1XB2B

Crystal structure of bos taurus mitochondrial elongation factor tu/ts complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
276
Chain Sequence
SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRKTKEGLIGLLQEGDTTVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQNLKDQLSTYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAAWVKVPAGFYVGSYVHGAMHSPSLHNLVLGKYGALVICETSELKANLADLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPHGVSVVDFVRFECGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor Tu, mitochondrial
publication title Crystal Structure of the Bovine Mitochondrial Elongation Factor Tu.Ts Complex
pubmed doi rcsb
source organism Bos taurus
molecule tags Translation
total genus 83
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1xb2B01
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B03
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1xb2B02
2BWBA 1DO2A 1HT1E 2B3TA 2DHYA 1XB2B 2OOBA 2KNAA 1OKSA 1XXHE 1G3IA 1WGNA 2H5XA 2LTUA 1TFEA 2KNZA 2DAEA 1IXSA 3H4JA 1HJPA 1F4IA 5JI2E 1CUKA 3F92A 4F1IA 1G41A 3BBZA 2QNJA 1VEJA 2DAGA 2JY7A 2L2DA 2KNVA 1T6OA 2JY6B 2QSFX 4DBGB 2JUJA 3IHPA 1BVSA 2MJ5B 3LCVB 2JZ1A 2K0BX 2ZTCA 4F2LA 3K9PA 1TTEA 1C7YA 1VG5A 2O25A 3GLFE 1NV9A 1VDLA 2CP8A 2DKLA 3MMPA 1IM2A 1P3QQ 1ZMUA 1JR3E 1Y8GA 2WZJA 3GLGE 3GLHE 2JP7A 1YLAA 2LVPC 2R0IA 5DFLA 1WR1B 1NV8A 2LVAA 2L4EA 1HQYE 3E21A 1DO0A 4G3OA 4HEOA 2DZLA 4WP2A 1OAIA 2LBCA 1WHCA 2JNHA 2OOAA 2JY8A 2JY5A 1E94E 2HAKA 2MROB 2MR9A 3LCUA 2KHHA 3K9OA 2HWJA 1V92A 2LVQD 1TR8A 2K9DA 2DAIA 2JZ0A 1UFZA 2CWBA 2DNAA 3T6PA 1VEGA 2RRUA 1OQYA 1WGLA 2QHOB 2OO9A 4Q7JA 2LVNC 2EKFA 2EKKA 1WIVA 2G3QA 2DI0A 1WJ7A 1ZV1A 2DENA 1DV0A 1HT2E 3E46A 3GLIE 2L4FA 1Q02A 1OTRA 1KYIA 1PGYA 1T43A 4UN2B 3FRIA 1AIPC 2BWEA 1A5TA 2ZTDA 4R71A 1G4AE 1VEKA 1SG9A 1MN3A 1ZMVA 2MGWA 3FRHA 2LVOC 1R4GA 3B89A 1GO5A 2DAKA 1QZEA 1IFYA 1EFUB 1VQ1A 4GEWA 1ZMWA 2DAMA 3FE3A 2EJSA 3IECA
chains in the Genus database with same CATH superfamily
4NTKA 4DR2M 1HNZM 1IY2A 1DO2A 4ANRA 2R62A 3LX3A 2B3TA 3E9SA 1GKIA 1FNNA 2KXEA 5EJCA 1H6UA 2UXBM 1DGBA 4QNMA 1D0MA 1WGNA 2FNAA 4DV0M 5IT9S 2XEPA 3KOYE 4PT5A 1XNRM 1B6ZA 1J09A 3JYGA 1TFEA 4YY3M 3U6EA 4DV4M 1Z5CA 3H4JA 1HJPA 3I4YA 1IY1A 3AOEC 3F92A 4G4QA 3BOSA 3M6AA 4KT0F 4JI0M 3SBJA 3VKGA 4FVFA 2KDLA 4LFBM 1Z5BA 2Z7JA 4DR3M 1VEJA 2DAGA 2JY7A 2L2DA 2Y21A 3I01M 3K2LA 4PD2A 4B3MM 3IHPA 4IBJA 4LFAM 1L1ZA 3QN0A 5EP4A 4MM3B 4JYAM 1ZAEA 2ZTCA 3LCVB 1ZQ9A 3U61B 3I04M 3PFIA 4OU7A 3CF0A 