1XB2B

Crystal structure of bos taurus mitochondrial elongation factor tu/ts complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
276
Chain Sequence
b'SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRKTKEGLIGLLQEGDTTVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQNLKDQLSTYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAAWVKVPAGFYVGSYVHGAMHSPSLHNLVLGKYGALVICETSELKANLADLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPHGVSVVDFVRFECGEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor Tu, mitochondrial
molecule tags Translation
source organism Bos taurus
publication title Crystal Structure of the Bovine Mitochondrial Elongation Factor Tu.Ts Complex
pubmed doi rcsb
total genus 83
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1xb2B01
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B03
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B02
2JY6B 5DFLA 1GO5A 1VEJA 1VEKA 1IXSA 1VDLA 1CUKA 2ZTDA 3GLHE 1Y8GA 2MJ5B 2MR9A 1R4GA 4GEWA 1TTEA 1OAIA 2DHYA 1HQYE 3E46A 1G41A 1ZMUA 2MROB 2JY8A 2LVOC 1TFEA 2OOAA 1NV8A 1XB2B 2H5XA 4HEOA 2HAKA 2DKLA 3IHPA 1OKSA 4G3OA 3LCUA 1BVSA 1DO2A 2O25A 2R0IA 3GLFE 1G3IA 3FE3A 1G4AE 1ZMVA 1EFUB 1WIVA 2KNVA 1DV0A 1DO0A 2LVPC 2DAEA 2L4EA 2L4FA 2BWBA 2JY5A 2JZ0A 2JP7A 2KHHA 2OO9A 3K9PA 3GLIE 1MN3A 2B3TA 1NV9A 3FRHA 1T6OA 1KYIA 3E21A 3BBZA 2BWEA 2DAGA 1IM2A 1IFYA 2ZTCA 2JNHA 1OTRA 3FRIA 1PGYA 1YLAA 2EKKA 1F4IA 2JY7A 1HT2E 1P3QQ 2JUJA 1AIPC 2LTUA 4Q7JA 3B89A 3IECA 2DZLA 1OQYA 2LVQD 2DENA 2OOBA 2HWJA 2RRUA 4F1IA 1WGNA 2QHOB 1ZV1A 2L2DA 2JZ1A 1QZEA 1V92A 1VQ1A 1WJ7A 2KNZA 1WHCA 1ZMWA 1WR1B 2DI0A 3K9OA 4R71A 5JI2E 4F2LA 3T6PA 2LVAA 2CWBA 3LCVB 2DAIA 2KNAA 1C7YA 1HJPA 1HT1E 1JR3E 1A5TA 1T43A 2QSFX 2LVNC 2MGWA 1E94E 2QNJA 1VEGA 2DNAA 2EJSA 1Q02A 2DAMA 1SG9A 3F92A 2K9DA 1UFZA 2EKFA 4UN2B 3GLGE 4WP2A 4DBGB 2G3QA 1TR8A 1XXHE 3H4JA 3MMPA 2WZJA 1WGLA 2DAKA 1VG5A 2K0BX 2LBCA 2CP8A
chains in the Genus database with same CATH superfamily
2JY6B 2QBYB 2KRUA 2APLA 3R9XB 3CF0A 2KEBA 2VQFM 3PFIA 5EP1A 2ZTDA 2QBYA 5ITRA 3QN0A 4FVMA 4JI4M 4G4RA 3QN9A 3ZCBB 2R18A 2EO2A 1I4WA 4GEWA 4X62M 2HKJA 4GMQA 3GLFB 1TTEA 4LJ5A 3IG8A 4QHTA 1JR3A 1G41A 2BJWA 3E9SA 3VLFB 4PCZA 3SAUA 2F5PA 5FTKA 4OX9M 1H6UA 2DZNB 2JY8A 2L7HA 4R7GA 3DZDA 1TFEA 2OOAA 3VKGA 3FUTA 1Z5BA 1DGHB 2QP9X 4DV1M 1QANA 4HEOA 1DGGA 2BNKA 2HAKA 2DKLA 4TUWA 4LRSA 4Z8XA 1OJLA 2KRKA 4B08A 1C1KA 2OBAA 4B3MM 3KFUG 3L2AA 1PJJA 2UUAM 3AV0A 4FW9A 3FE3A 1HNZM 1G4AE 1Z5AA 2QENA 1OFIA 4DUYM 5FLXS 3J27B 1D2NA 1NHWC 2OPFA 2BJVA 5EJCA 3B7NA 4RKUF 4AG5A 1MX0A 3ZC7B 3V76A 1J7KA 3BK6A 3KSXA 2CUZA 3E4RA 3AL0C 2L4FA 2CV2A 2OQ4A 4LFAM 2ZAMA 2R4JA 1IY0A 2KHHA 2C99A 1NNUC 2ERCA 1MN3A 2JWSA 3A42A 4KLNA 3FRHA 1T6OA 3MK6A 3U6EA 3HHXA 2FNAA 3U6MA 3UJNA 3BBZA 