1XAKA

Structure of the sars-coronavirus orf7a accessory protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
CELYHYQECVRGTTVILKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and intracellular targeting of the SARS-coronavirus Orf7a accessory protein.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords SARS ORF7A ACCESSORY PROTEIN
total genus 12
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1550 Mainly Beta Sandwich Immunoglobulin-like SARS coronavirus X4 1xakA00
1YO4A 1XAKA
chains in the Genus database with same CATH superfamily
4V11A 4WFHE 1Z1WA 2VDPB 2HPTA 1Z5YD 3VM5A 5DVLA 5C07A 3WN6A 1RK0A 1YY9C 3QUYB 1RJLA 1WT5A 2GI7A 4AVIA 2P45B 1A7QL 3IKKA 3S4SG 4YHLL 3VH8G 1TVHB 5GRUL 1E8YA 1QFOA 2VJ0A 1KMGA 5K33A 4GP5B 5ALCL 1HHHB 1JGLH 4X6EB 5GGQH 4M1CC 3T04D 4LCIH 5E6SB 2BLFA 4OT1H 1IZKA 1DVFD 3FB5B 4I1NB 5C0BD 3T3PF 3OG6B 1RP9A 2XZQH 3IPEA 2C7FA 3W5MA 1EUUA 2LTQB 3X13A 3ZIYA 1QSEA 2YA1A 1UA7A 4XR8C 1BZ8A 1BBJB 1IVLA 1JHTA 5IBLC 5BJTA 1I1YB 4LSSL 2Z4QA 4FQXD 3CBKB 4NCDA 1OAQH 4BK5A 4QRUA 3DXAD 3R8QA 4A2MA 2I9LA 3BUDA 1B3JA 5KTEL 1ZPUA 5D1QD 3TZVD 2E7CA 3PGDB 1BXAA 3CJJA 4EOWL 4GMSH 4PS7A 1AANA 3BUBA 3HC0A 3OZ9H 4L1TA 4JG1H 2P26A 2PYFB 2OCCB 5JHDD 1R3JA 1SXZA 5JORB 4MNGE 4JJOA 4NFBA 4IW4C 4PRPE 3SE8L 1KXHA 5JPNA 4N0FA 4B27A 2W81C 4M1CD 1R34A 4J27A 5IWLC 2YQBA 3OF6A 3HA0A 2J6EL 2ZYHA 1MFDH 4MA7L 3CPLA 4NQCE 3CCHB 1DHKA 5HYJB 5LGHH 3U46A 4LRNH 2FIKB 4NUPA 4ZS6D 4R26L 1LEIA 2XN9A 1PPIA 2JVUA 3HE7A 4HFWA 4KXZI 2EZ0C 4QF1A 2UX7A 4HC1H 3RAJH 2F8VA 1QFWI 1CCZA 1G7LB 5BNXD 3AFLA 2AP2A 5TQ2H 3SPVA 5FOBB 4G8IB 4PGCA 2R8SL 4TSAL 4ZQKA 5F9JA 4PJFA 4CDGC 3EJPA 3ZKMD 1U6AH 2FWOB 3EJYC 3A4FA 1XH3B 3QR0A 1NEZG 4WK4B 2Y06L 1T0MB 3QIBC 5FO7A 4S0HA 3BWAB 2QR0A 2R1XA 4M7KL 4DVRL 2D9CA 4I0KA 4B9KC 1JGVH 3D0LB 5CD5D 3H0TB 3VRJB 3AG3B 4NKDA 1U91A 3QEUB 1FL3A 1YUHA 4U6HB 1KCLA 1CUOA 1MVYA 4UQ2A 4S1RL 3V0DA 1NMAL 2ADFL 1NKRA 4GRLB 1NCHA 2IDSA 1P2CA 3QDJD 4G3YH 4TTGA 3D2UA 3ARED 3R0NA 2VGLM 2EDKA 3AGVA 3ERXA 5D1XB 5FGCB 1PX8A 3DJZA 1AH1A 2PTTA 2AJXL 5D8JL 2APVA 4X99A 1MIML 4RZKA 4X4XB 4BCXA 3CLFL 5DZLA 1O7DE 3KS0J 4F5CE 3VNYA 1G6RB 2DJSA 4NKQB 1CIUA 1TPXB 3VNZA 2A9BA 3GMOB 5FV2A 1JPFA 4O02L 5B3NA 4AI7A 2EADA 1F4XL 5D1QB 4DKFH 3D07A 1U8CB 1UXSA 4MHHG 4RMBA 3LRMA 3TBTB 4UNVA 2OJEA 1SM3L 2IOMA 1N67A 2TSAA 2XSKA 1HZHH 3L3KB 2K9FB 1VB9A 4YDKL 4FTVA 3U4BH 2WO4A 3FZUC 4BFOA 3VU2A 2IAMD 1BQUA 3U83A 7FABH 4JPVL 2AEPH 2XWBA 2WCSA 4OIIL 1D5IH 3T2QA 4M7KH 4N6RA 1ZXKA 4D94A 1QUPA 5DVPA 2I69A 4OLVH 2BSRB 4Q14A 4X6EA 4XP4L 3RL1A 1P7QD 3IRPX 4MMXA 4B3VA 2MKWA 1HH9A 1KXVA 1TO5A 2HN7B 2ZOKA 1U8MA 4OCXL 5FR3A 4WTZG 1CFVL 3GB7B 2L8AA 3E8UL 3HE7D 4PBXA 5GSVA 2V17H 4QI3A 4APQD 4ODXA 1L9OA 4LKXB 2MCPL 1RIHL 4HG4K 4F9PA 5CZXC 5LCVA 1A9BA 1MCCA 4FC3E 2A6JB 2BWIA 1QSEB 3QRLA 4P4KA 4FP8H 2XBDA 2IDFA 3QORA 3TO4D 1ID2A 2W07A 4S1DC 5D7JD 1OAYL 3ILQC 5LNDA 1DQTA 3IJHA 3WEXB 1CFTB 4YBQC 2ADYA 1I7RB 4M9OA 1WBXB 2CSPA 1E4JA 2B15A 5FO9B 3BVTA 3IT8D 4F3FA 2R27A 1OGAD 2AJSH 3PWVB 5EZJA 1NDMA 5HDBB 2ZP9A 3DGCR 4BFEA 4UZGA 5LXGH 1YJDH 1KIQA 4JY4A 1KPRA 2E47A 4YWGL 2DDQH 4ZUUA 4JL2A 1QLFA 4OD1L 5F6IC 7FABL 2E7LC 1INQA 5EEVA 4KOCA 1LJMA 3MLZH 3GT6A 5EU4B 2OMVB 4WFFE 3SPIA 5HHVH 4S1SL 4N2LA 4UQ9A 2BWDA 4PJIE 2WIIA 4O5LL 3ZMRA 1YMME 3VGHA 3KPLA 5F7WC 1DO5A 1MW1A 1VAHA 2I07B 3HNTH 4X9GA 5JIHA 2UZPA 4CW1B 2BNQE 2UZIL 3NCCB 5FDWA 2FQFA 4JHZA 1J0ZA 2PABA 4MXVF 1NGXB 1MUJA 4J4PA 4PJEA 3VD9A 2C4XA 4TMPA 2O5YL 1IUZA 5F88B 1WA2X 3US0A 1H3VA 1Z9SA 3QDGB 3MSPA 5DT1L 3CDYA 3ZTJG 4HOZA 2Q7YA 3DC0A 1C08A 4FP8L 3QFDB 4PJ5B 1CDCA 1I7TA 1YPZA 2VZSA 3FXIC 4RMQA 3LN5A 4HUUB 4TTDC 1HFUA 4JO4H 4DJMA 3HPLA 3KGRA 3ZDXE 2EIKB 4PD4K 3JV6A 1NMBH 2DQUH 3KPSD 2D03L 3IN2A 3E3QE 1Z3RA 2Y7NA 3O3UN 3VXQA 5FUZH 2IDQA 5EOCJ 3QWRD 3RWFB 1OGAA 1QR1A 1YDPB 3TVMC 4G8FA 1MFCH 5IFJA 4BQ9A 1UFUA 4A6YB 2C7UB 3S8GB 4XWOD 5IB1B 1KBWA 3RG1C 4DP6X 3N41F 1ASOA 1GPOH 4GI9A 3TBVA 1YYLH 3HC4L 4IJ3C 1EZSA 3X1EA 5DDHA 3TO4A 2FGWL 3TBYA 4EIGB 2HTKC 3QUXA 1P9MC 2V4LA 1URLA 4OBRA 1WCQA 4HLZG 5D1QA 5B1CA 2PCFB 3VRIB 3UX9B 3TGXA 2H1LM 2OM5A 3FRPB 5BUGA 2N0KA 4QOKD 4Y2NA 4JLRA 3T8XB 3JSSA 3ARUA 2QPUA 2ICWI 5EEYA 4DUWA 5CLYA 3BDXA 4AKOA 5MERB 4PD4J 3O45B 4UINL 4JO3L 2A2QT 4BFRA 1FFQA 5E8EA 4PJCB 5SWZB 1TSHA 2B3RA 5CLXA 3SCMC 1QRND 1WZ1L 5GRUH 3O6FA 3NACL 1D5BB 1A4CA 4XCNA 1DBKH 5I8EB 2QVMA 4PJFF 3RFZB 4M9PA 2DEYX 2R59A 1JGLL 5HVHC 2VR3A 4Q6IA 3BT0A 2Y7OA 4LCYA 3K91A 2HJLB 3EH1A 2BNUA 3KDMB 5G4NA 1J1XL 4HH8A 3RWJA 5HVHB 4ZUTA 2OAAA 2XHNA 3DIFA 2ROXA 4FS0A 1I3VA 3MO1B 5AZ2H 2VC2B 1SXSA 3L6FA 3WEMA 1BOGA 1OZTG 2WXIA 4YXKH 3T6WA 2WD0A 1K3IA 4FFTA 1JTOA 3IWVA 1EA9C 3CUPA 4K3DH 2EDXA 1JK9B 2WP3T 2OSLA 4U1JA 4E41B 4UUJB 5DTFB 3BHBB 3SQOL 2J25A 1U2YA 4E5XA 2JB5H 1WBXA 5L4FA 3GSRA 2XYBA 1LD9A 2P52A 1FVDB 1IEBB 4LF3B 4LCUB 1XXFC 4KXAA 3VFUB 3WHE0 1PY9A 3F7QA 4HHGA 4Z7UF 5C8JB 5C97A 5IF0A 2HA1A 3IXTB 4YZFF 2FX7H 4U1LB 4DKEL 4LSUL 1AC0A 4OAWB 5HHOE 1BM7A 5EU5A 1FFPA 3DV6B 2EDJA 3L54A 4UMSA 1GAFL 4KI5F 1QRNB 2FZ3A 4DZBB 2ZD0A 1N7MH 1ZT4A 3IEAA 4H0GA 