1XB2B

Crystal structure of bos taurus mitochondrial elongation factor tu/ts complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
276
Chain Sequence
SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRKTKEGLIGLLQEGDTTVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQNLKDQLSTYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAAWVKVPAGFYVGSYVHGAMHSPSLHNLVLGKYGALVICETSELKANLADLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPHGVSVVDFVRFECGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Bovine Mitochondrial Elongation Factor Tu.Ts Complex
pubmed doi rcsb
source organism Bos taurus
molecule tags Translation
molecule keywords Elongation factor Tu, mitochondrial
total genus 83
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1xb2B01
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B03
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B02
1Q02A 1Y8GA 2DZLA 3GLFE 3FRHA 1TFEA 2DAGA 1T6OA 1OKSA 2DI0A 2DAEA 2LVOC 1WJ7A 2JZ1A 3GLHE 4Q7JA 2EJSA 2MJ5B 2HWJA 2L4EA 1HQYE 1ZMVA 1WIVA 4GEWA 1WGLA 1BVSA 2DKLA 4WP2A 1ZV1A 4UN2B 2DENA 1YLAA 2KNAA 2JY5A 2DAIA 2JY6B 3F92A 1ZMUA 1G3IA 2DNAA 1DO2A 2LVQD 3BBZA 1G4AE 2G3QA 1HT1E 3K9PA 3E21A 2ZTCA 2B3TA 1XB2B 1OAIA 2LBCA 2EKFA 1HT2E 1NV9A 1WHCA 2CP8A 1GO5A 4G3OA 1WGNA 1G41A 3FRIA 1E94E 1IM2A 4DBGB 1T43A 3K9OA 1C7YA 1VQ1A 1HJPA 4F2LA 1XXHE 4HEOA 2EKKA 5JI2E 1SG9A 3FE3A 2JY7A 1IFYA 2O25A 3IHPA 2JNHA 2L4FA 2LVAA 2BWEA 2L2DA 3LCUA 3T6PA 2CWBA 2KHHA 2K0BX 2DAKA 2OOAA 1OTRA 1VEGA 2ZTDA 1DV0A 1ZMWA 1VEJA 5DFLA 1NV8A 2MROB 2QNJA 2R0IA 3H4JA 1WR1B 2OOBA 2DAMA 2MR9A 1A5TA 2OO9A 2K9DA 2LVNC 2QSFX 1MN3A 1KYIA 2LVPC 1R4GA 1VG5A 2WZJA 2KNZA 3B89A 1CUKA 4R71A 1QZEA 1EFUB 1JR3E 2JUJA 1IXSA 3MMPA 1P3QQ 1OQYA 1TR8A 2KNVA 2DHYA 1VDLA 1UFZA 3E46A 1TTEA 2BWBA 3GLGE 2LTUA 3GLIE 1F4IA 2QHOB 2HAKA 2MGWA 3IECA 2JP7A 2JY8A 2JZ0A 1VEKA 1AIPC 2RRUA 1DO0A 3LCVB 1V92A 2H5XA 4F1IA 1PGYA
chains in the Genus database with same CATH superfamily
3BXWA 2ZM6M 4KHPM 5JI3E 3GLFE 1L2BA 3L28A 1N33M 4S12A 4FWHA 2A0SA 2A5YB 2N35A 2G5GX 4JI5M 2R45A 3LQRA 1HR0M 2LVOC 4NSOB 4NC6A 3JYGA 4FVMA 2HKJA 3TPZA 4GHAA 3KOZE 1NVMA 3FUVA 2RPBA 4GEWA 3U5ZA 1BVSA 1DGHA 3DA1A 2YNMD 1H6UA 4WP2A 3A42A 2LHCA 1VDDA 4NRWA 4NSRA 1D2NA 3W0FA 2F5PA 1J7KA 2DAIA 3U6MA 1QAMA 5H37D 3KS4A 1ZMUA 3J2PB 2G8LA 2DNAA 3CTWB 2LVQD 3RFWA 3E9SA 4BB9A 1QANA 2JA2A 4KT0F 3K9PA 5BPVA 4WW0A 1G71A 2ZTCA 1TF0B 3PNVA 4PCZA 4IBBA 5ITXE 2UU9M 4FCTA 1DGBA 1QDRA 2O01F 1HT2E 1GJTA 4OVZB 4QHTA 4EIWA 1WHCA 5IWAM 4NTKA 2X49A 1GO5A 5FLXS 4LRTA 4LGYA 3PFIA 4DR4M 3R9XB 2DXIA 1EIJA 5GKNA 4LF6M 1FJGM 4L8RC 3SHGB 3T38A 1TDHA 4GITA 3W68A 1T43A 4I81A 2J7OA 1T3TA 3CF6E 1EE8A 1OFIA 1W5TA 2Q2EB 1ORYB 2NQ8C 4NL4H 3J81S 3HJQA 1R7RA 3FE3A 2JY7A 1K82A 4TUWA 2J5YA 4JN6A 