1XALA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate (soak)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
352
structure length
336
Chain Sequence
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDDINVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDMMLSDKKNDKQGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
molecule keywords 3-dehydroquinate synthase
total genus 113
structure length 336
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xalA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xalA01
4RFLA 1XALA 1NVAA 5BR4A 1DQSA 3W5SA 1NR5A 1JPUA 3OKFA 3BFJA 5EKSA 5HVNA 1JQAA 3RF7A 1JQ5A 1VHDA 4QGSA 4MCAA 1UJNA 3CLHA 1NVBA 2BL4A 4FR2A 3CE9A 3UHJA 2D2XA 5K8CA 1NVEA 2BI4A 3QBDA 3QBEA 1RRMA 5FB3A 1KQ3A 4P53A 3OX4A 1XAIA 1NVFA 1NVDA 1XAGA 1XAHA 3ZDRA 3ZOKA 1VLJA 1O2DA 1SG6A 1XAJA 1OJ7A 3HL0A 3IV7A 3OWOA 4RGQA 2GRUA 3JZDA 4RGVA 1NUAA 1TA9A 1NRXA
chains in the Genus database with same CATH superfamily
5JWRA 3E8XA 2JVKA 5DHFA 1FS6A 1N6LA 2ORVA 3LNTA 3E15A 4KL8S 3OWHA 5DTEA 1P19A 1AZTA 2GO7A 3LYAA 1YBVA 2PS0A 5J9FA 1F5NA 3LRXA 3MELA 3CKMA 1MW8X 4YP9A 4B6QA 1ZSVA 5C0OE 4YGYA 2OHGA 1D3AA 2PR2A 1VBMA 5EIFA 3QXXA 3QELA 4LCJA 3RHSA 1LX6A 4P98A 4QAJA 1RM5A 4I5EA 4ROTA 1U5CA 2ECOA 4JAVC 2FRDA 2D06A 2V96A 3WLEA 1QR2A 2J3KA 4HZGA 3RU9A 3T8YA 3WLRA 4CT4B 3K70D 2DR3A 4IFIA 1YS7A 3CUYA 1MB4A 3V33A 5EJ9A 2GVZC 3CUUA 3FR7A 3DNPA 3GDFA 4IWXA 4MP3A 4UHBA 4R54A 3W79A 5B3JA 5DE3A 2I6XA 2IC5A 1ETHA 1U6IA 4BNJA 3ZVLA 1SCDA 4BNVA 1J1IA 1RXIA 3EXEB 1EYZA 3FUUA 5E38A 2QRQA 3W05A 4CN9A 5H59A 4QWMA 1GDTA 1RHUA 3VNSA 2BEVB 2OESA 3JAKB 2FE4A 2Y9PB 4K3VA 1Q0HA 1VM6A 3CLHA 1DOAA 4WVLA 5HIMA 3TUIC 1F8UA 2WJWA 1SC6A 3KJZA 5EG5A 1MH9A 4J9UE 5G02A 5JH7B 1NM5A 2V5VA 5BMVB 1KU6A 1N2BA 2CVQA 2QLJA 2PTGA 3KJXA 2ZRLA 1U2PA 2JGJA 2O52A 3PRHA 1EVLA 3VJKA 1QU3A 3HU3A 1QYIA 3EODA 1Q6ZA 1K6MA 1PGQA 4CMHA 3P2JA 4B32A 4TLMB 5ADHA 2OLEA 3D0KA 5CPFA 2R751 2ZT5A 3EHDA 3HVHA 1U7ZA 5AW2A 1ZD8A 4W6ZA 8ATCA 1LBQA 3KKOA 1F2UA 3I9V6 3TI7A 2Q3JA 2B7LA 4XKJA 2O5VA 4U6QA 1O95C 2QGFA 5IJXA 5I7HA 3N8GA 1ZR2A 3HTXA 2QG6A 2NUAA 1KR2A 2OZLA 4V0RA 1UZMA 1ZJYA 3NTVA 4GO1A 4HDRA 4PGGA 2HU2A 4P4SB 2Y99A 2ZFUA 3JVVA 1A2BA 1GILA 1GSIA 2R3SA 2P4QA 1RAFA 2H1LA 4ND4A 1QZUA 4M9UA 4UUNA 3ICCA 4Q9KA 1U3UA 3K0CA 3EYWA 4MVCA 1H5QA 1YT5A 3GLHA 1EJ0A 5ARCA 1G291 4GX1A 4E2ZA 3VOTA 1HT1E 2HHJA 2WYOA 4C2TA 3C3CA 5EQJB 5KKAA 3WR5A 1U8UA 4M46A 5JEEA 5EP3A 3FGZA 1PKEA 5FTNA 1G5IA 3EZ9A 3NGLA 3HFJA 3L02A 4IYRA 4V39A 1PQUA 3OU7A 2BFWA 5DGCA 3MQ2A 2CFOA 4B6EA 3LO8A 1XCBA 3NEYA 4IG4A 4I4TA 1NBME 5EQTA 1J8VA 4CQNA 1B0PA 3K0FB 3C5EA 4YJHB 3C1TA 3PDIB 5SICE 1SCQA 4AO7A 1VB5A 1I9GA 2JARA 2FP4B 2BFDA 3CXUA 2WMYA 1XR3A 3LDAA 4P3XA 5JSQA 2C7BA 3LBHA 3PNSA 2HU7A 1OXVA 2PH3A 3WLPA 1CJUC 2IHYA 4KIJA 1H8HD 1SR8A 4YJFB 4WKCA 1FVFA 1NF3A 1WW3A 3QVXA 1Z25A 3SZOA 3LPDA 1QGUA 2UU9B 5DHQA 1J0DA 1EVJA 2VSOA 2R84A 4G2NA 3URKA 4ZRDA 4ZIRA 5AVYA 2BFPA 5AJWA 3Q40A 2HRRA 3EGWA 1JFFB 4NQZA 4UU7A 1GZSA 3SZGA 2VDKB 5DIZA 1E2JA 1K89A 1JQDA 5FORA 1GVNB 3NTXA 5KYXA 1KFKB 1WUIS 3IKJA 3IPYA 3KHKA 3ANXA 1UMBB 4K6FA 1D0IA 1U7WA 1LKZA 1KYVA 3GD7A 4G5YA 3ZI0A 1HFJA 1F3OA 1RBZA 3KLOA 3CLTD 3STYA 4UVHA 3HH8A 3KZNA 1AD2A 3U9TA 4D74A 1GJRA 2BGTA 5CTJA 5LMUB 1A8QA 2PANA 3EAGA 1VFPA 4BCBA 3UXMA 1TQ2A 1EX6A 1ZH0A 3E0QA 4JC0A 4CM7A 2J3DA 5KUTA 1HDGO 2GEUA 1A8IA 1HT0A 1RI5A 1DBSA 2C8KA 1KI1A 3C4JA 4D0RA 3JRWA 4XD7A 1EP3B 1JYFA 2ZJ6A 4KQXA 4QTTB 5FFFA 5I7UA 1I8TA 4V3BA 4U1RA 1JFVA 1IY8A 4L4RA 4EA6A 1CSEE 2ZPTX 3RT9A 5LWQA 1EXVA 4G0WA 2YQ4A 2YQ5A 4HK4A 4WGGA 2FWJA 3LPNA 4TTTS 2JKYA 5CB0A 1JRLA 1LI7A 5HIIA 4AZTA 3GPBA 3OT5A 3T35A 3TF5A 4JX8A 5IJZA 3RTCA 3TLJA 3LLCA 2XBUA 5B4VA 1U3WA 4L15A 3CKKA 5AHKA 5H4HA 5EZYB 2W6QA 4XM0A 2ZXUA 2YS7A 1DB3A 2PMKA 2Z83A 5BURA 4KQ6A 4G01B 1EUZA 3VR2A 1ZM2A 4P3PA 1E99A 3NQ41 4NBKA 5DJ5A 1DPGA 3GP3A 3QZUA 4F84A 5KSOA 4S1VA 1RVV1 2XWBF 4FHEA 5BQ5A 1V0JA 3FPFA 3AI3A 1QGYA 4HZUA 1UODA 2P0AA 2ZRDA 4RKRA 5IJAA 3GJZA 3SE7A 1N57A 3TSZA 2ALJA 1DJPA 4U6SA 1OLSB 3M5WA 4YP1A 3QFRA 4K88A 1SEVA 3IOCA 1NXSA 3EXIB 4LY6A 1RWQA 4OU4A 4E22A 4B8WA 3KSRA 4MVWA 2A5LA 3HFGA 4COOA 1K7FB 1Y1RA 2PO5A 1H5UA 3R5FA 2R65A 3CLTC 3GCWA 4QUGA 2AEEA 3OQNA 4MWGA 1H22A 3UHAA 1PLJA 4ZRNA 2JJ2D 1IEXA 2P2GA 3OLCX 2PJDA 5CTAA 4IS2A 3FHOA 1EE2A 3TRDA 3G8DA 4UU8A 3SBXA 4FMDB 5D3ZA 4QHYA 2FSFA 2CKMA 3KEFA 1OI4A 3NEAA 3L0IB 3U4AA 1E66A 3COJA 1UEXC 1XP5A 2BEKA 5CNJA 3H6KA 5LXTF 3C6BA 3CS3A 5JADA 4BGDA 2CB9A 3COPA 5GTDA 5E95A 4RWZA 1S4MA 1LC3A 4UCWA 2R7LA 1IVYA 1HUQA 3GJ4A 3L5KA 3SPXA 3T1OA 3OFVA 1NA5A 1R9MA 1LI5A 3Q8WA 3HM9A 1VE7A 2B4QA 3KIPA 4G0PA 1NSYA 3Q4GA 2NTNA 2BDTA 1Z5VA 4KODA 1J49A 3KXDA 3UPTA 2HSWA 4F9GA 3RABA 5JROA 3QNUA 2V8OA 3VAYA 2PUGA 4GEGA 4CUZA 2AOWA 3NR2A 3U4IA 2XRFA 1MV8A 3ROFA 4MQFA 4DIFA 1IMJA 3IR6A 4M22A 2OCYC 1TJNA 2ZRKA 4WZBA 3L7AA 1RD4A 4DM4A 4I1VA 3STVA 3NTRA 1SUSA 1G4AE 1H6AA 3C1AA 1WO8A 1WUYA 3LLSA 1LBIA 3DNMA 5CA1A 2C7OA 4L73A 3E6AA 3DFUA 3NDRA 3W5AA 2OCLA 3NHBA 3SC3A 2ZAOA 2YHUA 1QIGA 1QGDA 5DXFA 1YJBA 2ZUBA 5JPDA 