1XB2B

Crystal structure of bos taurus mitochondrial elongation factor tu/ts complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
276
Chain Sequence
SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRKTKEGLIGLLQEGDTTVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQNLKDQLSTYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAAWVKVPAGFYVGSYVHGAMHSPSLHNLVLGKYGALVICETSELKANLADLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPHGVSVVDFVRFECGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Bovine Mitochondrial Elongation Factor Tu.Ts Complex
pubmed doi rcsb
source organism Bos taurus
molecule tags Translation
molecule keywords Elongation factor Tu, mitochondrial
total genus 83
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1xb2B01
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B03
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B02
2CWBA 3MMPA 1KYIA 1IM2A 2QNJA 4WP2A 1OQYA 2EJSA 1HT2E 4DBGB 1XXHE 2LTUA 2G3QA 1WGNA 1TR8A 2L2DA 1Y8GA 2B3TA 1DV0A 3IECA 3LCUA 1XB2B 2KNAA 2JY8A 2MGWA 5DFLA 1VEGA 1PGYA 4Q7JA 3H4JA 2O25A 1JR3E 2LVNC 4F2LA 2EKKA 1VQ1A 1HT1E 2LVPC 1E94E 1ZMVA 2WZJA 1WGLA 1T6OA 2OOBA 2K9DA 1G4AE 3GLIE 3GLGE 2QSFX 1G3IA 3BBZA 2MR9A 2JY5A 1GO5A 2DAKA 2K0BX 5JI2E 3FRHA 2LBCA 3FRIA 1VDLA 1NV8A 1WHCA 2DAMA 2H5XA 1VEJA 3B89A 3K9OA 4F1IA 3LCVB 1QZEA 1VG5A 1P3QQ 2DENA 2LVAA 2MROB 2JNHA 1TTEA 4UN2B 2DAEA 2KHHA 1OKSA 2MJ5B 1IFYA 1OAIA 2DHYA 1HQYE 2LVOC 1A5TA 2DZLA 3GLFE 1NV9A 3GLHE 4R71A 2DAGA 1BVSA 2BWBA 1MN3A 1TFEA 2HWJA 1Q02A 2QHOB 2KNVA 2LVQD 1WIVA 1OTRA 1HJPA 1DO2A 1EFUB 1G41A 3T6PA 2JY6B 2RRUA 2OOAA 3K9PA 2JUJA 2JZ0A 3IHPA 1ZMUA 1F4IA 3FE3A 1WJ7A 1UFZA 3E46A 1VEKA 4HEOA 2DKLA 2CP8A 2DAIA 3E21A 2DNAA 1YLAA 1AIPC 1IXSA 1DO0A 1ZV1A 2DI0A 2EKFA 2JY7A 2KNZA 2OO9A 1CUKA 1WR1B 3F92A 1T43A 4G3OA 2HAKA 2L4FA 2ZTDA 1C7YA 2BWEA 2JP7A 1R4GA 2ZTCA 2L4EA 4GEWA 1V92A 1ZMWA 2JZ1A 1SG9A 2R0IA
chains in the Genus database with same CATH superfamily
4NRWA 4IBCA 1IM2A 4LZZA 4WP2A 2ZAOA 4KODA 4GC5A 2KRUA 1K3WA 2XEPA 2LTUA 3HGIA 4FVMA 4HL4A 2VDBB 2R4EA 1TDZA 4QOZC 2CFOA 4AKIA 1RU3A 2B3TA 5IWAM 2JY8A 1SXJA 4Q7JA 4GH9A 3FUVA 2L09A 3FYCA 3UK6A 1JR3E 2LVNC 2EKKA 2LXEA 3U6DA 3DA1A 1J09A 2FNAA 3UMMA 3A45A 5LMNM 2Y0TA 2FE8A 2WZJA 3KDSE 1E9SA 3GPXA 4JI4M 2J7NA 1IBKM 1L2CA 2O01F 4IBBA 2HCBA 1K82A 3D8BA 2K9DA 3GLIE 3GLGE 3GLHB 1G3IA 3BBZA 3HHXA 2JY5A 4IBFA 4X66M 3GO8A 1PJQA 5KQDA 2UXCM 4KT0F 2R44A 2Y21A 3E9SA 2Y0QA 4NSOB 4JXJA 1R2YA 1IXSB 3EIEA 1GJTA 3U6QA 3WHLA 4I8OA 3NBXX 3PXGA 4CHTB 1VDLA 1WHCA 1VEJA 4DV7M 2A5YB 1QZEA 5FTNA 1LV7A 3L2AA 1HNXM 1W5TA 2DENA 2EA0A 1GL7A 1QAMA 4GRIA 3CF2A 3U60A 3Q8GA 3BXWA 1TTEA 2F5SA 1SXJC 1UM8A 3RE8A 3PVSA 3B7NA 2DAEA 2MJ5B 3QYEA 1FJGM 1E32A 5IZ7D 1GVNA 4LF4M 3A46A 1A5TA 3DOAA 