4QNMA 3LVWA 4MGZE 2K6BA 2M5ZA 2LH0A 2XSZA 2CWBA 3HX3A 3I4VA 1IN8A 3QAUA 2C96A 4G4OA 2CHVA 3GPUA 4Y28F 2RGHA 3LX3A 2VF8A 1IY1A 4FWGA 4DV2M 2DWLA 2QNJA 4IBKA 3SBJA 5C18A 2DAMA 1L1ZA 1A5TA 5KPRA 2CV2A 3VLFB 2LVNC 2DHRA 3SAVA 2YR0A 1QQWA 2Z7JA 2MH8A 4RKUF 3J80S 1PM5A 1N77A 3I2BA 4B08A 1SXJD 3KDSE 1HNWM 2KDLA 1PRBA 4MM3B 1OJLA 3K2LA 4RF0A 2WZJA 3J7AS 2I7PA 4IIWA 3T1YM 3B89A 2FE8A 1XC8A 3U6PA 1CUKA 4XBOA 5ITUA 4B3SM 4X66M 3HZJA 3SAWA 2F5OA 3MHVC 3HKPA 1IXSA 2CV0A 2WSEF 2XLJA 2YFQA 1TTEA 3KSJA 2LHGA 2VQEM 3L25A 1D0KA 1YUBA 3GLGA 2LNHC 2MGWA 3HHWA 4DV0M 3VFDA 2JP7A 2QP9X 3D8BA 1SXJB 3RE8A 3FUXA 3U6DA 4RF1A 1GL7A 1JR3A 4LJ5A 4DV1M 4OX9M 1Q3BA 1QAQA 1Q02A 1OFHA 2D7EA 3C3EA 3KP1E 4JI0M 1R2YA 1TFEA 2KZSA 3CGWA 2FFJA 1OKSA 5DYGA 1QDTA 2DI0A 3DOAA 5FTNA 3FKEA 4DR1M 3GLHE 3B7QA 1OIPA 2HWJA 4KO8A 3D8LA 1QYRA 2XGNA 3FTCA 4L6V6 1WGLA 4IBIA 2XFSA 2R65A 4NRVA 4UN2B 2FH0A 1GVNA 2KW0A 3GRRA 4IBFA 3KW6A 1LV7A 4DUZM 2KNAA 2CEAA 3FYDA 2JY5A 2Y0TA 4DR2M 3SYKA 2JY6B 1E32A 3B9PA 2UUCM 4M0DA 4KODA 4CHTB 3TE6A 3SMSA 1IXRC 2DZOB 2C9CA 2FOIC 3HY5A 2OBAA 3TWKA 3L26A 1L2DA 3BBZA 4AI6A 1NHGC 1HT1E 4IJFA 4II7A 1DGHB 1L1TA 5KQDA 4JYAM 4REZA 4LFAM 2B3TA 1IXZA 2Y0QA 4YY3M 3IG8A 4HLQA 1N32M 2HHHM 5A2QS 2VQFM 3I4YA 1NJGA 1NV9A 2R4EA 2V1CA 3FTFA 1GTQA 1NO1A 4LZZA 1WGNA 3SMPA 3UJNA 4DBGB 4DV4M 2FS1A 4I8OA 3THGA 1JR3D 1XXHB 4LCBA 3B7NA 3U6QA 4GHLA 3MK6A 2KXEA 1K3WA 2I7NA 1IN7A 4I5SA 1VQ1A 4NOOB 3U61A 1HJPA 3RGSA 4F2LA 3A46A 2M60A 4DV7M 4JI8M 4ANRA 4DR6M 5JI2E 1MU5A 4D81A 4LF4M 2O5RA 5ITRA 2L2DA 1KSFX 4I4LA 1PJQA 5L8RF 3QNAA 3T6PA 4AZFA 1W5SA 3HJSA 4DV6M 3DZDA 2GNOA 1Y13A 3LVVA 4Z8XA 1V33A 3VK7A 4X65M 3VKHA 1IN6A 4NTMA 3FUUA 2OOBA 2BJVA 3UK6A 1IN4A 3FUTA 2DWNA 3KSXA 2DWZB 4L4UA 4M9ZA 5EQTA 5KQ8A 5ITTA 3OTOM 1IBMM 4QNRA 2X4AA 2QSFX 1MN3A 4MGKE 3GP1A 2CHGA 3VK8A 2CUZA 2H1RA 4RNAA 1DGFA 2F4VM 5FTLA 2D7GA 4PT5A 1R4GA 1Q39A 3ZQJA 1VG5A 3GPPA 3LMMA 3SAUA 1OAOC 1Z6TA 8CATA 1PJTA 2KNZA 3BK6A 2APLA 3V76A 1G59A 4M0WA 1XXHA 3AL0C 4NTNA 4JXJA 3GPYA 1JQJC 1EFUB 1JR3E 4LG2A 4LFBM 1SXJC 3MMPA 1B6ZA 1P3QQ 4LZJA 1TR8A 3SHFA 3TWLA 1DGGA 2LWXA 2VF7A 4B3MM 3E46A 4PD2A 3GLGE 2LTUA 2RKOA 3A45A 1IBKM 2DZNB 2QBYA 3UZUA 1TH4A 3VKGA 3I01M 2JY8A 4KLNA 1NSFA 1VEKA 2ERCA 4ZPXA 1N36M 4OW0A 2RRUA 2CHQA 1RU3A 1ZQ9A 2W82A 4YHHM 4QOZC 3HU1A 3AOEA 3K92A 1QZMA 5C1BA 3HU2A 1K3XA 1YE9A 4HL4A 2QPAA 3FRHA 3GPXA 4CIZA 3KOWE 3L27A 4G6ZA 1GABA 3AKZA 2DAEA 4X62M 4LF7M 1IY0A 4LJ4A 2JZ1A 1XHBA 4Q7JA 2EJSA 4GC5A 2MJ5B 5EXSA 1J5EM 1HQYE 1WIVA 1I4WA 4B3RM 4FWDA 3FTDA 1ZV1A 4A3VB 1YLAA 3BOSA 1G8PA 1TGUA 1D0LA 3KP0E 4JI2M 3U6EA 4LFCM 4R3DA 4W5WA 2OQ4A 3F92A 2R18A 4M9SA 1G3IA 5E6JA 2R4JA 4LJ8A 7CATA 4IJEA 1E9SA 2R46A 3KFUG 2DVWB 3ILKA 2G3QA 1MJGM 3L2AA 2QQ8A 4AKIA 1FNNA 4FD2A 1PJIA 2XH9A 1IQPA 1XB2B 1OAIA 3H4MA 4JI3M 