4IBIA 4JXJA 5EP2A 5A2QS 3FD9A 3HJSA 4IJEA 4M0DA 3VDPA 4LF5M 4LCBA 3KOYE 4LZZA 2RKOA 1IBKM 3SASA 3KOWE 1PGYA 1YLAA 2EKKA 3BOSA 3L26A 2DWLA 4AKIA 4IJFA 2VIIA 2JUJA 4KO8A 1TF0B 1AIPC 1YE9A 1R5LA 1RU3A 3AOEC 2Z8YM 2X4AA 4D81A 5EXPA 1JQJC 1TDZA 1N34M 1XNRM 3B89A 3LVWA 2DZLA 1N78A 3UZUA 1WXQA 2P5TA 1QDTA 2UXDM 1PJTA 3W67A 2R44A 2WSFF 3LVVA 2L6OA 4F1IA 2J7OA 2R45A 4NC6A 1L2BA 5KPRA 3M0NA 4Z6YA 3I2BA 1VQ1A 3U6DA 3T1HM 2XLJA 3LZEA 1DGFA 4FCWA 1I94M 2F5QA 3MHVC 4ZPXA 2XEPA 4CIZA 1QAMA 1SXJC 2AHMA 3K9OA 4LJAA 5EQTA 4L6V6 1L1ZA 3GLHA 1SXJE 3I04M 4M9SA 3VKHA 1E9RA 1HT1E 3FUVA 3GLGB 1ORYB 4NSRA 3K1JA 1G59A 2DWNA 1QVRA 2K47A 2DXIA 3LMMA 2LH0A 3U6PA 2C9CA 4QOZC 1TH2A 3DOAA 4GHLA 2H1RA 3NBXX 1GKIA 2KDLA 4B3TM 3GQ4A 2C9OA 5BR8M 4LF4M 3U61A 3ZH9B 3QYBA 3TWLA 5KPTA 4WP2A 4BLCA 4DV4M 1IY2A 3KW6A 2CHQA 5C1BA 3U5ZA 4XK8F 2EA0A 2UU9M 4K0KM 4IBBA 2LBCA 2RGHA 1SXJB 2CP8A 1NHGC 4HLQA 1LTMA 3AJIB 2DTTA 1VEKA 1NJGA 2Y0TA 2HL7A 3SHFA 1IXSA 5FTLA 1CUKA 1XMOM 1E32A 3KXEC 4LF6M 1Q3CA 3JYGA 1NVMA 3SAWA 5FTJA 4X66M 4LJ7A 4WURA 2FFJA 3SYKA 4KODA 1SXJA 2KA6B 2DVWB 4AKHA 1OAIA 2KW0A 4MH0E 5C18A 1J09A 3DFZA 4LJ9A 1GTQA 1IXSB 2XH9A 1SXJD 3CF2A 2CHGA 2MROB 3HU1A 4REZA 4LGYA 2V1CA 4NRWA 4G4OA 2WSEF 4QNMA 2XSZD 3QAUA 3T15A 4LRTA 2CV0A 3HHZA 3VFDA 3IHPA 1ZQ9A 4LJ8A 3U60B 1BVSA 1Q3BA 2ZBKB 1EE8A 4L4UA 3SARA 1L2CA 2LHCA 2G8LA 3W0LB 3GLFE 3KS8A 2M60A 3AFHA 3U6CA 4X65M 3HU3A 1R7RA 1ZMVA 5KQDA 4DR1M 1EFUB 1GL6A 4AW4A 3SC3A 3FTCA 1TDHA 2YQZA 2KNVA 3PVSA 5KPZA 3R8FA 4X64M 2L4EA 3K8ZA 4B3SM 4D82A 2BWBA 3GRVA 3AOEA 2Z7JA 4GH9A 4DV3M 2DJ6A 3KOZE 1G71A 2QPAA 4GITA 4YY3M 3I4YA 3GPYA 3GRYA 5ITXE 3IG5A 2Y0QA 4Y28F 1IM2A 4G6ZA 1D0LA 5EXSA 4PD2A 4LG2A 2JNHA 3KP0E 2J5YA 3NBIA 1IBMM 4M9ZA 1G8PA 4XBOA 3DA1A 3SFZA 4DV7M 2I7NA 4IBDA 2EUCA 4QNRA 1PRBA 3B9PA 3M6AA 5KQ8A 3KS4A 4DR7M 4OVZB 1P3QQ 2KXEA 4YHHM 3SATA 5GKNA 3D7JA 5E26A 3A45A 3RFWA 1L1TA 3GO8A 3HWSA 3T38A 2LTUA 3QNAA 4RF0A 1R2YA 4IBKA 4OVZA 2FE8A 3OTOM 2CRUA 1IY1A 3IECA 4ITQA 4JI0M 4G4QA 4I4LA 1OQYA 4MM3B 7CATA 3GRRA 2Z4RA 5LMNM 1HNWM 3GQ3A 2CV1A 3M0EA 2L2DA 2JZ1A 3JR4A 4JI2M 2VF8A 5FTNA 5ITQA 4QHSA 3Q8XA 3C3DA 4FD2A 1OIPA 2XSZA 2R46A 5F3WA 1ZMWA 4NOOB 1N32M 1WR1B 3K2LA 3CGWA 5DYIA 3GLFA 2C98A 2LHGA 3WHLA 4R71A 1GABA 3HHYA 3T6PA 4F2LA 3PNVA 3HJ8A 3LCVB 2KNAA 3EIHA 4LJ4A 3TL4X 2CE7A 4JI7M 1A5TA 1GL7A 4KHPM 2QSFX 4MGZE 2DWZB 3W0FA 2C5RA 1NSFA 2W82A 4MGKE 1L2DA 1D0MA 3HU2A 4NTMA 1PJSA 3CF6E 3QYEA 5EXXA 1IXZA 4QOSA 2XZFA 1SG9A 1V33A 1D0KA 4UN2B 1MU5A 2G3QA 2LXEA 1J5EM 4CGYB 4NL4H 1HR0M 1OFHA 4WW0A 3FTFA 3LX3A 3GPPA 4GC5A 5EP3A 1WGLA 3VK7A 4L16A 1YSYA 3NWLA 1XC8A 2G5GX 1VG5A 2K0BX 1E9SA 3CTWB 1Z5CA 5DFLA 3U6QA 4LFCM 1N33M 4W5WA 1VEJA 3C58A 2O5RA 1VDLA 1N77A 1UM8A 3U6LA 1XMQM 5JI3E 1AUAA 3J80S 2Q2EB 4B7GA 2D7EA 3SMSA 4NXMM 3FKEA 