3K1JA 3LQRA 1GKIA 2KA6B 1IN4A 3WHKA 3GLFE 4LFAM 2OPFA 2BJVA 3FTCA 1NV9A 4LJ8A 3ZC7B 5ITQA 2J5YA 2O5RA 5BPVA 3TE6A 8CATA 3T1HM 4BB9A 1L2BA 4R71A 3LVVA 3L25A 4I81A 3KXEC 3I51A 4DR6M 3AL0C 3EIHA 5EXPA 1QDRA 4CIZA 3A98B 1IXZA 1W5SA 3SARA 1IN8A 4NOOB 1PM5A 1C1KA 1DGHB 4I5SA 3QNAA 2C98A 2KEBA 3I4YA 4ITQA 2JUJA 3GRYA 1ZMUA 2GQFA 3L27A 3KP1E 3UZUA 1XWIA 1D0LA 2R6FA 1VEKA 2ZBKB 5EJCA 1KSFX 4R3DA 1HR0M 2DKLA 1OIZA 4LY6A 2F4VM 2V6ZM 3E21A 4PT5A 2Q2EB 2R46A 5DNYA 3OTOM 2JY7A 5EP3A 2CV2A 3I4VA 3SAVA 2G8LA 1V33A 1OIPA 2WSCF 4QOSA 1WR1B 4DV1M 5F3WA 4D80A 1JR3D 2VF7A 4G3OA 2XZUA 3FD9A 3HU3A 4QNRA 1N78A 4TUWA 1Q39A 2Z7JA 3HWSA 4G4RA 1QUTA 2HL7A 4FCVA 1TGUA 3FKEA 3SHFA 3VK7A 2YQZA 1Z59A 1JQJC 1R4GA 2H1RA 2ZTCA 4LGMA 2D7HA 3T15A 1VDDA 4X64M 1X37A 2FS1A 4D81A 3QN9A 1L8QA 3HJ8A 3KOZE 2R18A 3ILKA 1GTQA 4FWDA 1TH4A 1T3TA 1HT2E 1DGHA 5L8RF 4B3RM 1NNJA 1AUAA 4AZFA 3GP1A 1NY5A 2ZAMA 4JI7M 4KO8A 2V1CA 3C3EA 1NHWC 1TR8A 4IBEA 3LZEA 1SXJB 1Y8GA 2R65A 2DXIA 1XB2B 1XHBA 4M9XA 3MJ5A 1VEGA 1PGYA 3U5ZB 3H4JA 2O25A 4L78A 5KPTA 2K6BA 1G71A 1N75A 1VQ1A 3U6PA 3VKGA 3W67A 3U6OA 4Z6YA 3TL4X 2LVPC 5E6JA 2LH0A 2QP9X 5EXTA 3GRVA 3ZH9B 5A2QS 1QVRA 5E26A 2Z3XA 1HNWM 2DWZB 4M0WA 4DR1M 4B7GA 1WGLA 2XSZD 3NBIA 1Z6TA 4DR2M 4XGIA 5EP1A 3UGJA 2UUCM 4JI6M 2KZSA 3GQ3A 2F5OA 3I01M 4P17A 3KP0E 4JI2M 1NNUC 2Z8YM 3GPUA 4B3TM 3KOWE 3JR5A 4FVGA 1GO5A 4A3VB 1IN7A 5JI2E 3M7GA 3L29A 3C58A 3FRHA 3FUWA 2LBCA 3VDPA 1JB0F 3SMSA 4B3MM 1NSFA 3KFUG 1NV8A 2DAMA 2H5XA 3B89A 4F1IA 3J80S 3SASA 2X4AA 4BBAA 2MH8A 1WINA 3I2BA 1N36M 5C1BA 2C5RA 4QHSA 3KS4A 1B66A 4YY3M 1QANA 1ZQ9A 3SBJA 3AJIB 4NTNA 2CHQA 2DHYA 1HQYE 4IBGA 3L26A 4AW4A 3TWMA 1R7RA 3HHZA 4BLCA 2X49A 2RGHA 2RKOA 3VDUA 1HQCA 4OVZA 3PNVA 1BVSA 5ITRA 1MX0A 3AOGA 3GLGA 2HKJA 3GLIA 2KNVA 2LVQD 5EP4A 2LWXA 4PD2A 4FD2A 4MGZE 3U61B 1NO1A 1DO2A 2KW0A 5DYGA 3GPPA 3T6PA 4AQYM 4M0DA 2JY6B 2RRUA 2OOAA 4GMQA 1J7KA 1S3SA 2L7IA 3IHPA 3LMMA 4GITA 4MH0E 3GPYA 3R8FA 1F4IA 3L28A 2VQFM 3FTDA 4LJ4A 1QQWA 2VIIA 1GABA 3CF0A 3JYGA 3C9PA 4Z8XA 4AKHA 1IQPA 1SXJE 2X8AA 3ZCBB 2JWSA 4DV2M 4KHPM 4DV4M 2DNAA 2QQ8A 3D8LA 1YLAA 1AIPC 1IY2A 1IXSA 1DGBA 1PJSA 1Z5AA 5EXSA 2DWLA 2J7OA 3H4MA 5BR8M 1I94M 2DWNA 4FVJA 2V1UA 3C3DA 5FSWA 4IBKA 1E9RA 3HKPA 4OW0A 5ITYA 2APLA 1GJSA 1N32M 2DWMA 3KVWA 4JI0M 2AHMA 3IG5A 2XSZA 4FVFA 3GLFA 5EXXA 1EIJA 2L4EA 3RFWA 5KQ8A 2JZ1A 2R0IA 2GNOA 3KW6A 2DZOB 3KOYE 5FTLA 3VK8A 3MMPA 4LRTA 4DR4M 1KYIA 2UXDM 4NTMA 1SXJD 1OQYA 3GLIB 4DR3M 1R2ZA 3B7ZA 4DBGB 2A0SA 3LX3A 1MJGM 1XXHE 1D0MA 1I4WA 4XBOA 2XZFA 1L1ZA 3IG8A 1DV0A 4OX9M 5IT9S 3IECA 4W5WA 2DHRA 2MGWA 3HZJA 4LJ6A 5DFLA 3TPZA 3HU2A 3UJNA 3SMPA 4X62M 4F2LA 2F5QA 1TF0B 4KLNA 5IREB 4L15A 1HNZM 3LVWA 1HT1E 2CHGA 1E94E 1NY6A 1YE9A 1ZMVA 3B7QA 5LMUM 1NJFA 4OU7A 1XNQM 4NSRA 2K47A 4IJEA 4JYAM 1IN6A 2RGOA 