA 4JKMA 1YSOA 4JQVA 4M7JL 5BZXA 3UAAA 4LPVA 1J1XL 5FKPB 3RRQA 1WS7A 4LHUD 1RZGB 5EZLA 1ECYA 1T7ZA 3ZDXE 1JHTB 2XACC 3KBEA 5SV4A 5PAZA 1ZDSA 1IAOB 1MLBB 1TR7A 3T04D 1OGAA 4F7EB 3G5WA 3G04B 1YA5A 1U36A 2ZXGA 4NSKB 3U9PH 5GS1A 1F41A 3EGDA 3OKLB 4WCYL 1LO4H 4JY5H 5JORA 1C5CL 3SDYH 2VITB 5CZVL 1UQSA 4HFUL 4X0KA 3T4AA 3QORC 2UXFA 3DXAA 3BRGC 1G6RH 3PG2A 4LCIL 5D6DA 2YAPA 1XAUA 4JPIA 4YDKH 2CXGA 1QSVA 1MCPH 1YYLL 3NA4A 1FVDB 1JNNL 1MWAA 1RK7A 2C34A 2VLRE 2QKIC 4Y2DD 1ZK9A 4PJFF 4UOQA 3WJMA 1IAIM 3HZYA 4P23A 5EFIB 5IHZB 2GABA 2HJLB 2EYTB 4HXAL 3RILA 2E75C 1MREH 3CPLA 4XCEA 1B88A 2V7NB 4I0PD 2A0LD 3IEAA 3MZTA 1T21A 2IAMB 2AGJH 3VD4A 4WKXA 2AW2A 4WFGD 3D4YA 4NXKA 4HZ1A 3O9WA 4JDTH 1X9RA 5E8DL 5IT2H 4CMHB 1TO4A 1AO7E 4JZNA 1LWJA 3RAJH 2W91A 3QCTL 1F3JA 4Z0BL 1FE8H 1ZSDB 2JV6A 3QG7L 1XGYL 1O5PA 4UIKH 5FB8B 4MJIE 3MV9B 2DDQL 4I4WA 1MAMH 4RFNC 5E0QA 5F7MC 2EZ0C 3UTTE 2AQ3A 4NO0A 1A21A 4R8WH 3T8XA 2IDUA 4WU7A 4ZOAA 1A4BA 2CKBL 4NB7A 4HEMA 4QHUB 4AK2A 1VKXA 3VA6A 4PJFE 4H8UA 2WXJA 5B4MC 4YHZH 2GSIA 1YEDA 1BJ8A 2ADYA 2WINB 2YSTA 2DLFL 3RJDA 5ID0A 4N2MA 5H2BA 4F92B 3TN0A 2ATKB 2H1XA 3KPPA 3QNYA 1XH0A 5INDA 2P8MA 3DX8B 4P5TD 2X9ZA 1OK8A 5CNHA 5D7IB 5J9PA 1TEFA 2CR6A 1BQSA 1BWWA 1R5WA 5F88A 5I16A 1SM3H 3NIFF 3NCJL 3ARTA 4HPOL 3V4VH 3ISYA 1JTTA 2CBOA 2QGEA 3F7LA 4AUYA 4BQ9A 5L88L 2PW2B 4L4VB 5AKRA 2DQJH 4HAKA 4LFHD 2WLLB 4Q4EA 5H2BB 3WFBH 3OAWA 2WXMA 3EHBB 3VDAA 3FSOA 5ERWA 4G80A 1YEDB 1KGYE 2X87A 4DP1X 4LHQB 4PS4H 4N8UA 4PLJC 1FAKT 4RGNB 3TO4B 1H6TA 3B9EA 4ZO8A 2ENQA 5EOCL 1XSIA 3T6ZA 7CGTA 2XFGB 3S2CA 1UOWA 2EXWD 2FDBP 3HKFA 2QQNH 3J07A 4XAWH 5EIIA 3GRGA 2G5BB 2PWHA 1LK3L 1SVBA 