2UZYA 2Y6TE 1FQ9C 3V6ZB 5EC1A 1G1KA 2IANA 2JELH 4IRJD 4K7FA 4RISH 3BJLA 3EIFA 3JWNC 2JJTC 2WXGA 4ZMYA 1NAKL 3UTSE 3VMPA 3EYOA 5DUPL 3Q9QA 4NM4H 2RMNA 2YPLB 1U8QA 3O11A 4JCMA 5DEFB 1NMBL 3KVPA 5JHLL 3MMEA 1MCFA 2RACA 2Y6SC 1YEKL 1R17A 1FFNA 5C7XL 1A8JH 2E9BA 2X9WA 3HC3H 2QQLL 3EJZD 1OP3H 4HWEL 25C8H 5CLZA 3ZRSA 3B2UC 3BCDA 3AGWA 2HFFA 2NY4D 4X6BB 4BYHA 5FGSA 3PU7A 4PJ5E 1L9MA 3K80A 4YEFA 2BFVH 3PJSA 3LPWA 2ADGB 5L88H 3NEOA 2TRYA 4PJ7A 2HT2D 4AC4A 4YFEA 4RMWA 1A7NH 1TQCC 3JBG7 3P73B 4ZFFA 1AAJA 2YN3A 5FOJA 3UYRH 3VACA 5DI8A 1JPTL 1IKFL 4DKEH 4G5ZH 2YKLL 1EHKB 4JKNA 4HCFA 5F2FA 2DY2A 3I2CL 3MLRH 4GB9A 5JXEA 5CKGA 1A3QA 2YWZA 4NBZB 4HUCA 3I50H 4A6YH 2ZCLH 5JOPE 2W9LA 4WU5A 5D7IE 5D7IB 1IGMH 5ESVB 5I2IB 5F6IB 3OKLA 4Z7VB 5KSAB 4UBDD 4W9HC 1UJTA 1BQHG 3QIUA 1MFMA 1CU4H 1AR1B 5T33H 3ZSTA 4POUB 3ARGC 3S36X 4P4KC 4K23L 1ZV5A 2ATPA 2VZTA 2XN1A 3FRPA 1Y1UA 4G1EA 2F68X 2HT2C 4H20L 4X8JA 1MY7A 3KM2A 1CE6B 5GXBB 1O75A 1WISA 5E9DD 1LK3H 1QTPA 4UT9L 3HZMB 4PRNB 2Y23A 3VD5A 1HH9B 2HN7A 4CMHB 3CE1A 3L5JA 1LILA 3DTUB 1OE2A 2VQTA 4I2XB 4JANB 4CVZB 1AGDB 5K59F 3HJ0A 4Y2DD 3SJVD 3V4VA 2CRYA 1FSKC 2YPKB 1UM5H 1XD1A 1J0YA 3F64A 4PJBE 4AQ1A 4UM8B 1KGYE 4R4NC 1ZHBB 1BVKA 1U4FA 3KR3L 3UG3A 2Y36H 5DUBA 1ZA3B 4GBXD 4JPQA 3ZE1B 4GKNB 1MREL 2FX7L 3LKRA 2IH9A 2CKBL 4UTCA 4NUJB 1FG2A 2JCCA 4G3YL 3EH4B 4F8PA 2QPDB 5JYLA 4ZMQA 1Q38A 2VJXA 3Q3GB 3GGWA 1BSIA 4FFYH 4JE4B 1JYXA 1JGDB 1BIIA 3L95A 3CZEA 3QZNA 3RNKA 3RJQB 2FLRT 2EYTB 3HKFA 4YLBA 4AE0A 4D3CH 2ERJC 2VM3A 2X70A 2ZXQA 2NY2C 3NFSL 2F58L 1JYWA 4BFKA 4HIEA 5CEYB 4M6MH 2HJKB 4BQ6A 2UY7A 3MRRA 3C6LD 4APXA 2OL3A 2VDRL 1GXEA 1SUHA 4MNHB 4ODSL 2FYYB 1CK0L 1NIDA 1KBGH 2ZX9A 4XC1H 5HGAA 5TE7H 3I84A 2X0VA 1U3JA 4JFDB 3FCGA 1C5CL 3ELQA 5AZEH 4PB0H 3T3PB 2IG2H 3GIZL 1K6QH 5ITBL 5IJBC 3BPNB 2FQEA 4FFYA 1RUKH 4EBQL 1A8ZA 3H85A 1EANA 3C09B 4JAMA 2C9AA 1KCKA 3Q6FA 4GRMA 4KKLD 1OTSC 3GHEH 2H4EA 3MA9L 1KCRH 3LPFA 4Z7NF 1IBDA 3DGGB 3FTYA 2NX5E 4U3SA 5KJ4A 1G9EA 4B9YA 1ZEAH 2C3WA 4JKMA 2H2SD 3ULVF 2JJSA 2O5YH 5E9DE 32C2B 2WBWB 2RR3A 2BSCA 4N2AA 1ZIAA 1NGZA 2FJHB 4G6JH 1RZFH 2Q1EA 3Q44A 4LVHB 3CPUA 4IIZA 4Z3FA 3QDMA 4MJJA 1L7TH 3BVWA 2WTOA 3BKYL 4X80L 3ESNA 5DJCA 4FXLA 4JFFB 1AZUA 4GLRH 4ZFQA 4NO3A 3QJFA 1FFRA 2IMNA 4XNAA 1AG0A 1RUPH 4GI8A 3UMTA 3VFPA 5MEOA 3P73A 4OLZL 3T1FA 1XCTB 5B3JE 1YEGH 2C7UA 4X7SH 4KKPA 4F9PC 3DYOA 3SDDD 5DI8B 1OAUH 3HE6D 4WI6A 3STZA 4E5XG 3GEWB 3MV7B 3FQXA 1EEUA 5IP4A 3LEYH 1KLFB 3PF2A 4PGDA 1R3JB 5CD5C 1TYJA 3QFJE 2AQ2A 4H0IA 3VXNB 4XGZA 4MMYB 3FB7B 3PUCA 5DJ8B 3IMBA 4RESB 3OAUL 1MCJA 2BP3A 3VJ6B 3FQRB 1CXLA 4HIHA 1AHKA 4LVNC 4UTAL 3MLSH 2G60L 1H15B 4YPGB 5FB8B 1KBVA 2N7BA 2RQ8A 3LNGA 4L4JA 1NCTA 1FNGB 4L0ZA 3PP3K 4AQ8C 3C5SB 3EF4A 3GBNH 2IGFL 1QW8A 1A2YB 4U6YB 3ARBB 4QYAA 3V7MA 1AYRA 1OSZB 5JIKA 5DD1L 4G82A 3L5WB 4LPUA 3ULUL 3FQUB 2ICWA 3W37A 3ETBJ 5I8EA 2Y7LA 5CWSA 1G6RL 1A6UH 3WFDH 4UIMA 4CU8A 5GS1B 4X2UA 4NZTH 1DBBL 1T6VN 3EG9A 1Q1PA 1L5GA 2BIHA 1HQRA 2I5YL 3HE6C 4EN3B 1FNFA 1QBMH 4LBAA 3W57A 3MRBB 3VXSE 5I30H 5IR1A 2NX5D 3S8WA 3MKKA 1VRSA 4GLRI 4P2QE 3HZYA 2HG5A 1CZ8H 4CRPA 3MLXH 5ADOL 3GNMH 4MQTB 1NBVH 4Y1AD 1U91B 3FQTA 4KRLB 3D39D 3QFJA 2CA3A 4RWHA 1W8NA 2BY2A 4Z7VF 1CFNB 4JG0H 4MZ2A 1S9VB 2W0FA 3FTGB 1ZA6B 5EZLB 1ZE3H 4RRPA 4M48H 5JHLA 1WLHA 1FNSH 4X6CF 3O3AB 3BZEB 5DS8B 5HGDB 3TN0D 4WGWB 7PAZA 3B9KC 4N0YL 4PJIB 5ITBH 2HFEA 3RFRA 1AR1D 3CN0A 4YDJA 4BUQA 2VDML 1S3RA 3TIEB 4J3TA 1ADQA 3B37A 3CFDB 3JVGC 3MYJA 1MCPH 2EXYC 3PYCA 3MRKA 2AK4A 2O5NA 1NCWL 2X70B 3LHPL 2PPCA 3HRZB 3CHRA 3CFEA 3ABZA 3DX8A 3NGBB 1KCUL 4L4TB 4MLSA 5EU5B 5HJGA 3V6OC 5I0ZA 1YO4A 1U92A 3WMPA 4KJQD 2AAAA 3P2TA 4L9DA 4DZBA 1MJJB 3ZR6A 3QC6X 5D2LF 4KV5E 3BT2H 3CMOL 4ES9A 1FFOB 3ARZA 4LRIA 4MCYB 1C1EH 4PV9A 2GTZB 3ZL4L 4UQEA 3QG7H 5EZOH 3G5XB 5EWIL 1RZFL 3VXTB 4PWIA 1ILUA 1MHCA 4NHCL 3EFDL 3T2OA 4RISL 1F02I 4N2BA 1SRDA 4M1GL 4I3SL 2OI9B 3DGGA 4X4MA 2DWEB 4OZGE 3WCYA 4ORGA 1SVCP 2NLJA 1W0WA 3MGAA 4DPRA 3UAFA 4G7YL 2OR7A 3IMUA 3AXLA 5TH2A 3V6OA 3FSAA 5C71A 2AGJL 2XG5B 3ESPA 4MS8C 1GHFH 2E59A 3FYIB 4KZCA 4DIXA 3D39A 1Q0EA 4P2AA 1I9IL 3POHA 1WPCA 3B2VH 4MA3A 4LIQH 3P69A 2FT8A 4FQHA 1DQDL 3P9WB 1THAA 3OXSA 4FG6D 2BNRD 5EIVA 3LIZH 4HG4J 3GHBH 2YZ8A 2DTSA 1BVLB 4PJ9A 4XHQA 1QLEL 3ALPA 5D2NA 3EOBA 3WIHA 5FFGA 2B59A 4ERSL 1CO1A 2EILB 2XWEA 2GG1A 3OXRA 1G6VK 4ODUB 4J39A 2K6ZA 4U1HA 1A7RL 3HG2A 2XJLA 1N59A 3FO1B 2XWJA 3PABB 1U21A 1UZ8B 1EV2E 3C9NB 3IBOA 1KLUB 4OLWH 4NNXB 4BHUI 3QGVA 3LKQA 4OI8A 4HKJB 1MLBB 4L3CB 4CN6A 5E2JA 4GFXA 4GH7B 1IARB 1SEQL 4ONFH 1R5VB 4KKBD 1UCBL 1HHGB 1UB6A 5BO1H 4MCNA 3X14B 3NIDB 4F2MB 4JFXB 5BQ7B 1T4KA 1Y0LA 1P84K 1T1ZA 2X2JA 2EO7A 2L04A 1AXIB 3U0TA 2X4NA 3JWNG 2CM6A 1AD9A 1NCNA 3KXFD 2Q7NA 4HIIA 3C5JA 2O6FA 5J1TC 1NCUA 1S9YA 1IGIH 4LP8A 1TPXC 4CW1A 1HNYA 5FDWB 5DJDB 2XTJB 4IRJB 2CHDA 2VE6B 3GPEA 3TNNB 1MUJB 4HZLB 3OMIB 1UACL 4PJEB 3SSGA 3L5WA 3DOSB 43C9B 4N9GB 3QDHA 1HKFA 1K8IA 1LK3L 1XFPA 3D51A 4URKA 3HC3L 4H2CA 1FJ1A 5F1KC 4WCYL 3VGEA 2CIKA 2OTWA 4C54A 1J5CA 1JN6A 4PV8B 1KXVC 4L8DB 5CS7A 1DQVA 3GSVB 4ISVA 4L2LA 