1XMOM 4B08A 2QPAA 3TQSA 4PDIA 5GKNA 2CEAA 1XC8A 7CATA 3VKHA 1IXRC 4IIWA 4NL4H 3W0FA 2P5TA 4EIWA 4JV5M 1IBMM 2QBYA 2G64A 1R6BX 3J7BA 4RNAA 4AKGA 2Z4SA 2FH0A 3W68A 1PRBA 3J27B 2JA2A 2M60A 3RGPA 2UUAM 1OAOC 4L4UA 3FRIA 3KSJA 3U6MA 3PNYA 2Z4RA 1N33M 4ANRA 4B7HA 1YUBA 1VG5A 2XFTA 1P3QQ 3JAMS 1KFVA 3MK6A 2DJ6A 5EQTA 2F5PA 4D82A 3FUXA 3HJSA 3VLFB 4UN2B 4B3SM 3QWLA 3HHYA 3SHGB 4DV3M 1LTMA 4RKUF 3T1YM 1IFYA 3M6AA 1OAIA 2QZ4A 4MB7A 3KSXA 2ERCA 2LVOC 2JXNA 3I04M 3A42A 5KO3A 1L2DA 4LZJA 3U6EA 3HX3A 4IBIA 3U5ZA 3AOEA 2C96A 3GLHE 1EE8A 4JI5M 3BK6A 2DAGA 5KPZA 2CUZA 2L7HA 3K2LA 1MN3A 4FWGA 4MGKE 3T38A 3AKZA 1Q02A 4RF1A 2QHOB 4MM3B 4LF8M 2D7GA 4G6ZA 1QDTA 5H37D 2XGNA 3HJQA 3M0NA 1HJPA 3LQQA 1OFHA 4GC9A 4GIPA 4PCZA 3FUUA 3FYDA 4LGYA 2R45A 3GQ5A 1QUSA 4DR5M 5ITTA 2R4JA 3B9PA 2CV1A 2HHHM 1TH3A 2EUCA 2C99A 2KRKA 3QAUA 4L16A 2G5GX 2N35A 3HY5A 1V34A 5ITXA 2YNMD 4GKJM 3GLFB 3KS8A 4K0KM 3LW5F 2EO2A 4JI1M 3J7AS 4X65M 3VFDA 2DI0A 4MGHA 3KOXE 1MU5A 2KNZA 3D7JA 1Q3CA 4G4OA 1CUKA 2E5LM 4XK8F 2CRUA 2KZUA 2CHVA 4LJ5A 4LFBM 1T43A 1ZAEA 2BNKA 5EP2A 2HAKA 2L4FA 2ZTDA 3SYKA 3FTEA 2QBYB 1PJJA 4GHLA 3SC3A 3FUTA 4L6V6 1NHGC 1TDHA 4B7FA 1C7YA 3Q8XA 4GEWA 1V92A 4AG6A 2QENA 4II7A 5KPRA 2OQ4A 2BJWA 5FLXS 4DUZM 1OJLA 3E4RA 2CWBA 1YSYA 2NQ8C 4AI6A 4S12A 1FNNA 2QNJA 3QYBA 4OVZB 4DV5M 3U6SA 2EJSA 3MHVC 2UU9M 4NC6A 1GLNA 1XNRM 4GKKM 2G3QA 1WGNA 2CE7A 4IJFA 3GLGB 2D7EA 2L2DA 4FWHA 4IBDA 4LJ7A 4LRSA 5ITUA 5DYIA 4G4NA 4NRVA 3LCUA 3SFZA 3U60B 2KNAA 2CV0A 4QHTA 2XF3A 4MGIE 1XMQM 2OBAA 4P16A 5FTMA 1N34M 4FCWA 4R7GA 1QAOA 2C9CA 2LHCA 4M9ZA 4HLQA 1IY1A 1Q3BA 3GRRA 1T6OA 2OOBA 3HU1A 1G4AE 2L6OA 3CTWB 1JR3A 2QSFX 1DGGA 1OFIA 3SAUA 2LNHC 2MR9A 2R62A 4CISA 1GL6A 2DAKA 2K0BX 1IY0A 2XFSA 1J5EM 1IN5A 3K92A 4RF0A 2DZNB 5FTKA 4JN6A 4NXNM 3JR4A 2FOIC 4QNMA 1ORYB 5FTJA 4AG5A 2C9OA 3GRUA 3B74A 4WURA 1N77A 4NXMM 4DR7M 3K9OA 3J81S 4LF5M 2WSEF 3CGWA 3LCVB 3THGA 2FFJA 2I7NA 3SATA 4LF9M 1R5LA 2LVAA 3U61A 3CF6E 2MROB 1Y13A 2WSFF 2JNHA 4CGYB 3GQ4A 2KHHA 1Z5BA 1OKSA 2VF8A 1D2NA 4PDGA 3K8ZA 1G8PA 1D0KA 2QCUA 4WW0A 2KDLA 1K3XA 4M9SA 3AFHA 2DZLA 3BOSA 4G4QA 4LJ9A 5JI3E 3DZDA 1G59A 1QZMA 2YR0A 4LF6M 3AOEC 2ZM6M 2XH9A 2VQEM 2XLJA 4DV0M 3FTFA 2BWBA 1TFEA 2HWJA 1QAQA 3V76A 1WIVA 1OTRA 3W0LB 2Y20A 1PJIA 4FCTA 1EFUB 2M5ZA 2YFQA 1G41A 4Y28F 3QN0A 3RGSA 2W82A 4GHAA 4IBJA 2KXEA 3K9PA 4ZPXA 3U6LA 2JZ0A 2UUBM 3FE3A 1WJ7A 1DGFA 1B6ZA 1UFZA 3E46A 3AV0A 4I4LA 4REZA 5ITXE 1H6UA 4HEOA 4YHHM 3SAWA 4LFCM 1NVMA 2CP8A 2DAIA 3SYLA 4JI3M 3NWLA 1WXQA 1DO0A 4LJAA 1ZV1A 2EKFA 4LG2A 1XXHA 3ZQJA 4DV6M 2OO9A 3M0EA 1XXHB 1IBLM 4NTKA 1Z5CA 1NJGA 4JI8M 2I7PA 3HHWA 1QYRA 5C18A 3DFZA 4L8RC 3F92A 2ZANA 2RPBA 3U6CA 1TH2A 2LHGA 1PJTA 4DUYM 2DTTA 2UXBM 3GLHA 1L1TA 4CJ6A 4FW9A 4LF7M 2BWEA 2JP7A 3J2PB 3PFIA 4LCBA 3TWKA 3TWLA 2DVWB 4MGYE 3R9XB 1ZMWA 2F5NA 1SG9A