2WSFF 4X64M 1Z5BA 3TL4X 3Q8XA 4CGYB 2VDBB 3HHYA 4GIPA 5EXPA 4K0KM 1B66A 3GRYA 3AV0A 3HU3A 3KOYE 2XFTA 4DR5M 1R6BX 2DJ6A 1Z59A 1IM2A 5DYIA 4FW9A 4WURA 4XK8F 4BLCA 1XMQM 3EIEA 1NY5A 4G4RA 3QYEA 1N78A 1JB0F 2D7HA 4L16A 4IBCA 4GMQA 1C7YA 2Z8YM 3AFHA 3KXEC 3U60A 3U6LA 4Z6YA 1XXHE 1XNRM 4DR7M 4LJ7A 4G4QA 1SG9A 1IFYA 2KZUA 2ZBKB 4AKGA 2O25A 3LQQA 4M9XA 2L4FA 1J09A 1TH2A 2LVAA 2QENA 1NJFA 3LCUA 2EO2A 3GLIA 3DFZA 4FVJA 2OOAA 1OTRA 1QVRA 3K1JA 1VEGA 4GH9A 4GRIA 3RGPA 3FYCA 3AJIB 5DFLA 1N75A 4AG6A 5IT9S 1NV8A 1R2ZA 3C9PA 1GKIA 3T1HM 3FTEA 2MR9A 3UMMA 3PXGA 2F5QA 4MGYE 3TWMA 4JI4M 2CRUA 4B3TM 5ITQA 1KYIA 1PJJA 3HJ8A 4MGHA 2XZUA 3I51A 2LVPC 1WXQA 4B7FA 3JR5A 2XSZD 4P16A 3HWSA 3FUWA 4QOSA 3QN9A 1IBLM 2E5LM 3GLFA 2XZFA 4NXNM 1XMOM 2DTTA 1OIZA 4DV5M 2JUJA 4MB7A 3J27B 4LJAA 3GQ4A 1WINA 2KNVA 5EJCA 3SFZA 2DHYA 3VDUA 5DNYA 3IG5A 1Q3CA 1GL6A 2XF3A 4L78A 2EA0A 1F4IA 1SXJA 5KPZA 2QHOB 2HAKA 4MH0E 3KS8A 3SYLA 2V1UA 2C99A 3B7ZA 4AKHA 5LMUM 3U60B 3GLGB 2JXNA 5EP2A 2P5TA 2J7NA 3C58A 1PGYA 4D80A 3NWLA 1C1KA 1Y8GA 2CFOA 2DZLA 2RGOA 1IXSB 1PJSA 1QAOA 1MX0A 2DAGA 4IBDA 3QN0A 1T6OA 4LY6A 2UUBM 2Z4SA 2Y20A 3U6SA 3GQ3A 2QZ4A 1WJ7A 2L7IA 4LRSA 3MJ5A 4IBJA 3HGIA 3W0LB 4PDGA 2L4EA 2Z3XA 3ZC7B 1ZMVA 3WHKA 3SASA 1GJSA 3TQSA 2EUCA 3U5ZB 3R8FA 1S3SA 2F5NA 2ZANA 3QYBA 1L2CA 3I04M 2DKLA 2HL7A 3FD9A 5F3WA 3E4RA 2XEPA 2DENA 4BBAA 4FCVA 3U6OA 4ITQA 4LF5M 2V6ZM 4JV5M 4P17A 3NBIA 4AQYM 5FTJA 1TH3A 4JI7M 3J7BA 4JI6M 3GLHA 1XNQM 1XWIA 3GRVA 5EP3A 2UXCM 2GQFA 3ZH9B 2KEBA 2UXDM 1AUAA 1R5LA 1DO2A 2FNAA 3B74A 4OU7A 3EIHA 1G4AE 3PNYA 4LF9M 4LGMA 2KA6B 2KRKA 3E21A 4AW4A 1NNJA 2L09A 3VDPA 5KPTA 5KO3A 2LBCA 2EKFA 2ZAMA 1Z5CA 1NNUC 3CF2A 1X37A 1E9RA 1QUTA 1V34A 4D82A 1IY2A 3AOEC 5LMNM 4NXMM 1N34M 3PVSA 4LJ6A 1L8QA 2CP8A 3HHZA 3GLHB 4GKJM 4G3OA 2YQZA 1G41A 3C3DA 3FRIA 4DV3M 3WHLA 2G64A 1E94E 2L7HA 3SC3A 4DUYM 3SARA 2LXEA 4LF8M 4IBEA 3T15A 1HNXM 1YSYA 5EXXA 2Z4RA 3K8ZA 3K9OA 3GLIB 1LTMA 4B7HA 5ITYA 3U6CA 4FCWA 4OVZA 2L6OA 3LZEA 4HEOA 2EKKA 5FTKA 2R6FA 2CV1A 2QBYB 3AOGA 5IREB 3JR4A 3IHPA 5EP4A 2CE7A 2JNHA 3M7GA 3KOXE 4GKKM 2JWSA 2BWEA 2DWMA 1ZAEA 4R7GA 2Y21A 3D7JA 2KHHA 3KVWA 2K0BX 2DAKA 4IBGA 4QHSA 2WSCF 1I94M 3M0NA 2ZTDA 1DV0A 1ZMWA 1VEJA 2KRUA 3QWLA 2UUAM 1IN5A 2MROB 3H4JA 2R0IA 4L15A 1WR1B 4FVGA 3UGJA 4XGIA 2R62A 3W67A 2OO9A 2BNKA 3CF0A 2K9DA 2OPFA 3GO8A 3ZCBB 2C5RA 1TDZA 5FSWA 1D0MA 4CJ6A 2UXBM 3GRUA 1UM8A 3SATA 2C98A 2AHMA 3HHXA 4LJ9A 2QCUA 4AG5A 4DR3M 4GC9A 4R71A 5E26A 1QZEA 2HCBA 5BR8M 1KFVA 5FTMA 3JAMS 3GLFB 3Q8GA 3L29A 3LW5F 2BJWA 3A98B 2X8AA 1OQYA 5EXTA 1VDLA 1UFZA 4B7GA 1SXJE 2BWBA 2ZAOA 4MGIE 3GLIE 1GLNA 4G4NA 4CISA 1NY6A 4FVFA 3IECA 3M0EA 2R44A 1HQCA 2C9OA 1Z5AA 2JZ0A 2VIIA 3M6AA 5EP1A 5IZ7D 3U61B 2F5SA 1AIPC 4JI1M 2K47A 1DO0A 3LCVB 1V92A 2H5XA 3NBXX 5ITXA 4F1IA 1QUSA 3GQ5A 1NHWC 4PDIA 1HNZM