2VLKA 4KDTC 5DC2A 43CAB 4LSSH 5D7JA 4NPJA 1R3IH 2Y5EA 3SKOA 2GUYA 4DGIH 5IHUL 3L3OC 1UWEL 3AMKA 5AAPA 1AKJB 1V7ML 1LEGB 4PN6A 1HH6B 3UO8B 3ARXA 2JI1A 3MFFA 1HVXA 1E4WL 3SDYH 3O6ML 5IMLA 1T89C 4ZO8A 3TWCH 3B2PA 4ATTA 2YWYA 3ARQA 3V4PH 1AKJD 1CFSA 4F33B 3SKNB 2J55A 4AE1A 3LQAC 2R4SL 1YNTA 4U4IA 2J6EA 3MRDA 1PJWA 3O6KL 1PG7X 2G3NA 4JM0A 5FEBA 1NCCH 4XXCA 1BWWA 3FU9A 4LL4A 1AQDA 2IFGA 4D7PA 2R9HD 3EYVB 4FXGB 5I6OA 4L1LA 3CHXA 2LLNA 4LHQB 1BMWA 2FSEA 1UT9A 4KK6C 3OHXA 1FH5L 4NQSB 2A73B 3T8XA 3TT1H 3VI3F 4QTFA 1A3LL 1KIRB 2DMKA 2FT7A 3KPQB 4HF5H 1OF2B 4ZO9A 5MERA 4JFSA 5JW3H 2YUXA 3FO2B 5KSUA 5LG6A 4QOKB 4AH2B 3MRFA 4QJ3B 4E9TA 4PYGA 5CJOL 5G5DB 1AS6A 4IBVA 2XG4B 3KZ8A 5BZWA 4OGQC 1JMXA 1R19A 3ETSA 3MUUA 1UA3A 2D9QB 3IE9A 3QDAA 2P8MB 2R56H 5ADPL 2VSDA 1ZKAA 2A9DA 3T6VA 2XG5A 4XRCB 1WV7T 1NUFA 4PJDF 4AGQA 4G71B 3BYTA 4R84A 5BOPA 2Y36L 1RZGB 4Q4IA 1LO0H 5LN8A 5EUOE 2VIRB 1S6NA 3CVHH 2ZX8A 4HJ0D 4KQ3H 1MAML 1JV2B 3RI5F 1C7SA 1TEYA 4WHYG 4HOXA 1X5FA 4UYPA 2P42B 3LXCA 3UZVA 3FN3A 2FLBT 2DLEA 4CNIB 1WHOA 2Y1VA 4H88H 1MXDA 4DN4H 5FECB 1HILA 2HKFL 3PGCB 3BPOB 4PAZA 3RDJA 3FT9A 4HWZB 1YEGL 2ZUXA 4I77H 3ARDA 5F7YC 2B39A 3DV4A 1FGVH 1BF2A 2XWJB 3HS0B 3ASNB 1FVDA 1IEBA 4XNXL 1YY9D 1HCZA 2NW2A 4XMXA 1PY4A 5JQ6H 1SUJA 4ENEC 3ZVVA 5C0FB 2H1XA 1J9RA 1MLBA 1WA1X 2FATL 4NZRH 3HBGA 4TUKL 4LPTA 3D3VD 1OVZA 2ZOLA 2WXLA 1MFAH 1RZIA 1CXFA 3FU7A 2WYHA 4JPWL 1KTLB 3L08A 4AV5A 3DOHA 3FO0L 2GJZA 1F3DJ 1QFHA 3UTTA 1S7RB 5JA9A 2X4NB 1KB5L 4PLOB 1WWAX 2JQAA 3QXUA 1MVUA 4AIXA 2X42A 2ZYIA 3RILA 5GS3A 3GUTB 3QNZA 4X4YA 3C5JB 1BXUA 3OJ2C 2IGFH 2XZAH 4HETA 4MQXD 3NG5A 3MUGA 5DZVA 2L0DA 1HE8A 1DVYA 3BWUF 1OGAE 3LQAL 2YR3A 1D7FA 1TEGA 3LH2L 3RDTA 3WTSA 3MMEB 2BX5A 15C8L 1UB5A 3QHFH 4WI9A 3ZK0A 2QADC 3HUJF 4HX1B 4FQXC 5HHQB 3E9TA 3ZDZF 3LEVL 3U1SL 1Y6MR 3QEHB 1JN6B 3A4DA 4PV8A 4ZFZB 5D1QC 4FQJH 4DN4L 2B1OA 1T21B 5BRZB 1ZT1B 5FA3B 3VFVB 4EO5A 2NCMA 1TJMA 1AIFA 1CPUA 2AJUH 1F13A 1JTTA 3HG1D 4GRLC 3UC0L 4BFBD 2H6PB 4ZBJA 5HHPB 2N01B 1VGEH 2WQXA 4GBXA 5DMKA 3ZTNH 1SQMA 1MHEA 1U3NA 4L29B 4V1DB 3AT8A 1MRCH 4RAHA 4KY1H 1EZLA 4Y19E 1ED3B 1F11A 1LGVA 1VFMA 5E6ZA 4HS8L 1EBAA 3G04A 4X0KB 5EPMB 3CAFA 5C9JA 2APXA 2FUTA 3SOBL 4YX2L 3TBSB 5J6GA 3VFRB 1RULH 1A5FH 4RZCB 5IVXE 2LU5A 3EDEA 4JZNB 1HDMB 2QPFA 1A6WL 4OLUH 1YCSA 4P2OD 4RGNC 3P4LA 5AYTA 4MD0A 4PJAB 5DZAA 1Q0YL 2XOTA 5GZNA 4UTAH 4OW6A 3DXAE 3CZGA 3UIZA 1F56A 5FCUH 3MUY1 4R2GC 4J12A 1G94A 2WBJA 2ZJSH 2NW3B 4N86A 1EEZA 1JFHA 5IJVB 3G5XA 5FUOH 5IHHA 1TVDA 4N9OB 3OV6A 4B95C 2YD2A 2IGLA 5A40E 2IFFH 2AMUA 3IJYB 3N43B 2V2XA 1PF3A 1S78D 1YN7B 4WFGD 1RZKL 1C9SA 2VMJA 1IIIA 1TVHA 1QUNB 3EXJA 4FKHA 3VTMA 3P3SA 1MRDL 3SDXA 2EC9T 1HQ4A 1RIHH 2R0ZL 2XZZA 4N28A 1YYCA 1KWGA 2AXGB 3KG5A 3NTCL 4AKPA 1GSKA 1RCYA 1N6VA 1I75A 5BXFA 4OCSL 5GJTH 4WZ9A 2H3KA 2O61B 1AGCB 5D71H 3PP3H 4YHNA 3CFJB 3C60C 3V0EA 3EH2A 5IHBA 1Y18A 4PS8A 4WNSA 4NUMA 4PRHE 1ZHNB 3N43F 4FQCH 1B6UA 4P2OC 4PJXB 3WY2A 5AYQA 1AO7B 4HKZA 1NWPA 3J8F7 4Y4KC 2DBJA 2DWSA 4KXDA 5JPMC 4R2GD 5C0RL 4P3CH 4O02B 3MBWA 4GPVA 3MUHL 3PFUA 3UTPD 4CBZA 5IGXH 1JV5A 1AZNA 3PABA 1FGNL 2PO6A 5HDRA 3EDFA 1BIIB 4ZD3H 4MDIB 3BH8B 2ARJQ 4JY5L 1KPUB 4OZFG 2CZNA 2GB2A 1DUZA 4Y8AA 1CD8A 4JFFD 4RMUA 3ARDB 4MSWB 1HIMH 3C8KA 4F58H 3KD4A 1YECH 4NAQA 1A6TB 3FZUD 3HG1A 5E2TL 5E4AA 1NLBL 2J1XA 2GW5A 3L1FA 1D6VL 3ZGIA 3T4AB 3IGAB 4ONGH 2BS8A 3KJ6H 2ATKA 3AU1A 4ZTOH 1DTUA 3FSVA 4F91B 3NRFA 1A1NA 1GR7A 5HGHA 3ZL4H 2BH0A 2CO4A 2Y1ZA 3ZL1A 3FHQA 3RE0A 1DVSA 1G87A 3CFCH 5IBUG 2EDWA 3VX0A 3QK0A 5CP7A 3PUUA 1FNEA 2V9UA 2EKSA 1NCGA 4YDVB 3MLWH 4JHAL 4X4YB 4S0SD 5L2KE 3HUJB 3DOSA 43C9A 1J0IA 6PAZA 1FYTB 3K2MC 1I3GL 1HSBB 3BEVB 5CZVL 1H8SA 3WJMB 3LZRA 3FU3A 4NXSA 5E6ID 5IMMB 2X89A 4LLAA 3PDOB 3TO4C 2AQNA 2P8PB 2LLLA 4XNMA 2XQYG 4UF7C 5EEZA 1DANT 2WLMA 3RUGF 3MV8E 1E2WA 4AQAB 2KDGA 1NCBL 2ITCA 2XN9E 5A2KH 1TLKA 4DP9X 2OPCA 2GFBB 3VD0A 5TPWH 1B6DA 4KPHH 1AKJA 1I4FA 5FM5M 3ULVH 1FC2D 1VGKA 3LIZL 3F3HA 5DJCB 3UABA 3C5ZC 4CVWA 3DKHA 4GKZA 3VSQA 1OV8A 4ZXBA 1U30A 3FQ2A 4I4WB 4Z7UA 4CVUA 1JXDA 1F18A 2WANA 1BFVH 1NBZA 1ORQA 2DBLL 3C5ZB 3FB8A 4WQOA 5FYJD 3AS1A 2X2YA 3SKNA 4UYQA 1D6VH 2DWDB 5DFWH 2ORBL 3RGVC 4QRTB 3KWWA 5D5MB 4TUOB 2YOCA 5JTWA 1N26A 4KK8D 4J3OF 3LV3B 1HINL 1OM9A 1XH3A 1S7WA 3ESMA 3X11B 1AJ7L 1OP4A 2ZOWA 4Z7AA 5LCVH 2X4SA 3GMOA 4I0PD 3QQDB 1H5BB 2BFGA 1MPAL 1W6LA 5L2KA 2K3HA 5DJ8A 5HP5A 1QNIA 5I1IL 1OHZA 1CGSH 2MPVA 3KAAA 3SYOA 1RMFH 3DROB 1BIHA 1PFCA 2UWEE 1IGCH 4L9LA 1IGTB 4QHLA 1A6AB 1VFBB 2GITA 1HXYB 4HIQA 4PH8A 3AB0C 1IJNA 1EGJA 1ZVNA 4MWFA 5M94B 3D2UB 4F7TB 1LK2B 4AMXA 4CSZA 4LEXH 4Y5VC 2V2XB 1AS7A 1R4XA 2VB5A 3NRPA 3B5TA 3OKDA 1D9KB 1EDHA 3AQYA 4PRIE 4YSUA 1BECA 1WCBB 5T5FL 1FO0H 3RX7A 2ICWB 3U6RB 1CG9B 2BSRA 3NCFB 4TSAH 1TSRA 5J9PB 3TYGL 1JZIA 3ETBF 1KBKA 2FWLB 4FXKA 4K9JA 4AVJA 4Z0XB 4XRCA 2BFVL 3MRQB 4MB3A 4MZIA 5L88L 4CJ1A 2GJJA 2ZXBA 3U9WA 4XP6H 5GGRB 3WE6A 2Z34A 4YLQT 4D0DB 2ZKMX 2QHRL 4XXWC 3EJSA 4I0PC 3F7VA 2EH7L 3GSWB 4NIYE 3VA6A 4FTVB 4ZPTA 4G9DB 2HRPH 4TNFA 4HIXL 1UD6A 1CFVH 5CBEA 5LDSA 4FNQA 4LMQE 1Z32X 