chains in the Genus database with same CATH topology
2CWBA 3MMPA 1KYIA 1IM2A 2QNJA 4WP2A 1OQYA 2EJSA 1HT2E 4DBGB 1XXHE 2LTUA 2G3QA 1WGNA 1TR8A 2L2DA 1Y8GA 2B3TA 1DV0A 3IECA 3LCUA 1XB2B 2KNAA 2JY8A 2MGWA 5DFLA 1VEGA 1PGYA 4Q7JA 3H4JA 2O25A 1JR3E 2LVNC 4F2LA 2EKKA 1VQ1A 1HT1E 2LVPC 1E94E 1ZMVA 2WZJA 1WGLA 1T6OA 2OOBA 2K9DA 1G4AE 3GLIE 3GLGE 2QSFX 1G3IA 3BBZA 2MR9A 2JY5A 1GO5A 2DAKA 2K0BX 5JI2E 3FRHA 2LBCA 3FRIA 1VDLA 1NV8A 1WHCA 2DAMA 2H5XA 1VEJA 3B89A 3K9OA 4F1IA 3LCVB 1QZEA 1VG5A 1P3QQ 2DENA 2LVAA 2MROB 2JNHA 1TTEA 4UN2B 2DAEA 2KHHA 1OKSA 2MJ5B 1IFYA 1OAIA 2DHYA 1HQYE 2LVOC 1A5TA 2DZLA 3GLFE 1NV9A 3GLHE 4R71A 2DAGA 1BVSA 2BWBA 1MN3A 1TFEA 2HWJA 1Q02A 2QHOB 2KNVA 2LVQD 1WIVA 1OTRA 1HJPA 1DO2A 1EFUB 1G41A 3T6PA 2JY6B 2RRUA 2OOAA 3K9PA 2JUJA 2JZ0A 3IHPA 1ZMUA 1F4IA 3FE3A 1WJ7A 1UFZA 3E46A 1VEKA 4HEOA 2DKLA 2CP8A 2DAIA 3E21A 2DNAA 1YLAA 1AIPC 1IXSA 1DO0A 1ZV1A 2DI0A 2EKFA 2JY7A 2KNZA 2OO9A 1CUKA 1WR1B 3F92A 1T43A 4G3OA 2HAKA 2L4FA 2ZTDA 1C7YA 2BWEA 2JP7A 1R4GA 2ZTCA 2L4EA 4GEWA 1V92A 1ZMWA 2JZ1A 1SG9A 2R0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWB A;  3MMP A;  1KYI A;  1IM2 A;  2QNJ A;  4WP2 A;  1OQY A;  2EJS A;  1HT2 E;  4DBG B;  1XXH E;  2LTU A;  2G3Q A;  1WGN A;  1TR8 A;  2L2D A;  1Y8G A;  2B3T A;  1DV0 A;  3IEC A;  3LCU A;  1XB2 B;  2KNA A;  2JY8 A;  2MGW A;  5DFL A;  1VEG A;  1PGY A;  4Q7J A;  3H4J A;  2O25 A;  1JR3 E;  2LVN C;  4F2L A;  2EKK A;  1VQ1 A;  1HT1 E;  2LVP C;  1E94 E;  1ZMV A;  2WZJ A;  1WGL A;  1T6O A;  2OOB A;  2K9D A;  1G4A E;  3GLI E;  3GLG E;  2QSF X;  1G3I A;  3BBZ A;  2MR9 A;  2JY5 A;  1GO5 A;  2DAK A;  2K0B X;  5JI2 E;  3FRH A;  2LBC A;  3FRI A;  1VDL A;  1NV8 A;  1WHC A;  2DAM A;  2H5X A;  1VEJ A;  3B89 A;  3K9O A;  4F1I A;  3LCV B;  1QZE A;  1VG5 A;  1P3Q Q;  2DEN A;  2LVA A;  2MRO B;  2JNH A;  1TTE A;  4UN2 B;  2DAE A;  2KHH A;  1OKS A;  2MJ5 B;  1IFY A;  1OAI A;  2DHY A;  1HQY E;  2LVO C;  1A5T A;  2DZL A;  3GLF E;  1NV9 A;  3GLH E;  4R71 A;  2DAG A;  1BVS A;  2BWB A;  1MN3 A;  1TFE A;  2HWJ A;  1Q02 A;  2QHO B;  2KNV A;  2LVQ D;  1WIV A;  1OTR A;  1HJP A;  1DO2 A;  1EFU B;  1G41 A;  3T6P A;  2JY6 B;  2RRU A;  2OOA A;  3K9P A;  2JUJ A;  2JZ0 A;  3IHP A;  1ZMU A;  1F4I A;  3FE3 A;  1WJ7 A;  1UFZ A;  3E46 A;  1VEK A;  4HEO A;  2DKL A;  2CP8 A;  2DAI A;  3E21 A;  2DNA A;  1YLA A;  1AIP C;  1IXS A;  1DO0 A;  1ZV1 A;  2DI0 A;  2EKF A;  2JY7 A;  2KNZ A;  2OO9 A;  1CUK A;  1WR1 B;  3F92 A;  1T43 A;  4G3O A;  2HAK A;  2L4F A;  2ZTD A;  1C7Y A;  2BWE A;  2JP7 A;  1R4G A;  2ZTC A;  2L4E A;  4GEW A;  1V92 A;  1ZMW A;  2JZ1 A;  1SG9 A;  2R0I A; 
#chains in the Genus database with same CATH topology