1KJ2B 3V10A 3L6FB 4AYDC 1F3JB 5IREA 4XWGL 5TE7H 4XAKD 2OR9L 1CFBA 2JKIS 2YA2A 4NBXB 1ESOA 5C0CE 3S97C 1P9MC 4AUJA 4BFBD 1HHKB 2BCKA 4HPHA 2WKGA 4GBXC 4AX3A 2VSKB 4QHMA 4AGMA 5I1EL 2DL9A 4B60A 1TNMA 5TH2B 1TVBB 3K6DA 1N64L 2BWDA 3W38A 1JV5B 3IE9A 5EZJB 4YSOA 5IHZA 3CQPA 4QLWA 5EFIA 4Y4HA 5BZWA 4WW2B 4C4BA 2UY6A 3DVFA 5DK3A 5FYKU 1P1ZA 1Q0XH 2A83B 4HXBL 4JGNA 1DSFL 1NWPA 3CN3A 2Y7SA 1W8EA 3OWRA 5KVEE 3DYOA 3R4DA 4UINH 1XB3A 3L3HA 3LDBC 4OLYH 5JOFA 4EDWH 1UH3A 4M3KB 5I1LA 1LHZA 3I3BA 3NJNA 5JLZB 2AJUH 2DMBA 4P9MH 4FLQA 1SVZA 1YEKH 2APXA 4JVPA 1Y6NR 1MRCH 1UQSB 5F2FA 3GZQA 4YHYC 2IQAA 3P3UA 1YECL 3EGDB 3OKLA 5GS1B 2HCZX 1E3FA 4W6WB 4GG6E 4K2UH 1H3WM 4NENA 1SEQL 4R3SA 3U0PB 4E41D 3KWVA 4JFFB 5H94B 5EEVA 1DBBL 5JZ7D 2YKKA 2R4RH 3I50H 3QEUB 3T6QC 4JJ5B 3V0HA 4ORGA 4BKSC 1NCGA 2ZONA 2AK4E 2BNRE 1KN2H 2BC4B 2YAHA 4HUWB 2EO9A 1KCKA 1I8MB 4YHPA 5D7LA 2CM5A 3DUUA 3D30A 3HG3A 3PP3H 2FLMA 2BY0A 4ECNA 4KKZA 1IO4C 2YK1L 3K80A 3PPEA 3V6FA 3TTSA 1BREA 4Q6IB 1WISA 1WUZA 2BIOA 2R69A 1ES0A 1A9EB 2NLJB 3MJ9A 3QZLA 4Y2DB 1D5ZB 4ZX4A 3HB3B 4N5ED 1KLFA 4B9YA 4H88L 4Z5RB 4AM0B 1GW6A 3HTLX 5DRWB 4APQD 3I9AA 1LE9B 1D7CA 3CZKA 3C09C 4HJGA 4LCIH 3BAIA 3FT4A 3MXWH 2JQAA 4UDUA 1MJUH 4OD2A 3E8UH 3SO3B 4LQ1A 2FO1A 4XN8A 4PV8B 4PVMA 3TN0D 3HC4H 3EOYG 2R2HA 2CO7A 1H3TA 4HHGA 2B3IA 2VAJA 5JW4R 2FJFB 2XWTA 3BLKA 2A5UA 2XQYG 2ZOTA 2AERT 5AW9B 3CFKB 4JHAL 4EIZC 3K8LA 4OLYL 1NFIA 1G0YR 4PGEB 2D7OA 3SY6A 4TNFA 4PM1A 1C9SA 3U7AA 1TQSA 5KSUA 5D71H 1RFDL 5E56A 5JW5A 1I7UB 3GSWB 2AFNA 1YHPA 3BSZL 3CXHK 3DSNB 1VGEL 4RH4A 3JWDH 3V0IA 5JOPE 4XH2B 5KS9F 4M1DH 2X4TB 5HJ3A 3UZEA 4YLCA 3GBDA 1U2CA 4B3VA 3MBXH 3U0TA 