4UPDA 1EUCB 3H18A 1Y6RA 5KMGA 1LWOA 1NVKA 2L2QA 2O6LA 1HDXA 3LYUA 3KJHA 4GE3A 5F35A 3B1ZA 4QGGA 3LX5A 1U2SA 4C30A 3NOQA 2XUOA 3HO8A 1K92A 2IZZA 3EMBA 3QFSA 4C0HA 2A8YA 1YB7A 1QR6A 4XFJA 1J2JA 1KF0A 2VHQA 4JHXA 4AMUA 5KOJA 1FBNA 3QSYA 2W70A 3R7NA 4UM9B 1JEDA 1YU9A 2WV7A 4YB8A 4HS9A 4ZFNA 3QG1A 5B7NA 3U1VA 5K6AC 1ENZA 1GZUA 3B1KA 3QOXA 1GTSA 4E5PA 2J9RA 1FRNA 1UKZA 3FCEA 4KMMA 2P30A 4CKWB 5IS2A 2AFHA 3IEPA 4OSPA 3DLIA 1T4CA 3G7UA 4YS6A 1OA1A 3WJ7A 1OILA 4YGXB 2BFNA 5DHSA 3ZYCA 3HO1A 1NI4A 4PPYA 4KR2A 4HMPA 3WA7A 4BCDA 1BS1A 3QKTA 5KAPA 3TRIA 2C4MA 3LVQE 4QNNA 1RJ9B 4AF8A 4KFRA 3OIWA 4MQEA 1C0KA 3ORRA 1E0JA 4MARA 4NNJA 4DDWA 5HX7A 2WWIA 3T7EA 4J6EA 1CUEA 1HH4A 1PNTA 3NO4A 4RF2A 5C7OO 2H3HA 1KMHA 1OPXA 1YRBA 3DE3X 3IYLW 5I9SA 3HB9A 4RLFA 1QZXA 2M6SA 3B9RA 4XVQA 1D8AA 3VR1A 1P5ZB 5J47A 2ZCJA 1L7AA 2VP6A 2Q4BA 1CVLA 5DH9A 3INGA 4KIWA 3UXEA 1UWCA 3GJ8A 4WJKB 2C61A 4FD2A 2B83A 3IT2A 5DM70 2FUEA 1HKUA 3K0EA 2FZ4A 3NDJA 4TTQA 1U6KA 4E5YA 1KH3A 2QPLA 4FXPA 4ZK6A 2R8BA 3SGLA 3KPVA 4V2UA 1XD9A 5D3QA 2ILTA 1CY0A 3V8BA 3WRVA 1JV2B 1OT3A 5EMKA 2DF8A 5MN6A 1HL7A 3AONB 3N86A 4YT2A 1V5FA 2ZIXA 3FPGA 4MJXA 5I9BA 5SZHB 2AYZA 4J8PA 1ZNYA 5HZGA 5JNLA 1YZLA 2ST1A 4TRRA 4DYDA 1CIJA 1KAOA 1FTGA 3DA8A 2PXAA 1B6GA 2ZETA 2NZUG 3VTAA 1QHGA 1VOTA 3HDYA 4MJLA 2ZVJA 3FGNA 4NDNE 4J07A 3NV7A 3U4QB 2E3JA 3RC9A 2WFLB 4EDFA 1D9XA 5CT5A 5KNCH 4XYGA 4L9SA 3WNVA 2ORED 4P4LA 1C41A 3HVIA 3RS8A 2IEGA 3V1UA 4A0SA 2ZJAA 4V0LA 4DLXA 2UKDA 3QFTA 4AL4A 4EJSA 1QIFA 2GZSA 4H7KA 4JSRA 5TE9A 3ZIDA 5IASA 1DQZA 1K3FA 3HJCA 1PFYA 3C3BA 4Q4JA 3WIVA 4C4RA 4KGZA 3ZGOA 4OHFA 1Q0TA 5LBIA 1AT1A 3L8YA 1Z13A 4Y1EA 3HCWA 4I55F 2XNDD 2AR0A 2WYIA 3AUFA 2WJJA 3MWFA 5TPZA 2VR1A 2YUIA 2PL1A 1GTMA 1W88B 5M04A 3ZZMA 3ZGZA 3HWSA 1MX3A 4RL4A 2YCBA 3E9CA 1KYIA 4NU0A 1LBSA 1Z17A 3PU6A 4J2OA 4JR2A 4EI8A 1Q7BA 3S81A 4OM8A 1P74A 2QQGA 1A5ZA 2DFNA 1V4BA 2QN9A 3RS0A 3ZEIA 1EXDA 2QPTA 4NZYA 1FW6A 1J09A 4PXAA 2FPGA 2FE1A 3U5ZB 3RSOA 3I0MA 1WP4A 1AHHA 2OHFA 4KXLA 5DI9A 3SG0A 5K20A 4MCJA 4RA9B 3RBVA 1D2EA 3FNGA 3CUKA 1C8BA 3TEFA 3AY3A 2KE5A 2VT7A 2O8VA 4R0VA 4KQ1A 1MBZA 4FS8A 3UB4A 2ZWOA 3KVNA 3HMKA 2R8OA 1QP7A 1QHYA 5DULA 1E79A 3O1JC 3MSCA 1Z35A 3IQWA 4NJOA 4GRAA 3W8FA 1R6DA 5DMXA 5L3SB 1VGRA 2JA2A 3P9SA 1YJAA 3G2KA 4M1WA 4E5MA 1N6PA 3BB1A 3OCYA 4NVRA 3VGPA 3S1SA 3ICPA 3AFNA 5K8LA 1DRVA 1FF9A 3TMKA 5L3RA 3VV3A 2R79A 1ONBA 4L2IA 4OLBA 4BN0A 1U1CA 4YMGA 3VR3A 3H1GA 1C7RA 2EJBA 2BGNA 1PDWA 2HDHA 3QXGA 2ZRGA 4D9GA 4KKVA 4C22A 2Y71A 5T67A 3V3KA 3I3SR 1RAGA 1CQZA 3UCFA 5A7HA 1JWAB 1XAJA 2DHDA 2GO1A 4DY4A 3L6CA 1Z6XA 1E9EA 2B3TA 3BMNB 1AS3A 4MR7B 3HRHA 3N8KA 3AHDA 2CNNA 4HC4A 2C92A 1E3MA 3S8EA 1WDMA 1D1QA 4RO0A 3IPLA 3U3MA 4YUAA 3RSSA 2HYDA 4ARBA 1QG4A 4UMDA 1VLMA 3H84A 1NXQA 4NDAA 3UK7A 1V3TA 3DDCA 5CB8A 2YIDA 2O3RA 2QQ0A 3B5IA 3VNRA 2PUEA 5ESWA 1QF9A 3W4JA 3NPMA 3F8SA 1II8A 3UHPA 3W7VA 1V71A 1KS9A 1XEWX 2GYYA 2OQ2A 3FZQA 3MEQA 1E69A 2A1UA 3CUSA 3CF2A 3KZXA 1G2OA 4OXRA 2QUHA 3V55A 3RHFA 3ZWQA 3PV0A 4GP6A 2DPXA 4W7SA 4HWKA 4PZYA 4DWOA 4MV3A 3AF3A 1F4PA 1SG6A 2M9MA 2XA9A 3BERA 4XM1A 5GY7A 4KOEC 1MO5A 4J9VA 4TYPA 3NWBA 1YD7A 4WY2A 1E5QA 3AM3A 3UV7A 4ZOLB 2ZIFA 4FS3A 4DZTA 3FZGA 3MCVA 3QX7A 1II0A 2GBIA 3DZFA 4P3KA 4PZCA 1SQ6A 3CCFA 3HLKA 3I72A 4RA9A 1G8HA 1R4MB 4XWGA 2PS9A 1CF2O 1T3ZA 4R98A 1FSGA 5B3KA 2JFNA 4TTRA 4MW1A 4YROA 2M6KA 3M33A 2LXNA 1NLYA 3KDAA 4FFPA 4JGGA 4E7OA 2J59A 2JIQA 5IM5A 1GPKA 4HBGA 2JEZA 1ZUHA 3OQIA 1CE8A 2FW7A 3JQ8B 4KGDA 4O0LA 4D5GA 1J23A 5KYKA 3KVYA 4MB2A 4L2IB 5ES4B 1YL5A 5BVHB 3ROQA 3NI2A 5FWXA 4MTCA 5EUBA 3VR3D 5EUCA 4DMHA 1FDUA 3GLTA 2IOYA 4W82A 3TGLA 3X2EA 2PKQP 7REQB 4BAGA 4HPXB 4W5JA 3WYAA 2VPXA 1GG5A 3BE4A 4FI3F 4M0FA 3RU7A 1P3JA 2DFPA 2FKAA 3NXSA 2I2AA 4XGQA 3RVPA 4NEGA 3QM1A 2IYEA 3OVMA 2J6HA 4RJJA 2BE9A 4G9BA 4CTNA 2LKCA 1XL1A 3VU3A 1EVIA 3PQ7A 4WQMA 2OECA 3MJRA 5DYYA 3SC4A 1PV4A 2VXCA 4FR0A 5CM9C 4I6GA 3SFVA 5A4AA 3DAPA 3MJTA 4CTJA 2D1SA 2ZTVA 1BHO1 3CGWA 1NRXA 3D5EA 1WPRA 2RAVA 3AUAA 1B6TA 3ESCA 6LDHA 1XZQA 2P3SA 4KGXA 1JLRA 1JPJA 3CVJA 5E4JA 3UUFA 4EGSA 3JYNA 5JD3A 1GSHA 2F90A 3W5BA 3K70C 3IESA 3PD7A 1LCIA 4PSKA 5KKNB 3K0HA 2ZRAA 4EYQA 4F7DA 4HFRA 2BL4A 4JT8A 1IK6A 5B64A 3U13A 2QM7A 2NSLA 4X8HA 3IVAA 4IH1A 1VL5A 5H16A 2JIZA 4CFZA 2WQ7A 4FWTA 5F2NA 1XP8A 1Q0ZA 2FZLA 1S96A 1YE5A 3KEQA 4IQ8A 1XCJA 4RD0A 3MXOA 3E8SA 1T8YA 4UAGA 5HQJA 1VL0A 1MUUA 3KT6A 3SSAA 4HVCA 1NQOA 5IF3A 2HA7A 4CU2A 3FUTA 1SXJD 3RJ9A 5JFOA 2OCAA 5JLAA 2QLTA 3ZKAA 2I4NA 4TV9A 5GADl 3KJGA 2X1VA 5L8VA 2P2DA 1M6NA 1T13A 3E9RA 1VXOA 3ANMA 3C7KA 4BNYA 4PZ0A 3ROKA 5JR3A 4ILKA 4UZFA 2FMXA 1W87A 2IYNA 1KBZA 4QQRA 1XFDA 3F0TA 3JZIA 2HSZA 4N49A 5FUBA 3WLOA 4AKTA 5JMWA 3ENKA 1XTQA 3H2KA 4QM6A 3ZZTA 1P62B 3FCCA 4IOLA 1K9VF 2GS9A 2QMOA 3L0SA 4P32A 3BCHA 2ODPA 4FEEA 5EN4A 3FTQA 3NHZA 1R5NA 2QKYA 2FP4A 3UWSA 3U3KA 3HJBA 1GU1A 2JDID 5B57C 1EQAA 3HP7A 3DP7A 4H3HB 4Q93A 1RU3A 4FGSA 4B4DA 1YONA 4P1ZA 2GESA 1DV1A 2O06A 3GXBA 1AXRA 4L4XA 3QOFA 2AFRA 2FXVA 4O4IA 1A82A 5CR9A 4D0GA 2OHJA 2HLPA 5CDTA 5CLGA 2GJAA 2ZYWX 1FUIA 1T1RA 2D1YA 