4II7A 3GLHE 1Y8GA 2MJ5B 4IBJA 4IBCA 4I8OA 3TWMA 4RNAA 1JR3D 4NRVA 1FNNA 4DV5M 1HQYE 3E46A 1N36M 1DGHA 1ZMUA 2N35A 3AKZA 2LVOC 1W5SA 2Y20A 1EIJA 1KSFX 1XB2B 3C9PA 3HZJA 2V6ZM 2ZAOA 3B7QA 2ZANA 3HJQA 1OKSA 2YFQA 3LCUA 2GNOA 1WINA 4PDGA 2R0IA 8CATA 2NQ8C 3B7ZA 3B74A 3MJ5A 1VDDA 4DUZM 2F5SA 3C3EA 4GC9A 2X49A 1PJIA 4R3DA 4GHAA 1DO0A 2LVPC 4AG6A 1MJGM 4JYAM 2JZ0A 3Q8GA 1W5TA 4AI6A 2JP7A 2OO9A 3HY5A 4L78A 3K9PA 5IZ7D 3LQQA 4NXNM 3GPUA 3GP1A 1R6BX 1XWIA 2B3TA 1NV9A 3UK6A 3J7AS 2M5ZA 1KYIA 3E21A 2DZOB 2UUBM 4FCVA 3I4VA 2ZTCA 1Q39A 2DWMA 4MGHA 4PT5A 4CJ6A 1OTRA 1IN5A 4P16A 3LW5F 1IN8A 1T3TA 1HT2E 2VDBB 3EIEA 2I7PA 3QWLA 3TE6A 2LWXA 2RGOA 5DNYA 2GQFA 4AKGA 3GLGA 4DR6M 1QAOA 3TPZA 2R62A 1B6ZA 1IN6A 2XFSA 3ZQJA 4FVFA 2LVQD 2OOBA 3JR5A 3GLIB 1Y13A 2QHOB 2QZ4A 1ZV1A 4D80A 3FYDA 2F4VM 4JV5M 4I5SA 3FYCA 4RF1A 1WJ7A 2KNZA 1WHCA 1IQPA 2CFOA 4M0WA 2XFTA 1LV7A 3A46A 3JAMS 5JI2E 3GLIA 1PM5A 2JXNA 2CWBA 2QQ8A 1QZMA 2DAIA 2O01F 1TH3A 1NY6A 1YUBA 2D7HA 5IWAM 2L7IA 1PJQA 2HCBA 1T43A 5DYGA 5H37D 1GVNA 3THGA 2LVNC 3U6SA 1E94E 2QNJA 2E5LM 4JI8M 5ITXA 2DNAA 2R4EA 1XNQM 3HX3A 3D8BA 1NJFA 1Q02A 1V34A 2F5NA 2DAMA 3F92A 2K9DA 3SYLA 4DR5M 2EKFA 2Y21A 4FWHA 4DV2M 4DBGB 3J7BA 4L8RC 1ZAEA 4DR4M 4EIWA 2QCUA 2WZJA 2DAKA 5EXTA 4GKKM 2FH0A 1IN7A 3FUWA 4LZJA 5EP4A 1FJGM 3FUXA 1GO5A 4LGMA 2YR0A 5KO3A 1S3SA 3U5ZB 1KFVA 4FVJA 2Z4SA 4OU7A 4DV6M 2VF7A 3VDUA 2CEAA 2MR9A 4LF9M 1R4GA 3A98B 4KT0F 2FOIC 3GPXA 2Z3XA 4FVGA 2F5OA 3FUUA 2XF3A 2DHYA 3TQSA 3UGJA 4JI5M 3I01M 3SAVA 2MH8A 4AQYM 4DV0M 4JI6M 4OW0A 1NV8A 2J7NA 2HHHM 4ANRA 2H5XA 4B7FA 5LMUM 3LQRA 1XHBA 4G3OA 4FCTA 4G4NA 2O25A 1DO2A 3GRUA 3KP1E 4NTNA 2FS1A 2R6FA 3WHKA 2CHVA 1G3IA 1QYRA 4BB9A 1Z6TA 2VQEM 1L8QA 3U60A 2UXBM 2JA2A 1WIVA 2ZM6M 3GLHB 1DGBA 4P17A 3J81S 1TGUA 2R65A 1JB0F 2L09A 1QQWA 5ITYA 1DV0A 5IREB 3W68A 2DAEA 2JY5A 4LF8M 3HKPA 4I81A 3KDSE 1IBLM 4CHTB 3AOGA 3HHWA 4PDIA 4DR3M 2V1UA 4NTKA 1GJTA 2KZSA 3T1YM 3FTEA 2WSCF 2BWEA 1X37A 3K92A 2DAGA 4IBGA 2XZUA 1R2ZA 1IFYA 2LNHC 4DR2M 1QAQA 1N75A 1Z59A 3FRIA 4JI3M 4IBEA 1NNJA 4B3RM 4MB7A 1F4IA 2JY7A 2KZUA 3L27A 5FSWA 4GIPA 3M7GA 4LY6A 4L15A 5FTMA 1OIZA 4Q7JA 3SMPA 1XXHA 4XGIA 4M9XA 2DENA 4LJ6A 2DHRA 3U61B 2HWJA 2RRUA 1WGNA 4AZFA 1K3XA 4CISA 5E6JA 4FWDA 1B66A 1XXHB 2K6BA 3ILKA 4S12A 1QZEA 3VK8A 1V92A 4BBAA 3UMMA 3KOXE 3J2PB 3KSJA 2X8AA 2DI0A 4A3VB 2UUCM 1NY5A 3RGPA 1GJSA 2UXCM 2YNMD 2LVAA 4MGYE 3GLIE 1K82A 1C7YA 4GRIA 4B7HA 3L25A 1K3WA 4FWGA 5ITUA 2RPBA 1HJPA 3I51A 1JR3E 3PXGA 5IT9S 2A5YB 2XGNA 3BXWA 3L29A 4IBFA 2MGWA 2A0SA 3KVWA 3D8LA 1QUTA 4LF7M 1IXRC 3HGIA 4NSOB 1VEGA 4JN6A 1HQCA 3GQ5A 2G64A 2EJSA 4HL4A 3RGSA 1GLNA 5ITTA 3L28A 3H4MA 3TWKA 4GKJM 1UFZA 1QDRA 4MGIE 2D7GA 3GLGE 1TH4A 1TR8A 1XXHE 3H4JA 3MMPA 1OAOC 3PNYA 1HNXM 3RE8A 3FTDA 1IN4A 3SHGB 5L8RF 3SBJA 4JI1M 5BPVA 1QUSA 4IIWA 2C96A 1NO1A 3U6OA 4LFBM