4JO1L 2X44D 5BPPA 3SB3A 4G8GB 1HH9B 3VXUA 4Z7WF 1AAJA 2YLKA 3RURA 1I4FB 3SDXF 2VSMB 1E3XA 2XN9D 2LFGA 4LAQH 1DQLL 2WKOF 4AEIL 1T1ZA 3VWJC 3W39B 1XGTB 2BOCB 2IIJA 4PYGA 2O5YL 4BGDA 1L4IA 3CXDH 4XN1A 1KACB 1RV6X 4D9RE 3K74B 4ZMQA 1GGBL 1XF3A 4FG6C 1ZV2A 1IGJB 5DZNA 1TSHA 2ZSWA 3EHBD 3BVVA 1VFAA 1RZQA 3FUEA 1CDIA 5C0AB 4JFDD 5HXMA 3GIZL 1PX4A 5BS0D 1QFUL 2A6IA 2IH9A 3FB8B 4IDLA 3EO9H 1JZDC 5FM8A 3MLUH 4TNGA 1SYVA 1T04B 5B4MD 2F68X 2OTWB 3IPBA 5BO1L 5IUCA 1I1YA 1OGAD 4R4ND 2I07B 4L1SA 5HHOA 1QO3A 1SOQA 4OJDH 4ZFFA 4D8PA 4CVUA 1RUAH 3BPLB 1LK2A 1AOZA 2VR8A 4LAJH 1U8PA 5BJTA 2EEFA 2EVGA 2WTOA 3TT3H 3IKKA 1XIWA 2P42B 5DJYA 1GGUA 4S1DD 3ZZLA 2BSDA 4LSSL 1GC1C 5I5MA 2J2ZA 3DOSB 1VAHA 1U3HD 1R1CA 1I85A 4HEME 2EVIA 5T3ZD 3RL1A 1H3GA 2CIKA 1YLBB 5ADPH 5FLVA 4PD4J 1QBLL 2DIBA 4QMEA 4UI2A 1AZBA 4GG8B 4XMKL 1FL6A 2XKUA 2ATPA 3EADA 4EI5D 1N68A 3Q1EA 2LAAA 4UT6L 4RNRA 3ZMNA 4PWFA 3IU4L 1AO7A 2FBJL 5K9QI 4ZS6D 5ES4B 1JGEB 1NC4B 4GJTB 1MIEL 4Z7NE 2VZOA 1A6PA 4IU3B 4Z7OF 1L0QA 2XBDA 1EAPB 3N41F 1E4JA 2CR3A 4DP2X 2C3VA 1J9QA 5EULV 4BWWA 1QI5A 2RFXB 4F27A 2WJ7A 2IEPA 4HIJB 4HKBB 2AV7B 1KPRB 3ZR6A 5FECA 2FGWL 3PHQA 1UATA 4JRXB 3ARWA 3G6DL 5D7JC 4ZSOA 4DK5A 3WENA 1E30A 5JW4N 2V0AA 1PFCA 4RGMC 2HFFA 4WHYG 5JIKA 2XNAB 3WD5H 2NNAB 4CBPA 3VRIA 4PRIB 1MRFH 4LMQI 1FP5A 3ETBJ 1Z9SB 1JZ6A 1E67A 1LO3H 4TXVB 2AQPA 3LN4B 3UAJA 1IM3A 4Z7WA 4MQTB 1DSFH 4MDJB 3KPNA 3ROLB 1KG0B 4Q9BA 3D50A 2EIZA 2N0MA 3FO2B 2O30A 2VXVL 2OSLA 5L2JA 4M8UA 3BYTA 5HVHB 2OI9B 3G6DH 2JJSA 2EDYA 2B5IC 2EUWA 4R84A 2IFFH 4IS6A 1L9PA 3MKGA 3S37L 1KTJA 4GXUM 2OI9C 5L0QB 1GPOL 2Y1AA 1HEZB 4PTTA 4WHDA 4ZFOB 2NY6D 2BPBA 2NNAA 