 4NRW A;  4IBC A;  1IM2 A;  4LZZ A;  4WP2 A;  2ZAO A;  4KOD A;  4GC5 A;  2KRU A;  1K3W A;  2XEP A;  2LTU A;  3HGI A;  4FVM A;  4HL4 A;  2VDB B;  2R4E A;  1TDZ A;  4QOZ C;  2CFO A;  4AKI A;  1RU3 A;  2B3T A;  5IWA M;  2JY8 A;  1SXJ A;  4Q7J A;  4GH9 A;  3FUV A;  2L09 A;  3FYC A;  3UK6 A;  1JR3 E;  2LVN C;  2EKK A;  2LXE A;  3U6D A;  3DA1 A;  1J09 A;  2FNA A;  3UMM A;  3A45 A;  5LMN M;  2Y0T A;  2FE8 A;  2WZJ A;  3KDS E;  1E9S A;  3GPX A;  4JI4 M;  2J7N A;  1IBK M;  1L2C A;  2O01 F;  4IBB A;  2HCB A;  1K82 A;  3D8B A;  2K9D A;  3GLI E;  3GLG E;  3GLH B;  1G3I A;  3BBZ A;  3HHX A;  2JY5 A;  4IBF A;  4X66 M;  3GO8 A;  1PJQ A;  5KQD A;  2UXC M;  4KT0 F;  2R44 A;  2Y21 A;  3E9S A;  2Y0Q A;  4NSO B;  4JXJ A;  1R2Y A;  1IXS B;  3EIE A;  1GJT A;  3U6Q A;  3WHL A;  4I8O A;  3NBX X;  3PXG A;  4CHT B;  1VDL A;  1WHC A;  1VEJ A;  4DV7 M;  2A5Y B;  1QZE A;  5FTN A;  1LV7 A;  3L2A A;  1HNX M;  1W5T A;  2DEN A;  2EA0 A;  1GL7 A;  1QAM A;  4GRI A;  3CF2 A;  3U60 A;  3Q8G A;  3BXW A;  1TTE A;  2F5S A;  1SXJ C;  1UM8 A;  3RE8 A;  3PVS A;  3B7N A;  2DAE A;  2MJ5 B;  3QYE A;  1FJG M;  1E32 A;  5IZ7 D;  1GVN A;  4LF4 M;  3A46 A;  1A5T A;  3DOA A;  3K1J A;  3LQR A;  1GKI A;  2KA6 B;  1IN4 A;  3WHK A;  3GLF E;  4LFA M;  2OPF A;  2BJV A;  3FTC A;  1NV9 A;  4LJ8 A;  3ZC7 B;  5ITQ A;  2J5Y A;  2O5R A;  5BPV A;  3TE6 A;  8CAT A;  3T1H M;  4BB9 A;  1L2B A;  4R71 A;  3LVV A;  3L25 A;  4I81 A;  3KXE C;  3I51 A;  4DR6 M;  3AL0 C;  3EIH A;  5EXP A;  1QDR A;  4CIZ A;  3A98 B;  1IXZ A;  1W5S A;  3SAR A;  1IN8 A;  4NOO B;  1PM5 A;  1C1K A;  1DGH B;  4I5S A;  3QNA A;  2C98 A;  2KEB A;  3I4Y A;  4ITQ A;  2JUJ A;  3GRY A;  1ZMU A;  2GQF A;  3L27 A;  3KP1 E;  3UZU A;  1XWI A;  1D0L A;  2R6F A;  1VEK A;  2ZBK B;  5EJC A;  1KSF X;  4R3D A;  1HR0 M;  2DKL A;  1OIZ A;  4LY6 A;  2F4V M;  2V6Z M;  3E21 A;  4PT5 A;  2Q2E B;  2R46 A;  5DNY A;  3OTO M;  2JY7 A;  5EP3 A;  2CV2 A;  3I4V A;  3SAV A;  2G8L A;  1V33 A;  1OIP A;  2WSC F;  4QOS A;  1WR1 B;  4DV1 M;  5F3W A;  4D80 A;  1JR3 D;  2VF7 A;  4G3O A;  2XZU A;  3FD9 A;  3HU3 A;  4QNR A;  1N78 A;  4TUW A;  1Q39 A;  2Z7J A;  3HWS A;  4G4R A;  1QUT A;  2HL7 A;  4FCV A;  1TGU A;  3FKE A;  3SHF A;  3VK7 A;  2YQZ A;  1Z59 A;  1JQJ C;  1R4G A;  2H1R A;  2ZTC A;  4LGM A;  2D7H A;  3T15 A;  1VDD A;  4X64 M;  1X37 A;  2FS1 A;  4D81 A;  3QN9 A;  1L8Q A;  3HJ8 A;  3KOZ E;  2R18 A;  3ILK A;  1GTQ A;  4FWD A;  1TH4 A;  1T3T A;  1HT2 E;  1DGH A;  5L8R F;  4B3R M;  1NNJ A;  1AUA A;  4AZF A;  3GP1 A;  1NY5 A;  2ZAM A;  4JI7 M;  4KO8 A;  2V1C A;  3C3E A;  1NHW C;  1TR8 A;  4IBE A;  3LZE A;  1SXJ B;  1Y8G A;  2R65 A;  2DXI A;  1XB2 B;  1XHB A;  4M9X A;  3MJ5 A;  1VEG A;  1PGY A;  3U5Z B;  3H4J A;  2O25 A;  4L78 A;  5KPT A;  2K6B A;  1G71 A;  1N75 A;  1VQ1 A;  3U6P A;  3VKG A;  3W67 A;  3U6O A;  4Z6Y A;  3TL4 