chains in the Genus database with same CATH topology
2JY6B 5DFLA 1GO5A 1VEJA 1VEKA 1IXSA 1VDLA 1CUKA 2ZTDA 3GLHE 1Y8GA 2MJ5B 2MR9A 1R4GA 4GEWA 1TTEA 1OAIA 2DHYA 1HQYE 3E46A 1G41A 1ZMUA 2MROB 2JY8A 2LVOC 1TFEA 2OOAA 1NV8A 1XB2B 2H5XA 4HEOA 2HAKA 2DKLA 3IHPA 1OKSA 4G3OA 3LCUA 1BVSA 1DO2A 2O25A 2R0IA 3GLFE 1G3IA 3FE3A 1G4AE 1ZMVA 1EFUB 1WIVA 2KNVA 1DV0A 1DO0A 2LVPC 2DAEA 2L4EA 2L4FA 2BWBA 2JY5A 2JZ0A 2JP7A 2KHHA 2OO9A 3K9PA 3GLIE 1MN3A 2B3TA 1NV9A 3FRHA 1T6OA 1KYIA 3E21A 3BBZA 2BWEA 2DAGA 1IM2A 1IFYA 2ZTCA 2JNHA 1OTRA 3FRIA 1PGYA 1YLAA 2EKKA 1F4IA 2JY7A 1HT2E 1P3QQ 2JUJA 1AIPC 2LTUA 4Q7JA 3B89A 3IECA 2DZLA 1OQYA 2LVQD 2DENA 2OOBA 2HWJA 2RRUA 4F1IA 1WGNA 2QHOB 1ZV1A 2L2DA 2JZ1A 1QZEA 1V92A 1VQ1A 1WJ7A 2KNZA 1WHCA 1ZMWA 1WR1B 2DI0A 3K9OA 4R71A 5JI2E 4F2LA 3T6PA 2LVAA 2CWBA 3LCVB 2DAIA 2KNAA 1C7YA 1HJPA 1HT1E 1JR3E 1A5TA 1T43A 2QSFX 2LVNC 2MGWA 1E94E 2QNJA 1VEGA 2DNAA 2EJSA 1Q02A 2DAMA 1SG9A 3F92A 2K9DA 1UFZA 2EKFA 4UN2B 3GLGE 4WP2A 4DBGB 2G3QA 1TR8A 1XXHE 3H4JA 3MMPA 2WZJA 1WGLA 2DAKA 1VG5A 2K0BX 2LBCA 2CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY6 B;  5DFL A;  1GO5 A;  1VEJ A;  1VEK A;  1IXS A;  1VDL A;  1CUK A;  2ZTD A;  3GLH E;  1Y8G A;  2MJ5 B;  2MR9 A;  1R4G A;  4GEW A;  1TTE A;  1OAI A;  2DHY A;  1HQY E;  3E46 A;  1G41 A;  1ZMU A;  2MRO B;  2JY8 A;  2LVO C;  1TFE A;  2OOA A;  1NV8 A;  1XB2 B;  2H5X A;  4HEO A;  2HAK A;  2DKL A;  3IHP A;  1OKS A;  4G3O A;  3LCU A;  1BVS A;  1DO2 A;  2O25 A;  2R0I A;  3GLF E;  1G3I A;  3FE3 A;  1G4A E;  1ZMV A;  1EFU B;  1WIV A;  2KNV A;  1DV0 A;  1DO0 A;  2LVP C;  2DAE A;  2L4E A;  2L4F A;  2BWB A;  2JY5 A;  2JZ0 A;  2JP7 A;  2KHH A;  2OO9 A;  3K9P A;  3GLI E;  1MN3 A;  2B3T A;  1NV9 A;  3FRH A;  1T6O A;  1KYI A;  3E21 A;  3BBZ A;  2BWE A;  2DAG A;  1IM2 A;  1IFY A;  2ZTC A;  2JNH A;  1OTR A;  3FRI A;  1PGY A;  1YLA A;  2EKK A;  1F4I A;  2JY7 A;  1HT2 E;  1P3Q Q;  2JUJ A;  1AIP C;  2LTU A;  4Q7J A;  3B89 A;  3IEC A;  2DZL A;  1OQY A;  2LVQ D;  2DEN A;  2OOB A;  2HWJ A;  2RRU A;  4F1I A;  1WGN A;  2QHO B;  1ZV1 A;  2L2D A;  2JZ1 A;  1QZE A;  1V92 A;  1VQ1 A;  1WJ7 A;  2KNZ A;  1WHC A;  1ZMW A;  1WR1 B;  2DI0 A;  3K9O A;  4R71 A;  5JI2 E;  4F2L A;  3T6P A;  2LVA A;  2CWB A;  3LCV B;  2DAI A;  2KNA A;  1C7Y A;  1HJP A;  1HT1 E;  1JR3 E;  1A5T A;  1T43 A;  2QSF X;  2LVN C;  2MGW A;  1E94 E;  2QNJ A;  1VEG A;  2DNA A;  2EJS A;  1Q02 A;  2DAM A;  1SG9 A;  3F92 A;  2K9D A;  1UFZ A;  2EKF A;  4UN2 B;  3GLG E;  4WP2 A;  4DBG B;  2G3Q A;  1TR8 A;  1XXH E;  3H4J A;  3MMP A;  2WZJ A;  1WGL A;  2DAK A;  1VG5 A;  2K0B X;  2LBC A;  2CP8 A; 
#chains in the Genus database with same CATH topology