4HP5A 3ASWA 1FCCA 1JPSH 3VCLA 2E74C 5C0BA 4AYFA 4M48H 1HZLA 2PNDA 1ZJBA 4IEFA 2Y6SD 4N8VG 5KYXA 4N90D 4LBEA 4L2LA 4QRPD 3KXFD 1ORSA 1J9TA 3MLVL 5HTSA 2WSKA 4MHHI 4Z7UB 3PWPD 1U8KA 4P23D 5FC9A 3OC5A 4F1SA 1NLDL 4PJGB 5IB3B 4NX0A 4PEEA 25C8L 2J6WA 3OV6A 1P7QB 3ALPA 4PW3A 2AABL 1CZ8H 2IBGA 3ISWA 4YHOH 4QOKA 5C9KA 4N86A 5C97A 4N0CD 3ZUNC 5HHXH 4RBPH 1SN0A 1P53A 5L6YH 4LFHG 2XTJD 1DP0A 3GSOA 1WCQA 3E6HB 2ICWB 3N6YA 5DZOA 1AR1B 1H15A 4MDIA 1I1RA 3ZDXF 5ECGA 1UCBH 4ZMOA 1OQOA 1IRAY 5JNYB 4PCTA 4CVXB 4PJIA 3WIAA 6FABL 1RZKL 1TMQA 3RX9A 1PCXA 3PXJA 1UZ6E 4NS0A 4FEIA 5MEPA 4FNRA 4XXDB 2WLYA 3MCLH 3UADA 4ODUB 4C54A 4BZYA 2PWDA 1SFDA 2A4CA 1J1PL 2X1XR 4NO2B 5FLUA 3TO2A 5GZNA 2WMPA 1EEZB 5A6LA 4Q9RL 3F00A 5C0AD 4JFDB 4L1DA 3TH2T 4QT5A 3WKYA 5JTWA 4Y4FD 5B1CA 2Z7ZA 4YFLF 4FFZA 4M02A 3Q6FB 4AEIH 5BQ7A 2QPFA 2BCMA 4M4PA 3ETTA 4QOKE 1PLAA 1GTFA 4ZFFB 1LP9F 2E5EA 1GGIH 5LCVH 4OLVH 3ISRA 3HAEB 5B7MA 1MUJA 1S8DA 1B0WA 3AQDA 2E47A 3IN2A 4PBDA 4PTUB 4WEEA 5GS2H 3N5AA 1RURL 3S3SA 1GHFH 3IDJA 3UJTL 5GGTA 2Y1VA 3AAZA 4HJJL 2WLMA 2A99A 1RK1A 2J20A 4M6NH 4PJDA 4Y4FA 2QKIB 4GW4A 5EUOA 3KYOA 1TQWA 1DVXA 4BRJA 1B9KA 4MA3B 3VD5A 3S5LB 4CKVX 2DM4A 5J89A 2G2RA 5GPRA 4AEHL 2EIEA 2WBJD 1LMKA 2A1WL 5DRXB 1CCZA 2WJ5A 3NCYP 4GKOA 4PJ8B 3COOA 3HS0B 1TVHB 3T4AC 1LVEA 2O6PA 3ML9A 5JHDB 2Y24A 3GSVB 1XMWA 3O3EA 3R19A 4NUJB 1OP3H 1JWMA 1OV8A 1INEH 2QZ5A 3MUY1 4F8TA 1DSYA 1JZHA 3AWEA 5E6IB 2WUBL 4KKCC 1GSKA 3MNVB 2WOYA 4LLUB 1AY1L 2ICEB 1MCWW 3IJYB 3UTZB 4P5TC 4WUKH 5BUPA 4IRJD 2NYKA 1UXLA 2CE6A 2TSAA 4GSUA 4TL5A 4QOKD 4XCNA 3NJXA 4XT1C 2F54E 4ZSOE 5EEZA 3DSNA 1BD2B 4MGXA 1FN4A 5IESL 5A16B 4P2OA 5D5MA 