1XB2B

Crystal structure of bos taurus mitochondrial elongation factor tu/ts complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
276
Chain Sequence
b'SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRKTKEGLIGLLQEGDTTVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQNLKDQLSTYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAAWVKVPAGFYVGSYVHGAMHSPSLHNLVLGKYGALVICETSELKANLADLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPHGVSVVDFVRFECGEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor Tu, mitochondrial
publication title Crystal Structure of the Bovine Mitochondrial Elongation Factor Tu.Ts Complex
pubmed doi rcsb
source organism Bos taurus
molecule tags Translation
total genus 83
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1xb2B01
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B03
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B02
1G41A 1IFYA 2L4FA 4WP2A 2OOAA 3GLFE 2MROB 1HT2E 2BWBA 2DNAA 1WGLA 4DBGB 5JI2E 3E21A 2LBCA 2EKFA 1OQYA 2HAKA 2OOBA 1P3QQ 2WZJA 2JY7A 2DENA 2B3TA 3GLHE 3BBZA 2DAMA 3K9OA 1NV9A 1CUKA 1IM2A 1TTEA 2CWBA 2K9DA 1AIPC 4GEWA 2JUJA 1DO2A 2JP7A 3H4JA 2DAIA 3LCUA 1OKSA 3FRIA 2L4EA 1XXHE 2JZ1A 2MGWA 2K0BX 1C7YA 1WR1B 1GO5A 3GLGE 2R0IA 2L2DA 4G3OA 2G3QA 1XB2B 2DAGA 3K9PA 4UN2B 3T6PA 2KNVA 2ZTCA 2BWEA 1E94E 1MN3A 2QHOB 2KNZA 1WHCA 2QNJA 1VDLA 2JY6B 1VEKA 4Q7JA 2EKKA 3GLIE 4HEOA 1WJ7A 3IHPA 1ZMUA 1VQ1A 1YLAA 1G4AE 2HWJA 2CP8A 2DZLA 1IXSA 2KNAA 1OTRA 1DO0A 1ZV1A 1QZEA 1WGNA 3MMPA 1SG9A 1G3IA 2LVQD 1VG5A 1OAIA 2JNHA 4R71A 2LVPC 3B89A 2JZ0A 1T6OA 1DV0A 1HJPA 3F92A 1NV8A 2LTUA 2DAEA 1Q02A 3LCVB 1HQYE 2KHHA 3E46A 1F4IA 2JY8A 2LVAA 1EFUB 1VEJA 1ZMVA 2QSFX 1V92A 1TFEA 3FE3A 1UFZA 1ZMWA 2LVOC 4F1IA 1T43A 5DFLA 1PGYA 2MJ5B 2RRUA 2DHYA 1TR8A 2O25A 1BVSA 2MR9A 2LVNC 1A5TA 2OO9A 4F2LA 1KYIA 3FRHA 2DAKA 1JR3E 2JY5A 1WIVA 2DI0A 2EJSA 1VEGA 1Y8GA 3IECA 2DKLA 2ZTDA 1R4GA 1HT1E 2H5XA
chains in the Genus database with same CATH superfamily
2C99A 1IFYA 4NTNA 2WSFF 2OOAA 4WP2A 4W5WA 1YUBA 3SYKA 2LH0A 3HU1A 3SATA 5GKNA 2RPBA 1HT2E 3JAMS 5EXTA 2BWBA 2DNAA 1E32A 1PJTA 5JI2E 1DGHB 5FTLA 3GO8A 4L16A 4L4UA 2UXBM 1OQYA 3HWSA 2OOBA 2DWNA 3DA1A 4G4OA 1GJSA 3KVWA 2DENA 1R2ZA 4XGIA 2DTTA 3BBZA 3KOWE 2KZUA 4FCWA 4FVMA 2EA0A 3K9OA 1XNQM 3TQSA 3GQ5A 4AKIA 1NV9A 3HHWA 4AZFA 4FCTA 5F3WA 5KPTA 4AQYM 2JWSA 3C58A 1Q3CA 4XBOA 1Z5BA 4FW9A 4JI7M 2L7IA 1XNRM 4FVJA 2R45A 3B74A 3FTFA 2LNHC 4NRVA 1HNZM 1IN4A 2F5SA 3H4JA 3GLHA 4MB7A 3TPZA 3UK6A 4FCVA 2MGWA 2VIIA 2QQ8A 4TUWA 1GO5A 1I4WA 2QP9X 3NWLA 4EIWA 5C18A 4G3OA 5IT9S 4PDIA 3KS8A 1XB2B 2DAGA 3K9PA 4CHTB 2BNKA 2KNVA 2DVWB 2J7NA 2H1RA 2ZTCA 3UJNA 2BWEA 4PCZA 1MN3A 2DZOB 2ZAOA 5FTNA 4LFAM 2QNJA 1Q3BA 3I2BA 2O5RA 2CFOA 2KEBA 1VEKA 4YY3M 2JXNA 2LWXA 3B7QA 