chains in the Genus database with same CATH topology
1Q02A 1Y8GA 2DZLA 3GLFE 3FRHA 1TFEA 2DAGA 1T6OA 1OKSA 2DI0A 2DAEA 2LVOC 1WJ7A 2JZ1A 3GLHE 4Q7JA 2EJSA 2MJ5B 2HWJA 2L4EA 1HQYE 1ZMVA 1WIVA 4GEWA 1WGLA 1BVSA 2DKLA 4WP2A 1ZV1A 4UN2B 2DENA 1YLAA 2KNAA 2JY5A 2DAIA 2JY6B 3F92A 1ZMUA 1G3IA 2DNAA 1DO2A 2LVQD 3BBZA 1G4AE 2G3QA 1HT1E 3K9PA 3E21A 2ZTCA 2B3TA 1XB2B 1OAIA 2LBCA 2EKFA 1HT2E 1NV9A 1WHCA 2CP8A 1GO5A 4G3OA 1WGNA 1G41A 3FRIA 1E94E 1IM2A 4DBGB 1T43A 3K9OA 1C7YA 1VQ1A 1HJPA 4F2LA 1XXHE 4HEOA 2EKKA 5JI2E 1SG9A 3FE3A 2JY7A 1IFYA 2O25A 3IHPA 2JNHA 2L4FA 2LVAA 2BWEA 2L2DA 3LCUA 3T6PA 2CWBA 2KHHA 2K0BX 2DAKA 2OOAA 1OTRA 1VEGA 2ZTDA 1DV0A 1ZMWA 1VEJA 5DFLA 1NV8A 2MROB 2QNJA 2R0IA 3H4JA 1WR1B 2OOBA 2DAMA 2MR9A 1A5TA 2OO9A 2K9DA 2LVNC 2QSFX 1MN3A 1KYIA 2LVPC 1R4GA 1VG5A 2WZJA 2KNZA 3B89A 1CUKA 4R71A 1QZEA 1EFUB 1JR3E 2JUJA 1IXSA 3MMPA 1P3QQ 1OQYA 1TR8A 2KNVA 2DHYA 1VDLA 1UFZA 3E46A 1TTEA 2BWBA 3GLGE 2LTUA 3GLIE 1F4IA 2QHOB 2HAKA 2MGWA 3IECA 2JP7A 2JY8A 2JZ0A 1VEKA 1AIPC 2RRUA 1DO0A 3LCVB 1V92A 2H5XA 4F1IA 1PGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q02 A;  1Y8G A;  2DZL A;  3GLF E;  3FRH A;  1TFE A;  2DAG A;  1T6O A;  1OKS A;  2DI0 A;  2DAE A;  2LVO C;  1WJ7 A;  2JZ1 A;  3GLH E;  4Q7J A;  2EJS A;  2MJ5 B;  2HWJ A;  2L4E A;  1HQY E;  1ZMV A;  1WIV A;  4GEW A;  1WGL A;  1BVS A;  2DKL A;  4WP2 A;  1ZV1 A;  4UN2 B;  2DEN A;  1YLA A;  2KNA A;  2JY5 A;  2DAI A;  2JY6 B;  3F92 A;  1ZMU A;  1G3I A;  2DNA A;  1DO2 A;  2LVQ D;  3BBZ A;  1G4A E;  2G3Q A;  1HT1 E;  3K9P A;  3E21 A;  2ZTC A;  2B3T A;  1XB2 B;  1OAI A;  2LBC A;  2EKF A;  1HT2 E;  1NV9 A;  1WHC A;  2CP8 A;  1GO5 A;  4G3O A;  1WGN A;  1G41 A;  3FRI A;  1E94 E;  1IM2 A;  4DBG B;  1T43 A;  3K9O A;  1C7Y A;  1VQ1 A;  1HJP A;  4F2L A;  1XXH E;  4HEO A;  2EKK A;  5JI2 E;  1SG9 A;  3FE3 A;  2JY7 A;  1IFY A;  2O25 A;  3IHP A;  2JNH A;  2L4F A;  2LVA A;  2BWE A;  2L2D A;  3LCU A;  3T6P A;  2CWB A;  2KHH A;  2K0B X;  2DAK A;  2OOA A;  1OTR A;  1VEG A;  2ZTD A;  1DV0 A;  1ZMW A;  1VEJ A;  5DFL A;  1NV8 A;  2MRO B;  2QNJ A;  2R0I A;  3H4J A;  1WR1 B;  2OOB A;  2DAM A;  2MR9 A;  1A5T A;  2OO9 A;  2K9D A;  2LVN C;  2QSF X;  1MN3 A;  1KYI A;  2LVP C;  1R4G A;  1VG5 A;  2WZJ A;  2KNZ A;  3B89 A;  1CUK A;  4R71 A;  1QZE A;  1EFU B;  1JR3 E;  2JUJ A;  1IXS A;  3MMP A;  1P3Q Q;  1OQY A;  1TR8 A;  2KNV A;  2DHY A;  1VDL A;  1UFZ A;  3E46 A;  1TTE A;  2BWB A;  3GLG E;  2LTU A;  3GLI E;  1F4I A;  2QHO B;  2HAK A;  2MGW A;  3IEC A;  2JP7 A;  2JY8 A;  2JZ0 A;  1VEK A;  1AIP C;  2RRU A;  1DO0 A;  3LCV B;  1V92 A;  2H5X A;  4F1I A;  1PGY A; 
#chains in the Genus database with same CATH topology