2J87A 2LZ0A 4HRVA 4JKIA 3GUHA 3P94A 3R5KA 3Q3IA 2WKPA 5FNVA 1YDEA 1KZ9A 5K99A 3MTEA 3DHEA 1DKLA 2C78A 2IYWA 4TMWA 4LNUB 5JTUA 4Q4LA 4WDQA 5CCBA 2CFTA 1VRCA 1GPNA 3DPIA 1Y8QB 2FPMA 3B1VA 5DTMA 3DMYA 2R8YA 1M1YB 2CVPA 2D74A 2ETXA 3CPHA 3Q3HA 1E4EA 4KK3A 4LZZA 5EP4A 3ZLJA 1XRJA 4AY2A 2GQ0A 4AN1A 1MABA 3TQHA 4R1MA 2IP1A 4DGQA 1B0UA 4FFBB 1HXHA 4FLMA 3F4LA 5LQKA 2W2LA 3WGJA 1ZEMA 1O9BA 4ER6A 1G21B 2NACA 3TSWA 1N7GA 1TT5A 2I7TA 3KO8A 4O29A 3VBCA 4MLPA 2ROQA 2AR7A 1UBGA 1J56A 3I6YA 4PQEA 4CQLA 3ZY3A 4N3NA 1NXTA 4CMGA 3T5AA 2UYCA 1C8LA 1Q57A 2IIPA 3UY4A 5ETJA 1G8PA 1ZW6A 4EB0A 4QVIA 1WB5A 3PFWO 5JPIA 2JLYA 2QAGA 3BF8A 2NYVA 2J1LA 3HR7A 3IDQA 3KV3O 3OFJA 2VDQB 4MW7A 5FOWA 4CLRA 1NNI1 2IVFA 2R00A 3IEIA 4MKRA 4ZO6A 3I76A 2ZUVA 2ZIEA 4JT2A 4Y2SA 4EJSC 1PVDA 3GEIA 2BFAA 2MSCB 5DM2A 5A4KA 1ZM7A 3ANLA 1R0KA 3GDHA 1I3LA 4QFMA 4EYOA 5JWOA 3GJ6A 3RRXA 1OLUB 1E8MA 1G9XA 1ID1A 1XCLA 2WTXA 4LISA 5KWEA 5MFPA 4OMFG 4BP3A 3LFTA 1A2QA 1DMRA 1UDWA 1T0IA 4FMPA 2HX1A 3GLVA 3HKDB 2C2KA 2R6R1 5AM0A 5LB4A 1WJGA 1GUBA 4FQ7A 4I4NA 1XCMA 1FQKA 2FETA 1BGWA 3N8IA 2QN1A 1J20A 1FYFA 1EA7A 3FNIA 2QV7A 3GZTB 3QEOA 3KR1A 2HU5A 1FYDA 2ZBEA 5EWMB 4HRXA 4XTCS 3BK1A 2HEGA 2C1ZA 2R5NA 3GMSA 3MCWA 1LEHA 1FRQA 3IXMA 5CW1A 4AUKA 4EHNA 2WK1A 4RK1A 2UZ1A 3ERCA 2OOSA 1DAHA 1IVNA 2EBHX 2JIOA 3VU1A 3Q7PA 4KDFA 4LSGA 4RFSB 1GG9A 2PUVA 4J0IA 3ULKA 3IP1A 2RCYA 4YPOA 5KNDD 3EISA 3NAMA 2Y0BA 1LBHA 4H6XA 1NASA 4MYDA 1L7MA 2YTZA 1T8WA 1JAZA 2CMFA 2DSTA 3QLUC 4JFAA 4XD7D 3GLIA 2ZIAA 2WJ3A 3WDKA 2CKDA 4BVBA 4FYXA 4G1EB 4BJ6A 3EIHA 2AI3A 2C84A 2I3ZA 4FZ3A 4EMTA 3U44B 3ADPA 4C78A 3TOZA 3I2GA 4PG4A 1KYZA 4TKUA 4EB3A 4LXTA 4C6RA 1LTHR 4QA9A 1KS2A 2YRFA 4ESEA 2J0SA 5AVXA 3ENVA 3BFVA 5ENDA 1U28C 2P11A 4GXTA 1UAYA 2IBMA 2ZIWB 4D57A 3C5HA 5I7OA 3VKUA 5LU9A 3SWWA 3RLIA 4B75A 4HYTA 4E2YA 5JQWA 4E07A 5HUQA 5AVJA 2DRIA 4DZRA 5ALLA 3NT5A 3WG9A 3AVPA 1UF9A 4IGAA 4NG5A 2JJ2A 1W9MA 4MKIA 3AHEA 2O2DA 2NT4A 1LVUA 3NFRA 2OO3A 1ISPA 2P0YA 3FY4A 1VCHA 3LFHA 1ZH2A 4AIIA 5I7VA 3FF4A 2QRMA 3NWOA 3HUUA 4F3TA 1NVTA 1IJKA 1G2QA 1GL6A 3AR9A 3H0EA 1YZNA 3ZX4A 3ZCQA 4N9QA 3OPXA 4LE1A 3H2ZA 2ATIA 2EV9A 3KR0A 4UMFA 2GK7A 1V5GA 1Y4SA 2XZDA 4KE8A 1FS4A 4FBGA 2JK1A 1W0KD 2V7PA 3I4CA 3SZMA 3ZQ6A 4HAVA 4O1HA 5ECDA 3AB7A 1QFYA 3NHMA 1FVXA 1T9GR 1RNLA 3PFHA 4LPSA 3W8NA 4AIRA 2FPRA 4BFSA 1WHTB 1H0HA 4R2XA 5JI2E 1EFVB 1IU9A 3HBNA 3DXYA 3N2GA 1N6RA 5DDIP 3LPAA 1BXZA 4CJXA 2F7SA 1ST2A 4J43A 3UPDA 2R6HA 2VEOA 1DCKA 3I34X 4IQGA 5JPCA 4RD3A 4BX0A 1XZNA 1WD7A 4DIKA 1CQJA 3SU8A 2A0UA 4J94A 4M8NE 4ZCSA 3U6KA 3LY8A 4UTXA 3T7TA 5HGXA 3C98A 4KLRA 1U8XX 3IKVA 1ZKDA 2VN8A 1ZN9A 4Z99A 2XMPA 2LV8A 3S29A 1TAHA 3L7MA 3V1LA 4QU0A 3ND8A 1I7NA 1L4LA 2W6NA 2X15A 2Z1MA 4LE2A 1KWKA 2VL7A 1D03A 3MS2A 1B8VA 4AY5A 4DNFA 1KQGA 3JR7A 1E3LA 4O4IF 5E8RA 1ORWA 5DM1A 3ZXXA 2XMSA 4LYAA 5U9CA 2QLLA 1S89A 4DR3B 1X8LA 1F8YA 2IS4A 3PXCX 1MW9X 3NXKA 1CUYA 1ILEA 1MH1A 3M9LA 1PSWA 3PDCA 1L9XA 4LVOA 4Y0NA 3RYIA 1QKIA 3P9QA 1M66A 1EVKA 1U1GA 3MT8A 4DLYA 1QGZA 1JAHA 3LLMA 3NKLA 1ECCA 5CK5A 2ET6A 2YJ6A 2EFYA 2KWIA 2QF7A 5AJXA 1X7HA 4LXYA 2GB4A 2X8JB 3SFZA 1E4OA 2G9ZA 3RWMB 1XN4A 1DTWB 4CCAA 2HIGA 4MCAA 2VKQA 3IBFA 3KSZO 3HL4A 5IUJC 2XD9A 1EJ2A 1KI3A 5JAHA 1V9LA 1IHDA 1RXCA 3BA6A 3MBIA 5IRCD 3WNQA 3HO6A 4KYTA 1EP9A 4L5JA 3RO7A 3VR4H 5GQSA 5K5EA 4YUVA 4B47A 4NZZA 2W8BB 5FTWA 3OTOB 1XZFA 3CIOA 1EK1A 3ITKA 3OOJA 2I6UA 4MRVA 4D9EA 2ZIXB 3AIOA 4G97A 3GLFE 1Q1NA 3W1WA 2OBNA 2XDYA 4ZC1A 4DLWA 1H8HA 2H1WA 1LDMA 4AT1A 1OWLA 1N4AA 1L8AA 2VH1A 1AUVA 2J7KA 1KDOA 1JG7A 4OA8A 3IODA 4QG3A 3A6DA 3D7LA 3IOEA 4OXXA 2G88A 5G3ZA 3AVWA 4DANA 1B8UA 2WPDD 1COWA 1JDNA 2PZMA 3MJCA 4R6WA 3RS4A 4EEZA 4HJRA 1U0FA 3MT0A 4ND5A 4EJSB 3KAQA 2PUBA 4BU0A 2AK3A 1PYGA 2F17A 4IDBA 2WAXA 3ZN2A 1L5ZA 2ZBVA 1ZM4A 2YV3A 1F6WA 5DLQC 2EZ4A 4ZEVA 1U2QA 4EW1A 5B55A 3H2SA 3Q7QA 3RFXA 4WHMA 3WYNA 3CSSA 3C7AA 4CLOA 3T3EA 2D7CA 1RWBA 1WXHA 2L19A 1S2NA 1UJMA 3TIFA 3UT5A 3VH1A 4R3UC 1WHTA 1ZMBA 1E1RD 4NEHB 1RQRA 3ETLA 5F2KA 2X5JO 3CZ5A 1HT3A 1QHXA 1XGKA 3L7IA 3QVUA 4QL3A 2RGGA 1GLGA 3ZDCA 5GONF 2GBPA 3LT5A 2PDAA 5K3FA 4P5PA 2L0XA 3A26A 5TVKA 1IXZA 2D2EA 2QD5A 4L4UA 4V0KA 2D0DA 3IUPA 2X42A 2ZW9A 4ZQBA 3SZRA 1KH1A 3ZDRA 1D4FA 2D3WA 4G8BA 4NDZA 4OSOA 5AKXA 5JDIC 2VUSA 3LCCA 4EGCB 2LTAA 5HM8A 1E6WA 3Q7SA 5ICFA 4B44A 2KSQA 2VDMB 1OB2A 3DW1X 4NP6A 4WZAA 2JHFA 3R8FA 1XBTA 3BQMB 3OI7A 1EM6A 5BNWA 4ND1A 1Z0IA 3Q15C 3EXEA 3IV9A 3K0AB 3EUWA 5F98A 4J1TA 3JALB 3UYLA 3U44A 3SJZA 2PCLA 1FPQA 3EAQA 3OJLA 4M7OA 2VNIA 1BU8A 1U2GA 3ILXA 3TSAA 3IQIX 5EWMA 1RIFA 3P26A 4FN5A 5BMVA 4KPYA 4C04A 3EBOA 3S8YA 3E61A 1DWQA 1NU8A 1I6MA 1MJFA 1UZUA 2NTJA 1B6SA 4ATNA 1QLJA 4ZO8A 4WKBA 2GOYA 1T5LA 1V9SA 3PDHA 1THTA 3RBAA 1NUQA 2A9QA 3ZK9A 1P0PA 4F38A 1TK2A 2FN8A 3O82A 2DYKA 2ZTHA 1D1PA 5J1SB 3RARA 1UJCA 4TQ9A 4MGIR 4RH3A 5FJJA 4A26A 4FJ2A 3Q0EA 1A9OA 2O2HA 4G0VA 3O26A 3B3FA 4ZQHA 5KOYA 1OQAA 1EAYA 3I04M 2BEJA 1QBKC 3E9MA 4JGBA 5J2TF 3D0QA 1TAQA 2Q2WA 2X6RA 5AVUA 2GH1A 2QAIA 4G4SP 1M33A 4DMRA 2IPMA 3DEIA 3E3AA 2BFFB 3QVOA 3A6PC 1IJEA 3QITA 2XOKD 1QF6A 