 2JY6 B;  2QBY B;  2KRU A;  2APL A;  3R9X B;  3CF0 A;  2KEB A;  2VQF M;  3PFI A;  5EP1 A;  2ZTD A;  2QBY A;  5ITR A;  3QN0 A;  4FVM A;  4JI4 M;  4G4R A;  3QN9 A;  3ZCB B;  2R18 A;  2EO2 A;  1I4W A;  4GEW A;  4X62 M;  2HKJ A;  4GMQ A;  3GLF B;  1TTE A;  4LJ5 A;  3IG8 A;  4QHT A;  1JR3 A;  1G41 A;  2BJW A;  3E9S A;  3VLF B;  4PCZ A;  3SAU A;  2F5P A;  5FTK A;  4OX9 M;  1H6U A;  2DZN B;  2JY8 A;  2L7H A;  4R7G A;  3DZD A;  1TFE A;  2OOA A;  3VKG A;  3FUT A;  1Z5B A;  1DGH B;  2QP9 X;  4DV1 M;  1QAN A;  4HEO A;  1DGG A;  2BNK A;  2HAK A;  2DKL A;  4TUW A;  4LRS A;  4Z8X A;  1OJL A;  2KRK A;  4B08 A;  1C1K A;  2OBA A;  4B3M M;  3KFU G;  3L2A A;  1PJJ A;  2UUA M;  3AV0 A;  4FW9 A;  3FE3 A;  1HNZ M;  1G4A E;  1Z5A A;  2QEN A;  1OFI A;  4DUY M;  5FLX S;  3J27 B;  1D2N A;  1NHW C;  2OPF A;  2BJV A;  5EJC A;  3B7N A;  4RKU F;  4AG5 A;  1MX0 A;  3ZC7 B;  3V76 A;  1J7K A;  3BK6 A;  3KSX A;  2CUZ A;  3E4R A;  3AL0 C;  2L4F A;  2CV2 A;  2OQ4 A;  4LFA M;  2ZAM A;  2R4J A;  1IY0 A;  2KHH A;  2C99 A;  1NNU C;  2ERC A;  1MN3 A;  2JWS A;  3A42 A;  4KLN A;  3FRH A;  1T6O A;  3MK6 A;  3U6E A;  3HHX A;  2FNA A;  3U6M A;  3UJN A;  3BBZ A;  4IBI A;  4JXJ A;  5EP2 A;  5A2Q S;  3FD9 A;  3HJS A;  4IJE A;  4M0D A;  3VDP A;  4LF5 M;  4LCB A;  3KOY E;  4LZZ A;  2RKO A;  1IBK M;  3SAS A;  3KOW E;  1PGY A;  1YLA A;  2EKK A;  3BOS A;  3L26 A;  2DWL A;  4AKI A;  4IJF A;  2VII A;  2JUJ A;  4KO8 A;  1TF0 B;  1AIP C;  1YE9 A;  1R5L A;  1RU3 A;  3AOE C;  2Z8Y M;  2X4A A;  4D81 A;  5EXP A;  1JQJ C;  1TDZ A;  1N34 M;  1XNR M;  3B89 A;  3LVW A;  2DZL A;  1N78 A;  3UZU A;  1WXQ A;  2P5T A;  1QDT A;  2UXD M;  1PJT A;  3W67 A;  2R44 A;  2WSF F;  3LVV A;  2L6O A;  4F1I A;  2J7O A;  2R45 A;  4NC6 A;  1L2B A;  5KPR A;  3M0N A;  4Z6Y A;  3I2B A;  1VQ1 A;  3U6D A;  3T1H M;  2XLJ A;  3LZE A;  1DGF A;  4FCW A;  1I94 M;  2F5Q A;  3MHV C;  4ZPX A;  2XEP A;  4CIZ A;  1QAM A;  1SXJ C;  2AHM A;  3K9O A;  4LJA A;  5EQT A;  4L6V 6;  1L1Z A;  3GLH A;  1SXJ E;  3I04 M;  4M9S A;  3VKH A;  1E9R A;  1HT1 E;  3FUV A;  3GLG B;  1ORY B;  4NSR A;  3K1J A;  1G59 A;  2DWN A;  1QVR A;  2K47 A;  2DXI A;  3LMM A;  2LH0 A;  3U6P A;  2C9C A;  4QOZ C;  1TH2 A;  3DOA A;  4GHL A;  2H1R A;  3NBX X;  1GKI A;  2KDL A;  4B3T M;  3GQ4 A;  2C9O A;  5BR8 M;  4LF4 M;  3U61 A;  3ZH9 B;  3QYB A;  3TWL A;  5KPT A;  4WP2 A;  4BLC A;  4DV4 M;  1IY2 A;  3KW6 A;  2CHQ A;  5C1B A;  3U5Z A;  4XK8 F;  2EA0 A;  2UU9 M;  4K0K M;  4IBB A;  2LBC A;  2RGH A;  1SXJ B;  2CP8 A;  1NHG C;  4HLQ A;  1LTM A;  3AJI B;  2DTT A;  1VEK A;  1NJG A;  2Y0T A;  2HL7 A;  3SHF A;  1IXS A;  5FTL A;  1CUK A;  1XMO M;  1E32 A;  3KXE C;  4LF6 M;  1Q3C A;  3JYG A;  1NVM A;  3SAW A;  5FTJ A;  4X66 M;  4LJ7 A;  4WUR A;  2FFJ A;  3SYK A;  4KOD A;  1SXJ A;  2KA6 B;  2DVW B;  4AKH A;  1OAI A;  2KW0 A;  4MH0 E;  