 3BXW A;  2ZM6 M;  4KHP M;  5JI3 E;  3GLF E;  1L2B A;  3L28 A;  1N33 M;  4S12 A;  4FWH A;  2A0S A;  2A5Y B;  2N35 A;  2G5G X;  4JI5 M;  2R45 A;  3LQR A;  1HR0 M;  2LVO C;  4NSO B;  4NC6 A;  3JYG A;  4FVM A;  2HKJ A;  3TPZ A;  4GHA A;  3KOZ E;  1NVM A;  3FUV A;  2RPB A;  4GEW A;  3U5Z A;  1BVS A;  1DGH A;  3DA1 A;  2YNM D;  1H6U A;  4WP2 A;  3A42 A;  2LHC A;  1VDD A;  4NRW A;  4NSR A;  1D2N A;  3W0F A;  2F5P A;  1J7K A;  2DAI A;  3U6M A;  1QAM A;  5H37 D;  3KS4 A;  1ZMU A;  3J2P B;  2G8L A;  2DNA A;  3CTW B;  2LVQ D;  3RFW A;  3E9S A;  4BB9 A;  1QAN A;  2JA2 A;  4KT0 F;  3K9P A;  5BPV A;  4WW0 A;  1G71 A;  2ZTC A;  1TF0 B;  3PNV A;  4PCZ A;  4IBB A;  5ITX E;  2UU9 M;  4FCT A;  1DGB A;  1QDR A;  2O01 F;  1HT2 E;  1GJT A;  4OVZ B;  4QHT A;  4EIW A;  1WHC A;  5IWA M;  4NTK A;  2X49 A;  1GO5 A;  5FLX S;  4LRT A;  4LGY A;  3PFI A;  4DR4 M;  3R9X B;  2DXI A;  1EIJ A;  5GKN A;  4LF6 M;  1FJG M;  4L8R C;  3SHG B;  3T38 A;  1TDH A;  4GIT A;  3W68 A;  1T43 A;  4I81 A;  2J7O A;  1T3T A;  3CF6 E;  1EE8 A;  1OFI A;  1W5T A;  2Q2E B;  1ORY B;  2NQ8 C;  4NL4 H;  3J81 S;  3HJQ A;  1R7R A;  3FE3 A;  2JY7 A;  1K82 A;  4TUW A;  2J5Y A;  4JN6 A;  4QNM A;  3LVW A;  4MGZ E;  2K6B A;  2M5Z A;  2LH0 A;  2XSZ A;  2CWB A;  3HX3 A;  3I4V A;  1IN8 A;  3QAU A;  2C96 A;  4G4O A;  2CHV A;  3GPU A;  4Y28 F;  2RGH A;  3LX3 A;  2VF8 A;  1IY1 A;  4FWG A;  4DV2 M;  2DWL A;  2QNJ A;  4IBK A;  3SBJ A;  5C18 A;  2DAM A;  1L1Z A;  1A5T A;  5KPR A;  2CV2 A;  3VLF B;  2LVN C;  2DHR A;  3SAV A;  2YR0 A;  1QQW A;  2Z7J A;  2MH8 A;  4RKU F;  3J80 S;  1PM5 A;  1N77 A;  3I2B A;  4B08 A;  1SXJ D;  3KDS E;  1HNW M;  2KDL A;  1PRB A;  4MM3 B;  1OJL A;  3K2L A;  4RF0 A;  2WZJ A;  3J7A S;  2I7P A;  4IIW A;  3T1Y M;  3B89 A;  2FE8 A;  1XC8 A;  3U6P A;  1CUK A;  4XBO A;  5ITU A;  4B3S M;  4X66 M;  3HZJ A;  3SAW A;  2F5O A;  3MHV C;  3HKP A;  1IXS A;  2CV0 A;  2WSE F;  2XLJ A;  2YFQ A;  1TTE A;  3KSJ A;  2LHG A;  2VQE M;  3L25 A;  1D0K A;  1YUB A;  3GLG A;  2LNH C;  2MGW A;  3HHW A;  4DV0 M;  3VFD A;  2JP7 A;  2QP9 X;  3D8B A;  1SXJ B;  3RE8 A;  3FUX A;  3U6D A;  4RF1 A;  1GL7 A;  1JR3 A;  4LJ5 A;  4DV1 M;  4OX9 M;  1Q3B A;  1QAQ A;  1Q02 A;  1OFH A;  2D7E A;  3C3E A;  3KP1 E;  4JI0 M;  1R2Y A;  1TFE A;  2KZS A;  3CGW A;  2FFJ A;  1OKS A;  5DYG A;  1QDT A;  2DI0 A;  3DOA A;  5FTN A;  3FKE A;  4DR1 M;  3GLH E;  3B7Q A;  1OIP A;  2HWJ A;  4KO8 A;  3D8L A;  1QYR A;  2XGN A;  3FTC A;  4L6V 6;  1WGL A;  4IBI A;  2XFS A;  2R65 A;  4NRV A;  4UN2 B;  2FH0 A;  1GVN A;  2KW0 A;  3GRR A;  4IBF A;  3KW6 A;  1LV7 A;  4DUZ M;  2KNA A;  2CEA A;  3FYD A;  2JY5 A;  2Y0T A;  4DR2 M;  3SYK A;  2JY6 B;  1E32 A;  3B9P A;  2UUC M;  4M0D A;  4KOD A;  4CHT B;  3TE6 A;  3SMS A;  1IXR C;  2DZO B;  2C9C A;  2FOI C;  3HY5 A;  2OBA A;  3TWK A;  3L26 A;  1L2D A;  3BBZ A;  4AI6 