4PD2A 3GLIE 1I94M 3KP1E 2VF8A 4LGMA 3IHPA 1ZMUA 3C3DA 1N33M 3HKPA 4LCBA 1QDTA 3FUTA 3UMMA 3TWKA 5KO3A 1FNNA 4L6V6 1SXJD 4DUYM 2FS1A 5KPZA 1ZV1A 2C9OA 1PJJA 1FJGM 1NJGA 1W5TA 3KP0E 2I7NA 4GHAA 1SG9A 4NC6A 2DHRA 4QOSA 2J7OA 1N32M 2UXDM 1G3IA 4X62M 3THGA 2K6BA 3U5ZB 3PNVA 1J09A 1D0MA 3AOGA 1LV7A 1VG5A 4OVZA 4DV5M 1AUAA 3I51A 3SC3A 2Y21A 4XK8F 4R71A 3SAUA 3B89A 1IY0A 1DV0A 1HJPA 3F92A 1NVMA 3GQ4A 4LJ8A 2XFSA 3TL4X 4DR6M 1T3TA 2DAEA 4B3TM 4JI2M 4AG5A 2UXCM 4IJEA 4LRSA 5FTKA 3E46A 1QDRA 1ZMVA 1IXZA 1GTQA 2XSZD 3DZDA 3QWLA 1IN8A 1IBLM 4KO8A 2XEPA 1NY5A 3FE3A 4IBFA 3WHLA 3OTOM 1R6BX 3L27A 4JI6M 3HU3A 5LMUM 4JI8M 3FYDA 2HL7A 1QQWA 1MU5A 4X64M 3L25A 1IN6A 3W67A 4GKKM 4FVGA 2O25A 1BVSA 2MR9A 4ITQA 1A5TA 2OO9A 1OFHA 2L09A 3U6CA 1VDDA 3KXEC 4IBDA 2ZANA 4GC5A 2QZ4A 1EIJA 2JY5A 3U6LA 3HJ8A 2XZUA 3HZJA 1H6UA 3QYEA 5LMNM 4MM3B 3VK7A 1Y8GA 3IECA 3J80S 4BB9A 2KDLA 1GVNA 2R65A 3MJ5A 3ZC7B 2H5XA 7CATA 1KFVA 3M6AA 4M9SA 3SAVA 1N78A 3TE6A 4AW4A 4R3DA 1JR3A 4NOOB 4RNAA 2CHVA 3KSXA 2OQ4A 3U60B 2LBCA 2HAKA 2F5OA 4P16A 3FUWA 1OFIA 5C1BA 3GPUA 4B7GA 2R4EA 2WZJA 2R4JA 2JY7A 4NTMA 4IIWA 4OW0A 1GJTA 2WSEF 1QUTA 2BJWA 3K8ZA 1E9SA 4GMQA 3HX3A 4IBJA 2FFJA 4Y28F 3HHXA 3LZEA 3QYBA 1QAMA 2Z3XA 4HLQA 1SXJE 2LHGA 2VDBB 3DFZA 4GEWA 2F4VM 1GABA 2DAIA 1XWIA 1OKSA 1Z6TA 2P5TA 2L4EA 4D82A 2K0BX 1D0KA 1WR1B 1QAOA 3GLFB 4MGHA 1V33A 1S3SA 3BOSA 2L2DA 3CF6E 3DOAA 3HJSA 3J7BA 2G3QA 4DR1M 3D8BA 4UN2B 3I4YA 4IBKA 2C96A 1E94E 3LX3A 2V1UA 2KNZA 2JY6B 4CGYB 4PT5A 2UUBM 4R7GA 1J7KA 2RGHA 1WINA 2KZSA 1PJSA 1WJ7A 3U61B 2VQEM 4LJ6A 5ITQA 1VQ1A 4M0WA 1OJLA 3SBJA 5ITUA 3I01M 1IXSA 2DZLA 3AKZA 1OTRA 1WGNA 3QAUA 4NTKA 1Z59A 3GLIA 1NHGC 1NO1A 2E5LM 1XC8A 5IZ7D 1HNXM 2LVQD 2QBYA 3SMSA 2DJ6A 2LHCA 3T38A 2JNHA 1TDHA 1GL6A 4LJ4A 2LVPC 4LJ5A 4AG6A 3QN0A 2JZ0A 3QNAA 1HQCA 3GLGB 1G8PA 5EQTA 2GQFA 3U6PA 1B6ZA 3K92A 1L8QA 1Q02A 3EIHA 5KQ8A 1N34M 1K82A 3EIEA 3LCVB 1XXHA 1HQYE 3KDSE 3FTEA 3J2PB 1F4IA 2RGOA 4K0KM 4LZJA 1EFUB 1VEJA 2QCUA 4KHPM 1JB0F 2L7HA 4AI6A 3KSJA 1N36M 2UU9M 2DWMA 1Z5AA 1ZMWA 1NHWC 3PNYA 1R7RA 2QPAA 3RGSA 2R18A 1T43A 4F1IA 5ITRA 2VF7A 1PGYA 2MJ5B 3I04M 2XLJA 2DHYA 4G4QA 2XH9A 1TF0B 2A5YB 2RKOA 3T1YM 3TWMA 1SXJB 4F2LA 4JV5M 2YQZA 3PFIA 1K3XA 3SASA 4CJ6A 3A46A 2C98A 4JI5M 3W0FA 2GNOA 1JR3D 2R44A 3FKEA 3V76A 1TGUA 4NSRA 4G4RA 1NNUC 1IXRC 1DGHA 3KS4A 1HNWM 4KLNA 4KODA 3E9SA 5DNYA 2DZNB 1LTMA 1WIVA 4I4LA 2DI0A 2EJSA 3MK6A 1B66A 1EE8A 3K2LA 1PRBA 3ILKA 3MHVC 4FVFA 2CRUA 4REZA 4L78A 4JI4M 4FWGA 1R5LA 2L4FA 3HGIA 3GLFE 1Y13A 4DV2M 2CV0A 4YHHM 3GRVA 4LF8M 4DBGB 1WGLA 1L2CA 2UUCM 5EP1A 2XZFA 2ERCA 2N35A 5DYGA 4IBGA 1PJQA 4DV7M 3SAWA 1G71A 4QOZC 3TWLA 3RFWA 3R8FA 1L1ZA 2B3TA 4JN6A 4B7FA 3JR5A 5KQDA 4MGYE 3FD9A 4IBBA 3LQQA 3L28A 4WW0A 1QVRA 1QUSA 2Z8YM 3GRRA 2W82A 1J5EM 1TH2A 2KRUA 4QHTA 