1SMKA 2Y68A 4CF6A 4QGBA 2QJWA 2HIHA 4URYR 1YVDA 3ESAA 3DAOA 3G8CA 3EPRA 4RDIA 4RPJA 3OEED 4RQTA 1QHFA 1ORHA 2PD4A 1PRYA 1MAVA 3PPWA 4W9NA 5DNVA 5GONB 1VA5A 4FBMA 1QE0A 3G6WA 1DPFA 1JGTA 1UQUA 1A76A 3GFPA 1QC5A 4HAOA 2FUCA 4UUBA 5E9QA 4ZOQI 2BR3A 2BZSA 2CK3D 2WOJA 3O4JA 2FHSA 3U31A 3K8YA 1ZR4A 4LJSA 1Q21A 5AJVB 3F7NA 2VHWA 2YJZA 1IIBA 4AJNA 5KYUA 5E7IA 3A9WA 3JW8A 2XNJA 3RODA 5T6MA 1LVGA 5EESA 5M7EA 1GG8A 5K8UA 2AG8A 1EGMB 2GAAA 2PSSA 1BX0A 2BHNA 3JRNA 3BGIA 3GA7A 5FH9A 3L77A 1U2TA 3TEMA 4ZTUB 2B1IA 4ZXFA 1PS8A 4O6VA 3QV2A 1JR3D 1JIUA 1G5HA 2O0JA 2QL7A 4XGRA 2BSXA 4C6SA 4FLEA 4PO9A 2OXCA 4MW4A 5AMXA 4AXBA 1KKMA 3UOAB 1E5TA 1XOIA 10MHA 1XZLA 2R7MA 4RUKA 1QOPB 5KSYA 1IRIA 1HOXA 4N3CA 2CLSA 1GNPA 2P6UA 3DEZA 4DCUA 3DJFA 5BW5A 3FHCB 3HJNA 3IPRA 5DBOA 4N3BA 3GFTA 4FXOA 4POOA 5JC1A 2YR0A 3E81A 4BV9A 5CVUA 2XB4A 2X2EA 3QKUA 3T06B 1EINA 3OE5A 1WX1A 3AV3A 3SLRA 5ALJA 3BKXA 4XB2A 4AMYA 3EIUA 2FZVA 1RADA 3BIOA 1Z3CA 3NB0A 4TLBA 3CVUA 2PMDA 3WMXA 5G4LA 2HIMA 3ZE8A 3RYIB 1FMJA 3L3BA 1NBMD 4D98A 1A5AB 1KAHA 4ZVQA 3CN9A 2CJFA 5FLEX 3JSXA 1EGHA 2ZE8A 3SHOA 1JJBA 1NJ1A 4G86A 3RWOA 1RS0A 1XZAA 4LRQA 1KJIA 4OHCA 3WGNA 5TY0A 2IU6A 3WGHA 1P81A 4W5TA 5ICSA 3PSHA 3U3XA 2VNHA 4HNAA 5IJ0A 1Y9JA 2JATA 1A7KA 1EB8A 2IOQA 5T8KC 3EJWA 3SX0A 1BJKA 4OQXA 2Q5IA 2TRSB 2ZVQX 3IS3A 3LKVA 3PIRA 3QBVA 5TQJA 5DW3A 2V7QD 3FDZA 2UZIR 3ES9A 3WB1A 2CD7A 3VZBA 2PX4A 3IHKA 4LC0A 1RT9A 4QJ4A 1B3RA 1J0AA 1UR5A 1PQYA 2BM0A 3KFXA 4IS3A 4KQIA 2BC9A 1NVWQ 3I30X 4NAHA 4QOGA 4QEZA 4O4JF 4HDAA 5HKAA 1K1EA 3T9FA 3BQ9A 3RAPR 3D6HA 3IIJA 3DFKA 3IP3A 3OEYA 4IRMA 2EG5A 2GFQA 3RVJA 2YWEA 2IELA 5AI5A 5LP1A 1DP4A 1BHQ1 1T2FA 1VSTA 3TS1A 4DXHA 3WLQA 1O5OA 2WDZA 1G63A 4L8FA 4B73A 4F1WA 2VYND 2ZE5A 4FU0A 2PXXA 4Z2YA 3X0DA 4C6HA 2P40A 4LMBA 5FP0A 3CVVA 4CT0A 4ZREA 3G0BA 1W46A 3G9TA 3SC2A 4YCBA 1T5HX 4K9KA 4GH5A 2DJIA 3FG9A 2QRNA 3BZUA 3LUAA 2HJVA 3ICQB 4GGMX 1QG0A 1SVSA 1P8AA 1U7UA 4WGFA 1E6UA 1IBLB 2UYGA 3SBOA 1R8QA 3RAEC 1RWPA 3TMAA 3KR2A 1F1BA 4EB8A 3T3MB 2W22A 4X84A 2IX9A 3AMVA 4KNYA 3Q41A 4L7VA 5CDGA 2SICE 3TLBA 3PJGA 3MGBA 3O9MA 3SDZA 2ZUCA 3HCCA 1XVVA 2VP3A 4MYCA 3VSDA 4A0RA 5AW6A 1YFJA 4NJMB 1FP4A 4R7TA 5I7RA 2I4OA 1Z0KA 1ZLXA 4Q3KA 4EG7A 4H59A 4EG1A 1I1HA 1MABB 3LKBA 5ER9A 5A06A 4DC0A 1K8QA 3SD7A 4TZ0A 4KSCA 3EY9A 5K0GA 1YRHA 3DTNA 3RRNA 4ESVA 2B37A 2DULA 2P9HA 5H3LA 1KDYA 2F3QA 4QIHA 1O58A 4X8LA 1PIWA 3Q8KA 1Z0UA 3GYGA 3QYAA 4XRRA 5TNXA 3EZFA 2C07A 4RTNA 1C4XA 2NZWA 3RLFA 1FL9A 4RIIA 2VZ9A 4QU8A 1NXVA 3JD2A 3ZHRA 1S8FA 4QU5A 5AKLA 4XYLA 3SQWA 3RRMA 4M8KA 4TTSA 5AHOA 3AK4A 5FO1A 1MC1A 5CA1F 2O48X 2NZXA 4WESB 4RAOA 1ZGZA 3LU1A 1XTJA 3PUHA 3V2UA 2XZTA 5AW0A 4GVPA 2WM3A 3QXJA 3VR6D 3KQTA 2XI4A 3A9SA 2X77A 3FH0A 1QQ5A 4IXWA 1C7EA 4MOWA 3LOUA 2YNMA 3AFOA 2UYOA 1J9EA 2HQOA 4FJ1A 1YQXA 2XUPA 4DTIA 4EGJA 1MKYA 4RS4A 4U2FA 2G1JA 1WCWA 3AI1A 1Y1TA 2OUIA 3MUNA 4B33A 5EKTA 3KUDA 5K2MA 1T8RA 3ORQA 4IFTA 5LUAA 5E4FA 4ZOLA 1K08A 2WIKA 4JLJA 1OFTA 2PL5A 3E9DA 3F4BA 3IEUA 3M6XA 5AVTA 2WIGA 3LP8A 3HVUA 1RKBA 2COEA 4GQAA 3D2AA 5JAQA 3U7QB 1LJ8A 1XNGA 4BLPA 4CG1A 4CMBA 2P67A 3B13B 3IQZA 1QK4A 3ZG6A 1PV1A 3CCCA 2XNDA 4YO8A 4ZICA 3ZH2A 2VS1A 4YJHA 4P93A 4QOJA 5AVVA 1ONNA 2ECFA 2UZ3A 3O6VA 4KWHA 1DAGA 1FUYB 2NZVG 3IDFA 5D00A 3W5CA 4LF8B 2RGNA 2QTNA 4GICA 4XVRA 3SHTA 2IS6A 5IBCA 4II3A 4I1IA 3B5JA 3UEOA 1RYEA 3WDMA 2EZUA 1AGYA 4PHTA 1UMCB 1CR0A 4A91A 3C6XA 4AS1A 1VHWA 1VJ0A 1BVYF 2J7PD 2RHLA 3FWPA 4RF4A 3PB3A 4YN3A 3UBTA 3EDYA 4DV3B 4BEWA 1FP4B 3LUCA 4L85A 2QTAA 3T5CA 3UO8B 4IDHA 5DLEA 2O8CA 3NALA 2VLBA 3IFSA 2Q3BA 4Z4GA 3EWNA 2NVOA 3GLIB 3CSUA 1Y1QA 1IOLA 1CJMA 4RNDB 3BQNB 3KU1A 3JQCA 4EW2A 1IBMB 1H6CA 2ODBA 2XWJI 2DUJA 3FSEA 2CMDA 2AJLI 2D5LA 3GVHA 4N5NA 3LRTA 3PNMA 1W59A 4BZXA 4Z3OA 3KEGA 3K0SA 2Q3LA 9MHTA 4F2HA 1P2TA 3KSDO 1FMLA 4FKMA 4FFVA 1ATIA 1HSZA 1TZKA 4NXNB 4A8JC 2B7CA 1IUOA 1ORRA 2WFMA 5ILQA 5JE8A 4F8EA 3DHYA 2CYAA 4YJKA 4BZZA 4DABA 5K2OA 4AKSA 1PJSA 3PP8A 3GW8A 3WLTA 5A7FA 4OQPA 2QK4A 5HEKA 2Z9BA 4MAMA 1PG2A 4BGVA 3AJDA 3BIXA 1ACMA 1ZXBA 3BGOS 4AVYA 1VE6A 2ATCA 1R27A 2QRGA 2VI5A 3DZ8A 3I6QA 4NBUA 1JEQB 3RSZA 4QTXA 1I2BA 3M0EA 5H1YA 4B83A 2WT9A 4RGBA 2Q6LA 5HCNA 1P91A 4RTOA 3QEMA 3UUGA 3AW9A 3NIDB 1V8OA 3FTNA 4REMA 2PG3A 2DFLA 2O3TA 3S7ZA 3Q9SA 1XU9A 3T54A 3LHIA 1Q1AA 1QE3A 2A4KA 1D7AA 1T5OA 3G0GA 4IDFA 3EF1A 2R1VA 4QYIB 5KU1A 3FBTA 1CYDA 2DY0A 2JCVA 1WTCA 2Y0PA 3P9NA 1W5EA 4JLAA 3IAXA 3VHXB 4CW7A 1RYNA 2CLFB 2ZBUA 2RHTA 3BK2A 4WXHA 4ITVA 5EHIA 1U98A 3UMSA 3L4JA 1QRUA 1DUVG 1ZY2A 2B5WA 2NYAA 1F48A 3DGFC 4FKZA 2IXBA 4KPFC 4ND3A 4Q9LA 2IXEA 2DEUA 3P9PA 3P5SA 2JJMA 2P9ZA 2PZKA 3NBMA 3UMVA 3WRYC 4GOKA 3Q1LA 1LDYA 2VTBB 4CCYB 5L95A 1FX1A 1N9GA 3ESDA 2X9VA 5EPOA 3U7RA 4REQA 2RHRA 5IAOA 5T4BA 1THMA 2I1LA 3MZ0A 4XWKA 3I01M 1Q11A 1NC3A 3I73A 1IHPA 3AO0B 2ON6A 3P0JA 4DPLA 3ILYA 4TQGA 3IAAA 1M6WA 3L7CA 4X62B 4NY1A 1ZEJA 1VI5A 2D2IA 4WNAB 5JZVA 3PA6A 3I2YX 2G7ZA 2ZBFA 4GPAA 4LK2A 1DT3A 2XRZA 3E0XA 4KXQA 2IYQA 2H4JA 2QTGA 3ZV3A 1V2GA 2P5TB 3R7DA 4MDYA 4HX5A 4U7FA 2VK8A 3U2QA 2JGKA 3UUWA 4WIAA 1J0CA 3N8HA 