5C18 A;  1J09 A;  3DFZ A;  4LJ9 A;  1GTQ A;  1IXS B;  2XH9 A;  1SXJ D;  3CF2 A;  2CHG A;  2MRO B;  3HU1 A;  4REZ A;  4LGY A;  2V1C A;  4NRW A;  4G4O A;  2WSE F;  4QNM A;  2XSZ D;  3QAU A;  3T15 A;  4LRT A;  2CV0 A;  3HHZ A;  3VFD A;  3IHP A;  1ZQ9 A;  4LJ8 A;  3U60 B;  1BVS A;  1Q3B A;  2ZBK B;  1EE8 A;  4L4U A;  3SAR A;  1L2C A;  2LHC A;  2G8L A;  3W0L B;  3GLF E;  3KS8 A;  2M60 A;  3AFH A;  3U6C A;  4X65 M;  3HU3 A;  1R7R A;  1ZMV A;  5KQD A;  4DR1 M;  1EFU B;  1GL6 A;  4AW4 A;  3SC3 A;  3FTC A;  1TDH A;  2YQZ A;  2KNV A;  3PVS A;  5KPZ A;  3R8F A;  4X64 M;  2L4E A;  3K8Z A;  4B3S M;  4D82 A;  2BWB A;  3GRV A;  3AOE A;  2Z7J A;  4GH9 A;  4DV3 M;  2DJ6 A;  3KOZ E;  1G71 A;  2QPA A;  4GIT A;  4YY3 M;  3I4Y A;  3GPY A;  3GRY A;  5ITX E;  3IG5 A;  2Y0Q A;  4Y28 F;  1IM2 A;  4G6Z A;  1D0L A;  5EXS A;  4PD2 A;  4LG2 A;  2JNH A;  3KP0 E;  2J5Y A;  3NBI A;  1IBM M;  4M9Z A;  1G8P A;  4XBO A;  3DA1 A;  3SFZ A;  4DV7 M;  2I7N A;  4IBD A;  2EUC A;  4QNR A;  1PRB A;  3B9P A;  3M6A A;  5KQ8 A;  3KS4 A;  4DR7 M;  4OVZ B;  1P3Q Q;  2KXE A;  4YHH M;  3SAT A;  5GKN A;  3D7J A;  5E26 A;  3A45 A;  3RFW A;  1L1T A;  3GO8 A;  3HWS A;  3T38 A;  2LTU A;  3QNA A;  4RF0 A;  1R2Y A;  4IBK A;  4OVZ A;  2FE8 A;  3OTO M;  2CRU A;  1IY1 A;  3IEC A;  4ITQ A;  4JI0 M;  4G4Q A;  4I4L A;  1OQY A;  4MM3 B;  7CAT A;  3GRR A;  2Z4R A;  5LMN M;  1HNW M;  3GQ3 A;  2CV1 A;  3M0E A;  2L2D A;  2JZ1 A;  3JR4 A;  4JI2 M;  2VF8 A;  5FTN A;  5ITQ A;  4QHS A;  3Q8X A;  3C3D A;  4FD2 A;  1OIP A;  2XSZ A;  2R46 A;  5F3W A;  1ZMW A;  4NOO B;  1N32 M;  1WR1 B;  3K2L A;  3CGW A;  5DYI A;  3GLF A;  2C98 A;  2LHG A;  3WHL A;  4R71 A;  1GAB A;  3HHY A;  3T6P A;  4F2L A;  3PNV A;  3HJ8 A;  3LCV B;  2KNA A;  3EIH A;  4LJ4 A;  3TL4 X;  2CE7 A;  4JI7 M;  1A5T A;  1GL7 A;  4KHP M;  2QSF X;  4MGZ E;  2DWZ B;  3W0F A;  2C5R A;  1NSF A;  2W82 A;  4MGK E;  1L2D A;  1D0M A;  3HU2 A;  4NTM A;  1PJS A;  3CF6 E;  3QYE A;  5EXX A;  1IXZ A;  4QOS A;  2XZF A;  1SG9 A;  1V33 A;  1D0K A;  4UN2 B;  1MU5 A;  2G3Q A;  2LXE A;  1J5E M;  4CGY B;  4NL4 H;  1HR0 M;  1OFH A;  4WW0 A;  3FTF A;  3LX3 A;  3GPP A;  4GC5 A;  5EP3 A;  1WGL A;  3VK7 A;  4L16 A;  1YSY A;  3NWL A;  1XC8 A;  2G5G X;  1VG5 A;  2K0B X;  1E9S A;  3CTW B;  1Z5C A;  5DFL A;  3U6Q A;  4LFC M;  1N33 M;  4W5W A;  1VEJ A;  3C58 A;  2O5R A;  1VDL A;  1N77 A;  1UM8 A;  3U6L A;  1XMQ M;  5JI3 E;  1AUA A;  3J80 S;  2Q2E B;  4B7G A;  2D7E A;  3SMS A;  4NXM M;  3FKE A;  4II7 A;  3GLH E;  1Y8G A;  2MJ5 B;  4IBJ A;  4IBC A;  4I8O A;  3TWM A;  4RNA A;  1JR3 D;  4NRV A;  1FNN A;  4DV5 M;  1HQY E;  3E46 A;  1N36 M;  1DGH A;  1ZMU A;  2N35 A;  3AKZ A;  2LVO C;  1W5S A;  2Y20 A;  1EIJ A;  1KSF X;  1XB2 B;  3C9P A;  3HZJ A;  2V6Z M;  2ZAO A;  3B7Q