4LGYA 1QZMA 3CF0A 2MH8A 2Z4RA 4AKHA 1AIPC 3U6MA 2CV1A 3IG5A 2JUJA 1DO2A 2KRKA 4ZPXA 4B08A 3LCUA 3U6QA 3NBIA 2OPFA 3FRIA 5EP4A 1MX0A 2D7EA 2ZBKB 3AV0A 1QANA 3HJQA 1C7YA 2F5PA 1JQJC 3GLGE 1NY6A 3FUUA 3J81S 3BK6A 2X8AA 5ITXE 3KFUG 1KSFX 3L29A 3T6PA 3U5ZA 4Z8XA 3WHKA 2M60A 3Q8XA 1WHCA 4IBIA 3Q8GA 4QNMA 1W5SA 1PJIA 5BPVA 2EKKA 1D0LA 5A2QS 4LF9M 4BBAA 2FE8A 4MGIE 2G64A 4KT0F 3B7NA 4B3SM 3GLHB 2BJVA 1YLAA 4B7HA 2HWJA 3RE8A 2DWLA 3SARA 2KNAA 4DR4M 1DO0A 2V6ZM 5EXPA 1C1KA 4I81A 3AOEA 3KOYE 3L2AA 3MMPA 2YNMD 2YR0A 4DV3M 4JI0M 3VKHA 4JXJA 3R9XB 2Q2EB 2Y20A 4A3VB 3NBXX 1IY1A 3H4MA 1DGBA 3KW6A 4FWDA 2X49A 1NSFA 3M7GA 4LF5M 2R62A 2DWZB 4LRTA 2M5ZA 4DV1M 3CTWB 2L6OA 1NV8A 4I5SA 2NQ8C 2LTUA 4GRIA 3ZQJA 3GRUA 5H37D 2R46A 3M0EA 2KHHA 2K47A 2LVAA 4LY6A 3JYGA 5JI3E 4LF6M 3U6SA 4HL4A 2CE7A 3PXGA 3W68A 4L8RC 3KOXE 4D81A 5DYIA 3FUVA 1XMOM 4G6ZA 2LVOC 1UFZA 2XF3A 4MGKE 4OVZB 3UZUA 4BLCA 3GPPA 3SHGB 4DV6M 3BXWA 3HHYA 2G8LA 3GRYA 1QAQA 4DR2M 1PM5A 2F5NA 3B9PA 1TR8A 4LJAA 5L8RF 3UGJA 3M0NA 4RF1A 2LVNC 2ZM6M 3PVSA 4IJFA 5EP3A 3AFHA 3VKGA 2HHHM 5E6JA 1IQPA 1N77A 1KYIA 1L1TA 4LF7M 3AL0C 2OBAA 3A98B 3VLFB 5E26A 4GIPA 2XFTA 3U60A 2CV2A 1K3WA 4GKJM 1ORYB 3HU2A 4X66M 4LFCM 2XGNA 3E4RA 1HR0M 1ZQ9A 2ZTDA 5BR8M 1R4GA 1HT1E 2J5YA 4FD2A 3J7AS 1G41A 3ZCBB 4M9XA 4RKUF 1TH3A 2R6FA 1IBMM 2MROB 2X4AA 1QYRA 5ITYA 3QN9A 1D2NA 2Y0QA 2KA6B 3RGPA 4DV0M 3E21A 2LXEA 4DUZM 4DV4M 2EKFA 3U6DA 2APLA 1UM8A 4AKGA 3U6OA 3GLFA 4QNRA 1P3QQ 1Q39A 2Y0TA 3KOZE 3T15A 4GC9A 3GLHE 4LF4M 2DAMA 3U6EA 1GL7A 1IBKM 4S12A 4X65M 5FLXS 4LJ7A 4MH0E 1CUKA 3FUXA 4RF0A 8CATA 4DR7M 3FYCA 4LZZA 4NXNM 1IM2A 1TTEA 1ZAEA 2CWBA 4M9ZA 4NL4H 2K9DA 1DGFA 2C5RA 1L2DA 3HHZA 1WXQA 4L15A 1IN5A 3U61A 2JP7A 1XMQM 1MJGM 3A45A 1NNJA 3C3EA 3LQRA 3C9PA 4NSOB 1XXHE 2JZ1A 2UUAM 3D7JA 3L26A 5ITTA 1TH4A 3D8LA 4LJ9A 5FSWA 5KPRA 4GH9A 2R0IA 3GQ3A 3A42A 3AJIB 1GLNA 2QHOB 2VQFM 5EXXA 4G4NA 1VDLA 3FTDA 3SMPA 2FNAA 3W0LB 4GHLA 4Q7JA 2C9CA 2FOIC 4P17A 2QENA 3LMMA 1TDZA 4HEOA 2CHGA 5IREB 1N75A 3GLGA 1YE9A 5ITXA 3LVVA 3J27B 2FH0A 1G4AE 2V1CA 2F5QA 2CP8A 4GITA 1IY2A 2G5GX 5FTMA 3GPXA 1QZEA 3T1HM 1DGGA 3HY5A 4LFBM 3LW5F 4FWHA 4WURA 3I4VA 5IWAM 4B3RM 4IBCA 3B7ZA 3VFDA 2Z4SA 4CIZA 1OAIA 3JR4A 2O01F 3K1JA 2HCBA 2KXEA 1T6OA 1GKIA 2EO2A 4MGZE 3VDUA 1R2YA 4ANRA 1Z5CA 2WSCF 1SXJA 4B3MM 2CUZA 2Z7JA 4DR5M 1IXSB 2JA2A 1V34A 2JY8A 5EXSA 4NRWA 4NXMM 3IG8A 1SXJC 2YFQA 1OAOC 2QSFX 2ZAMA 1L2BA 1V92A 3GLIB 1TFEA 2AHMA 2QBYB 3FTCA 1NJFA 5FTJA 4LG2A 2A0SA 2KW0A 1E9RA 5DFLA 1X37A 3VK8A 4II7A 3CF2A 1IN7A 3GP1A 2CHQA 1OIZA 1RU3A 2RRUA 4JI1M 4D80A 2EUCA 4IBEA 3SFZA 2DXIA 2CEAA 3SHFA 3SYLA 3GPYA 1G59A 4CISA 5EP2A 4JI3M 3AOEC 3LVWA 3FRHA 4M0DA 1OIPA 1XXHB 2XSZA 2D7GA 1XHBA 2DAKA 5EJCA 4JYAM 2D7HA 4Z6YA 3CGWA 1JR3E 2I7PA 4DR3M 3VDPA 1VEGA 1YSYA 4OX9M 4I8OA 4PDGA 2DKLA 4QHSA 3ZH9B 4OU7A 2HKJA