A;  1NHG C;  1HT1 E;  4IJF A;  4II7 A;  1DGH B;  1L1T A;  5KQD A;  4JYA M;  4REZ A;  4LFA M;  2B3T A;  1IXZ A;  2Y0Q A;  4YY3 M;  3IG8 A;  4HLQ A;  1N32 M;  2HHH M;  5A2Q S;  2VQF M;  3I4Y A;  1NJG A;  1NV9 A;  2R4E A;  2V1C A;  3FTF A;  1GTQ A;  1NO1 A;  4LZZ A;  1WGN A;  3SMP A;  3UJN A;  4DBG B;  4DV4 M;  2FS1 A;  4I8O A;  3THG A;  1JR3 D;  1XXH B;  4LCB A;  3B7N A;  3U6Q A;  4GHL A;  3MK6 A;  2KXE A;  1K3W A;  2I7N A;  1IN7 A;  4I5S A;  1VQ1 A;  4NOO B;  3U61 A;  1HJP A;  3RGS A;  4F2L A;  3A46 A;  2M60 A;  4DV7 M;  4JI8 M;  4ANR A;  4DR6 M;  5JI2 E;  1MU5 A;  4D81 A;  4LF4 M;  2O5R A;  5ITR A;  2L2D A;  1KSF X;  4I4L A;  1PJQ A;  5L8R F;  3QNA A;  3T6P A;  4AZF A;  1W5S A;  3HJS A;  4DV6 M;  3DZD A;  2GNO A;  1Y13 A;  3LVV A;  4Z8X A;  1V33 A;  3VK7 A;  4X65 M;  3VKH A;  1IN6 A;  4NTM A;  3FUU A;  2OOB A;  2BJV A;  3UK6 A;  1IN4 A;  3FUT A;  2DWN A;  3KSX A;  2DWZ B;  4L4U A;  4M9Z A;  5EQT A;  5KQ8 A;  5ITT A;  3OTO M;  1IBM M;  4QNR A;  2X4A A;  2QSF X;  1MN3 A;  4MGK E;  3GP1 A;  2CHG A;  3VK8 A;  2CUZ A;  2H1R A;  4RNA A;  1DGF A;  2F4V M;  5FTL A;  2D7G A;  4PT5 A;  1R4G A;  1Q39 A;  3ZQJ A;  1VG5 A;  3GPP A;  3LMM A;  3SAU A;  1OAO C;  1Z6T A;  8CAT A;  1PJT A;  2KNZ A;  3BK6 A;  2APL A;  3V76 A;  1G59 A;  4M0W A;  1XXH A;  3AL0 C;  4NTN A;  4JXJ A;  3GPY A;  1JQJ C;  1EFU B;  1JR3 E;  4LG2 A;  4LFB M;  1SXJ C;  3MMP A;  1B6Z A;  1P3Q Q;  4LZJ A;  1TR8 A;  3SHF A;  3TWL A;  1DGG A;  2LWX A;  2VF7 A;  4B3M M;  3E46 A;  4PD2 A;  3GLG E;  2LTU A;  2RKO A;  3A45 A;  1IBK M;  2DZN B;  2QBY A;  3UZU A;  1TH4 A;  3VKG A;  3I01 M;  2JY8 A;  4KLN A;  1NSF A;  1VEK A;  2ERC A;  4ZPX A;  1N36 M;  4OW0 A;  2RRU A;  2CHQ A;  1RU3 A;  1ZQ9 A;  2W82 A;  4YHH M;  4QOZ C;  3HU1 A;  3AOE A;  3K92 A;  1QZM A;  5C1B A;  3HU2 A;  1K3X A;  1YE9 A;  4HL4 A;  2QPA A;  3FRH A;  3GPX A;  4CIZ A;  3KOW E;  3L27 A;  4G6Z A;  1GAB A;  3AKZ A;  2DAE A;  4X62 M;  4LF7 M;  1IY0 A;  4LJ4 A;  2JZ1 A;  1XHB A;  4Q7J A;  2EJS A;  4GC5 A;  2MJ5 B;  5EXS A;  1J5E M;  1HQY E;  1WIV A;  1I4W A;  4B3R M;  4FWD A;  3FTD A;  1ZV1 A;  4A3V B;  1YLA A;  3BOS A;  1G8P A;  1TGU A;  1D0L A;  3KP0 E;  4JI2 M;  3U6E A;  4LFC M;  4R3D A;  4W5W A;  2OQ4 A;  3F92 A;  2R18 A;  4M9S A;  1G3I A;  5E6J A;  2R4J A;  4LJ8 A;  7CAT A;  4IJE A;  1E9S A;  2R46 A;  3KFU G;  2DVW B;  3ILK A;  2G3Q A;  1MJG M;  3L2A A;  2QQ8 A;  4AKI A;  1FNN A;  4FD2 A;  1PJI A;  2XH9 A;  1IQP A;  1XB2 B;  1OAI A;  3H4M A;  4JI3 M;  2WSF F;  4X64 M;  1Z5B A;  3TL4 X;  3Q8X A;  4CGY B;  2VDB B;  3HHY A;  4GIP A;  5EXP A;  4K0K M;  1B66 A;  3GRY A;  3AV0 A;  3HU3 A;  3KOY E;  2XFT A;  4DR5 M;  1R6B X;  2DJ6 A;  1Z59 A;  1IM2 A;  5DYI A;  4FW9 A;  4WUR A;  4XK8 F;  4BLC A;  1XMQ M;  3EIE