1CDJA 1LYQA 3MA7B 4HT1L 1CLOH 5FECA 5KJRH 2DQTL 3NSXA 5CMAA 3T0EB 4AZ8B 4U6TA 5EF3A 1RPUA 4KKLC 4N1EA 4MAYA 5GGTA 3L3GA 4W9DC 5SX5H 4B5ZA 3QZBA 4HDIA 4RLDA 1UATA 1P9MA 2EDDA 1H8LA 2WB1A 4IBYA 4QTIH 1R0AH 2VXUL 3ZYIA 1EAQA 1X5JA 1QP1A 3W11C 4AL8C 3HG4A 2GK2A 4WFFD 1DE4A 1WRFA 4ZUUB 4YK4C 1CXIA 3PG2A 4R97C 1BJ1H 1C5DA 3T9WA 1AGFB 1MHHA 3RGVB 5D96B 1YEEH 4RSVA 1V55B 1IB5A 1FAIL 3G6JA 5DVNA 5MP6H 4Z0BL 5J5EA 3FUEA 4WK2B 3LCYA 4MCYA 3BZ5A 1KUMA 1ODUA 5HGHB 1A3LH 4RSYA 1Y7VA 4F7PB 1Z0NA 3IJHB 3WEXA 4W9EC 4YFLI 4FOMA 4L3ED 4ZQKB 1KCVL 3G5VA 4JFQB 1NGXA 2ZCKL 2BJML 2C4FT 3GI9H 2YBGA 3MJ9H 4Y4KD 4N2MA 3VXMB 5MENE 1AC6A 2OMXA 4Z7NB 4X5RA 2X6UA 4ZO7A 2LFEA 1KTRL 4LE8A 4JG1L 4XZUB 5T5NF 3G7TA 1QX1A 3BAEH 1N64L 4Y4HD 5GGUA 3NIGE 1OP3K 5CGMA 5HHPA 2E7HA 3VRLE 2IH1B 4GBXB 5DMKB 3EDDA 1X6LA 2GEEA 3EAKA 5KVFE 3HUJE 5LAPA 4ABQA 2VDLH 5I6NA 3QZPA 4RDQG 3H2PA 4AIZB 2I25N 5J6HB 2VRQA 2VLRB 3MOQA 2Z0UA 3C5ZA 5KYUB 4B3EA 3AQZA 1LO3L 3NABH 2P47B 3LB6C 4NN6C 4TUOA 2X53A 4JFHE 3GRGA 4JRYD 4TULH 3NCMA 3TZVB 4HKJA 1WAAF 4DETA 1Z7JA 5FDYA 4PP1C 1LEKA 1JDAA 2IQAA 2J21A 3DROA 2ESVA 1H6UA 1HXYA 2EVJA 1DVUA 2BOLA 2OMNA 1QMUA 3CZJA 2ODHA 5DS2A 3K5SA 5H35B 3MBXL 5H94A 1GCFA 1R6VA 3NGBC 2C3VB 1DSFL 3MXVL 1E9OA 3MOAL 5DO8A 5JPNC 3PWPD 2Q8AH 4MMXB 2CO7A 4XAKD 3T77B 3UGUA 2JKLA 1D9KA 2WO2B 3I9GH 3MV9D 4OJFH 1BMZA 4Z7UE 4OM1H 4I89A 3M17B 1ET5A 5IT2L 3LMJH 3KPRD 5T1JA 1ZTXL 2AEWA 1U0QA 2DEXX 2R1YB 1RKRA 3T65A 2YUVA 5EU7C 2VH5H 4AIEA 4RETB 2XI9A 1RHHB 4P5SA 1WZLA 5CCGE 4M8VA 5DMJB 3ZHFA 2H3XC 2B1AL 1IC5H 3GMNB 1QSFE 1UTDA 1MJUH 3IDXH 1W80A 1E2VA 4GXVH 4BBWA 4HUVB 3ULUF 2V8MA 2ZPKL 3QIWC 4RIRA 1DQKA 2B9AA 3NCJL 2R7EA 3V52H 1DCEA 4UT7L 4QRAA 2GIMA 3VXPA 3ML9A 4TVPE 1NEUA 4LSQH 4P9HC 5KS9F 3L3JA 1KPUA 4E9WA 3H9HB 1QA9B 1DUZB 3ESVF 3NZHL 4OF0A 1GYAA 4LDOB 1CR9H 1GS7A 3QDMD 4QRSA 3IDMB 4P4KD 3B2MA 1IL1B 3EYUH 1KBBA 3MFGB 5E9NA 2AK1H 1ZT7B 2AI0H 4POZC 3DETD 1DQJA 3EZ8A 2EUVA 3DSNA 2JI3A 3PWPB 4ZODA 2FGWH 3BUTA 4YC2B 5DUJA 2HX9A 1UWFA 5FUOL 4ANXA 4AG4H 3WO4C 3REWB 4CVXA 2XY2A 1BW8A 2B1HL 4J8QA 1G6RH 4NWTH 4U1JB 4XCYB 3T2LA 4ZMTA 3MGTB 2ZAHA 4NSKA 5I1GH 2CR0A 2P24A 5EIQA 4H26A 3KCPB 3P11L 2Q7YB 2PWHA 5AOZA 3WJLA 2PP9A 5JW5A 5ACMA 2MCG1 2XG4A 4CADB 2PN5A 4U31A 3KPPA 2BVQA 2FO4A 4XPTL 5ES4B 5IQLA 1UFGA 3RDTD 4Z76A 1M2VB 3NPSB 5I1DA 1TTAA 2X4OB 4AM0Q 2BSSA 3L4VA 3NJFA 4KO5A 1XCWA 4PS3A 4WWKB 4G7SB 3ZHLA 4DKFL 4ELKA 4F7CB 4Z3IA 3A23A 3MTRA 5EC1B 3RZCA 4AIOA 4N0YH 1TJIH 2VIRA 1CWVA 1OGAB 2WZ0A 5E6IB 2IBGA 3BQUC 4YSTA 1JV2A 2EACA 3BAIA 4YHKL 5C0AA 3TEXA 5CR8A 5IJKA 1BQHB 4CA4A 4HMDA 2XWRA 3MRPB 3ZUNC 1ONQB 4DEPB 5IGXL 1IGJB 4TL5A 1WFJA 2WINA 4QRTA 4X5WB 4XBGB 3GMMA 1OGPA 1U93B 4KFZC 4PJDB 4TNEA 3QSKB 4MBRA 4ODHL 3RQ3A 2JB6B 3U9UB 4Z7QB 2G9HB 3VXRE 1FYTE 5KUMA 2KLRA 2WWKT 2ZUYA 3N04A 2G2NA 3ROLA 5L2KB 3H9YA 4B9ZA 1T66C 4OCXH 4OZGA 4R0LC 4H7VA 3O8XD 1HAWA 3DVNA 4K2UH 3BWZA 3OKOB 4W9KC 5KOVC 2LOEA 4L8SC 4ZTOL 2E74C 2B9BA 4TSBH 3VD4A 3FKUS 4XPFL 3H6AA 2RAMA 1S9KC 2JKJA 2MIZA 4EDWL 2VZ3A 1HOEA 4JO4L 2OMZB 4AT6A 3WTUA 5AW6B 2GUOA 5IHLB 1WCBA 3SD5A 2XWTA 3MJ8A 4XOCA 3UOAB 3MLXL 2DICA 2ZKHH 3LPOA 1AQKH 2V9QA 2Q2EB 3QJTB 5F1NB 3ORJA 2OZ4L 1CLZH 1UH3A 2UXTA 3B2XA 4GRWH 3ZHKA 4HZAA 5EDSA 3LXAA 4O58L 2BNUB 4LXFA 3B2VL 4UAOC 3IJSB 2OXGA 1FL5A 2Y7QB 4Y4FA 5IBUB 2X3BA 1PS3A 2Z93B 1S7VA 4HJ1A 2OTUA 3BKJL 3H2WA 2FWUA 3PAVA 1YEHH 5B39A 4YL4A 3CSYA 5CD3B 3OLIA 5A3IC 3V7AE 3STLA 5C7ZA 5IB3B 5T1MA 4AQ8A 5E5MA 1TZHA 2D7PA 2ID5A 5I6PA 1AIFB 3D85D 4HALA 2FEJA 3MODH 3T8MA 4GQRA 5KTEH 4X7TA 5DRXA 2A6KA 2QVFB 3SQBA 2PYEB 2YEVB 3GPSA 3Q8BA 4DHLA 2Q9OA 3GSRB 1A9EA 3IBEA 4LLWA 2YUZA 1M3JA 4D9QD 1XF5A 1JRHL 3U30C 1V05A 4Z3GA 4JHBA 1ZHLA 4Q9QL 2ICES 1INDH 3BIAX 4GKSB 3L3JB 5E2WH 5IVZB 2A99A 1XO8A 3BSGA 2BVPB 4FQQA 4UINH 2YKLH 5JOFB 4WSGA 3L81A 5DYOA 5DT1H 4Y5YB 4GSXA 2GJ6A 3BE1H 4QRSB 3IM1A 3KJ4B 1ACYH 2PR9A 4HGMA 1XMWA 1HDMA 3BX7C 2DMCA 3FTVA 3S5LG 4AXWA 5I1LB 1OL0A 4EEEA 2QGCA 3E8VA 4DSYA 1MQKH 5TGBA 2WNGA 1U8PB 3N85H 4FFVD 3MJ7B 4NQXA 5C92A 2W88A 3DX6A 3MHZA 3I85A 3CC1A 1FVCB 1CXHA 4AEEA 2BPBA 4P23C 3NJIA 3CDCA 3V10A 4AYBA 5JLZA 2DMBA 2OS7A 4G7VL 2IXQA 3QHZL 4ZFGH 3OGCB 2OMYA 1UM4L 3MV7E 2QELA 5F9OH 5JNYA 4GRMB 1YQVL 1OT2A 4FTDA 4LSPH 2BZDA 2P24B 5C3IA 1XIWA 3QCTH 2F74B 3SKJL 5ECJE 2EIJB 4ANKA 1WC7B 3KBPA 4N68A 2FYVA 5E24E 3T08A 3LZOA 2HFFB 4P8QA 1D2PA 3W2DH 3GBLA 3MODL 2FYYA 4IU2A 2OMTA 1Q9WA 1M6OB 2VO8A 3D2TA 2GPZA 1VACA 5GGVL 3UPCA 1ZS2A 2WVSA 3H55A 3Q7JA 2N56A 4KQ0A 3OJVC 4GEIA 2VN3A 4NO3B 4BJLA 1CLOL 3JYCA 2DQHH 4JFPA 1GS8A 3T0AA 1FPTH 1KYFA 5F93C 1V3JA 3DPBA 3CN4A 1DLHB 3G08B 5HDQH 4RMTA 4ZX6A 5D7KE 2GSGB 4EDWH 5A2AA 5CO1A 1TMQA 1FLRH 4XPGL 3SE3A 1FV1A 1MQKL 3N85L 2CGZA 4K7PL 2EDMA 3I6GB 4OFYD 4Y16B 1ZLWH 4ABWA 4YSRA 5C1MB 2AKRA 2N59A 4ZW8A 3NABL 4UOW1 1IM9B 1E8WA 3VWKA 3HG1B 5C0DB 2E56A 5KAQG 1VZIA 3TO2A 1PCXA 1XCQB 3PV7A 2LU3A 4JRXE 1J1OL 2XZCH 1ZSDB 1BZ7A 1NC4B 4A04A 1UD8A 2IPKA 1JZ3A 1KFAL 1FNGA 3GK8H 4AUJA 3ZHNA 2OR8A 4GQQA 5MEOB 2BS71 2OSWA 2WNWA 4N3UA 2DLGA 2O5ZL 4ZZFA 4AT6B 4H1LG 1GH7A 4GSDH 3TA3C 