chains in the Genus database with same CATH topology
1G41A 1IFYA 2L4FA 4WP2A 2OOAA 3GLFE 2MROB 1HT2E 2BWBA 2DNAA 1WGLA 4DBGB 5JI2E 3E21A 2LBCA 2EKFA 1OQYA 2HAKA 2OOBA 1P3QQ 2WZJA 2JY7A 2DENA 2B3TA 3GLHE 3BBZA 2DAMA 3K9OA 1NV9A 1CUKA 1IM2A 1TTEA 2CWBA 2K9DA 1AIPC 4GEWA 2JUJA 1DO2A 2JP7A 3H4JA 2DAIA 3LCUA 1OKSA 3FRIA 2L4EA 1XXHE 2JZ1A 2MGWA 2K0BX 1C7YA 1WR1B 1GO5A 3GLGE 2R0IA 2L2DA 4G3OA 2G3QA 1XB2B 2DAGA 3K9PA 4UN2B 3T6PA 2KNVA 2ZTCA 2BWEA 1E94E 1MN3A 2QHOB 2KNZA 1WHCA 2QNJA 1VDLA 2JY6B 1VEKA 4Q7JA 2EKKA 3GLIE 4HEOA 1WJ7A 3IHPA 1ZMUA 1VQ1A 1YLAA 1G4AE 2HWJA 2CP8A 2DZLA 1IXSA 2KNAA 1OTRA 1DO0A 1ZV1A 1QZEA 1WGNA 3MMPA 1SG9A 1G3IA 2LVQD 1VG5A 1OAIA 2JNHA 4R71A 2LVPC 3B89A 2JZ0A 1T6OA 1DV0A 1HJPA 3F92A 1NV8A 2LTUA 2DAEA 1Q02A 3LCVB 1HQYE 2KHHA 3E46A 1F4IA 2JY8A 2LVAA 1EFUB 1VEJA 1ZMVA 2QSFX 1V92A 1TFEA 3FE3A 1UFZA 1ZMWA 2LVOC 4F1IA 1T43A 5DFLA 1PGYA 2MJ5B 2RRUA 2DHYA 1TR8A 2O25A 1BVSA 2MR9A 2LVNC 1A5TA 2OO9A 4F2LA 1KYIA 3FRHA 2DAKA 1JR3E 2JY5A 1WIVA 2DI0A 2EJSA 1VEGA 1Y8GA 3IECA 2DKLA 2ZTDA 1R4GA 1HT1E 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G41 A;  1IFY A;  2L4F A;  4WP2 A;  2OOA A;  3GLF E;  2MRO B;  1HT2 E;  2BWB A;  2DNA A;  1WGL A;  4DBG B;  5JI2 E;  3E21 A;  2LBC A;  2EKF A;  1OQY A;  2HAK A;  2OOB A;  1P3Q Q;  2WZJ A;  2JY7 A;  2DEN A;  2B3T A;  3GLH E;  3BBZ A;  2DAM A;  3K9O A;  1NV9 A;  1CUK A;  1IM2 A;  1TTE A;  2CWB A;  2K9D A;  1AIP C;  4GEW A;  2JUJ A;  1DO2 A;  2JP7 A;  3H4J A;  2DAI A;  3LCU A;  1OKS A;  3FRI A;  2L4E A;  1XXH E;  2JZ1 A;  2MGW A;  2K0B X;  1C7Y A;  1WR1 B;  1GO5 A;  3GLG E;  2R0I A;  2L2D A;  4G3O A;  2G3Q A;  1XB2 B;  2DAG A;  3K9P A;  4UN2 B;  3T6P A;  2KNV A;  2ZTC A;  2BWE A;  1E94 E;  1MN3 A;  2QHO B;  2KNZ A;  1WHC A;  2QNJ A;  1VDL A;  2JY6 B;  1VEK A;  4Q7J A;  2EKK A;  3GLI E;  4HEO A;  1WJ7 A;  3IHP A;  1ZMU A;  1VQ1 A;  1YLA A;  1G4A E;  2HWJ A;  2CP8 A;  2DZL A;  1IXS A;  2KNA A;  1OTR A;  1DO0 A;  1ZV1 A;  1QZE A;  1WGN A;  3MMP A;  1SG9 A;  1G3I A;  2LVQ D;  1VG5 A;  1OAI A;  2JNH A;  4R71 A;  2LVP C;  3B89 A;  2JZ0 A;  1T6O A;  1DV0 A;  1HJP A;  3F92 A;  1NV8 A;  2LTU A;  2DAE A;  1Q02 A;  3LCV B;  1HQY E;  2KHH A;  3E46 A;  1F4I A;  2JY8 A;  2LVA A;  1EFU B;  1VEJ A;  1ZMV A;  2QSF X;  1V92 A;  1TFE A;  3FE3 A;  1UFZ A;  1ZMW A;  2LVO C;  4F1I A;  1T43 A;  5DFL A;  1PGY A;  2MJ5 B;  2RRU A;  2DHY A;  1TR8 A;  2O25 A;  1BVS A;  2MR9 A;  2LVN C;  1A5T A;  2OO9 A;  4F2L A;  1KYI A;  3FRH A;  2DAK A;  1JR3 E;  2JY5 A;  1WIV A;  2DI0 A;  2EJS A;  1VEG A;  1Y8G A;  3IEC A;  2DKL A;  2ZTD A;  1R4G A;  1HT1 E;  2H5X A; 
#chains in the Genus database with same CATH topology