A;  2ZAN A;  3HJQ A;  1OKS A;  2YFQ A;  3LCU A;  2GNO A;  1WIN A;  4PDG A;  2R0I A;  8CAT A;  2NQ8 C;  3B7Z A;  3B74 A;  3MJ5 A;  1VDD A;  4DUZ M;  2F5S A;  3C3E A;  4GC9 A;  2X49 A;  1PJI A;  4R3D A;  4GHA A;  1DO0 A;  2LVP C;  4AG6 A;  1MJG M;  4JYA M;  2JZ0 A;  3Q8G A;  1W5T A;  4AI6 A;  2JP7 A;  2OO9 A;  3HY5 A;  4L78 A;  3K9P A;  5IZ7 D;  3LQQ A;  4NXN M;  3GPU A;  3GP1 A;  1R6B X;  1XWI A;  2B3T A;  1NV9 A;  3UK6 A;  3J7A S;  2M5Z A;  1KYI A;  3E21 A;  2DZO B;  2UUB M;  4FCV A;  3I4V A;  2ZTC A;  1Q39 A;  2DWM A;  4MGH A;  4PT5 A;  4CJ6 A;  1OTR A;  1IN5 A;  4P16 A;  3LW5 F;  1IN8 A;  1T3T A;  1HT2 E;  2VDB B;  3EIE A;  2I7P A;  3QWL A;  3TE6 A;  2LWX A;  2RGO A;  5DNY A;  2GQF A;  4AKG A;  3GLG A;  4DR6 M;  1QAO A;  3TPZ A;  2R62 A;  1B6Z A;  1IN6 A;  2XFS A;  3ZQJ A;  4FVF A;  2LVQ D;  2OOB A;  3JR5 A;  3GLI B;  1Y13 A;  2QHO B;  2QZ4 A;  1ZV1 A;  4D80 A;  3FYD A;  2F4V M;  4JV5 M;  4I5S A;  3FYC A;  4RF1 A;  1WJ7 A;  2KNZ A;  1WHC A;  1IQP A;  2CFO A;  4M0W A;  2XFT A;  1LV7 A;  3A46 A;  3JAM S;  5JI2 E;  3GLI A;  1PM5 A;  2JXN A;  2CWB A;  2QQ8 A;  1QZM A;  2DAI A;  2O01 F;  1TH3 A;  1NY6 A;  1YUB A;  2D7H A;  5IWA M;  2L7I A;  1PJQ A;  2HCB A;  1T43 A;  5DYG A;  5H37 D;  1GVN A;  3THG A;  2LVN C;  3U6S A;  1E94 E;  2QNJ A;  2E5L M;  4JI8 M;  5ITX A;  2DNA A;  2R4E A;  1XNQ M;  3HX3 A;  3D8B A;  1NJF A;  1Q02 A;  1V34 A;  2F5N A;  2DAM A;  3F92 A;  2K9D A;  3SYL A;  4DR5 M;  2EKF A;  2Y21 A;  4FWH A;  4DV2 M;  4DBG B;  3J7B A;  4L8R C;  1ZAE A;  4DR4 M;  4EIW A;  2QCU A;  2WZJ A;  2DAK A;  5EXT A;  4GKK M;  2FH0 A;  1IN7 A;  3FUW A;  4LZJ A;  5EP4 A;  1FJG M;  3FUX A;  1GO5 A;  4LGM A;  2YR0 A;  5KO3 A;  1S3S A;  3U5Z B;  1KFV A;  4FVJ A;  2Z4S A;  4OU7 A;  4DV6 M;  2VF7 A;  3VDU A;  2CEA A;  2MR9 A;  4LF9 M;  1R4G A;  3A98 B;  4KT0 F;  2FOI C;  3GPX A;  2Z3X A;  4FVG A;  2F5O A;  3FUU A;  2XF3 A;  2DHY A;  3TQS A;  3UGJ A;  4JI5 M;  3I01 M;  3SAV A;  2MH8 A;  4AQY M;  4DV0 M;  4JI6 M;  4OW0 A;  1NV8 A;  2J7N A;  2HHH M;  4ANR A;  2H5X A;  4B7F A;  5LMU M;  3LQR A;  1XHB A;  4G3O A;  4FCT A;  4G4N A;  2O25 A;  1DO2 A;  3GRU A;  3KP1 E;  4NTN A;  2FS1 A;  2R6F A;  3WHK A;  2CHV A;  1G3I A;  1QYR A;  4BB9 A;  1Z6T A;  2VQE M;  1L8Q A;  3U60 A;  2UXB M;  2JA2 A;  1WIV A;  2ZM6 M;  3GLH B;  1DGB A;  4P17 A;  3J81 S;  1TGU A;  2R65 A;  1JB0 F;  2L09 A;  1QQW A;  5ITY A;  1DV0 A;  5IRE B;  3W68 A;  2DAE A;  2JY5 A;  4LF8 M;  3HKP A;  4I81 A;  3KDS E;  1IBL M;  4CHT B;  3AOG A;  3HHW A;  4PDI A;  4DR3 M;  2V1U A;  4NTK A;  1GJT A;  2KZS A;  3T1Y M;  3FTE A;  2WSC F;  2BWE A;  1X37 A;  3K92 A;  2DAG A;  4IBG A;  2XZU A;  1R2Z A;  1IFY A;  2LNH C;  4DR2 M;  1QAQ A;  1N75 A;  1Z59 A;  3FRI A;  4JI3 M;  4IBE A;  1NNJ A;  