1UASA 4U2ZA 1JXFA 1CICB 4OGXL 3CDZA 5ISZA 3RUGB 1KEGH 1I9RL 3WJJA 1MNNA 3MOAH 5GS1A 4OV5B 3W9DA 4XZ4A 1H9DA 4AY0A 3FB7A 2VMDA 2XY1A 3FFCD 3TVMA 2D0HA 3FQWB 4J4PD 5FHAL 5F3BA 1UJ3C 5GS0D 4K3JL 1JCKA 1R3LB 2R1WA 1JBJA 3QQ4A 3UACA 1LWHA 4FLSA 3C5SA 4Y2LA 4ZQTA 2XVGA 4PI2A 4QHMA 3FQTB 5CM1A 2BP8A 4HIJA 4C83B 2NDGA 4P46A 4XVUD 1EHLL 1JGDA 1NCIA 2XQ0A 3PPEA 4BUGA 1CZ8L 3F7PC 4N8VB 1DN0A 2OMUB 4ZXBB 4EF3A 4FZ8H 1U3ZA 1SXBA 3L5HA 1NTDA 3KPSA 1ZCRA 4KKBC 4YDJB 4FABL 1LO3H 1JWMB 5AG9A 3ULAB 2TSBA 5HSFA 3BIKB 3EG9B 2BHFA 3UIYA 2KPNA 2CXGA 4JFED 4N8UA 1WYJA 5HGAB 5IG7B 2NNCA 5CLWA 1S5IH 3NCEB 3O4LE 4XVTL 2KT6A 2GBAA 4ODWB 4XE0A 5F97E 2OMWB 4ELMB 2H2PD 4QYOA 3NCXA 4GBXC 1YEIH 4P57B 3KS0H 5TK4A 4JPVH 1A1OA 1MZZA 4J4PC 2X4PA 1KJVA 5E8DH 1HKLL 3TBBA 2C9VA 3PRZA 3DX6B 4PJEF 5GZOD 3ABGA 5FKAB 1MCWM 2CUIA 3Q6GL 5EO9A 2YARA 2EDHA 4J28A 3U2SA 1OE3A 2APWA 2XNAA 3KLQA 3M1BB 5M7QA 3OKDB 3LEVH 2VLRD 2G9KA 4U1NB 4E9VA 3T8VA 3EUDA 4JJ5A 2XXCB 4AYID 1U95A 2DWEA 4TNGA 5IVOA 3BZ4B 4LCWB 1LE5B 4OB5H 1AQHA 2HKAA 1U3HD 3UO1L 5C0AD 1UHVA 1NLDH 3FMGH 2WAQA 5GIRA 5B4MD 3RVVD 4CKVX 3KPSE 3EFFA 1BVOA 1GSMA 2CKBA 2W5PA 4MA3B 3TLRA 1N68A 3OL2A 1PZ3A 5I73C 2NXZC 3VFPB 3F7YB 2MCMA 3QPXH 4L37A 4PV1C 3WLWD 5JHBA 2V9RA 3OXSB 4L5FE 1WAPA 5F3HB 1ITCA 1ZD6A 2X1XR 3RWHA 3MJ9A 2LW3A 3NZSA 3FHEA 4WY7H 4B60A 4QAWA 4H20H 4PCTA 1ND0A 2J1WA 3OXRB 1RUML 3L3GB 1ZPLA 5C07D 3MNWB 5INDA 3ROLB 4DNLA 4FL4B 4GAJL 1N4XL 4U3CA 2GIYA 1T0OA 4XBEH 4R4BA 2FB4H 2R0WH 1Q9KB 5DR5L 3B7SA 3MA9H 5J1AB 4YIQB 4MMXC 3LKQB 1TMCB 3DBXA 5L4IA 4J6RL 3GBMH 2BMKA 4LESA 2F7PA 1ZLDA 4RFNC 4ELDA 3VI4F 3MV11 3OLEA 3VXOB 3TT3L 3G5YB 3VFSA 4RAVA 3AQDA 4S1QL 4MJIE 5EEWA 2Z7ZA 4BGLA 3IAQA 3BCFA 3FQNA 1X44A 5MI0B 4NYLA 5DVMA 5I5RA 3FQUA 1MLCB 3IK2A 5I1GL 4UIMB 1W72B 4HPOL 2DN7A 3PAYA 3QJVB 4PG2C 3CX5K 4UI2A 2UUDK 4OZIF 1FE8L 1KC5H 3MJWA 1FHGA 4UB0L 2YJLA 2OJZL 2G75B 2YK1L 4PY7B 4ZUSB 2Y7QA 4XMZA 2JFCA 3H8NA 4J1UA 3W9DB 1WGOA 3I75B 2ZAGA 4N8CL 4Y1AA 4BSJA 2VKWA 2OTWB 4NJ9L 1R5VA 3H54A 1EJOL 2VLMD 3CVDA 4X4ME 4XN1A 3A6BH 2CALA 4B9IA 2M2DA 2VL5A 5T1MB 2AQRA 3ILQD 3UTOA 4K9EC 3FCBA 2O26U 1S9VA 2DIJA 5TE4H 4X7TB 5DRXB 1WBZB 1NC2A 1EUTA 1REIA 3SDAB 2AFNA 1TZOA 5DD5L 4LLUA 4P2RB 3BVNA 5D7SL 4WKXA 1TQCB 2NY4B 1JCVA 5TDOA 3DJSA 3VFNA 2W92A 3VE0B 3GHEL 1BM3H 4LOEA 5FOBA 3GJEA 3GXUB 4PRAB 3TT3H 2GJ6B 1IT9H 3FAWA 3UBFA 3NPSC 3L5XL 3MREA 4JQXC 5A6LA 1WVZA 2PNDA 2OA9A 4WO4A 1R47A 4AXWB 4ZUVA 1DVTA 4IEFB 4D8OA 1LQSR 4V2CB 4PTTA 3K71A 4OCRH 4QO1B 2WMPB 2R0KH 5CJQL 3TPKA 5IFHL 2R4SH 5AVVB 4ELMA 4AEFA 3D0LA 1RJYB 3E6FB 2A7BA 4EUPA 1KTCA 2CHZA 5A7BA 4FG0A 6TAAA 3FUMA 1ZVHA 1QI5A 1YUHB 4JDEA 2FSEB 1J5OL 2XX0A 2HWZH 3MFFB 1J7VR 2VWEC 1MIEL 4GFTB 5D71L 5E99L 3TN0C 2F2HA 1BVNP 3B2UD 3H9SA 3Q48A 4Q9CA 3DHPA 5E1AB 2CMRL 4I7ZC 2AEIT 3O9WC 3U48A 4I18B 3L2NA 4ZOBA 3DUUB 1UM4H 2WGXA 5F9OL 1DBAH 4S11A 2NY5L 4EKXA 1Q94A 1T22A 2K6WA 2G4GA 3D39B 5HI5C 2VN5A 4AQZA 4KVCL 2V6HA 3WNJA 2QZ5A 3GZOA 1Q9LA 1NQBA 1U8NB 4A37A 4TVPL 4FERA 2K7QA 5GQBA 1UWXK 1CURA 5KVGH 3US1A 3JT0A 2C34A 5LGJB 4M61A 4ODVH 4M03A 4M93B 3T3MF 4PJIF 1M7DB 3SQOH 1EO8H 2Q2LA 5EEXA 3T2NH 1JS4A 5GGVH 2WLKA 4B50A 3DVIA 1ZMYA 1KDJA 2XWZA 2R7EB 3RWHB 1V7MH 3QXTA 4RGND 2R0LL 3QG7L 4R7LA 1CDHA 1RAMA 3B34A 4UM9A 3ULUH 3I6GA 1Q8MA 4Y16A 2E46A 3CZNA 2A9CA 3NN8B 3V9EA 5HDQL 2OYKA 4NRXB 1H0DB 2WSDA 1GYUA 3MCKB 3UTQB 4DGWC 1BJ1J 3HS0A 4EZKA 3IRZA 5HHXL 4PJHA 3IU3A 3O0RL 1SF5A 1B2WL 1U8MB 1TDQA 2IV9A 4K9EL 3AT0A 1CU4L 5J7CC 4LLDB 4Z7WA 1T04B 5D1ZB 2C1PA 2BERA 4KK9C 1KB3A 5AAWC 5GISH 4X6DA 5EU6B 1L9NA 3BMWA 4M4RB 4NT6B 1J1OH 2AQPA 2HLEB 2IV8A 5DWUH 4BA0A 4TUKH 3UG5A 2XZQL 1GJUA 1RY7B 4HKXA 1KELH 2A38A 4IHOB 4B9JA 5I1CL 4NYLB 4FQ2L 3RUGA 2A77L 3TZVC 2A74C 4LSPL 1A3RH 4XN9A 1DN2A 4RRPG 2Z8SA 3HAEB 5GRZA 2WBKA 3HZVA 1ASQA 1GJIA 3LEXB 4R26H 3BLKA 3KYMB 5B1KA 3S37L 1QW9A 4P5TC 3EFOB 5F89B 2IJ0C 1XF1A 4KHTH 3CU7A 1H3UA 3LQAH 1KPRB 4PJ7F 2Z65C 3OG4B 5HYJA 1KYOK 2H1PL 4ZFOL 5MHSE 5I15H 2YXWA 3DJRA 4K3JH 5KSBF 2GJZB 4O2FB 3MVSA 2MFNA 4FNUA 1NBQA 3AB0B 3K72B 3QJXA 3SE8H 4DFHA 5IFAL 1AZZC 3K74B 3HMXH 2OMUA 4KK9D 4R83A 5D2LE 1RIVL 1VFUA 3FPXA 2HTLD 1KEMH 2G3MA 1BPLB 1MWAL 1TQVA 3FCUB 3LZPA 2MSPA 4N0UE 3VGFA 5IEKA 4LLUB 4P2RA 5B7FA 1QO3A 3BGMA 5G55A 4XNQA 4RDQF 5E94B 4APQA 3VFTB 3NCYP 4ZUWA 3BVXA 1U93A 4PRHD 2DM4A 3OVUB 4KH2A 5FO8A 1KF9B 3KYOB 4OM0L 1AOZA 2G9HA 3ZKMC 3QDGA 2X40A 3BWAA 1I31A 1FGVL 2R1XB 3DLQR 3DNKA 2P48B 2WBXA 3O2DH 4QYOB 3UTSA 3HKZA 3KH4A 4M6OL 2DM7A 3ARVA 2X4UB 3SE4A 5CR1A 4FFZL 1ZT1A 3GIZH 2DM2A 4RAUB 3L4CA 3RNQB 1ZDSA 5EDXA 3J2PA 4TN9A 1UEMA 2V2TB 5I16A 4ZAKA 2Y2WA 3G6JF 4LP5A 1E4HA 3TYFA 3CVIL 3INUL 1RZJL 5IB4A 1ROWA 4ESKA 2GJ6E 2DJ4A 3MX0B 2FR4A 3OAYH 4IKLA 5AW2B 2FTAA 1GZHC 3WTTA 1KOAA 2QEJA 1F11B 1ZV9A 3FBKA 1M7IB 2QDVA 2WOBA 3KPOB 3Q43A 2XWTB 3MJ8B 3IFLH 4Q89A 4FQXB 1H3PL 5J13B 2ADFH 3HRZC 1P6AB 3VFRA 1XGPB 5FGCE 4I18A 5TJWK 3QUMH 4QHNA 3GF8A 5EF1A 4PPTA 2DZEA 4XMLH 3UGEA 5SX4H 3QPQC 2CJUH 2VDLB 4I3RL 1D5IL 1A7BA 3CSYB 5CD3A 4LB8A 4XP1H 4HFUH 4D8PA 4QR7A 1M7DA 5KSVA 1TQTA 3QR2A 1ND0B 3BYYA 