 2C99 A;  1IFY A;  4NTN A;  2WSF F;  2OOA A;  4WP2 A;  4W5W A;  1YUB A;  3SYK A;  2LH0 A;  3HU1 A;  3SAT A;  5GKN A;  2RPB A;  1HT2 E;  3JAM S;  5EXT A;  2BWB A;  2DNA A;  1E32 A;  1PJT A;  5JI2 E;  1DGH B;  5FTL A;  3GO8 A;  4L16 A;  4L4U A;  2UXB M;  1OQY A;  3HWS A;  2OOB A;  2DWN A;  3DA1 A;  4G4O A;  1GJS A;  3KVW A;  2DEN A;  1R2Z A;  4XGI A;  2DTT A;  3BBZ A;  3KOW E;  2KZU A;  4FCW A;  4FVM A;  2EA0 A;  3K9O A;  1XNQ M;  3TQS A;  3GQ5 A;  4AKI A;  1NV9 A;  3HHW A;  4AZF A;  4FCT A;  5F3W A;  5KPT A;  4AQY M;  2JWS A;  3C58 A;  1Q3C A;  4XBO A;  1Z5B A;  4FW9 A;  4JI7 M;  2L7I A;  1XNR M;  4FVJ A;  2R45 A;  3B74 A;  3FTF A;  2LNH C;  4NRV A;  1HNZ M;  1IN4 A;  2F5S A;  3H4J A;  3GLH A;  4MB7 A;  3TPZ A;  3UK6 A;  4FCV A;  2MGW A;  2VII A;  2QQ8 A;  4TUW A;  1GO5 A;  1I4W A;  2QP9 X;  3NWL A;  4EIW A;  5C18 A;  4G3O A;  5IT9 S;  4PDI A;  3KS8 A;  1XB2 B;  2DAG A;  3K9P A;  4CHT B;  2BNK A;  2KNV A;  2DVW B;  2J7N A;  2H1R A;  2ZTC A;  3UJN A;  2BWE A;  4PCZ A;  1MN3 A;  2DZO B;  2ZAO A;  5FTN A;  4LFA M;  2QNJ A;  1Q3B A;  3I2B A;  2O5R A;  2CFO A;  2KEB A;  1VEK A;  4YY3 M;  2JXN A;  2LWX A;  3B7Q A;  4PD2 A;  3GLI E;  1I94 M;  3KP1 E;  2VF8 A;  4LGM A;  3IHP A;  1ZMU A;  3C3D A;  1N33 M;  3HKP A;  4LCB A;  1QDT A;  3FUT A;  3UMM A;  3TWK A;  5KO3 A;  1FNN A;  4L6V 6;  1SXJ D;  4DUY M;  2FS1 A;  5KPZ A;  1ZV1 A;  2C9O A;  1PJJ A;  1FJG M;  1NJG A;  1W5T A;  3KP0 E;  2I7N A;  4GHA A;  1SG9 A;  4NC6 A;  2DHR A;  4QOS A;  2J7O A;  1N32 M;  2UXD M;  1G3I A;  4X62 M;  3THG A;  2K6B A;  3U5Z B;  3PNV A;  1J09 A;  1D0M A;  3AOG A;  1LV7 A;  1VG5 A;  4OVZ A;  4DV5 M;  1AUA A;  3I51 A;  3SC3 A;  2Y21 A;  4XK8 F;  4R71 A;  3SAU A;  3B89 A;  1IY0 A;  1DV0 A;  1HJP A;  3F92 A;  1NVM A;  3GQ4 A;  4LJ8 A;  2XFS A;  3TL4 X;  4DR6 M;  1T3T A;  2DAE A;  4B3T M;  4JI2 M;  4AG5 A;  2UXC M;  4IJE A;  4LRS A;  5FTK A;  3E46 A;  1QDR A;  1ZMV A;  1IXZ A;  1GTQ A;  2XSZ D;  3DZD A;  3QWL A;  1IN8 A;  1IBL M;  4KO8 A;  2XEP A;  1NY5 A;  3FE3 A;  4IBF A;  3WHL A;  3OTO M;  1R6B X;  3L27 A;  4JI6 M;  3HU3 A;  5LMU M;  4JI8 M;  3FYD A;  2HL7 A;  1QQW A;  1MU5 A;  4X64 M;  3L25 A;  1IN6 A;  3W67 A;  4GKK M;  4FVG A;  2O25 A;  1BVS A;  2MR9 A;  4ITQ A;  1A5T A;  2OO9 A;  1OFH A;  2L09 A;  3U6C A;  1VDD A;  3KXE C;  4IBD A;  2ZAN A;  4GC5 A;  2QZ4 A;  1EIJ A;  2JY5 A;  3U6L A;  3HJ8 A;  2XZU A;  3HZJ A;  1H6U A;  3QYE A;  5LMN M;  4MM3 B;  3VK7 A;  1Y8G A;  3IEC A;  3J80 S;  4BB9 A;  2KDL A;  1GVN A;  2R65 A;  3MJ5 A;  3ZC7 B;  2H5X A;  7CAT A;  1KFV A;  3M6A A;  4M9S A;  3SAV A;  1N78 A;  3TE6 A;  4AW4 A;  4R3D A;  1JR3 A;  4NOO B;  4RNA A;  2CHV A;  3KSX A;  2OQ4 A;  3U60 B;  2LBC A;  2HAK A;  2F5O A;  4P16 A;  3FUW A;  1OFI A;  5C1B A;  3GPU A;  4B7G A;  2R4E A;  2WZJ A;  2R4J A;  2JY7 A;  4NTM A;  4IIW