1QB8A 4UXHA 3R7SA 3UZUA 4ZZ0A 1DAMA 5ALEA 3KETA 3D8SA 2UXBB 4RV5A 2BSAA 2DUWA 4ENQA 3C5WP 1X86B 3TAHA 4XGNA 5EKUA 4BGIA 3RAFC 1E5XA 2GM4A 2I87A 1Q20A 2Q6VA 2WPDA 1RQLA 2YIJA 3GOQA 1X7WA 1K98A 4QDKA 1SZCA 4NEQA 5PNTA 2JZOA 4UDYX 1NULA 1TM4E 1X2BA 4MINA 5AUOB 1EUDB 3PUJA 5E3HA 1L8LA 2C03A 4KVZA 4QPZA 4JI5B 2HN9A 2OR3A 1VKHA 1U9JA 4XA8A 1GPYA 2GYWA 5AYVA 5B12A 4OBXA 2H1HA 5A3RA 3KTFA 3BSSA 2CMGA 5BY2A 4HT3B 2XRYA 1Y8CA 1FJHA 1JS1X 1GTVA 4LWQA 1BVRA 1E7MA 2ZB2A 1KIMA 3AUYA 1P7VA 1IEWA 3M5DA 3T5DA 3UOWA 2OVFA 1EXMA 1M72A 2BMAA 4V0MA 5EA2A 5I8WA 5CHEA 3QQ5A 4C7VA 1IUPA 4XSGA 4WWHA 2PUDA 1Q0SA 2PX5A 4PE5B 2AN5A 3AUJB 1KMNA 2NUPA 3AVOA 3M4JA 3MYYA 4Q3AA 1A5SB 3LPMA 4DA0A 1IXRC 1V47A 3ESXA 1QPZA 1T36B 3DR3A 3KYIB 2IUYA 2QSZA 4PGFA 4RTSA 3ZD7A 2O8DA 1VYTA 3MYRA 3O4RA 1SXJB 5FWXB 3SX2A 3MT9A 5DXJA 1B93A 4LN1A 5JTTA 1R5JA 4F2GA 3AL2A 2IU4A 1T6YA 2X2FA 1P6UA 5L7WA 1I7LA 4RJTA 2RK3A 4KEAA 3W2HA 4ARVA 1K86A 2YIVX 3JQ7B 3UXYA 3QEJA 3TBFA 4C7XA 4KQGA 3O1LA 3ZXUB 4QPDA 2Q21A 4YI3A 2DKNA 2X4DA 2XYGA 3GJSA 3QU9A 5A62A 2IITA 3I8XA 3N0RA 2XE8A 3K1YA 1V16A 4BFWA 3ZI4A 2VT6A 3GJ0A 1XF1A 2ZEJA 1JQ3A 3VR2D 2D1TA 5JSYA 3SP1A 3BJMA 1YCHA 3IIIA 2KHZA 5TGDA 3REQA 5FX2A 5AJUA 3KEOA 4H7HA 3Q2OA 1IB0A 3K2QA 3KL2A 1Z33A 4NYIQ 5K7SA 4DV0B 1P45A 3RK1A 3HP4A 1SH7A 4LOIA 3WOVA 2FFAA 4EW6A 1RRVA 5GV8A 5JCJD 3SJUA 3JQFA 3FPBA 4FX5A 1KEWA 3ZBUA 3A4YA 4GXRA 2A1IA 2M98A 5ALOA 3MTBA 3EWSA 3DZIA 4H3SA 4YEDA 5T41A 2OMKA 3NBFA 4CMEC 2FMFA 4UAJA 1KO4A 4F6CA 1H2BA 5CFOA 4UEJA 5KWJA 4Z9BA 1FA9A 3E9NA 3C1UA 4KQKA 2Q9BA 3MMSA 3VI4B 1EP2B 1GXSB 4M0MA 4NOJA 2RK6A 4DG8A 4LDRA 3ZVNA 5CNMA 5AQEA 4LDJA 1U5BA 1O94A 3OT1B 3FF1A 2B1JA 2NPOA 2BFEB 4M0PA 5G1PA 4LSWA 2DPHA 1D2GA 3RC8A 1X0VA 3PGMA 5IWAB 1WRBA 1C1XB 1U28A 1J7KA 4JYBA 4RZXA 4UTRA 1IDN1 5IKPA 3B6EA 5CEEA 3NBKA 4RD4A 1NX9A 2BGUA 1WE2A 1FMCA 2X0NA 2ZJZA 2QX8A 1PJQA 1G16A 3DBLA 3GBPA 2HHLA 2QW0X 4B4KA 4BLQA 3BZBA 3SM3A 3L0BA 1U4SA 1PI3A 4MJ7A 1WKVA 2PA0A 1VG0B 4I2NA 3GROA 4IW3B 1U81A 4RHUA 3SY8A 1R8JA 5FL3A 3S28A 4N5MA 2DZDA 4OVKA 5KYWA 1I0IA 4GQBA 3LQ2A 3A8TA 3LOQA 3KE8A 1RXVA 1X80B 4YY3B 5ECYA 2O0MA 2V58A 4QYSA 3C6YA 3IE1A 2VG8A 4PYKA 1FU8A 2GEJA 1X1EA 3N3AC 3OD1A 4FOLA 4ENVA 2WKQA 4LJYA 4Z9XA 3B1FA 1C50A 4HJXA 3PQ2A 2P3QA 4LE0A 5GONA 4F9EA 5K8TA 1SZPA 2HBQA 2FKNA 1JFRA 4MLCA 4L08A 3LO5A 4S1TA 4UUQA 1I3NA 1P39A 2QJRA 5H3CA 1K7SN 2M32A 1GTZA 2E49A 1QK5A 2Q7DA 1GGFA 7MHTA 1K5DA 4D44A 2NQ8A 3VC1A 1DIAA 3NRCA 3QP9A 4YJGA 2EEZA 1N1EA 1Z06A 2EATA 1QMPA 3T94A 1SOAA 1XZBA 3KTAB 5DU2A 4UEWA 3O0DA 4B3DA 5J2TB 1N6KA 1T6BY 3W3AA 4BFYA 1EB9A 1K7CA 1QZZA 5AK4A 2AMVA 2GTHA 3OP1A 4PAOA 3PGJA 4OAPA 2H07A 1DG1G 3RKUA 1E2KA 1O95A 3W78A 2Y8EA 2AG0A 4NFYA 4YFVA 2ISCA 1A9SA 4EYSA 3TO5A 1K8XB 3AH8A 1AMUA 3FPSA 1T9DA 3URMA 4BQOA 9LDTA 4DM7A 2O3UA 4HDMB 5ALDA 1OWOA 2YJ3A 2C2WA 3MGGA 3F90A 4DIUA 1NVXQ 2R47A 3O3CA 4JKYA 3EPKA 1G6KA 5FI1B 3JYHA 4MO2A 1FXSA 4IZ6A 4GKJB 4CFSA 4UOQA 1PZXA 1FJ2A 3GEPA 3MCTA 1KH2A 1E1CA 5HQ3B 1SHUX 4BO8A 5KJ1A 1KEEA 3CT6A 3DEKA 1N32B 1G17A 3QY0A 3DCIA 3FNQA 4E2WA 1DAOA 2EW8A 1VHLA 3F1KA 3HB0A 1LH0A 1XRNA 1SUEA 4JS0A 3LWDA 4NZPA 1K8RA 1KDRA 1X94A 2C57A 2MJLA 2XGOA 4KX3A 4TN1A 4X60A 3ZWPA 4RC9A 4CKYA 4ZGBA 1MGPA 1GTL1 2XF8A 3F4KA 3L5OA 3NRBA 4B8ZA 5KYVA 2N0SA 1I0ZA 1W93A 3K4QA 4KFTA 5LSAA 2AZ4A 3W3AH 3T7KA 1EG2A 1I1OA 3PZRA 5F9HA 5BR4A 4P84A 3A31A 2J6BA 1LDGA 4ZYZA 5CGQB 3R75A 3ZLUA 3KUXA 1KK1A 3L1JA 3ND5A 1R9GA 4YRDA 1ZGJA 3UC9A 3MXTA 3I52A 3TBKA 2YHSA 3WBBA 4LGCA 5MN4A 3HYCA 1TB4A 4Z7QB 2XEXA 3B8HA 3WLFA 4YRIA 3D6UA 2V65A 4RH0A 2QE7D 1U0SY 3OH8A 5HJ2A 1TKBA 2L17A 3ZCXA 1ULTA 1ESZA 4F3CA 4AF7A 2H1IA 1OLUA 2VP2A 4G8JA 3D6VA 3UKOA 2YY7A 4C5AA 1PGNA 3K3PA 1A4RA 1QXSA 2W2TA 3G49A 2YJTD 3OE7A 4N8EA 4TS1A 1JHUA 4OAOA 2J7PA 1UC9A 2VDNB 4BO5A 3NT4A 5F7XA 4ZA2A 2BR5A 3QYJA 3GRYA 4EO4A 4CG3A 2Q8NA 3O1HB 1KNQA 3LC7O 3R3XA 1VPDA 1FUUA 2C0CA 4K5QA 1G8SA 4IHQA 3AX6A 4I3GA 4TVBA 2VA9A 3ET5A 3I1JA 4EMBA 2OVBA 1ADGA 2E89A 1CE8B 4KRGA 1GO2A 3QY9A 2WHQA 2J45A 1SXJA 3MT7A 1CNFA 2ZWVA 4GLBA 3DAFA 1SEPA 2Q5JA 1EWQA 1YL6A 3SC6A 4EGAA 1HDZA 4FK8A 3V4RA 4OMCA 3A4MA 1QVAA 3MWGA 2OTCA 4HWTA 1LB1B 1XSEA 3FKSD 1XTZA 4R2WA 5G53C 2ZI4A 1U9CA 5JSZB 1VMDA 2VH2A 3L6EA 3TRKA 2C9OA 3BFXA 5BN3B 4KPUB 5BORA 3RBZA 1DAEA 1PD1A 4Q1CA 3ZHUA 2O3SA 3R3ZA 3CLRC 2QE6A 3RM3A 3FWZA 4WK2B 2RGBA 1YMQA 4GMGA 1OV6A 1JXOA 1T34A 1KY5A 2A1TS 3X43A 5KOJB 1H6DA 4FIZA 1BMFD 1UDXA 3B51X 4CV3A 1WW2A 3DBHA 3DL7A 1DG9A 2XAUA 3MTDA 5GOTA 3S4YA 4BTVA 4ENRA 2H54A 3AR5A 2BR4A 5E4YA 4OREX 2JANA 3TMYA 2JFPA 2P6MA 3DDNA 4LOAA 2FTKE 4ZDJA 3G79A 4GZ3A 1QO0A 4TM8A 2E37A 1T9AA 1ZRMA 2IZOA 4MMXB 1Z2AA 3LWBA 1OH8A 3I2JA 5ED0A 3W2GA 4A73A 1ZLYA 2PFGA 1OI7A 1M2KA 1OTYA 4H7PA 4BYMA 2ZRJA 2XWSA 4YP6A 3SQDA 2XXAB 1YKSA 5I5GA 1T2NA 3ELYA 1I3OA 3EVDA 1K8YB 2G5PA 3Q8XB 4IGKA 4DUYB 1U0OC 3WKAA 3RSHA 3BSFA 3GJ5A 3T7SA 1PFUA 3PFFA 4E32A 2WQZA 2AA3A 2C8JA 2G71A 3PPIA 2J5BA 2AS0A 4HUQA 1C4WA 1X39A 4KI0A 3C70A 4G26A 3GLRA 4PYQA 3B12A 1E8DA 3Q7RA 4KO2S 3JQQA 4HO1X 4TROA 3SQLA 3QUTA 2W37A 4KJZA 4NV1A 4V02A 4BV8A 