3QPXL 3Q2CA 3PXHA 1KPVA 2PYEA 4XO9A 4G83A 1A9EB 3IF1A 5FA4A 3WXWL 1V27A 2PO6B 4OZHA 1ZHLB 4PREB 1NCOA 4MAUH 4DGYH 7TAAA 5B1JC 4NQDD 5J1AA 2Q86A 4QTHA 3O6FB 2V7HB 4F9LC 2OQJB 3GSNB 4EIZC 2FUQA 5IVNA 12E8L 1K4DA 5KBKA 5SWQA 2QTVA 4KO6A 1A6TA 5D6CB 3BSZL 1AIZA 4RGNB 5T1LD 5JHDA 2WP3O 3KDMA 3CDGA 3FSZA 2ZCKH 1JXKA 1A21A 3KPNA 4AMKH 1S7RA 3L9YA 1QYGH 1PX4A 4NQCB 2I32A 2E7BA 4PGBB 1SBSH 1G7JB 5E2TH 3BQUD 1P4UA 4N2KA 3KPLB 4PGJA 3L6FB 5CJXA 5EBGA 3V0HA 4AZUA 3HFFA 4O02A 3NIGF 4YQXH 2J7LA 2HVKB 1E50A 1OTUC 1QEWA 1RK7A 5ICXB 3VFOB 4UNIA 5I8OL 5IT2H 3S3BB 1M9WA 4JK0D 1ZTXH 3RDTB 5D7LA 3QCVH 5HYQB 1P7BA 4Z78B 4Y2DC 4ZUSA 1G1YA 1X5GA 3UEZA 4I13B 1PLBA 3PHOA 3QDJA 3QYNA 4G8GB 2CK0H 4P2CG 2JK5A 3FMGL 4NENB 3SDXE 5K39A 4PJ6A 1WTLA 5JIPA 1BFOB 3KYAA 4XODA 5JR1H 3FFCA 1G9NL 5CIPH 1IAKA 3C60B 3LKSA 4AUYA 1D5RA 2BVOA 4C4UA 1M6OA 4OCWH 5DHVA 1X4XA 3PNWB 5KSBA 4Z7WE 1VGKB 2WLYA 3FH7A 1FDLH 1SFHA 4AGNA 1P4BH 3AM8A 4LSVH 4MQXC 4Q74A 4BRJA 4I48A 1BBDH 2JJTA 2ZSVB 3G04B 3O6LL 2CHXA 3ZDXF 3AS2A 4WW2B 4NN7C 2BNRA 1G6RA 3OAUH 1QO3B 3BGMB 3IETA 3L4ZA 4ZG1A 2DTMH 4XE5B 4EVNA 2GKIA 4GAJH 5CN3A 3CN2A 3DGDA 4HQQL 3TCTA 2EUZA 4A66A 1L9PA 3FFOA 4ZX4A 1EQWA 3G5ZA 2Q3XA 2WXNA 3E3QC 5CUSL 3S88L 2W0KA 2L7JA 1QBBA 2YPLE 4QXGH 3UZEA 1LNUB 2ICCA 3HPLB 1CB4A 1KDIA 4X4KA 4D0CA 3TM6A 1L6XA 2NW3A 3ARDD 3D06A 3JV6B 3LZQA 4ONOA 5KW9H 2O4EA 4M62H 5EMYA 3WIHH 4QRRB 4X50A 3DDFA 1GOFA 2R2BA 2BC4A 2VC2L 2I26N 2OXHB 4OCRL 4RGNE 4GKZB 4MWFB 3V6FB 2VLRE 3X3GH 1JUFB 1CGSL 5CBAA 1VADB 4DVBB 4Y5YC 1NAMH 3W0WB 2HKHH 3MUZ1 2XDHA 4B53A 5C0AE 1YN6A 2DIBA 1G7IB 1TQBC 3KWWB 3KPOA 2QLYA 4WFED 4OKDA 2O61A 1IAII 4H0HB 3NEXA 2PWFA 4KUZH 2ITEA 5A2IH 4UDTB 3TFKC 5DZ9A 2GY5A 3DUHA 5D1ZD 2ZE0A 3NIFE 2E8ZA 4N2NA 3QQDA 2E7LA 3ECQA 1QRKA 3OGOE 3MRQA 1HYRC 1SJHB 3AWGA 1XBRA 4UQ3A 4I85A 3MCG1 1T7VA 4FE9A 3RWJB 3A6BL 4I8DA 2DQFB 2O6EA 3OKLB 4IQHA 4G80B 4Z7VA 3KNBB 4NI6A 1UXWB 5GZOC 5E7FA 5IZ7A 4XAWL 2O5XH 2MEJB 3TJEH 3UPAA 4W9IC 2LE9A 3V0WH 3BLBA 2W1NA 2JI2A 1T0NA 2JIXB 2WO3B 4QHMB 3WMSA 4NFCA 3K1KC 4UAHA 5AG8A 5JW4N 4YDLB 2A1WL 4P2YA 1USZA 2VN6A 3K6DA 4WEUD 4CN1A 1OANA 3DVGB 1NDMB 1XL4A 3LHPH 1MKFA 4MMZA 4OFYA 4QXGL 4OZFH 4UUJA 5DTFA 2EICA 5DQDH 4YDLC 1QZ1A 5IHZB 1T7ZA 3NFNB 5ESAA 1TYRA 2R4RL 4M62L 4BFIA 5I8CA 5HDWA 1EHNA 4XOAA 2W59A 4BHUA 2WXKA 3BW9A 3TIDB 4A38A 1TU2A 1DBMH 2OQJA 3CFIC 3GSNA 4ZUTB 1A7PL 3H4HA 4WUUE 1XMEB 4HK0B 2Q8BL 4GKLA 4KZEL 3CX2A 3EJTA 4ABUA 5K9KA 2J2ZA 1M4KA 1KJVB 5JXED 5IW6A 5HPOA 1RUQH 4OQTL 1P53A 1JK9A 1DJIA 4E41A 4YFLF 3GS4A 4V33A 2PTUA 1SLUA 1QATA 5IQ9B 3PDGA 3BP4B 2AEQH 2EXWC 4LSDA 4JFQA 3MRHA 4QUOA 2XETA 3Q8CA 4A7GF 3KLHC 1M05B 2P8PA 4AW4A 2GT9B 5DHXB 4HHWA 4FLHA 2QL1A 1ORSB 4UANA 2R69H 1KENH 2GBTA 3AS3A 5CEYA 4MXQD 3EH3B 3OB8A 1ANUA 1QRNA 4U1KA 3SKUD 3QJHB 1OSYA 4W9GC 4S10A 2P3YA 3S48A 4JY6B 1MOEA 2Z1KA 4KJWD 2X6CA 1WIUA 4G9FD 2DV6A 3P9LB 4EI6A 3IKCA 2DH2A 2RBLA 2YBRA 2CHWA 4AYEC 3B9KA 3WLBA 2YSSA 4IRJC 3O11B 3V4VL 1SOSA 3D7PA 4LOUD 4QXUH 3ZY7A 3K5RA 3U0WL 4GUQA 3DETC 1GAFH 1GGYA 1U8LB 3ZE0B 1JDCA 2YAEA 2LT9A 3FU0A 4FXTA 3PP4H 5TDPA 3MBEC 4ADJA 1JI2A 1OSEA 5JA8B 2A4CA 3IETB 4OZHF 1JF5A 1PSKH 1H8NA 2ZX6A 5FKPB 2FLMA 4UDUB 3ME0A 4TYUA 5FGRA 4BXSV 2PCYA 3KLHD 3HLAB 2X4UA 3QC5X 4J3UA 2NY3D 4GW4A 1CYWA 2ZF9A 2BIMA 2GITB 4HCRL 4LRNL 2EIZB 1AHWB 1ULVA 3GZKA 4XCEB 1LEKB 4XI5C 3ZLQC 4CDHA 4KRPB 5ISZD 2CG9X 1ZHKA 2FDBP 3LS4L 4HS3B 3AROA 5AB2A 5IOPB 4XVUC 2IPUK 4OCLC 2FBJL 5J3HC 4G1EB 4RCAA 4U7MA 4KJWC 2WKLA 1R9FA 2QGDA 4Y4FD 2AXFA 4X8JB 2E3VA 1IM9D 2MQ3A 2ZCHL 4UTAA 4LT7A 3KWVA 3RDTC 5D4QA 1D5XA 5J11B 1YEHL 5GRYA 3GSOA 4PLJD 1L7IH 2EAEA 1W72A 2DI8A 1MCHA 3WMQA 2UX6A 2NRDA 2Y1YA 2KLSA 3KH3A 3C6SB 3OPZH 5AALA 1PGRB 3DHJA 4F57H 3F83A 2B4CC 4EPSA 3IFLL 1OHQA 5CZXD 1CICD 1D9KC 1IKFH 4NO5B 5T1KA 5KWYC 4HH9B 3F7VB 1RHHA 3QUML 3N91A 5JZ7D 4RWYL 1EJ6A 1KT2B 1MJ8H 3FQRA 4OM1L 3BP6B 1KBPA 1JZFA 2KQNA 5DJ0B 4YOKA 4D9QE 3MLTA 4PWHA 4DEPC 5KVFH 5BQDA 4Q9RH 5K9JH 3DSFL 1I8MB 1IQDA 2EO1A 1N7ML 1MI5A 4IBTA 3BAJA 3UEQA 4JRFA 3SPCA 1QFWL 3D39E 3HZMA 3FT2A 3IFNH 4BZYA 3LNFA 4FCHA 4U6VL 3ZTJH 4YSSA 3O3EB 2DQCL 1IV8A 1EX0A 3NSFA 5LAXA 3A22A 4YR6B 5CZVH 2DQJH 1BLIA 3OM3B 2MPAL 3Q8EA 1FFPB 3BQUA 5BVJA 1FI8C 5DXWA 4APXB 4NN6B 3ZYJA 4WLCA 2EDNA 1CLCA 2FJGB 2QKIA 3X17A 2XQBL 1PY0A 4U49A 1B3IA 4NI3A 4ZUVB 3JWNE 5DUBB 1JPGA 2XV6B 1OB1B 3K8LA 2WZ5A 4JQIA 2F7OA 4LVHC 1NOFA 3S5LA 1PKOA 5D1XC 2OR9H 4K94H 4CVXB 5GRJL 2W0FB 3BH9A 2EQDA 4PJDE 4HKBA 5F8QC 3PIQA 4LNRA 1MCDA 4J3VA 3QNXB 4BM7A 4MASA 1DUYA 4LCCB 5IQ9A 5I19L 3VGGA 2IWGA 1JHKH 1PD0A 4XVSL 1E28B 3BPLC 4GNKB 4HUXB 2DQTH 4G8GA 1NUGA 2QLVB 4Q52A 3R1GL 5H4ZA 3P4OA 1MI5E 4GRLD 4CADA 3DSFH 3IJ8A 4G5ZL 3KPPB 2V17L 5KVMC 5EBMA 4H8PA 3QIBA 3DX8B 3S2AA 2D3VA 4Y9BA 2BVOB 3QUYC 4IKKA 3LNDA 2EEFA 4IBLT 5DQ9A 2FHBA 3ZKSD 4IM8A 2IWFA 3L1EA 4Q2ZB 1G9NH 1PYWB 2HMID 4N0CC 4NBXB 2X10A 3IKCB 2ZPKH 5E1QA 2YBRB 2CJSA 1DDHA 1KXQA 2ZAIA 5I17B 4Z0BH 1BXVA 1NZRA 4P3WA 2APBA 1ZGLA 1U2HA 1U8LA 2FH6A 3F58L 4FQ1L 1NGWA 1FFTB 1TTCA 1W9XA 1XR9B 1CYGA 4YWGH 1HI6A 5BW7A 5K9OA 1E5ZA 2IEPA 4NZUL 