A;  4OW0 A;  1GJT A;  2WSE F;  1QUT A;  2BJW A;  3K8Z A;  1E9S A;  4GMQ A;  3HX3 A;  4IBJ A;  2FFJ A;  4Y28 F;  3HHX A;  3LZE A;  3QYB A;  1QAM A;  2Z3X A;  4HLQ A;  1SXJ E;  2LHG A;  2VDB B;  3DFZ A;  4GEW A;  2F4V M;  1GAB A;  2DAI A;  1XWI A;  1OKS A;  1Z6T A;  2P5T A;  2L4E A;  4D82 A;  2K0B X;  1D0K A;  1WR1 B;  1QAO A;  3GLF B;  4MGH A;  1V33 A;  1S3S A;  3BOS A;  2L2D A;  3CF6 E;  3DOA A;  3HJS A;  3J7B A;  2G3Q A;  4DR1 M;  3D8B A;  4UN2 B;  3I4Y A;  4IBK A;  2C96 A;  1E94 E;  3LX3 A;  2V1U A;  2KNZ A;  2JY6 B;  4CGY B;  4PT5 A;  2UUB M;  4R7G A;  1J7K A;  2RGH A;  1WIN A;  2KZS A;  1PJS A;  1WJ7 A;  3U61 B;  2VQE M;  4LJ6 A;  5ITQ A;  1VQ1 A;  4M0W A;  1OJL A;  3SBJ A;  5ITU A;  3I01 M;  1IXS A;  2DZL A;  3AKZ A;  1OTR A;  1WGN A;  3QAU A;  4NTK A;  1Z59 A;  3GLI A;  1NHG C;  1NO1 A;  2E5L M;  1XC8 A;  5IZ7 D;  1HNX M;  2LVQ D;  2QBY A;  3SMS A;  2DJ6 A;  2LHC A;  3T38 A;  2JNH A;  1TDH A;  1GL6 A;  4LJ4 A;  2LVP C;  4LJ5 A;  4AG6 A;  3QN0 A;  2JZ0 A;  3QNA A;  1HQC A;  3GLG B;  1G8P A;  5EQT A;  2GQF A;  3U6P A;  1B6Z A;  3K92 A;  1L8Q A;  1Q02 A;  3EIH A;  5KQ8 A;  1N34 M;  1K82 A;  3EIE A;  3LCV B;  1XXH A;  1HQY E;  3KDS E;  3FTE A;  3J2P B;  1F4I A;  2RGO A;  4K0K M;  4LZJ A;  1EFU B;  1VEJ A;  2QCU A;  4KHP M;  1JB0 F;  2L7H A;  4AI6 A;  3KSJ A;  1N36 M;  2UU9 M;  2DWM A;  1Z5A A;  1ZMW A;  1NHW C;  3PNY A;  1R7R A;  2QPA A;  3RGS A;  2R18 A;  1T43 A;  4F1I A;  5ITR A;  2VF7 A;  1PGY A;  2MJ5 B;  3I04 M;  2XLJ A;  2DHY A;  4G4Q A;  2XH9 A;  1TF0 B;  2A5Y B;  2RKO A;  3T1Y M;  3TWM A;  1SXJ B;  4F2L A;  4JV5 M;  2YQZ A;  3PFI A;  1K3X A;  3SAS A;  4CJ6 A;  3A46 A;  2C98 A;  4JI5 M;  3W0F A;  2GNO A;  1JR3 D;  2R44 A;  3FKE A;  3V76 A;  1TGU A;  4NSR A;  4G4R A;  1NNU C;  1IXR C;  1DGH A;  3KS4 A;  1HNW M;  4KLN A;  4KOD A;  3E9S A;  5DNY A;  2DZN B;  1LTM A;  1WIV A;  4I4L A;  2DI0 A;  2EJS A;  3MK6 A;  1B66 A;  1EE8 A;  3K2L A;  1PRB A;  3ILK A;  3MHV C;  4FVF A;  2CRU A;  4REZ A;  4L78 A;  4JI4 M;  4FWG A;  1R5L A;  2L4F A;  3HGI A;  3GLF E;  1Y13 A;  4DV2 M;  2CV0 A;  4YHH M;  3GRV A;  4LF8 M;  4DBG B;  1WGL A;  1L2C A;  2UUC M;  5EP1 A;  2XZF A;  2ERC A;  2N35 A;  5DYG A;  4IBG A;  1PJQ A;  4DV7 M;  3SAW A;  1G71 A;  4QOZ C;  3TWL A;  3RFW A;  3R8F A;  1L1Z A;  2B3T A;  4JN6 A;  4B7F A;  3JR5 A;  5KQD A;  4MGY E;  3FD9 A;  4IBB A;  3LQQ A;  3L28 A;  4WW0 A;  1QVR A;  1QUS A;  2Z8Y M;  3GRR A;  2W82 A;  1J5E M;  1TH2 A;  2KRU A;  4QHT A;  4LGY A;  1QZM A;  3CF0 A;  2MH8 A;  2Z4R A;  4AKH A;  1AIP C;  3U6M A;  2CV1 A;  3IG5 A;  2JUJ A;  1DO2 A;  2KRK A;  4ZPX A;  4B08 A;  3LCU A;  3U6Q A;  3NBI A;  2OPF A;  3FRI A;  5EP4 A;  1MX0 A;  2D7E A;  2ZBK B;  3AV0 A;  1QAN A;  3HJQ A;  1C7Y A;  2F5P A;  1JQJ C;  