4E09A 2QSUA 1SJ9A 3T5TA 3HY4A 3BEOA 4G67A 4Y6GB 1FXWF 1UT6A 4JXJA 3CR7A 1DVRA 5U1PA 1Z38A 3Q3GE 3BE5A 1NDQA 4C0BA 1XD8A 5CPBA 1XRQA 1NN3A 4INJA 3V4SA 1JJIA 3BPSA 1KEPA 2NTEA 1ES9A 3D02A 3KV1A 3MBKA 4PAMA 3QVTA 5E9WA 3MN1A 3W2FA 5EUMA 3ZIUA 4QRHA 4FEYA 1SA0B 2PX8A 2XVMA 3E53A 4MWZA 4C4XA 5KTRA 1CCWA 2H5EA 2D5AA 5IULC 4TV8B 5LZ9A 1HX7A 2DMRA 2O3QA 3FYUB 3TDKA 4BRSA 2IH4A 2YYZA 1QH8A 3IAM1 1VXRA 3FTCA 4EJ2A 3EVNA 3CX7A 3UYKA 2GCOB 5K4HA 1FMFA 5CB4B 3AVVA 4OQYA 2EP5A 3R9KA 5L6LB 3BCRA 5D5QA 3RVOA 3LX6A 5IK2D 5EXXA 1JG1A 2PRSA 3EIWA 3TW6A 2E4AA 1AGXA 2Z8ZA 3H8JA 1NQUA 3TI9A 5I4KA 3V4PB 1MFPA 4CEIB 4K2HA 5A5DA 2KMLA 1UJ2A 4L4YA 4WE3A 3J81A 4DR4B 3ZWWA 4KR6A 1AKUA 5KWSA 2ZWMA 2AEJA 1Y42X 2H18A 2OILA 4LHZA 4AZ3B 4DEVA 1C7FA 2QD1A 2PMWB 1R74A 2AUNA 3HZRA 1DIRA 3OTIA 1LPPA 4JMLA 2FPPA 3W2TA 5A5VA 2PKYX 4DR6B 3SZLA 4KN9S 1NFQA 2Q8PA 1BNCA 3UJCA 4UE3S 4W4TA 1HDIA 2Q99A 3OHMA 2A5DA 4XCVA 2AW5A 2EZTA 4FHCA 4KQ9A 3VX3A 3VZDA 3PZBA 3ZQJA 3OTHA 4F92B 2BZ1A 1ZCBA 4V1CB 3NP7A 5JH7A 1Q2UA 1SBQA 1UXJA 3Q72A 2ERXA 1TNDA 1UDCA 3R41A 1T43A 4M0EA 2QTHA 1JU9A 3FFBA 3PUYA 1LBTA 3L6RA 1V8BA 1CZUA 5E1OA 4OJKA 3SHFA 1EIWA 5DMHA 3HXMA 1TMOA 4JP3A 1BDJA 4E5SA 3T1QA 3USCS 1E0AA 3PF9A 1QQ7A 3GEBA 2REQA 1MG0A 1UOQA 4M1TA 5HS6A 3S1AA 4EY3A 1SIOA 3KVOA 4RADA 2OYCA 4CL0A 2EVWX 5TT1A 3RJ5A 2MINA 4N0DA 5A9SB 4AX4A 3FCYA 3AILA 1O6FA 1SCJA 1UKVY 3UM9A 5JV5A 2IFTA 3D7NA 2K87A 4R05A 2M6RA 5BV0A 5C7LO 1JLHA 4UARA 4OATA 4P6VF 2PJZA 3F6EX 2PYZA 5DCYA 1RJWA 1Z0AA 3I64A 5FWYB 1JTVA 1VECA 3OESA 2A58A 2UUBB 1NJ2A 2CCGA 2ZSHA 1DEAA 1YBHA 2NPIA 3AHIA 3LUHA 1Y3CE 3ZWYA 4C29A 1AO3A 4HFJA 1P4GA 3GLHB 5TMEA 1I2MA 2FMUA 4K46A 4U4AA 1L9KA 1SD1A 2CFIA 2VPYA 1BGVA 3WBFA 4G85A 5LUBA 1GP2A 1TM3E 1XVLA 4KR9A 1Z6TA 4YUYA 1U2GC 1O6GA 4A0FA 4MRRA 4C2AA 1L1FA 4BAZA 2D5BA 4NMHA 2WJVA 1OGJA 4FGLA 3PJEA 3ZY2A 1YE8A 2X7HA 3VXKA 1T8UA 2XVYA 4JITA 1OH7A 4DA8A 4DSZA 1W9HA 3CF4G 3EJ6A 1T5IA 4YTEA 5AVQA 5DYWA 1UZAA 3CYFA 1Y3IA 2XX3A 4M54A 4UZEA 3PX2A 2VWHA 4BUJA 1ZOPA 3TN7A 1G7TA 2J3HA 4INZA 3MMPA 3R6DA 5AJTA 1GA6A 2FMKA 5DI3A 1E9CA 3VSCA 2C9MA 3QI2A 4D6YA 1GSOA 1E9AA 4GC9A 1HK7A 1YR6A 1AZSC 3ONFA 5HDQA 2XUKA 3UJ3X 1KJJA 2Z2JA 3SQOA 3NOXA 1PLKA 2AOUB 3EAFA 4M7RA 2WV9A 3NUGA 1DAKA 3C6KA 4I1YA 2PEYA 4DMGA 4EJ6A 4PPFA 3T3OA 2QRKA 1WPQA 4KAAA 2REBA 3RSLA 1RI3A 1SB9A 1Z2CA 3V4ZA 1VMKA 2R1UA 1A5TA 4OB8A 1RLTA 1WNTA 1NW3A 1X1RA 3WKBA 3CVXA 3M4ZA 3EPLA 5EMHA 4YXFA 3AZQA 1II9A 1QKKA 3HYSA 4ENSA 1S2IA 5CFQA 1F4LA 5JCPA 5ISMA 2MHCA 4C4TA 3AF2A 4DG5A 2OG1A 3JASA 1ZGCA 1YDWA 4HH4A 5EYPA 3PTLA 4PPQA 3RVRA 2QW1A 3S2YA 4B45A 1OZHA 3VR4D 5C2JB 5FEUA 1P4HA 3PEYA 2FUG1 4K87A 4MRMB 4TUYF 3PKJA 2X0DA 5TDHA 3ZNOA 1AS2A 2JFHA 2FP3A 4I4TB 4Q7KA 5E6UB 3FI0A 1X9HA 3TLAA 1RXEA 2FHPA 2ZXEA 4INOA 4MNTA 1N7HA 1XPJA 2WUGA 4MUJA 4D82A 4J0CA 4B80A 3CJRA 3QTBA 3OZWA 5BWLA 1NXWA 3IP9A 3ZVRA 3HDJA 3FLEA 3W34A 1B41A 1LK5A 3WLKX 4KYUA 5K3CA 3KD2A 4MKZA 5M2QA 3TQFA 4FEGA 3S1AB 4RZSA 3MS4A 5LP6A 1AU9A 2HTEA 3ZDXB 5KPJA 5COQA 1CB7A 3K6SA 2DT5A 2A9PA 1T8TA 3EG9A 4P33A 3T3PB 2H17A 1OUMA 4KX5A 4PIPA 4BNHA 4IEEA 2VF4X 4GR9A 2XNKA 2FZWA 1TQHA 1N8NA 5KYXB 2ZUDA 1YMUA 2WZCA 2B8JA 1GQSA 2G77B 5F4BA 3CVOA 5LDGA 1XX6A 1IN5A 5EZ5A 4J0DA 1L1EA 1CR6A 4S05A 1JBKA 4AI6A 1DU4A 2XH8A 3QX8A 4Y6QA 2XCQA 2O8BA 3WK9A 1O54A 1Q7GA 4JYCA 2P3OA 4MUFA 4CGYA 1SVNA 3LZDA 3NEJA 5E8JA 1BQ4A 5IH3A 4ZDKA 4DSUA 2RC6A 2VO1A 3A05A 1L3IA 1Z0ZA 2C9CA 3ZE9A 3FOZA 3GRFA 3UG7A 4AO6A 1ZIDA 3THXA 1KYQA 4B2YA 1ZIOA 1PUXA 5CIWA 4WY8A 3SEFA 2XQJA 3MOIA 3ML1A 1G5FA 4IDCA 4D9JA 3I61A 4K40A 4S04A 3N2EA 5JXWA 1QIEA 2CD9A 1KFJB 5IHPA 5DT9A 4AJ1A 1NQAO 1Z7BA 4LHVA 4DDTA 3CPEA 1E92A 3K20A 4HXYA 2A88A 5ESXA 1M1XB 4IV0A 5DTRA 4KLZA 2GI4A 4M9QA 1Q0UA 2QXYA 3DE0X 4V0QA 4NKRA 1UPUA 3NNSA 3ZU6A 4X7PA 2E21A 3UT0A 1MEOA 2V74B 4G8DA 2IEBA 3ZNPA 1XCGB 4XRGA 1U9YA 2GETA 3OECA 5IC4A 3PE4A 4KXXA 2CXRA 1P9NA 1TVEA 4K3UA 1XEFA 1O89A 1V8DA 4Y2VA 4A8HA 2C29D 2B1RA 3QEAZ 1DO2A 1RAEA 4EPVA 4I14A 3NAQA 3JWHA 2Y6VA 4UUAA 3SS8A 2BJHA 3FE2A 3EHEA 3BWBA 1J0EA 4G0ZA 4RPKA 5EIWA 1KMMA 3GEMA 5JBQA 5K3EA 5KTSA 3K15A 3W4IA 3ADKA 1ESDA 1RP1A 4NBTA 2JD1A 1TT7A 4Y1RB 4WT7A 4ZVVA 1GNVA 4F4UA 4TMVA 3TFQA 3WRXA 3KD3A 5G3YA 4U7PB 3ISVA 1FW8A 2IYZA 5TPWA 1KP2A 2WT4A 3NJ8A 3RBXA 4GKVA 1DX9A 1QH1B 1U8YA 3T4XA 3M83A 4ZVSA 3LBNA 1I5OA 4QLBA 1M7HA 4IDOA 3JV7A 2BN4A 1A72A 1ODSA 1ZCAA 2JH3A 3EFBA 4UVGA 4D9MA 3JWIA 3NZEA 1J2UA 2Q5FA 1OROA 4JSTA 3Q87B 1N6OA 2WWGA 1F0YA 3O47A 4JENA 4WX2B 5SYMA 1YHZA 4EKEA 4L07A 3QTTA 2NO9A 4MB0A 5LBUA 3QPCA 4DB4A 2FG5A 3EZLA 1NMZA 5LA6A 3AGPA 4YONB 4MQBA 4O8ZA 2KBFA 3ISJA 1JSLA 3O8CA 3LQKA 4AY6A 3QJ5A 2XW6A 3GELA 3SR3A 2OGZA 1S5PA 3JVUA 1RXUA 4HRYA 4KN8A 1P4JA 1RJDA 1B8NA 5AI6A 5KC9A 2W2XA 4MCHA 3MHTA 4RVNA 4MZDA 3SXUB 2ES4A 1HSOA 4HS4A 4J1NA 4CIAA 1TLTA 2HFJA 3AXSA 3DCNA 3TKYA 4LJRA 3HBLA 4B6SA 2YQZA 1P60A 2CGEA 1L7EA 2QT1A 1XC7A 1ZFNA 5TF4A 4CLDA 4KFCA 1C5KA 3BWEA 1SBCA 2ZT6A 4Q7EA 3O83A 5LL6P 4OYLA 1XALA 2IYSA 3L4EA 5C31A 4LDQA 4DV4B 3R0VA 5IT4A 1CY6A 1U0HC 2YJ5A 4E94A 5ENZA 1VL2A 4FR5A 1MO6A 1PVOA 