A;  1NY5 A;  4G4R A;  3QYE A;  1N78 A;  1JB0 F;  2D7H A;  4L16 A;  4IBC A;  4GMQ A;  1C7Y A;  2Z8Y M;  3AFH A;  3KXE C;  3U60 A;  3U6L A;  4Z6Y A;  1XXH E;  1XNR M;  4DR7 M;  4LJ7 A;  4G4Q A;  1SG9 A;  1IFY A;  2KZU A;  2ZBK B;  4AKG A;  2O25 A;  3LQQ A;  4M9X A;  2L4F A;  1J09 A;  1TH2 A;  2LVA A;  2QEN A;  1NJF A;  3LCU A;  2EO2 A;  3GLI A;  3DFZ A;  4FVJ A;  2OOA A;  1OTR A;  1QVR A;  3K1J A;  1VEG A;  4GH9 A;  4GRI A;  3RGP A;  3FYC A;  3AJI B;  5DFL A;  1N75 A;  4AG6 A;  5IT9 S;  1NV8 A;  1R2Z A;  3C9P A;  1GKI A;  3T1H M;  3FTE A;  2MR9 A;  3UMM A;  3PXG A;  2F5Q A;  4MGY E;  3TWM A;  4JI4 M;  2CRU A;  4B3T M;  5ITQ A;  1KYI A;  1PJJ A;  3HJ8 A;  4MGH A;  2XZU A;  3I51 A;  2LVP C;  1WXQ A;  4B7F A;  3JR5 A;  2XSZ D;  4P16 A;  3HWS A;  3FUW A;  4QOS A;  3QN9 A;  1IBL M;  2E5L M;  3GLF A;  2XZF A;  4NXN M;  1XMO M;  2DTT A;  1OIZ A;  4DV5 M;  2JUJ A;  4MB7 A;  3J27 B;  4LJA A;  3GQ4 A;  1WIN A;  2KNV A;  5EJC A;  3SFZ A;  2DHY A;  3VDU A;  5DNY A;  3IG5 A;  1Q3C A;  1GL6 A;  2XF3 A;  4L78 A;  2EA0 A;  1F4I A;  1SXJ A;  5KPZ A;  2QHO B;  2HAK A;  4MH0 E;  3KS8 A;  3SYL A;  2V1U A;  2C99 A;  3B7Z A;  4AKH A;  5LMU M;  3U60 B;  3GLG B;  2JXN A;  5EP2 A;  2P5T A;  2J7N A;  3C58 A;  1PGY A;  4D80 A;  3NWL A;  1C1K A;  1Y8G A;  2CFO A;  2DZL A;  2RGO A;  1IXS B;  1PJS A;  1QAO A;  1MX0 A;  2DAG A;  4IBD A;  3QN0 A;  1T6O A;  4LY6 A;  2UUB M;  2Z4S A;  2Y20 A;  3U6S A;  3GQ3 A;  2QZ4 A;  1WJ7 A;  2L7I A;  4LRS A;  3MJ5 A;  4IBJ A;  3HGI A;  3W0L B;  4PDG A;  2L4E A;  2Z3X A;  3ZC7 B;  1ZMV A;  3WHK A;  3SAS A;  1GJS A;  3TQS A;  2EUC A;  3U5Z B;  3R8F A;  1S3S A;  2F5N A;  2ZAN A;  3QYB A;  1L2C A;  3I04 M;  2DKL A;  2HL7 A;  3FD9 A;  5F3W A;  3E4R A;  2XEP A;  2DEN A;  4BBA A;  4FCV A;  3U6O A;  4ITQ A;  4LF5 M;  2V6Z M;  4JV5 M;  4P17 A;  3NBI A;  4AQY M;  5FTJ A;  1TH3 A;  4JI7 M;  3J7B A;  4JI6 M;  3GLH A;  1XNQ M;  1XWI A;  3GRV A;  5EP3 A;  2UXC M;  2GQF A;  3ZH9 B;  2KEB A;  2UXD M;  1AUA A;  1R5L A;  1DO2 A;  2FNA A;  3B74 A;  4OU7 A;  3EIH A;  1G4A E;  3PNY A;  4LF9 M;  4LGM A;  2KA6 B;  2KRK A;  3E21 A;  4AW4 A;  1NNJ A;  2L09 A;  3VDP A;  5KPT A;  5KO3 A;  2LBC A;  2EKF A;  2ZAM A;  1Z5C A;  1NNU C;  3CF2 A;  1X37 A;  1E9R A;  1QUT A;  1V34 A;  4D82 A;  1IY2 A;  3AOE C;  5LMN M;  4NXM M;  1N34 M;  3PVS A;  4LJ6 A;  1L8Q A;  2CP8 A;  3HHZ A;  3GLH B;  4GKJ M;  4G3O A;  2YQZ A;  1G41 A;  3C3D A;  3FRI A;  4DV3 M;  3WHL A;  2G64 A;  1E94 E;  2L7H A;  3SC3 A;  4DUY M;  3SAR A;  2LXE A;  4LF8 M;  4IBE A;  3T15 A;  1HNX M;  1YSY A;  5EXX A;  2Z4R A;  3K8Z A;  3K9O A;  3GLI B;  1LTM A;  4B7H A;  5ITY A;  3U6C A;  4FCW A;  4OVZ A;  2L6O A;  3LZE A;  4HEO A;  2EKK A;  5FTK A;  2R6F A;  2CV1 A;  2QBY B;  3AOG A;  5IRE B;  