3GLG E;  1NY6 A;  3FUU A;  3J81 S;  3BK6 A;  2X8A A;  5ITX E;  3KFU G;  1KSF X;  3L29 A;  3T6P A;  3U5Z A;  4Z8X A;  3WHK A;  2M60 A;  3Q8X A;  1WHC A;  4IBI A;  3Q8G A;  4QNM A;  1W5S A;  1PJI A;  5BPV A;  2EKK A;  1D0L A;  5A2Q S;  4LF9 M;  4BBA A;  2FE8 A;  4MGI E;  2G64 A;  4KT0 F;  3B7N A;  4B3S M;  3GLH B;  2BJV A;  1YLA A;  4B7H A;  2HWJ A;  3RE8 A;  2DWL A;  3SAR A;  2KNA A;  4DR4 M;  1DO0 A;  2V6Z M;  5EXP A;  1C1K A;  4I81 A;  3AOE A;  3KOY E;  3L2A A;  3MMP A;  2YNM D;  2YR0 A;  4DV3 M;  4JI0 M;  3VKH A;  4JXJ A;  3R9X B;  2Q2E B;  2Y20 A;  4A3V B;  3NBX X;  1IY1 A;  3H4M A;  1DGB A;  3KW6 A;  4FWD A;  2X49 A;  1NSF A;  3M7G A;  4LF5 M;  2R62 A;  2DWZ B;  4LRT A;  2M5Z A;  4DV1 M;  3CTW B;  2L6O A;  1NV8 A;  4I5S A;  2NQ8 C;  2LTU A;  4GRI A;  3ZQJ A;  3GRU A;  5H37 D;  2R46 A;  3M0E A;  2KHH A;  2K47 A;  2LVA A;  4LY6 A;  3JYG A;  5JI3 E;  4LF6 M;  3U6S A;  4HL4 A;  2CE7 A;  3PXG A;  3W68 A;  4L8R C;  3KOX E;  4D81 A;  5DYI A;  3FUV A;  1XMO M;  4G6Z A;  2LVO C;  1UFZ A;  2XF3 A;  4MGK E;  4OVZ B;  3UZU A;  4BLC A;  3GPP A;  3SHG B;  4DV6 M;  3BXW A;  3HHY A;  2G8L A;  3GRY A;  1QAQ A;  4DR2 M;  1PM5 A;  2F5N A;  3B9P A;  1TR8 A;  4LJA A;  5L8R F;  3UGJ A;  3M0N A;  4RF1 A;  2LVN C;  2ZM6 M;  3PVS A;  4IJF A;  5EP3 A;  3AFH A;  3VKG A;  2HHH M;  5E6J A;  1IQP A;  1N77 A;  1KYI A;  1L1T A;  4LF7 M;  3AL0 C;  2OBA A;  3A98 B;  3VLF B;  5E26 A;  4GIP A;  2XFT A;  3U60 A;  2CV2 A;  1K3W A;  4GKJ M;  1ORY B;  3HU2 A;  4X66 M;  4LFC M;  2XGN A;  3E4R A;  1HR0 M;  1ZQ9 A;  2ZTD A;  5BR8 M;  1R4G A;  1HT1 E;  2J5Y A;  4FD2 A;  3J7A S;  1G41 A;  3ZCB B;  4M9X A;  4RKU F;  1TH3 A;  2R6F A;  1IBM M;  2MRO B;  2X4A A;  1QYR A;  5ITY A;  3QN9 A;  1D2N A;  2Y0Q A;  2KA6 B;  3RGP A;  4DV0 M;  3E21 A;  2LXE A;  4DUZ M;  4DV4 M;  2EKF A;  3U6D A;  2APL A;  1UM8 A;  4AKG A;  3U6O A;  3GLF A;  4QNR A;  1P3Q Q;  1Q39 A;  2Y0T A;  3KOZ E;  3T15 A;  4GC9 A;  3GLH E;  4LF4 M;  2DAM A;  3U6E A;  1GL7 A;  1IBK M;  4S12 A;  4X65 M;  5FLX S;  4LJ7 A;  4MH0 E;  1CUK A;  3FUX A;  4RF0 A;  8CAT A;  4DR7 M;  3FYC A;  4LZZ A;  4NXN M;  1IM2 A;  1TTE A;  1ZAE A;  2CWB A;  4M9Z A;  4NL4 H;  2K9D A;  1DGF A;  2C5R A;  1L2D A;  3HHZ A;  1WXQ A;  4L15 A;  1IN5 A;  3U61 A;  2JP7 A;  1XMQ M;  1MJG M;  3A45 A;  1NNJ A;  3C3E A;  3LQR A;  3C9P A;  4NSO B;  1XXH E;  2JZ1 A;  2UUA M;  3D7J A;  3L26 A;  5ITT A;  1TH4 A;  3D8L A;  4LJ9 A;  5FSW A;  5KPR A;  4GH9 A;  2R0I A;  3GQ3 A;  3A42 A;  3AJI B;  1GLN A;  2QHO B;  2VQF M;  5EXX A;  4G4N A;  1VDL A;  3FTD A;  3SMP A;  2FNA A;  3W0L B;  4GHL A;  4Q7J A;  2C9C A;  2FOI C;  4P17 A;  2QEN A;  3LMM A;  1TDZ A;  4HEO A;  2CHG A;  5IRE B;  1N75 A;  3GLG A;  1YE9 A;  5ITX A;  3LVV A;  3J27 B;  2FH0 A;  1G4A