5A03A 1CYEA 3MFYA 4FSHA 1AUOA 5IABA 3QU2A 3GG9A 3O4HA 3PHIA 1W0KA 4MGKR 2IYVA 3D5QA 2QTMA 4BO7A 1B1CA 2FF7A 5K0CA 4LA4A 3TLKA 5I01A 4A3SA 1XQVA 4QODA 1O96A 2C2GA 1QVWA 3B6KA 4NCHA 4JJKA 3U7QA 5JY6A 1DJLA 3G23A 4Y8VA 1MR3F 2D1RA 5KOHB 1ZQ1A 3E23A 4HUTA 2GZ2A 1VCOA 4BS9A 7REQA 2TYSB 2J3QA 1JHOA 2WG1A 3BTUA 3F5MA 3UWOA 4PAWA 2HRQA 4B35A 4DDUA 1KHHA 4MWCA 1X15A 1DIBA 2JG3A 1RQPA 1V4NA 2P90A 3PWTA 3UHFA 1XJWA 1GIAA 1F17A 2DM6A 1R4ZA 3EDRA 4M87A 5TVGA 3KTOA 5ULLA 1UJ5A 5JY1A 3H9BA 4J2HA 1GWNA 5AKZA 4E30A 1XWWA 2RK4A 5K3SA 2JI9A 3MNFA 4Y0VA 1R8XA 1N3YA 3V6LA 3H9UA 4EPRA 4LEIA 5KVCA 4OLAA 2JFGA 2FX3A 4XEUA 3JZFA 3ZBPA 2IS1A 3BDIA 3N05A 4AP9A 4C05A 1GL3A 2XZLA 5KWVA 3IVGA 4COKA 4GBED 2VQEB 3U0BA 1ML3A 1RXWA 3TIGA 1GQ2A 1TO1E 3QXSA 4IOJA 3ZCSA 4M9ZA 4UD6A 4LFCB 1XMQB 4PONA 3FW1A 4JBIA 1T5TA 4NZ9A 4WZZA 3BGWA 4MIOA 4KRXA 5I9NA 2QL5A 4MB6A 5K3OA 2G0NA 1ADFA 3BL8A 3LYHA 3IUBA 3KKLA 3OE1A 4ND6A 3STHA 3VDNB 4MDHA 4R1TA 2AH5A 5EMLA 5IDQA 5LQJA 4Z53A 1RZUA 3JQGA 3MWLA 4NMXB 5AI9A 2HI0A 1LLUA 1QF7A 4FONA 5DYGA 5JVDA 5KQGA 4FFMA 3OLYA 2QJOA 4KUEA 4CRWB 1Y7PA 2VSFA 2UVPB 3KKKA 4QXAA 2GCNA 5IT9A 3TPZA 4YYZA 3TDMA 2IHJA 5FAKA 3DTVB 1HQKA 5HRCA 1V9CA 3TQIA 2ODQA 2X19A 3ZQ4A 3T52A 1Y1SA 4IDNA 3X1JA 3JZAA 3RVBA 2QXUA 4ZT6A 3D8TA 4FN4A 4E3WA 2Z04A 3EFHA 4J1TC 3ND7A 4ZV4A 4QUBA 5AOCA 4HLCA 2E82A 2JAWA 5G0TA 4BFLA 3GGSA 4CMIA 3N76A 2HM7A 3ETHA 3OTWA 1L8QA 2OSBA 2QN8A 4TQAA 4U3JB 1BKYA 3RFVA 5L4SA 2O2YA 3DMNA 3L1UA 5JH7F 5L4NA 2B69A 3IBCA 4LWZA 4TT3A 1CRWG 3L4BA 3N2GB 1QCCA 2N75A 5FLYA 3V46A 4ZT3A 2EEPA 4IZIA 2QYHA 3TTXA 4ZN6A 3CEJA 5DNAA 2ECQA 1E7YA 1OY1A 1UH5A 3F5FA 4LKRA 4NIMA 2ZUWA 4MW5A 5HFJA 3SIXA 5KSWB 3WZ2A 2J9YB 5I9LA 3FCSB 1PK7A 2ILVA 3GARA 4JI6B 3WFJA 4A15A 4OSEA 3HRIA 1WBJB 1JB1A 2VJQA 2A9JA 4G0OA 4X41A 2V5UA 4ZVRA 5SZJA 2WSSD 3NNNA 4I7EA 5M5BA 1GM5A 2F8SA 3LL4A 3R3HA 3PNOA 3U6BA 3TIVA 3ZWCA 3DDOA 1CQIA 1FJXA 3E7FA 2PRYA 1R66A 4GGPA 4UTOA 2OOKA 3U61B 4ME6A 2BUAA 5E7QA 5I48A 1IONA 3FI9A 1ARZA 2OP0A 1XLTA 2E4WA 3NNDA 1JN0A 4EPYA 1KO1A 4AY3A 4EYEA 2B8TA 4EX6A 1JBQA 3C43A 2FFQA 4JP5A 2HRBA 4YECA 4HQ6A 1JNXX 5C8YB 4OHXA 1ZMRA 1HDYA 4S1NA 3WB2A 4AG6A 3DKRA 3KQLA 3OFSA 1SCUB 1VJRA 3AQ4A 3EF0A 4G8CA 2FSSA 2JK0A 3PC2A 2OAGA 3JD1A 3NH6A 2NO4A 1Y7TA 4ZO7A 4ZAXA 1NXPA 3TBHA 1Y82A 4G3XA 2E18A 1CZKA 5DTQA 3TOSA 2LKDA 3DF7A 3MBOA 4M8IA 4ZHQF 2AFIE 1HC7A 5HSGA 2QTZA 3DR5A 2H2WA 3L8MA 4H4CA 4UTZA 3D6FA 4R1OA 4Z0HO 1CJKC 4HTFA 5SZKB 3V8VA 1MB0A 3A6LA 3A3KA 2VHYA 1QCZA 3PUKA 4RFSA 4AQDA 5I7EA 1M34E 3CUWA 3ETJA 2V97A 4GD3Q 3ONVA 3BH7A 1WUHS 2CVOA 4YIKA 2DCMA 3FTFA 1LBEA 5LMNB 2WKRA 5TS2A 1ELOA 4L8LA 1A98A 3IJPA 3ZOKA 1K8ZB 1B2RA 2WD8A 3FSGD 3CX8A 5AQ1A 3CUTA 2OCGA 3B1JA 5TQ2B 3W9SA 1Z8DA 1MJ5A 4C3ZA 3HU1A 4M0DA 1LVHA 3KWJA 3BMQB 3LUBA 4MI3A 4PS0A 1HTBA 2B30A 5FI0B 4Q7MB 4MUIA 4MGEA 2PWPA 2QTLA 3WGKA 1U80A 3PUIA 2V6FA 1O5IA 1BXKA 2VPPA 3OX2A 4UULA 1B42A 3BRWD 1YDHA 1KVSA 4B7ZA 1TZCA 3QENA 4QGSA 4Q1BA 5MDHA 3PEWA 5BVHA 2R6AA 3WV4A 2PH7A 2W6ID 5FFNA 4ZV7A 2BMFA 4E6PA 3T5PA 4CGZA 4NJMA 1B3BA 3BICA 1M6HA 2QENA 3GRZA 3LBIA 2P77A 1ZOIA 5CDFE 4P54A 2RGCA 3X44A 3BM5A 5JECA 1A95A 1WF3A 4MS4B 1HNXB 4G07A 3CF0A 1H0KA 3KQYA 3RVSA 3WQRA 1XRPA 3W6NA 3HB4X 4MUGA 1EK2A 1MX1A 2AQ8A 3KPYA 1G6OA 1UXKA 5FQNA 4F5EA 3S7TA 3X1DA 2FZ5A 2GCGA 2W0MA 4LBWA 5FCDA 3GBSA 4EI9A 4WKOA 5IAAA 2AG6A 2JLCA 4YMWA 1AX9A 5B7QA 2BGMA 4NICA 2GWRA 4WESA 3ZQKA 1B26A 4X44A 3QUBA 3C4QA 1N5LA 2PK3A 1JIKA 2BI7A 1CP2A 1P9WA 1R9JA 3D2LA 1I1NA 3HXKA 4HPJB 5FLKA 5MFZA 1E64A 1JQJC 1X6VA 4PLYA 3X1WA 4ZYLA 1JXMA 1PS0A 4HNQA 1S2OA 4EYKA 2BZ0A 4BNMA 3RVNA 4F5YA 4EP1A 3JAWA 2JPDA 7YASA 1L4EA 4XYMA 3F6RA 3CX3A 2TMYA 2OENG 4KE7A 4R2LA 4JB3A 4WADA 1CULC 1EDBA 1FFYA 1HFWA 2VJMA 2FEXA 4BB5A 2OAEA 4WBNB 3ON5A 4PF1A 4F06A 5IZCC 3AZOA 4EUNA 1SUCA 4HCJA 3U80A 1XD2A 4MGZR 4EARA 4IX1A 4GQIA 2D8MA 5IKXA 1XJ0A 1Z7GA 2H65A 3QKRB 1DKOA 4LVCA 3RADC 2C2OA 4R40A 4CMKA 3JWJA 4XCQA 4OXYA 3WWDA 4A5OA 4KXMA 4XFKA 1RABA 3LCVB 3SSNA 2VCEA 4MVJD 3CT4A 4G1MB 2PMEA 2DTDA 4YH1A 4DR2B 1DDGA 2OKGA 1BXGA 2Z8YA 3D43A 4OJMX 5BPFA 1XKTA 4UHDA 2FEAA 2Q3CA 3QBDA 5H9VA 5LBTA 4CIXA 1I80A 5HCIA 4V1CA 4YDHB 5G0VA 4NXMB 4QHTA 4HXFB 1HYBA 1N0UA 2QVYX 3WP0A 2GTPA 3ZGNA 4F86A 5C4IA 4OHZA 2D00A 1TRKA 2DX7A 2GA8A 5D51S 3SQXA 2X41A 1VJCA 3FROA 3NIWA 2VHJA 3N6RA 2HY7A 2J41A 1P77A 1F9EA 1L5WA 2OUKA 5FTMA 3A1CA 5BSHA 3FDJA 5CFRA 4HATA 4BKPA 4YQEA 3LJKA 1E89A 1U0LA 2N1BA 3Q3EA 5SY4A 5C1OA 1XZIA 4HBZA 5BPHA 1Q0RA 4HDKB 4DLPA 4HNTA 3UV3A 1Z0SA 4RVSA 3D6MA 3M6MD 2Z5LA 2ZI9A 1RWWA 4FGKA 3TNFA 4ZZ3A 5H81A 2VF8A 1EFDN 4WY5A 1R0BA 1SVIA 4OUKX 5J59A 3MWJA 5CFLA 2J32A 3SEQA 4RMIA 1LQ2A 5F33A 4J0KA 3LVBA 5FI3A 1USGA 1P7YA 2NSYA 2GKSA 1PJRA 4Q4JB 3UAWA 1OU0A 3GEGA 4RLQA 3UK2A 1AKRA 1HETA 2H2FA 4N7BA 3RYTC 1DXOA 5CNIA 2Y4NA 2YN2A 2G1PA 3L06A 3ZV4A 2LDBA 3B7GA 5BUZA 3LTNC 3K94A 5CJJA 5F5LA 3ZNNA 4EG4A 5JEDA 1Q5PA 2AHRA 3HE3A 3W5SA 1DX4A 2OK7A 3DMTC 5CYFA 2ZJ0A 3OKFA 4K6OA 5AW7A 3RG2A 4YAUA 1CPYA 3VU9A 2RBEA 5CXXA 2KW5A 2NXJA 2IEDA 1MQ8B 4CMIB 2A9RA 2JC3A 2PSJA 2ZRIA 5DSTA 2Y1DA 