X;  2LVP C;  5E6J A;  2LH0 A;  2QP9 X;  5EXT A;  3GRV A;  3ZH9 B;  5A2Q S;  1QVR A;  5E26 A;  2Z3X A;  1HNW M;  2DWZ B;  4M0W A;  4DR1 M;  4B7G A;  1WGL A;  2XSZ D;  3NBI A;  1Z6T A;  4DR2 M;  4XGI A;  5EP1 A;  3UGJ A;  2UUC M;  4JI6 M;  2KZS A;  3GQ3 A;  2F5O A;  3I01 M;  4P17 A;  3KP0 E;  4JI2 M;  1NNU C;  2Z8Y M;  3GPU A;  4B3T M;  3KOW E;  3JR5 A;  4FVG A;  1GO5 A;  4A3V B;  1IN7 A;  5JI2 E;  3M7G A;  3L29 A;  3C58 A;  3FRH A;  3FUW A;  2LBC A;  3VDP A;  1JB0 F;  3SMS A;  4B3M M;  1NSF A;  3KFU G;  1NV8 A;  2DAM A;  2H5X A;  3B89 A;  4F1I A;  3J80 S;  3SAS A;  2X4A A;  4BBA A;  2MH8 A;  1WIN A;  3I2B A;  1N36 M;  5C1B A;  2C5R A;  4QHS A;  3KS4 A;  1B66 A;  4YY3 M;  1QAN A;  1ZQ9 A;  3SBJ A;  3AJI B;  4NTN A;  2CHQ A;  2DHY A;  1HQY E;  4IBG A;  3L26 A;  4AW4 A;  3TWM A;  1R7R A;  3HHZ A;  4BLC A;  2X49 A;  2RGH A;  2RKO A;  3VDU A;  1HQC A;  4OVZ A;  3PNV A;  1BVS A;  5ITR A;  1MX0 A;  3AOG A;  3GLG A;  2HKJ A;  3GLI A;  2KNV A;  2LVQ D;  5EP4 A;  2LWX A;  4PD2 A;  4FD2 A;  4MGZ E;  3U61 B;  1NO1 A;  1DO2 A;  2KW0 A;  5DYG A;  3GPP A;  3T6P A;  4AQY M;  4M0D A;  2JY6 B;  2RRU A;  2OOA A;  4GMQ A;  1J7K A;  1S3S A;  2L7I A;  3IHP A;  3LMM A;  4GIT A;  4MH0 E;  3GPY A;  3R8F A;  1F4I A;  3L28 A;  2VQF M;  3FTD A;  4LJ4 A;  1QQW A;  2VII A;  1GAB A;  3CF0 A;  3JYG A;  3C9P A;  4Z8X A;  4AKH A;  1IQP A;  1SXJ E;  2X8A A;  3ZCB B;  2JWS A;  4DV2 M;  4KHP M;  4DV4 M;  2DNA A;  2QQ8 A;  3D8L A;  1YLA A;  1AIP C;  1IY2 A;  1IXS A;  1DGB A;  1PJS A;  1Z5A A;  5EXS A;  2DWL A;  2J7O A;  3H4M A;  5BR8 M;  1I94 M;  2DWN A;  4FVJ A;  2V1U A;  3C3D A;  5FSW A;  4IBK A;  1E9R A;  3HKP A;  4OW0 A;  5ITY A;  2APL A;  1GJS A;  1N32 M;  2DWM A;  3KVW A;  4JI0 M;  2AHM A;  3IG5 A;  2XSZ A;  4FVF A;  3GLF A;  5EXX A;  1EIJ A;  2L4E A;  3RFW A;  5KQ8 A;  2JZ1 A;  2R0I A;  2GNO A;  3KW6 A;  2DZO B;  3KOY E;  5FTL A;  3VK8 A;  3MMP A;  4LRT A;  4DR4 M;  1KYI A;  2UXD M;  4NTM A;  1SXJ D;  1OQY A;  3GLI B;  4DR3 M;  1R2Z A;  3B7Z A;  4DBG B;  2A0S A;  3LX3 A;  1MJG M;  1XXH E;  1D0M A;  1I4W A;  4XBO A;  2XZF A;  1L1Z A;  3IG8 A;  1DV0 A;  4OX9 M;  5IT9 S;  3IEC A;  4W5W A;  2DHR A;  2MGW A;  3HZJ A;  4LJ6 A;  5DFL A;  3TPZ A;  3HU2 A;  3UJN A;  3SMP A;  4X62 M;  4F2L A;  2F5Q A;  1TF0 B;  4KLN A;  5IRE B;  4L15 A;  1HNZ M;  3LVW A;  1HT1 E;  2CHG A;  1E94 E;  1NY6 A;  1YE9 A;  1ZMV A;  3B7Q A;  5LMU M;  1NJF A;  4OU7 A;  1XNQ M;  4NSR A;  2K47 A;  4IJE A;  4JYA M;  1IN6 A;  2RGO A;  1XMO M;  4B08 A;  2QPA A;  3TQS A;  4PDI A;  5GKN A;  2CEA A;  1XC8 A;  7CAT A;  3VKH A;  1IXR C;  4IIW A;  4NL4 H;  3W0F A;  2P5T A;  4EIW A;  4JV5 M;  1IBM M;  2QBY A;  2G64 A;  1R6B X;  3J7B A;  4RNA A;  4AKG A;  2Z4S A;  2FH0 A;  3W68 A;  1PRB A;  3J27 B;  