E;  2V1C A;  2F5Q A;  2CP8 A;  4GIT A;  1IY2 A;  2G5G X;  5FTM A;  3GPX A;  1QZE A;  3T1H M;  1DGG A;  3HY5 A;  4LFB M;  3LW5 F;  4FWH A;  4WUR A;  3I4V A;  5IWA M;  4B3R M;  4IBC A;  3B7Z A;  3VFD A;  2Z4S A;  4CIZ A;  1OAI A;  3JR4 A;  2O01 F;  3K1J A;  2HCB A;  2KXE A;  1T6O A;  1GKI A;  2EO2 A;  4MGZ E;  3VDU A;  1R2Y A;  4ANR A;  1Z5C A;  2WSC F;  1SXJ A;  4B3M M;  2CUZ A;  2Z7J A;  4DR5 M;  1IXS B;  2JA2 A;  1V34 A;  2JY8 A;  5EXS A;  4NRW A;  4NXM M;  3IG8 A;  1SXJ C;  2YFQ A;  1OAO C;  2QSF X;  2ZAM A;  1L2B A;  1V92 A;  3GLI B;  1TFE A;  2AHM A;  2QBY B;  3FTC A;  1NJF A;  5FTJ A;  4LG2 A;  2A0S A;  2KW0 A;  1E9R A;  5DFL A;  1X37 A;  3VK8 A;  4II7 A;  3CF2 A;  1IN7 A;  3GP1 A;  2CHQ A;  1OIZ A;  1RU3 A;  2RRU A;  4JI1 M;  4D80 A;  2EUC A;  4IBE A;  3SFZ A;  2DXI A;  2CEA A;  3SHF A;  3SYL A;  3GPY A;  1G59 A;  4CIS A;  5EP2 A;  4JI3 M;  3AOE C;  3LVW A;  3FRH A;  4M0D A;  1OIP A;  1XXH B;  2XSZ A;  2D7G A;  1XHB A;  2DAK A;  5EJC A;  4JYA M;  2D7H A;  4Z6Y A;  3CGW A;  1JR3 E;  2I7P A;  4DR3 M;  3VDP A;  1VEG A;  1YSY A;  4OX9 M;  4I8O A;  4PDG A;  2DKL A;  4QHS A;  3ZH9 B;  4OU7 A;  2HKJ A; 
#chains in the Genus database with same CATH homology
 1G41 A;  1IFY A;  2L4F A;  4WP2 A;  2OOA A;  3GLF E;  2MRO B;  1HT2 E;  2BWB A;  2DNA A;  1WGL A;  4DBG B;  5JI2 E;  3E21 A;  2LBC A;  2EKF A;  1OQY A;  2HAK A;  2OOB A;  1P3Q Q;  2WZJ A;  2JY7 A;  2DEN A;  2B3T A;  3GLH E;  3BBZ A;  2DAM A;  3K9O A;  1NV9 A;  1CUK A;  1IM2 A;  1TTE A;  2CWB A;  2K9D A;  1AIP C;  4GEW A;  2JUJ A;  1DO2 A;  2JP7 A;  3H4J A;  2DAI A;  3LCU A;  1OKS A;  3FRI A;  2L4E A;  1XXH E;  2JZ1 A;  2MGW A;  2K0B X;  1C7Y A;  1WR1 B;  1GO5 A;  3GLG E;  2R0I A;  2L2D A;  4G3O A;  2G3Q A;  1XB2 B;  2DAG A;  3K9P A;  4UN2 B;  3T6P A;  2KNV A;  2ZTC A;  2BWE A;  1E94 E;  1MN3 A;  2QHO B;  2KNZ A;  1WHC A;  2QNJ A;  1VDL A;  2JY6 B;  1VEK A;  4Q7J A;  2EKK A;  3GLI E;  4HEO A;  1WJ7 A;  3IHP A;  1ZMU A;  1VQ1 A;  1YLA A;  1G4A E;  2HWJ A;  2CP8 A;  2DZL A;  1IXS A;  2KNA A;  1OTR A;  1DO0 A;  1ZV1 A;  1QZE A;  1WGN A;  3MMP A;  1SG9 A;  1G3I A;  2LVQ D;  1VG5 A;  1OAI A;  2JNH A;  4R71 A;  2LVP C;  3B89 A;  2JZ0 A;  1T6O A;  1DV0 A;  1HJP A;  3F92 A;  1NV8 A;  2LTU A;  2DAE A;  1Q02 A;  3LCV B;  1HQY E;  2KHH A;  3E46 A;  1F4I A;  2JY8 A;  2LVA A;  1EFU B;  1VEJ A;  1ZMV A;  2QSF X;  1V92 A;  1TFE A;  3FE3 A;  1UFZ A;  1ZMW A;  2LVO C;  4F1I A;  1T43 A;  5DFL A;  1PGY A;  2MJ5 B;  2RRU A;  2DHY A;  1TR8 A;  2O25 A;  1BVS A;  2MR9 A;  2LVN C;  1A5T A;  2OO9 A;  4F2L A;  1KYI A;  3FRH A;  2DAK A;  1JR3 E;  2JY5 A;  1WIV A;  2DI0 A;  2EJS A;  1VEG A;  1Y8G A;  3IEC A;  2DKL A;  2ZTD A;  1R4G A;  1HT1 E;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...