2CUAA 2W1NA 2FEDC 5DLMH 2AEWA 4JFEB 1GRWA 1UVQA 4DK3A 1BJ1H 1AGDA 2YXMA 3SE4A 2MOQA 3CFIC 4ZMTA 5B7FA 4OCRH 3IXAA 4MZ3A 3RDTA 1Z0MA 1QBMH 4J3UA 5EF0A 1S7XA 5D1ZD 2NY7H 1A7QL 3FPXA 4WSJA 1G0XA 5DMKA 1KTCA 3QDGE 4LCCA 1GVIA 3WFEH 3TVMA 5F9JA 3OR6B 3ABZA 1E28B 5DJDA 3B56A 3ATBA 3QUYD 1OAZH 4P4RA 3R06B 1BG1A 4GMTL 1N0LA 4JY4A 4WWKB 3B9KA 1A14H 2ROYA 4ZS6C 1IVTA 1M7IA 4M1GH 4PJIF 3IVKA 3D8MA 2DQGL 4MBOA 4PJBA 1WFJA 5EH1A 1UXSB 4FQXC 4MWFB 1A9EA 4XPGH 3WL9A 4R7LA 4XP6L 5FYLE 4LLYA 3V0VA 4KNTA 4POZC 5HY9A 3V55A 2JKWA 4E9RA 2OTPA 1KTDB 3MKKA 1HHGB 3N9GL 4YFEA 4HPOH 5KVDH 3N40F 4PD4K 3MMEA 5MENA 3FUFA 4EOWL 4YS4A 1A9BA 4YK4B 4EUPG 4JPKL 2Y4SA 1GOGA 1HIML 3RNQA 4N0RA 4UTBL 2HG5B 4ORGB 5MERB 3QEUA 2DZEA 1HJCA 4EDXA 2WQSA 3PWLA 4QXUL 1EZSA 4BIKA 1URIA 5AZ2H 3CG8A 4O4YL 3KNBB 2VDLL 2PMZA 1RZFL 3U4EB 2MCPH 3CU1A 3QI9D 2VR4A 5CXPA 3JXAA 4IJTA 3WKNA 5J13C 2QLYA 2BVQA 2PO6C 4KK9C 3P3TA 4YHOL 5ECJE 1YYML 5HJGA 1AXTL 1TDQA 5IBUG 3RPKA 1L9MA 3SSGA 3BUTA 3EYQC 3ZE0F 1MCNA 3D85A 4B9GA 3V79C 5EEWA 5C0IA 3LCYA 2YQBA 4PJXF 4N2HA 1BQ5A 3OAYH 3RWHB 1YEJL 3D34A 4QY8A 3O4OB 4QXWA 4XP4H 1WP6A 2HAZA 4OLZH 1ZT7A 3BLBA 3EIFA 3V95A 2YPLA 3H3KA 2QZQA 4ZTPH 4PRAA 5F7UA 5KYUB 1FVCA 3T0VA 3K3QA 1C5BH 1VFMA 3VG0H 2ESVA 4MVBD 1XIWD 1CDUA 2L7EA 2R23B 3LD8B 2PYEA 3U2SB 1KCLA 2P52A 1LP9E 3V0WL 4Y19B 1HYSD 2A74A 3BZ4B 1D5XB 2F8IA 1DYZA 4XO4A 5AZUA 2ZG3A 3FQUA 4FMVA 1AGCA 2FZ3A 3NJMA 3Q5YA 4KXBA 3BAWA 4HBCH 3KPSB 5FYKL 1H3XA 5JHLH 3CDFA 3CSGA 2WQ8A 3U25A 5I9QB 4NKDB 4K07A 4ZPTA 4ZAKC 2NY1B 2KZKA 3C9NB 4L4TB 2VXSL 3S36X 1HTYA 5F7WC 4R5VA 1K8IB 5L9DL 5BS0A 1PDKB 3M8OH 5HI4D 4ZTPL 5SWZE 3SKOA 4KZCA 1E4KA 1H0DA 