3JR4 A;  3IHP A;  5EP4 A;  2CE7 A;  2JNH A;  3M7G A;  3KOX E;  4GKK M;  2JWS A;  2BWE A;  2DWM A;  1ZAE A;  4R7G A;  2Y21 A;  3D7J A;  2KHH A;  3KVW A;  2K0B X;  2DAK A;  4IBG A;  4QHS A;  2WSC F;  1I94 M;  3M0N A;  2ZTD A;  1DV0 A;  1ZMW A;  1VEJ A;  2KRU A;  3QWL A;  2UUA M;  1IN5 A;  2MRO B;  3H4J A;  2R0I A;  4L15 A;  1WR1 B;  4FVG A;  3UGJ A;  4XGI A;  2R62 A;  3W67 A;  2OO9 A;  2BNK A;  3CF0 A;  2K9D A;  2OPF A;  3GO8 A;  3ZCB B;  2C5R A;  1TDZ A;  5FSW A;  1D0M A;  4CJ6 A;  2UXB M;  3GRU A;  1UM8 A;  3SAT A;  2C98 A;  2AHM A;  3HHX A;  4LJ9 A;  2QCU A;  4AG5 A;  4DR3 M;  4GC9 A;  4R71 A;  5E26 A;  1QZE A;  2HCB A;  5BR8 M;  1KFV A;  5FTM A;  3JAM S;  3GLF B;  3Q8G A;  3L29 A;  3LW5 F;  2BJW A;  3A98 B;  2X8A A;  1OQY A;  5EXT A;  1VDL A;  1UFZ A;  4B7G A;  1SXJ E;  2BWB A;  2ZAO A;  4MGI E;  3GLI E;  1GLN A;  4G4N A;  4CIS A;  1NY6 A;  4FVF A;  3IEC A;  3M0E A;  2R44 A;  1HQC A;  2C9O A;  1Z5A A;  2JZ0 A;  2VII A;  3M6A A;  5EP1 A;  5IZ7 D;  3U61 B;  2F5S A;  1AIP C;  4JI1 M;  2K47 A;  1DO0 A;  3LCV B;  1V92 A;  2H5X A;  3NBX X;  5ITX A;  4F1I A;  1QUS A;  3GQ5 A;  1NHW C;  4PDI A;  1HNZ M; 
#chains in the Genus database with same CATH homology
 1Q02 A;  1Y8G A;  2DZL A;  3GLF E;  3FRH A;  1TFE A;  2DAG A;  1T6O A;  1OKS A;  2DI0 A;  2DAE A;  2LVO C;  1WJ7 A;  2JZ1 A;  3GLH E;  4Q7J A;  2EJS A;  2MJ5 B;  2HWJ A;  2L4E A;  1HQY E;  1ZMV A;  1WIV A;  4GEW A;  1WGL A;  1BVS A;  2DKL A;  4WP2 A;  1ZV1 A;  4UN2 B;  2DEN A;  1YLA A;  2KNA A;  2JY5 A;  2DAI A;  2JY6 B;  3F92 A;  1ZMU A;  1G3I A;  2DNA A;  1DO2 A;  2LVQ D;  3BBZ A;  1G4A E;  2G3Q A;  1HT1 E;  3K9P A;  3E21 A;  2ZTC A;  2B3T A;  1XB2 B;  1OAI A;  2LBC A;  2EKF A;  1HT2 E;  1NV9 A;  1WHC A;  2CP8 A;  1GO5 A;  4G3O A;  1WGN A;  1G41 A;  3FRI A;  1E94 E;  1IM2 A;  4DBG B;  1T43 A;  3K9O A;  1C7Y A;  1VQ1 A;  1HJP A;  4F2L A;  1XXH E;  4HEO A;  2EKK A;  5JI2 E;  1SG9 A;  3FE3 A;  2JY7 A;  1IFY A;  2O25 A;  3IHP A;  2JNH A;  2L4F A;  2LVA A;  2BWE A;  2L2D A;  3LCU A;  3T6P A;  2CWB A;  2KHH A;  2K0B X;  2DAK A;  2OOA A;  1OTR A;  1VEG A;  2ZTD A;  1DV0 A;  1ZMW A;  1VEJ A;  5DFL A;  1NV8 A;  2MRO B;  2QNJ A;  2R0I A;  3H4J A;  1WR1 B;  2OOB A;  2DAM A;  2MR9 A;  1A5T A;  2OO9 A;  2K9D A;  2LVN C;  2QSF X;  1MN3 A;  1KYI A;  2LVP C;  1R4G A;  1VG5 A;  2WZJ A;  2KNZ A;  3B89 A;  1CUK A;  4R71 A;  1QZE A;  1EFU B;  1JR3 E;  2JUJ A;  1IXS A;  3MMP A;  1P3Q Q;  1OQY A;  1TR8 A;  2KNV A;  2DHY A;  1VDL A;  1UFZ A;  3E46 A;  1TTE A;  2BWB A;  3GLG E;  2LTU A;  3GLI E;  1F4I A;  2QHO B;  2HAK A;  2MGW A;  3IEC A;  2JP7 A;  2JY8 A;  2JZ0 A;  1VEK A;  1AIP C;  2RRU A;  1DO0 A;  3LCV B;  1V92 A;  2H5X A;  4F1I A;  1PGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...