2JA2 A;  2M60 A;  3RGP A;  2UUA M;  1OAO C;  4L4U A;  3FRI A;  3KSJ A;  3U6M A;  3PNY A;  2Z4R A;  1N33 M;  4ANR A;  4B7H A;  1YUB A;  1VG5 A;  2XFT A;  1P3Q Q;  3JAM S;  1KFV A;  3MK6 A;  2DJ6 A;  5EQT A;  2F5P A;  4D82 A;  3FUX A;  3HJS A;  3VLF B;  4UN2 B;  4B3S M;  3QWL A;  3HHY A;  3SHG B;  4DV3 M;  1LTM A;  4RKU F;  3T1Y M;  1IFY A;  3M6A A;  1OAI A;  2QZ4 A;  4MB7 A;  3KSX A;  2ERC A;  2LVO C;  2JXN A;  3I04 M;  3A42 A;  5KO3 A;  1L2D A;  4LZJ A;  3U6E A;  3HX3 A;  4IBI A;  3U5Z A;  3AOE A;  2C96 A;  3GLH E;  1EE8 A;  4JI5 M;  3BK6 A;  2DAG A;  5KPZ A;  2CUZ A;  2L7H A;  3K2L A;  1MN3 A;  4FWG A;  4MGK E;  3T38 A;  3AKZ A;  1Q02 A;  4RF1 A;  2QHO B;  4MM3 B;  4LF8 M;  2D7G A;  4G6Z A;  1QDT A;  5H37 D;  2XGN A;  3HJQ A;  3M0N A;  1HJP A;  3LQQ A;  1OFH A;  4GC9 A;  4GIP A;  4PCZ A;  3FUU A;  3FYD A;  4LGY A;  2R45 A;  3GQ5 A;  1QUS A;  4DR5 M;  5ITT A;  2R4J A;  3B9P A;  2CV1 A;  2HHH M;  1TH3 A;  2EUC A;  2C99 A;  2KRK A;  3QAU A;  4L16 A;  2G5G X;  2N35 A;  3HY5 A;  1V34 A;  5ITX A;  2YNM D;  4GKJ M;  3GLF B;  3KS8 A;  4K0K M;  3LW5 F;  2EO2 A;  4JI1 M;  3J7A S;  4X65 M;  3VFD A;  2DI0 A;  4MGH A;  3KOX E;  1MU5 A;  2KNZ A;  3D7J A;  1Q3C A;  4G4O A;  1CUK A;  2E5L M;  4XK8 F;  2CRU A;  2KZU A;  2CHV A;  4LJ5 A;  4LFB M;  1T43 A;  1ZAE A;  2BNK A;  5EP2 A;  2HAK A;  2L4F A;  2ZTD A;  3SYK A;  3FTE A;  2QBY B;  1PJJ A;  4GHL A;  3SC3 A;  3FUT A;  4L6V 6;  1NHG C;  1TDH A;  4B7F A;  1C7Y A;  3Q8X A;  4GEW A;  1V92 A;  4AG6 A;  2QEN A;  4II7 A;  5KPR A;  2OQ4 A;  2BJW A;  5FLX S;  4DUZ M;  1OJL A;  3E4R A;  2CWB A;  1YSY A;  2NQ8 C;  4AI6 A;  4S12 A;  1FNN A;  2QNJ A;  3QYB A;  4OVZ B;  4DV5 M;  3U6S A;  2EJS A;  3MHV C;  2UU9 M;  4NC6 A;  1GLN A;  1XNR M;  4GKK M;  2G3Q A;  1WGN A;  2CE7 A;  4IJF A;  3GLG B;  2D7E A;  2L2D A;  4FWH A;  4IBD A;  4LJ7 A;  4LRS A;  5ITU A;  5DYI A;  4G4N A;  4NRV A;  3LCU A;  3SFZ A;  3U60 B;  2KNA A;  2CV0 A;  4QHT A;  2XF3 A;  4MGI E;  1XMQ M;  2OBA A;  4P16 A;  5FTM A;  1N34 M;  4FCW A;  4R7G A;  1QAO A;  2C9C A;  2LHC A;  4M9Z A;  4HLQ A;  1IY1 A;  1Q3B A;  3GRR A;  1T6O A;  2OOB A;  3HU1 A;  1G4A E;  2L6O A;  3CTW B;  1JR3 A;  2QSF X;  1DGG A;  1OFI A;  3SAU A;  2LNH C;  2MR9 A;  2R62 A;  4CIS A;  1GL6 A;  2DAK A;  2K0B X;  1IY0 A;  2XFS A;  1J5E M;  1IN5 A;  3K92 A;  4RF0 A;  2DZN B;  5FTK A;  4JN6 A;  4NXN M;  3JR4 A;  2FOI C;  4QNM A;  1ORY B;  5FTJ A;  4AG5 A;  2C9O A;  3GRU A;  3B74 A;  4WUR A;  1N77 A;  4NXM M;  4DR7 M;  3K9O A;  3J81 S;  4LF5 M;  2WSE F;  3CGW A;  3LCV B;  3THG A;  2FFJ A;  2I7N A;  3SAT A;  4LF9 M;  1R5L A;  2LVA A;  3U61 A;  3CF6 E;  2MRO B;  1Y13 A;  2WSF F;  2JNH A;  4CGY B;  3GQ4 A;  2KHH A;  1Z5B A;  1OKS A;  2VF8 A;  1D2N A;  4PDG A;  3K8Z A;  