1P6XA 5BSTA 1J1UA 5JASA 3VNBA 2RG7A 3B9PA 4HGZA 5EXEA 4QE3A 3UT5B 4LXGA 1YR7A 4M8LA 4E15A 3HKEA 2CL7X 3CHYA 1SUWA 3ZNQA 2C54A 3RC3A 1EEXB 5BR8B 3NAGA 3DEFA 4JBNA 4AS2A 1PR0A 1KO7A 1M8GA 1WP9A 4RF5A 4GZLA 2WPNA 2X8BA 1V1JA 2VF5X 1E7SA 4X5OA 1KAMA 1NTRA 4M76B 1ZIYA 2O7VA 1R1DA 3QVGA 1JTFA 1K5GA 1R6BX 2W6MA 3IT3A 4IIVA 1KE2A 1FX0B 1XZKA 2VQ3A 1Q22A 3I6IA 1JE1A 1OGYA 2C20A 1QANA 4EJFA 1DWPA 1D4ZA 1J6UA 4UBNA 3TW8A 4RTQA 5JHGB 4XDGA 1PUJA 4R69A 1G20E 1M5TA 3HKBA 3CNBA 1RAIA 3EZYA 4H3VA 4BKOA 4A9AA 2R62A 4FYPA 4X1YA 4CM9A 5FB3A 1RYZA 1CY8A 1LNSA 1SKMA 5F2EA 3UWMA 1W52X 1UPCA 1V8ZA 4XARA 3IQDB 3C3EA 1CXZA 4D9NA 1N5OX 1K7YA 3GJQA 5DYIA 8AT1A 1L3CA 1NYTA 1KNXA 2CWWA 1ZD1A 1KRHA 3QIAA 4QARA 5AXDA 1Y4AE 3IAHA 4D99A 2O54A 4DARA 2A9VA 3ME5A 3I3OA 1NLUA 4TRNA 1HE5A 2AJ8A 3GAAA 4DQUA 2JGEA 2WJIA 5DP1A 3VTFA 3T1TA 1X7XB 3Q10A 4GMDA 4DFDA 5G2OA 3EEYA 1NSFA 3S2IA 2O8EB 1UT5A 5AKYA 2VOJA 4WN9A 3WBKA 1Y5LA 2OFPA 2WC1A 4DV2B 2Q8QA 2FB9A 2EDAA 1NR7A 5FL7D 3N07A 4L3OA 1ZNQO 1JHQA 1HLFA 3L7JA 3OQ1A 3TR5A 3VZQA 5KTPA 2A1UB 3AEXA 4PO1A 3CWQA 4WAUA 3NMUF 5LVAA 4OM7A 4UAUA 1SA0A 3V2HA 4CKCB 2YMPA 1DJOA 1XPUA 2BISA 3H65A 3DZKA 3ICVA 4ZO9A 2GXAA 1LLCA 4IRXA 5EP1A 1IUKA 1A1SA 1QZ3A 1SVWA 2PM8A 1V5WA 2BE7A 2IEIA 1P18A 4MQLA 4UC0A 2VTDA 1DKRA 3BULA 1YNOA 3DPUA 4GMKA 2RD2A 4MP6A 5KO2A 2O8DB 3EFOA 3OQMA 4QO7A 1L4UA 3UAZA 1V95A 2HSEA 5DV9A 1TW2A 5WRFA 3PE3A 3PL1A 3UATA 1G2PA 3VC7A 3W90A 4EHKA 1FFBA 5GMOA 4LF7B 2AKEA 1PGJA 3O3MB 5B4TA 4LHEA 4MI9A 3DOHA 1IM5A 3PL5A 3MWEB 1J2EA 1UPFA 3LH5A 4U8GA 1K0FA 3NANA 4CBVA 2FWNA 4CU5A 1V3QE 1GAJA 4HOYA 4PGHA 5NULA 3L9XA 2YZKA 8ADHA 4K6GA 3ZTYA 5K6RA 3TB4A 4F60A 2HMVA 2VDJA 1DARA 1N2IA 4AG5A 1XVTA 2ZUSA 1NZDA 4Q48A 4PLTA 1P29A 1Z5UA 4MH0R 4XWOA 3Q8LA 2QZZA 3B52X 1ZCJA 2HK8A 1DQNA 2B4KA 1DHTA 3UH0A 1KEKA 3IEVA 3WB0A 1J8YF 3TAXA 4G5FA 1G18A 1JKXA 1XJ5A 3QLVA 2R00C 4QNRA 1G20A 1LJUA 4Q05A 4DRZA 2IHBA 1U8AA 1E58A 1V3UA 3NATA 2FF5A 3K1ZA 3CZRA 4YRFA 4TVOA 3ITDA 1DJMA 4URXR 2WWRA 3CNNA 3FHLA 2OV1A 3DMTA 5TV2A 1D6NA 4TMKA 1ILWA 4WEQA 4OCZA 3G9XA 2E4YA 3RV3A 1S9HA 3FPHA 2X6QA 5BW8A 3I62A 3GBVA 2RGUA 2IOFA 3AU9A 4WXMA 3LIIA 4KG7A 2UAGA 5EQDA 4BPBA 1G5TA 4HN9A 3WIBA 4PICA 2FN4A 3AEUA 2NN3C 4M1ZA 3DONA 1LQTA 5KHAA 4J0GA 2P8JA 2WJPA 4AWAA 1ZD4A 1WDTA 13PKA 1W4ZA 1YZQA 2ZAIA 4A6DA 1SQ0A 1WV0A 1RFGE 3LSTA 3OOEA 4FCWA 4CLHA 1HI9A 4D9KA 1N2CA 4E5DA 2WW8A 5BMOA 2RDMA 4X6XA 3OEWA 4HH0A 1ABFA 4M6WB 4W8GA 4ZT2A 4C7BA 1IHYA 1K9SA 2Y2UA 3K9GA 2VP4A 3WWOA 3UJNA 4PZUA 2HTFA 3GFVA 2XDWA 6PFKA 3A4NA 5EZYA 1VKJA 3R7BA 5BSKA 1FC0A 4GECA 2F43A 4BB9A 4WK0B 2YL2A 3NIBA 3ROEA 2CJWA 3C8MA 4LY9A 1T9BA 3F7TA 3I39X 5C18A 1V8PA 2ZJYA 1QRDA 3RJMA 3VPHA 3DEJA 1GYPA 2NUTA 2CSXA 2ERYA 3L4SO 2XQFA 3A9TA 4KACA 4OD0A 3O21A 4J91A 1ADYA 2H48A 3C8DA 3KXPA 4I46A 1CC1S 3CNEA 4DR7B 1VB3A 1B43A 4ZQEA 3WK8A 3AWIA 4QELA 5FA8A 3FCOA 3PJDA 2GZHA 1NRWA 4M1YA 1TGYA 1RPAA 4BP8A 1XU7A 3U9LA 4ZVMA 5T3YA 5CH3A 1AUXA 3RTDA 4JU8A 2GRJA 4DC1A 1OAAA 4FW9A 3VPFA 3P9KA 1Z4NA 1XXHB 3KJIA 4NBLA 3RJTA 1D4OA 2Q4EA 5A5GA 3KQNA 3LMKA 3JZDA 3ZZ0A 2O8CB 4DCPA 1HEYA 1UXHA 2BHLA 2D0IA 3AB3A 1JIJA 2Y1EA 3AR4A 4J0FA 1XHLA 4X92A 3WXMA 4BXOB 3SFTA 3E7WA 5EZSA 3HJRA 4GPD1 1PWYE 4M21A 3TQOA 5EKSA 2GGSA 2QJTA 4EJ0A 5IZCA 1KOJA 2HWXA 3LT1A 1GGHA 1QZTA 4P8RA 4R7ZA 4EECA 4B3GA 5JXIA 4YAJA 1BN7A 2O2ZA 1QO9A 1WD5A 1ND6A 1IY9A 3BMXA 1HDEA 5IN4A 5KDOA 2I3AA 1RRMA 3OZBA 4OOFA 2Q5QA 3QKWA 1AK1A 4FE7A 3FPLA 3UW3A 2YWCA 1NNUA 1FLAA 2F3PA 2VKTA 1LX7A 1QORA 4Q47A 4C6TA 2FK7A 1CQPA 3ZJYA 3E03A 4NYMQ 4JUIA 5DGDA 1I2DA 3MK31 4QD3A 2V4UA 3QEMB 4JLMA 1G1AA 1UFOA 3A9RA 4JEIA 4Q12A 4C4OA 1I24A 1BS2A 4MWSA 2HA2A 4CYMA 2Z5VA 2W2OA 4EG0A 3FN4A 5F76A 2JLBA 4IMJB 3MIIA 2XTJA 2Q4DA 4JC8A 3K8OE 3CZQA 5ICGA 4DM3A 1UP4A 3JWGA 3SIRA 4XPZA 1MAWA 4IOKA 3CMMA 4FZJA 5AH0A 3EQZA 1RPNA 4LRXA 5CJPA 3ZWKA 1KO8A 3IP8A 4TGLA 4BBPA 5TS3A 5BRAA 4GZMA 5IYZB 2IJGX 2AQIA 1FLVA 3CR8A 1DXQA 3IDSA 1X87A 4Y6SA 4FE4A 3ZE6A 2IUEA 2CLOB 2G9VA 2W6IA 2BTOA 2QRJA 4AJ4A 3UAXA 5CVEA 2YFHA 3AI2A 4Z0PA 2CNOA 1RYMA 1U2DA 2A7XA 1J21A 1X0XA 5F7JA 4KIUA 3KQUA 1ENPA 4MRSA 1LXCA 2HBZA 3HY6A 3ENQA 4JI0B 3NS7A 5BN5B 5KINB 3PDUA 3G17A 1T3HA 4A23A 3SXJA 2GEFA 2GWHA 4H6VA 1OZGA 5J23A 4NYJQ 3T3HA 4B6JA 1Q7TA 5DNEA 1MAUA 1TFRA 1SULA 1MOQA 2I33A 4I1PA 4IMPA 3V42A 3NCHA 4Q1DA 2IYLD 2SKCA 3EFEA 3HXPA 4AYWA 4KBGA 2DB3A 4JC5A 1SHTX 4EFLA 2QG9A 1E1MA 2QN6A 4XEHA 4AU1A 3GPLA 3GVCA 5EHNA 4EO7A 1ZK3A 2W2PA 5IM4F 2I2CA 4II2A 3WICA 3ZI7A 4CIBA 1NI4B 1YGYA 2BFCA 3DNFA 1WBBA 2J08A 1TJ5A 3JAMA 2QZPA 2VP0A 1Z7WA 2VRWA 4PC6A 5ESDA 2Z6AA 4DQLA 5HE8A 3QFHA 1AHIA 3PICA 1A9RA 1UFRA 4O2BA 1RQNA 5KREA 5D3MA 3DH0A 3H7AA 1TCBA 5PGMA 4PWZA 1KPHA 4S0ZA 2IU0A 3JVIA 3PLAE 1KMHB 4N7JA 2QDKA 1KDZA 2RHWA 4IJVA 3PC8A 1N4DA 3MRTA 4QT4A 3BWXA 3AG5A 1F8XA 4RVUA 3ZCUA 4Y9DA 4IQFA 4EYGA 1W30A 1GD1O 2RHMA 4R5MA 5MGBA 2CNWD 3BORA 3KR9A 1JLLB 4EL0A 2J4FA 4NECA 3S3TA 2FVYA 3MTIA 2W43A 3N0XA 3DVLA 4ETMA 2Q3FA 2WU3A 3LC2O 3PWZA 1PWXA 4NE7A 3H11A 1DTSA 1QMGA 4F9FA 2YNMC 1VLHA 1YE3A 3JYOA 2FRDC 2AR9A 3LC1O 3MTAA 4JP2A