4O2EA 3KHQA 3S35X 1RVFH 2CJ3A 4KVNL 4HUKB 3FOMB 5CN2A 3T1WA 1NC2D 1U36A 2OK0H 2E27H 2O5ZH 4R7XA 2AJVL 4GAYA 4QRRA 1U8KA 2FHCA 5EZIL 3O3BA 1JJUA 4J3BA 2EIZA 3WFEL 5AENA 3UTSD 1EMTL 5D1ZA 4K07A 5FYJL 3FOLA 3RU8H 4L3AA 4QRPA 1OAUL 3DK2A 5E6IA 2PUQT 4FYSA 3ULVC 2WJ5A 2WSPA 1G9MC 3IJ9A 1ECZA 2XPYA 3MNDA 3S3SA 4LIQE 2OSYA 2VR6A 4HT1H 2D7TH 3AJ7A 1OCWL 5DF0A 3NJHA 2XIIA 2FX9L 1AGBB 3AAZB 1R5IA 1MIMH 4JANA 4TL4A 5K69A 1SGKA 5BV7L 2HKHL 3ZDYE 4BZ2H 3FU5A 5EU3B 2HYMA 2X9YA 4BIKA 1KNOA 1RD6A 5FUCC 4OV6F 1UZ8A 2DRUA 3D9AL 5CINL 1OAKH 3ATAA 5FLVA 3JWNH 5FB8A 4GKNA 5JR1L 2R15A 4XXWA 1D3CA 3F6JA 2F6AA 3S4SB 4OCNC 5I71C 5CFAA 4QCIA 1TKWA 5IVXF 4UZUA 1DBJL 3QJRB 1OSZA 3WY1A 4OFVA 2G0LA 4XPAL 1FZOA 4DESA 3K1DA 2IBZY 4LDCA 5CWSB 1JPSL 3FB6B 1E2ZA 2XPZA 3IDMA 1KFGA 3FRPG 5E94A 5IVZA 5J3HD 2VE6A 4P9HH 3TNNA 1OP9A 2VDQH 3N9GL 4MXWL 5AVWB 4G7QB 5LAXB 1XTMA 1E90A 1E3ZA 3KYKH 5I19H 5BV7B 2WZPD 1A4KB 2HFGL 1JHKL 4XVSH 4DN3L 1HXKA 3V0VA 4OF5A 3MXWL 3IMRA 1DYZA 4ZOAA 1HEZB 1ZJAA 2VITA 5IB3A 2X4TB 3QIWD 4GIAA 4K0OA 3GI8L 1N19A 4NZJA 5FIEA 4P23A 4TSBL 3RWIA 4HZ1A 1SJVA 2HT4D 3P3YA 2GABA 3HW7A 3O3AA 3BZEA 1MJUL 2JLPA 2EO9A 1P4IL 2EIBA 4DFIA 2IXQB 1MHCB 4E9YA 1S7XA 1I1AB 1X5HA 2BOCA 1RZ8B 1SLWA 4A7UA 3D4ZA 4LZKA 1DBKL 1BEYL 4H2AA 5JNYB 3UP6A 3U0PA 2BVQB 2FO4B 1H3TA 5AW1B 4BH7B 4F2EA 4OZIA 3IVKB 5DURB 1CFSB 1NGZB 2FJHA 2PCPA 1F4WL 5KZCD 3AXLB 5TH2B 3HG3A 3DMMA 3CG8A 1QWHA 4U1KB 5DK2B 1BFTA 1MJJA 3ASOB 4NQVA 4W4OA 4PBVC 3TBCA 5C0CD 4Q0XL 4F93B 1COBA 1IJ9A 2HPOA 2YA2A 3PFQA 4DP7X 1X5MA 1JNLL 2VQ1A 5BPPA 2VAAA 4G43B 1ZK5A 3ULSA 3NA9L 1LWRA 2RALA 3O3DA 4B9CA 4QJ5B 4Z3HA 3EYVA 4FXGA 4LQFL 4L05A 2OX5A 2K8QA 5ALCH 3ES6A 1A14H 1XGUA 2KMWA 4RFEB 4JEGB 4JFPB 1B4JH 3DPBB 5B3SB 1NM4A 2X5PA 1A3ZA 4FQPA 4JN2A 4BH8A 4YSQA 5ETUA 4MRCA 4JFHD 4ES8A 4FYRA 3R4RA 3NP3A 5FKPA 1BZEA 3C9NA 4CC1A 4WI5A 2CO2A 4RGOL 4ECNA 4P9MH 1NUDA 3MLUH 2X2HA 2Z64C 2ALAA 3ARFD 5AB1A 3FPYA 3RVWC 2J5LC 4L3EA 4NZTL 1Q9WB 1IM9A 2W80C 3RTQB 2W91A 5I71B 3C8HA 1EERB 1Z9OA 4CILA 4P59H 5EIIG 1CL7I 1EAOA 4JRXB 3PWLB 3WEAA 3U4KA 1HU8A 4EOWH 1DDTA 2VERA 4BZ1H 5ID1A 5MI0C 3SO3B 5EBWB 1J9TA 3LS4H 4TNVK 3IFPA 3M1OA 4JFZL 4U0RB 1VEMA 2V5RA 1MNUH 2A6DB 3DXAA 4LAQL 1ACZA 4LSQL 2ZQKA 3VD7A 5J06A 4FQIL 5D7LB 5HYQA 4HLZH 4P2RE 4R4FH 2V7NA 4LQFH 1HZKA 1SVBA 3N1FC 5GGTH 1KN2L 1V8HA 5DJ2A 1UM6L 4FTVE 4F80A 3HPJA 2CXKA 1UVQA 4NHUB 4NENA 4A7SA 1R1CA 4AVKA 3ARFC 3DECA 1SEBB 1XGTA 4DKAA 2VDKB 4NQEA 4QLWA 4GMSL 4GQZA 4RWYH 3QO0B 3MTXA 1NFIB 4PJIA 1SOKA 5SX4I 5AW9B 1MAJA 2A9AA 5KVFL 1Z2KA 2FJFB 3FW6A 5CP3A 1NGPH 4KTYA 2VXQA 1FPTL 1O9ZA 3IJ7A 1O6VA 1KJ3L 3HRZA 4L4TA 4XTRD 3O8XA 2EZ0D 1MJ7H 1XX9C 1R3HA 4DVRH 5F9JB 4ZMLA 2WXPA 4IMLA 5DJZB 4EVNB 3TVMB 1M71B 4PCYA 2BIOA 3FYEB 4KTDL 1MIEH 4JO1H 4HX1A 2X05A 5E1GA 5T33L 3RAJL 3MOBH 3BOVA 3LIUA 4M5TA 2AS5M 3RIKA 2DS4A 3SODB 1HCVA 5TQ2L 3S34H 2WQVA 3KPTA 4R4FL 1IBFA 5EN3A 3QZOA 3EO9H 1SMDA 1F58H 3NJXA 3ZBMA 5EG6C 1KCSL 4K3DL 3T4YA 4F27A 5CBAB 3UROR 3NA9H 1GGBH 4CC0A 4L29A 2NLJB 4AKQA 3BFQG 3GDCA 3MRFB 1JWMA 4FFWD 4OF3A 1I1AA 4W9JC 2VN4A 1VFAB 3KWTA 1YVLA 2XIBA 5T3XH 4F57L 3QZWG 4HULB 2ADJB 4JJ5B 1BYPA 2QPEB 1I9RH 3QQNA 4XTRC 4G7RB 2D7QA 3VYNA 4MQSB 4BKSC 4HCRA 1KJ2L 2KZ1B 4LMQI 3DA0A 4ZZKA 5JO5A 1FBIH 2X4RA 1U8CA 3K3QA 4RGOH 3BPCA 3BKCH 3QFGA 5I18H 1SEQH 3BRFA 1FG9C 3BKYH 4X80H 4XC3H 3I3DA 4P48A 3LB6D 3O3DB 2Y22A 3FULA 4G11A 2GJ6D 4ZK8A 1ZXQA 4QHKI 2QKSA 1G9MH 4CNIA 2COVD 2D3LA 1TJGH 5C07E 4Q6IC 2XNAB 4WTZA 4PLKD 5CJXC 5G5DA 1GS6X 3FQYA 4U6VH 2AHIA 4YDNA 3HNVL 4JRYE 5IHZA 5ESAB 3LQMA 4LL9A 4R5TA 3V5KA 1L6PA 3CVHL 3P77A 3DX7B 3R19A 3LEYL 5DJAA 3BI9X 3CN3A 5BXFB 1F4YH 1IE5A 1T03H 3UFIA 1T1ZB 5ANME 2BXZA 3PQYA 4TVUA 2J72A 3AG4B 4JQIH 3VXUA 2OK0L 2DWXA 4K73A 1RUKL 4ODXB 3ZDZB 3MLVH 4KK5C 4O51B 4L37B 1NIAA 1A9BB 4P4KB 4JJHA 1V7NH 2HT3D 2MH4A 3FUKA 3KBFA 1MVUB 4Z77A 2VDRB 4NQCD 3WEOA 4U7SA 1AI1L 1JI1A 2F9BT 2ETWA 4PY8J 1HSAB 3FUFA 3RIFK 4DP5X 2AV7B 3ULSB 2OMBA 2FBOJ 4Y16C 2XWXA 5AW8B 4GRWE 1A7OL 2AJYL 3PWVA 4R4BB 1GZHA 4N0RA 5IFAH 4JGNA 1IGFH 3T6QC 5EOQL 5C0FA 1FH2A 5FM8A 4CBPA 3LAFA 5AKRA 3EO1A 1INEH 3W56A 3SKOB 3BISA 4DZ8A 1HHIA 5L0QC 1QBLH 2ED9A 4EI5B 1NDTA 2Z91A 5D7IF 5BZDB 3WSQH 2JKIS 4YO0B 2KH2B 4IIQA 4NPKA 4M6NL 5F71A 5JHDE 4ORZC 2VLLB 4R90L 3GUTA 2AABL 2LR4A 4ATWA 2BK8A 4XX5A 4G7VH 5CGBA 3TA3D 1NOLA 2BCMA 2PTTB 3LZNA 2FJUB 5IQNA 4RFOL 4EUPH 3ZDYB 3V0FA 5JUEL 2VR4A 4G6KH 4IRZL 4R0LA 3QARA 5AVZB 3SN6N 1P0SE 2FE0A 5HHQA 2IAMB 3OJDA 1IBGH 3EF7A 3UJTL 2EEAA 3F6LA 2DQGH 3HHSB 4G8EB 1CE1H 1F1DA 2YPVA 2X4PB 1KEGL 2VL5B 4IK6A 5DZPA 2OLDA 2L7QA 1U3YA 5HJDA 1II4E 3G6DH 4WV1B 3GXIA 4J8RB 5LBSL 1MFBL 2YQ2A 4JM4L 5SWSE 1CLYL 1HE7A 2AVGA 3LRSB 1LWJA 4JDEB 3OB0K 3H4FA 4RNRA 1A4JB 3D0VA 2ZKWA 1J8KA 5IMOB 1XGZA 4R96B 4A2LA 1YEJL 1SHWA 3GUFA 5EPMA 3SJVE 5C9JB 5J6GB 3UBXB 4A6YA 5JOPD 2WN3A 4A2EA 4HP5A 1DR9A 1ZV2A 4OQ1A 5GGSY 4K8RD 2PXYA 4M6NH 4WO4B 5DFTA 1NCJA 4XWOC 1NANH 4IEFA 4IK7A 2AGJH 1IKNA 1RZKH 4IBWA 1CLVA 1CGXA 3FNKA 4OCYH 2X89D 1JZ8A 3T4AC 3PAZA 4N8PA 4QHLB 4FF9A 3NZHH 4FKEA 4GG6E 5C9KA 3PY9A 1QKZL 