1G8P A;  1D0K A;  2QCU A;  4WW0 A;  2KDL A;  1K3X A;  4M9S A;  3AFH A;  2DZL A;  3BOS A;  4G4Q A;  4LJ9 A;  5JI3 E;  3DZD A;  1G59 A;  1QZM A;  2YR0 A;  4LF6 M;  3AOE C;  2ZM6 M;  2XH9 A;  2VQE M;  2XLJ A;  4DV0 M;  3FTF A;  2BWB A;  1TFE A;  2HWJ A;  1QAQ A;  3V76 A;  1WIV A;  1OTR A;  3W0L B;  2Y20 A;  1PJI A;  4FCT A;  1EFU B;  2M5Z A;  2YFQ A;  1G41 A;  4Y28 F;  3QN0 A;  3RGS A;  2W82 A;  4GHA A;  4IBJ A;  2KXE A;  3K9P A;  4ZPX A;  3U6L A;  2JZ0 A;  2UUB M;  3FE3 A;  1WJ7 A;  1DGF A;  1B6Z A;  1UFZ A;  3E46 A;  3AV0 A;  4I4L A;  4REZ A;  5ITX E;  1H6U A;  4HEO A;  4YHH M;  3SAW A;  4LFC M;  1NVM A;  2CP8 A;  2DAI A;  3SYL A;  4JI3 M;  3NWL A;  1WXQ A;  1DO0 A;  4LJA A;  1ZV1 A;  2EKF A;  4LG2 A;  1XXH A;  3ZQJ A;  4DV6 M;  2OO9 A;  3M0E A;  1XXH B;  1IBL M;  4NTK A;  1Z5C A;  1NJG A;  4JI8 M;  2I7P A;  3HHW A;  1QYR A;  5C18 A;  3DFZ A;  4L8R C;  3F92 A;  2ZAN A;  2RPB A;  3U6C A;  1TH2 A;  2LHG A;  1PJT A;  4DUY M;  2DTT A;  2UXB M;  3GLH A;  1L1T A;  4CJ6 A;  4FW9 A;  4LF7 M;  2BWE A;  2JP7 A;  3J2P B;  3PFI A;  4LCB A;  3TWK A;  3TWL A;  2DVW B;  4MGY E;  3R9X B;  1ZMW A;  2F5N A;  1SG9 A; 
#chains in the Genus database with same CATH homology
 2CWB A;  3MMP A;  1KYI A;  1IM2 A;  2QNJ A;  4WP2 A;  1OQY A;  2EJS A;  1HT2 E;  4DBG B;  1XXH E;  2LTU A;  2G3Q A;  1WGN A;  1TR8 A;  2L2D A;  1Y8G A;  2B3T A;  1DV0 A;  3IEC A;  3LCU A;  1XB2 B;  2KNA A;  2JY8 A;  2MGW A;  5DFL A;  1VEG A;  1PGY A;  4Q7J A;  3H4J A;  2O25 A;  1JR3 E;  2LVN C;  4F2L A;  2EKK A;  1VQ1 A;  1HT1 E;  2LVP C;  1E94 E;  1ZMV A;  2WZJ A;  1WGL A;  1T6O A;  2OOB A;  2K9D A;  1G4A E;  3GLI E;  3GLG E;  2QSF X;  1G3I A;  3BBZ A;  2MR9 A;  2JY5 A;  1GO5 A;  2DAK A;  2K0B X;  5JI2 E;  3FRH A;  2LBC A;  3FRI A;  1VDL A;  1NV8 A;  1WHC A;  2DAM A;  2H5X A;  1VEJ A;  3B89 A;  3K9O A;  4F1I A;  3LCV B;  1QZE A;  1VG5 A;  1P3Q Q;  2DEN A;  2LVA A;  2MRO B;  2JNH A;  1TTE A;  4UN2 B;  2DAE A;  2KHH A;  1OKS A;  2MJ5 B;  1IFY A;  1OAI A;  2DHY A;  1HQY E;  2LVO C;  1A5T A;  2DZL A;  3GLF E;  1NV9 A;  3GLH E;  4R71 A;  2DAG A;  1BVS A;  2BWB A;  1MN3 A;  1TFE A;  2HWJ A;  1Q02 A;  2QHO B;  2KNV A;  2LVQ D;  1WIV A;  1OTR A;  1HJP A;  1DO2 A;  1EFU B;  1G41 A;  3T6P A;  2JY6 B;  2RRU A;  2OOA A;  3K9P A;  2JUJ A;  2JZ0 A;  3IHP A;  1ZMU A;  1F4I A;  3FE3 A;  1WJ7 A;  1UFZ A;  3E46 A;  1VEK A;  4HEO A;  2DKL A;  2CP8 A;  2DAI A;  3E21 A;  2DNA A;  1YLA A;  1AIP C;  1IXS A;  1DO0 A;  1ZV1 A;  2DI0 A;  2EKF A;  2JY7 A;  2KNZ A;  2OO9 A;  1CUK A;  1WR1 B;  3F92 A;  1T43 A;  4G3O A;  2HAK A;  2L4F A;  2ZTD A;  1C7Y A;  2BWE A;  2JP7 A;  1R4G A;  2ZTC A;  2L4E A;  4GEW A;  1V92 A;  1ZMW A;  2JZ1 A;  1SG9 A;  2R0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...