3VFVA 2BP5M 2NMSA 1T83C 4AGNA 2WZ5A 1YEGH 1WTLA 4KVCL 2DEXX 4M5SA 4JPWH 4OT1L 5AAMA 3VFUB 2XZCL 1UM6H 5IW1B 2ZOKA 3GINA 3TH4T 3SGJC 4QYOA 1PLCA 1AKJB 1ZK5A 2K45A 4WVRA 4ZTOH 4K5NA 5HHME 3QNXA 1TJMA 2K3HA 1T0OA 5D2NA 3MUJA 5FV1L 4LCYA 2XN9A 3QNZB 5D2NC 5BVPL 3NN8A 4WFFE 3UGEA 3U4AA 2K4WA 5KSVB 3TN0B 4HXAH 3MBED 5AUMA 1E4HA 2WZ6A 4PRID 1BYOA 1M71A 1H6EA 1RHFA 1HZKA 3II1A 3OMNB 2X3BA 1C8QA 1FCGA 4N0YH 3QH3A 3RNKB 3RKDC 3WLWD 3M6DA 2VDQL 5ALBL 2A9MH 1VA9A 3LZPA 4YL9A 3T8XB 5LGHL 2AP2A 1T1XB 1QZ1A 3DETD 4OGAD 3H0TB 1BFVH 3NP4A 3NACH 1R24A 5TDPA 2CK2A 2ZYSA 4MNHB 4LGRB 1PSKH 1GJIA 4KRPB 3DJTA 4L8BA 3MRNA 2XQ0A 5FM5M 4EMZA 4Z7NB 5KJRL 2W92A 3VI4B 2IAMA 2WCPA 5C0CD 1XH3A 1JDDA 1I3VA 2P24B 1KIRA 5DVNA 3ZVVA 2X4RA 5JDSA 5I6LA 3KW8A 5ICYB 5E03A 1BAFL 1LEKB 4JAMB 4ZRGA 2A4ZA 2HJLA 3RA7H 4NP4L 3TJHD 4XRCA 1JVLA 5J5EA 5BOJA 4MMZB 3R7RA 1W0VA 2AQNA 5C92A 4CN4A 1U58A 1F3DH 1EAJA 5TGBB 3DVGB 5DTFA 1T22B 1ZA6A 4X6CF 5D7KE 2E4TA 1ADQL 4NZUL 4KTGA 5IB2B 3ES6A 1HXYB 2Y36H 3D39E 1BYPA 3CCHB 3N0AA 2EIMB 2ICWI 2QPEB 2WBWB 3IGAA 3MUZ1 9CGTA 3MX0B 1IT9L 4ZTEA 1LD9A 1WWCA 2V9RA 3GQFA 5DUBA 1E6OH 1HL8A 2DWTA 2OMWA 4LPUA 2B1OA 1MCKA 1A0QL 3CDGB 4PRHE 4X0KB 1D5BB 3CX2A 4E9LA 1ASPA 1ZS8A 1LLAA 4KRPC 5F89B 2DY2A 2GTZA 1FZKB 1CFQB 3RWEB 4AC4A 5C0CA 3EJTA 1EEUA 4KUZL 1HSBB 4DUXA 1HINH 4FA7B 1FYHB 1L9TA 1NCIA 4NPKA 1CGSH 1KB5B 3KDPB 3GNMH 3WY2A 5LGJB 3I75A 5FKPA 4OFKA 4LSSH 3W56A 5DDHB 5E8EB 1PYWA 1IT9H 3ZQWA 3P4MB 2VN7A 3RZWA 1M9SA 2HKFH 3TBWB 1I8IB 5I24A 1BPVA 2I60L 4L37A 4JM2D 5HPMA 2WLHA 4HJ1A 4LIQE 2ZP8A 1VADA 5D72H 2IAMC 1S3KH 3TEXA 4NNYB 5DFTA 3X1FA 4OZIE 1ZIAA 3ZUCA 2UVEA 2VO5A 4X4MA 