2NXYC 5IOKA 2YIHA 3NCYS 4U0RC 5SWSB 3ARDC 1JZGA 5JW4R 1MI5B 1B90A 1HL9A 3ZW3A 1J18A 3H42L 2NY2B 2Z4TA 3V7AG 4XVJH 3ZZ1A 4AYDC 4O5LH 1CF8H 2YD9A 2WXFA 3EJQA 3PJLA 3LKOB 4GAAA 3IU4L 3QS2A 3QRGL 2QVTA 2DLTA 4YHYB 2Y25A 5KVDL 4O4YH 3S36L 1O6TA 1TTBA 1HHJB 3ISWA 4J3OD 2EDTA 2DQ6A 1R75A 1SF3A 5F7BA 1FN4B 1ZVSA 4KNTA 1CDYA 1UOLA 1AO7A 5C0EA 3CQQA 1ETJA 3ESUF 2VDMB 2A6IB 3WLWC 3GJFK 4X5QA 1BZ9A 1R3KB 4G72B 1JMZA 3HI5H 3P3TA 4NN5B 3DRTB 1CFTA 4OSUH 4YSEA 2Q20A 3OKEB 1RFDL 4LAJH 4CMMB 2HUHA 3K0WA 3T5WA 1Q9OB 1UZGA 4ANVA 4XNZB 3BH8A 3UYOD 2OL3L 2YXVA 4G1MA 5TFSL 2J88L 5A3ID 3QA3B 4O58H 5DSCA 3UTQA 2AJZA 4WNQB 3PE9A 2RCSL 5C09B 1GHFL 1H6TA 1MCQA 1TNMA 2BNQD 2DL9A 1NEPA 3QO1A 3TN0A 1A6VH 3WE1A 4N2EA 4XVTH 5EBMB 2ATKB 4X7EC 2CUHA 1GYVA 2ZTBA 1DE4B 1F6LL 1JNLH 1GW0A 1A1NB 2CLZB 3SYCA 2DYPD 5L4MA 4E9RA 2A0LD 3NIGB 1Q0YH 1E30A 4ENED 5D4HA 5DHVH 4E2OA 1NMCC 3VU1A 4XMKH 3QRBA 1X5YA 3DIDA 5CUSH 1UWEH 2H26B 3RWFA 4QNPF 3FTWA 1AD0A 4K5NA 5DHDA 2P7TB 1FRGL 4HC1A 4LARL 4LCVA 1JVKA 1W72L 5DD1H 2DWDA 3PLYA 3N6YA 1OAZL 4FMKA 1T83C 3G5VB 5AW5B 4APQB 5BW7C 5C6TH 3X1BA 2A83A 1SDAB 5E00A 3F62A 3B9EA 1KJMA 1XR9A 3G9AB 4W6YB 1BREA 5CGYD 1MRDH 2XXMB 4AEIH 4JQXA 4PSRA 1A66A 2P44B 3WN5C 4L0YA 1XIWD 3QHTC 4D0BA 1U8JB 3RVUD 2WNKA 3FUIA 2YD0A 4O00A 3EJZC 2XVKA 4M7LL 4NZFA 5AVTB 3MOBL 2DJUA 4LPXA 1OW0A 4M6OH 2K7PA 1EDYA 5CCJA 2DD8L 5D2LB 4MJ5A 3RGHA 3V8OA 2AXGA 1NANI 2C1OB 1N2RA 2V5MA 2PETA 4DO6A 1QPPA 3TJPA 5AAWA 4DTGH 4I5BB 5DDHB 5IMKA 2FEDC 2ZYSA 3RFZA 1M53A 3BP5B 1QPKA 4LASL 3AREA 4KK8C 3B56A 4E0RB 3JUYA 4XVJL 2HFTA 4UZSA 2VJ8A 3UDWC 3VG0H 2Z7YA 3UYRL 3D18A 1A6AA 4LLYA 3IU4H 3QRGH 2V2TA 3IWUA 5I16B 3HE6B 4EN3C 1EO7A 1HINH 3MROB 3HHMA 1HN1A 5ICZA 1U6AL 2B14A 3HI6L 4PVLA 5DJXA 1SPDA 4AZ8A 3GMQB 2P80D 2Z31A 3V9FA 5SWSA 1RSYA 3P0YH 1SDDA 4E5XB 1ZLWK 1FLRL 4XPGH 4NRXA 3WJJC 4P5MB 2Y2YA 2QQQA 1YNLH 1ZRUA 4FL4C 5IKCB 4PRPA 2E6QA 4R97B 2HJFA 4QHNB 1N12A 4PCKA 3QI9A 2MNJB 2RHEA 3PGFL 4OIFA 4ACTA 3B8YA 1OGTA 2KUTA 4O9HH 4E36A 1XB6A 4E9LA 5HHOB 5K1JA 2VYRE 4Z3EA 1QHPA 3EOTH 1U3HC 3LS5H 3DURA 3V0AC 3HN3A 1WT5C 4G42B 4HA1A 2FZ3B 2FATH 4NZRL 1LO4H 3BAKA 1JWUB 2CGRL 4UM8A 5B8CB 3T3PE 4YVUA 1MW2A 1G7PB 5DHYB 2EKSB 4OY9A 2NXZD 3QI9C 4LGPB 4HUVA 1R3KA 4P04A 2YOAA 1NWOA 4GSDL 1QLEH 2J5WA 4D3CL 3GRBA 5BMFL 1YYML 2P5EB 4PQXA 2ROYA 3WJMA 3ZPDA 2BSTB 3LEXA 2EH7H 1SM3H 1AMYA 4Z78A 3E7JA 4TPRH 1TVBB 3ARPA 2B16A 1NPJA 3HB3D 3E2HC 3KR3H 4KVPA 3VTAA 3QA3A 4GIPD 1GY2A 2ARJA 2EEBA 1ES0A 3L5XH 3TP4A 4WNQA 2B20A 3SKMB 4U1IA 3DMMB 5DK2A 5K39B 2NY2D 1I4FB 3W11D 5JHDB 1DL7H 1FYHB 5FF6A 3CDGB 1P7QA 2FQGA 4XNUL 1AJ7H 3UDWA 2CDEA 1QHQA 2BSED 2AJ3A 3BDBA 3ROOA 2QTEA 2CK0L 3B5HA 4HBCL 5L2KD 4BQCA 2CQVA 3A4EA 4FNTA 1XGYL 3KPRA 3W1ZA 1GRWA 4PJBB 4PEEA 4TLUA 4AIZA 2QSVA 4K15A 1V5JA 2ENSA 2NY7H 3IDGA 3DI2B 4YHIB 4WKZB 1FC1A 4ZUWB 1NMAH 1VHPA 2P7TA 5E2UH 1GTFA 2NR6C 5B38G 4FI6A 4V2BA 1WAEA 2CMRH 4JS7A 2VM9A 4P0DA 3GXFA 1BG9A 1Q1JH 3NP4A 1S5IL 4N2OA 3EGDA 4XZUA 3NJVA 5GSRA 1J0HA 3U7AA 1BAFL 1ITBB 1BZDA 2AQ3A 3LKSB 5KYXB 3D4YA 3K6NA 4ALAC 3Q5YA 3LRSA 4CKQA 4WWKA 5HYFA 4KHTL 5E23A 4PIRF 1QR4A 3PWLA 5EN2B 1M7UA 5H37G 2E9IA 2WWKO 4M43L 1N64H 1T83A 1KTJA 5EBWA 5KYUA 5KOMC 1NBYA 3TWCL 4X9BA 1EXUB 5BOZG 1HJCA 1O5DT 5EUOB 3VYOA 1R24A 1IGJA 2PXYB 1QOKA 2AZUA 2HLAB 4DP0X 4I88A 1J0KA 4WI8A 3SQRA 2N3JA 5DRNA 3V4VB 1IILE 5INCA 2ENQA 3S3DB 3ET9F 4GSRA 2XCMC 2D3JA 5D9SB 1XH1A 5ACZB 3WFZA 3Q2NA 1Y07A 4AQEA 1L0XA 3SJVB 5B8CC 4LPVA 5F7DA 1VEOA 3T09A 4M6ML 5GS0L 3O2DL 5C0GB 1YMHA 4GO6B 4NQEB 1F2XK 2NUPA 1WQVT 4EQ3A 1WFNA 1VADA 4DVBA 1FZJA 3UZQB 2F5BH 3W0WA 2Q7AA 2VH5L 3M8OH 2XQBH 4P49A 4PREA 3HNSL 2CO7B 3VI3E 1OD7A 2ZNXA 4JKLA 4HJJL 4NO0D 2PW1A 2EC9U 1XGRA 4ODTL 4IRZH 2P43B 3BXNA 4UDTA 4DCQA 6FABL 1NL0L 2A9NL 3GSQB 1F90L 3AQXA 3WNMA 3IMSA 5FK9B 3TJHC 4AQ1B 4HYTB 4S2SA 2BHYA 3U9PH 4Y5XB 1YECL 1DQJB 2WBJC 3H3PH 3QP3A 3QUMA 3QXVA 4MYWB 1FL5B 4Y4FB 2X87A 1B9ZA 1KTDB 3HCVA 2A6IA 1FNLA 3ENEA 2D3NA 3CC5A 2K1MA 4H1LA 2NYYD 3Q6GH 4L2YA 2IQ9H 3BAWA 4OF6A 3ZUCA 2HVKA 1XAKA 4J3OH 5J0BA 3QFJB 1K85A 3NUKA 1A7PH 2MJWA 3FSOA 2PPFA 5TTRA 4F92B 3MV9B 4NM8H 4JRYA 3US9A 3VXMA 4MHHI 2LGNA 4DK3A 3SQBB 5IVXB 1I3RB 4H26B 3CU1A 1Z0MA 4HXAH 5JORA 1E6JH 5GHWH 2WKOF 3C8DA 3WUZA 4U3HA 4BZ1A 3C2AL 1EXGA 1EFXA 2BRRH 3CQPA 2FNWA 3TIEA 4HVBA 4M5ZL 2QSQA 3LNHA 3OTTA 1FCGA 4PJHE 1WWCA 2APFA 1BYOA 3B6SA 3DSNB 4PI0A 3VMNA 4AG4L 3RIFF 4QD2E 1RZJC 4LCWE 4H44C 4Y5YA 3OQRA 4Z7OB 5J1SC 1C1EL 5JHMA 5E8PB 1OWWA 1X9QA 3C5ZD 1OLLA 4POZD 4OF7A 4OGZA 3W3BA 5K9KB 2V2WA 5HGBA 4IKNA 5FS5A 2X4RB 2AW2A 1WZ1H 1KV7A 1W0VB 4JRWA 1FFOA 4WHCA 2CKNA 4Y4HA 5F7UA 2PPDA 1BCIA 5CEZD 3INUH 4XWGH 2G60H 3RHWK 2X6VA 2VDQB 3UTPE 2NOYA 2ZG1A 5FYKH 4NZDA 3QUZC 5EC2B 5BV7C 3LH9A 5DFAA 3H9SD 5DC9B 2RA1A 4GQPH 1WHPA 5DJ6A 1QACA 4JR9L 3F12A 1XSIA 4OQTA 2ZICA 1PZSA 3OZLA 4IU2B 3M46A 5AOKA 3L1OH 4F7CA 1JZ6A 4GRLA 5I0YA 5AW7B 4BK8A 4PJGE 1A6ZB 4WIQA 2F8OA 2ZUVA 1AKPA 4HS3A 1KG0B 1QBML 2D2CC 1EH9A 1N2RB 2FL5A 5I76A 2ICEA 4WVRA 1F97A 2VM4A 2AXFB 4PUBH 2EC8A 2W8CA 3GMMB 2HTLC 4XH2B 4MLIA 3MRMA 2GC4C 3HVDA