4B3R M;  4MB7 A;  1F4I A;  2JY7 A;  2KZU A;  3L27 A;  5FSW A;  4GIP A;  3M7G A;  4LY6 A;  4L15 A;  5FTM A;  1OIZ A;  4Q7J A;  3SMP A;  1XXH A;  4XGI A;  4M9X A;  2DEN A;  4LJ6 A;  2DHR A;  3U61 B;  2HWJ A;  2RRU A;  1WGN A;  4AZF A;  1K3X A;  4CIS A;  5E6J A;  4FWD A;  1B66 A;  1XXH B;  2K6B A;  3ILK A;  4S12 A;  1QZE A;  3VK8 A;  1V92 A;  4BBA A;  3UMM A;  3KOX E;  3J2P B;  3KSJ A;  2X8A A;  2DI0 A;  4A3V B;  2UUC M;  1NY5 A;  3RGP A;  1GJS A;  2UXC M;  2YNM D;  2LVA A;  4MGY E;  3GLI E;  1K82 A;  1C7Y A;  4GRI A;  4B7H A;  3L25 A;  1K3W A;  4FWG A;  5ITU A;  2RPB A;  1HJP A;  3I51 A;  1JR3 E;  3PXG A;  5IT9 S;  2A5Y B;  2XGN A;  3BXW A;  3L29 A;  4IBF A;  2MGW A;  2A0S A;  3KVW A;  3D8L A;  1QUT A;  4LF7 M;  1IXR C;  3HGI A;  4NSO B;  1VEG A;  4JN6 A;  1HQC A;  3GQ5 A;  2G64 A;  2EJS A;  4HL4 A;  3RGS A;  1GLN A;  5ITT A;  3L28 A;  3H4M A;  3TWK A;  4GKJ M;  1UFZ A;  1QDR A;  4MGI E;  2D7G A;  3GLG E;  1TH4 A;  1TR8 A;  1XXH E;  3H4J A;  3MMP A;  1OAO C;  3PNY A;  1HNX M;  3RE8 A;  3FTD A;  1IN4 A;  3SHG B;  5L8R F;  3SBJ A;  4JI1 M;  5BPV A;  1QUS A;  4IIW A;  2C96 A;  1NO1 A;  3U6O A;  4LFB M; 
#chains in the Genus database with same CATH homology
 2JY6 B;  5DFL A;  1GO5 A;  1VEJ A;  1VEK A;  1IXS A;  1VDL A;  1CUK A;  2ZTD A;  3GLH E;  1Y8G A;  2MJ5 B;  2MR9 A;  1R4G A;  4GEW A;  1TTE A;  1OAI A;  2DHY A;  1HQY E;  3E46 A;  1G41 A;  1ZMU A;  2MRO B;  2JY8 A;  2LVO C;  1TFE A;  2OOA A;  1NV8 A;  1XB2 B;  2H5X A;  4HEO A;  2HAK A;  2DKL A;  3IHP A;  1OKS A;  4G3O A;  3LCU A;  1BVS A;  1DO2 A;  2O25 A;  2R0I A;  3GLF E;  1G3I A;  3FE3 A;  1G4A E;  1ZMV A;  1EFU B;  1WIV A;  2KNV A;  1DV0 A;  1DO0 A;  2LVP C;  2DAE A;  2L4E A;  2L4F A;  2BWB A;  2JY5 A;  2JZ0 A;  2JP7 A;  2KHH A;  2OO9 A;  3K9P A;  3GLI E;  1MN3 A;  2B3T A;  1NV9 A;  3FRH A;  1T6O A;  1KYI A;  3E21 A;  3BBZ A;  2BWE A;  2DAG A;  1IM2 A;  1IFY A;  2ZTC A;  2JNH A;  1OTR A;  3FRI A;  1PGY A;  1YLA A;  2EKK A;  1F4I A;  2JY7 A;  1HT2 E;  1P3Q Q;  2JUJ A;  1AIP C;  2LTU A;  4Q7J A;  3B89 A;  3IEC A;  2DZL A;  1OQY A;  2LVQ D;  2DEN A;  2OOB A;  2HWJ A;  2RRU A;  4F1I A;  1WGN A;  2QHO B;  1ZV1 A;  2L2D A;  2JZ1 A;  1QZE A;  1V92 A;  1VQ1 A;  1WJ7 A;  2KNZ A;  1WHC A;  1ZMW A;  1WR1 B;  2DI0 A;  3K9O A;  4R71 A;  5JI2 E;  4F2L A;  3T6P A;  2LVA A;  2CWB A;  3LCV B;  2DAI A;  2KNA A;  1C7Y A;  1HJP A;  1HT1 E;  1JR3 E;  1A5T A;  1T43 A;  2QSF X;  2LVN C;  2MGW A;  1E94 E;  2QNJ A;  1VEG A;  2DNA A;  2EJS A;  1Q02 A;  2DAM A;  1SG9 A;  3F92 A;  2K9D A;  1UFZ A;  2EKF A;  4UN2 B;  3GLG E;  4WP2 A;  4DBG B;  2G3Q A;  1TR8 A;  1XXH E;  3H4J A;  3MMP A;  2WZJ A;  1WGL A;  2DAK A;  1VG5 A;  2K0B X;  2LBC A;  2CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...