2IPKB 5F7DB 4NM8H 3QXAB 3JTSB 1S9WB 3C75A 3HOGA 1X5LA 3AS2A 3GLEA 3QWRA 4I0PB 4PFEA 5GHWH 2COVD 4KQ4H 2OMNA 4ZPVB 2ED7A 1ZXKA 3LS4L 5MI0C 2Y2YA 3N85H 2VW7A 4QYAA 1SUHA 1OTUC 4KK6C 1N5AA 4XP9H 2PCFA 4FDWA 4KJYA 5J56B 4MMYA 2VAAB 2NR6A 1V3KA 4A63A 3TEUA 3RIFK 3WUWG 4J8RB 4EIGB 2GAZA 3AACA 3GK8L 4HKZA 5D7SH 4XVTL 5CP3H 4CJ0A 3HLAA 4KFMA 4YL4A 1TETL 4Q9QH 2ALAA 2H2SD 4FTVA 1HKLH 2Q7NA 3NJVA 3QDMD 4HJIA 4AL8C 1XR9A 4HISA 5C0NC 1QKZH 2HYMA 1OO2A 3V4VB 4BKLB 1NLDH 4G8FB 2XZZA 4L3EA 3TBSA 4UQ9A 5I8EB 1OB1A 1E5YA 2DQUH 1R3IL 2F1AA 3MLYH 1EIBA 3FO9B 4RGOL 3WXVL 2BSBA 4PB0L 3C5JB 4X6BA 2IG2L 3ETSA 3BZ5A 1CLCA 4CDHA 3VRJA 2BOBA 1KJMB 1OGTA 5DD1H 3NTCH 1A7OH 3LQZB 1QRNE 3PWJA 1KDJA 5C71A 1ZLVH 4Q9CA 1L5GA 3X1BA 3OX8A 4G6AC 2KLTA 1ILUA 3W9EB 1D2OA 4YX2H 1LILA 4ZZKA 5KS9E 3RIFF 1XH2A 3A4FA 4DQOL 4J1UA 3WFHA 5LWYH 1SDAB 2AXGB 2O72A 3C5JA 3VFMA 4DPRA 1CBJA 3T77B 2B3RA 3DX6A 1NCCH 1YEWA 3GRBA 1EXUA 1PX3A 3V5KB 1OAYL 3IM1A 1AFVH 4OD3H 5IKCA 4K3DH 4PCKA 2WIIB 4LKXB 4CADA 1SHWA 1CVSC 3BPCA 4AIXA 5D4IA 4PMEA 5FW8A 1BFVL 3BVNB 5E1HB 3QZWB 3JWNC 4G8EA 4ABUA 4FQ2L 1SF5A 4HH8A 4LBAA 1IQDA 1OGAE 2DQIH 3CLEL 4Z7OB 4XPAH 4E5XG 1AR1C 3FO0H 4XX1E 4OFVA 5GSRA 2BFGA 3RB7A 4N0YL 4Y9FA 4FG2A 2WQUA 4QRFA 4G7VL 2QELA 4D0CB 1XO8A 2AJXL 2H3NB 2XG4B 3O0LA 2LW3A 1JNLL 4N4YB 4R4FL 4UV4H 1PZUB 3LRSB 5LBSL 4QRUB 4P0DA 4PQXA 4DT2A 4G7YH 4HAGA 3I9GH 3KAAA 5CCKL 4JZOA 3BZFB 4QTHA 2G5RA 2WSPA 1B90A 4Z1PA 3O3AB 4PIRF 4NNYA 1O6SA 4JFWA 2NY2D 5F9DC 5CN1A 4AKQA 3CTTA 4FADA 2J5WA 1B0GB 3CBJB 2CHNA 4LP4A 4PG2A 4L1BA 4Z7QE 2BVTA 5IVXA 3WEXB 1KXQA 3TX4A 1CO1A 2D3LA 1QI3A 1Y1DA 1UGKA 3DETC 1A25A 3MNWB 1ZE3C 4L5FE 2A9AA