4TUWA 2KZUA 3TPZA 2A0SA 1VDLA 1GL7A 2K47A 1QDRA 1SXJB 2CV2A 1JR3E 1GABA 5ITXA 3J27B 1GLNA 4GC5A 4JV5M 2JP7A 5A2QS 1K82A 4G4NA 1WR1B 2LNHC 4KHPM 3E21A 5ITYA 3GLFA 3R9XB 4BBAA 2RPBA 5FTMA 3HHWA 4GKJM 1DO0A 1WINA 1DGFA 1QDTA 1OIZA 4A3VB 2DZLA 1JR3D 4X62M 4IIWA 2LBCA 4NRVA 3L26A 4AI6A 1J5EM 2JNHA 1TH3A 3D8BA 2C9CA 1IY0A 3FYDA 3HX3A 4GITA 5C1BA 3SAWA 5F3WA 1N36M 2HAKA 2F5OA 3AOEA 3JAMS 4JI3M 3OTOM 3BXWA 3EIHA 3HZJA 3GPUA 3FD9A 1E9RA 1QAMA 5FSWA 4L8RC 4CGYB 4REZA 1NJGA 4IBDA 2CWBA 2FS1A 1RU3A 3A45A 3FTDA 2HL7A 3B7ZA 3T6PA 1N32M 4FD2A 1OIPA 4B7GA 3KDSE 4Q7JA 1IBMM 2XFTA 2LVNC 1XWIA 2H1RA 2Y0QA 5H37D 1IN7A 3MK6A 1HNXM 2D7GA 2EKKA 3LW5F 3U6MA 3SAVA 2DI0A 3U6LA 3GLGA 1I94M 5EXPA 3GLHA 3M0EA 2DZNB 4LJ4A 3QNAA 3AL0C 2FOIC 2CV1A 1TH4A 4IBCA 3FKEA 4UN2B 3GP1A 3V76A 3ILKA 1NSFA 3AJIB 2ZAOA 4QOSA 4G4OA 1PJIA 3I4VA 4FCVA 3HHZA 1XHBA 4HL4A 3L2AA 3GLFB 4PCZA 4DV3M 4LF8M 1WXQA 2WSEF 2A5YB 1G4AE 1VEKA 1DGGA 1SG9A 3CTWB 3QWLA 2G64A 3I2BA 1Q39A 3HJ8A 3U5ZA 1ZMVA 3FUWA 1R4GA 1NHGC 4P16A 5IREB 3VK7A 3GQ3A 1IN4A 4S12A 1IFYA 1JQJC 1EFUB 3J2PB 3W68A 4GEWA 4LF6M 2EJSA 3CGWA 1YSYA 5ITXE 1GJSA 3U60A 1OFIA 1OFHA 3KP1E 3L27A 2DVWB 4DR4M 3UGJA 4WW0A 1QANA 3IG8A 1N34M 2OOBA 4JI7M 3TWMA 4JI8M 4DUZM 3GO8A 4LFCM 2G8LA 2YQZA 2ZBKB 3SASA 2C9OA 5ITRA 1TGUA 3VDUA 2DAEA 4OX9M 1D2NA 3SFZA 3FTEA 1IXSA 4D81A 1NNUC 4RNAA 3Q8XA 3B7QA 3SMSA 1CUKA 4NSOB 3SYLA 1W5SA 2CV0A 3GLGB 2JA2A 5FTNA 3GLHB 2Z4RA 2FE8A 1XXHA 4X66M 2R6FA 2ZAMA 4JN6A 1C1KA 2APLA 4B08A 4GC9A 5JI3E 2KNVA 2K6BA 1QUSA 2JY6B 2QSFX 4Z6YA 1XMQM 3VKHA 2JUJA 2LWXA 5EXXA 3KOWE 1HQCA 1FJGM 3W0LB 2KW0A 3SMPA 1BVSA 2JZ1A 2KRUA 5LMUM 2BJWA 3U5ZB 1IXZA 2X4AA 4AG6A 5KO3A 1R6BX 3E4RA 2DZOB 2CHGA 2DKLA 2CHQA 5EXTA 4NTMA 3T1YM 1P3QQ 1HR0M 4MGKE 3GRYA 1Y8GA 1PJJA 4G6ZA 3GLGE 4W5WA 3GLHE 2GQFA 3HJSA 4LY6A 4ITQA 3U60B 1JB0F 1YLAA 2LVPC 2R0IA 4JI1M 1QAOA 2KA6B 4XBOA 2LVAA 2L4EA 1V34A 1TF0B 2YR0A 4MGZE 3WHKA 4CJ6A 7CATA 4GRIA 2MH8A 4Y28F 2YFQA 4OW0A 4LF4M 4D80A 3HWSA 4WP2A 2W82A 4XGIA 3TWLA 1GJTA 3UK6A 1IXSB 2C96A 3ZH9B 2MR9A 3SATA 3UJNA 5GKNA 2P5TA 3RE8A 2HWJA 4FVMA 3IG5A 2LVQD 4OVZA 1XXHB 2K9DA 1NNJA 4L15A 3RFWA 2XZUA 2EA0A 1D0LA 2O01F 2DNAA 2KEBA 1N75A 1Q3BA 1VEGA 4X65M 3JR4A 4HLQA 3HHYA 2KRKA 4YHHM 1QUTA 2RKOA 2WSFF 3LQQA 3KOXE 5EP2A 3SHGB 3UMMA 3C58A 2R45A 4GHLA 2E5LM 3FUXA 4M9ZA 4AW4A 2GNOA 2CUZA 4IBEA 1WJ7A 3K92A 3RGSA 1NVMA 4AZFA 1DV0A 1HT2E 2L4FA 2F5QA 1KYIA 1PGYA 1T43A 4ZPXA 1KSFX 2OBAA 5IWAM 4L6V6 2D7HA 1SXJE 4JI6M 2BWEA 2BJVA 4LRSA 1YE9A 3SAUA 1PJQA 2XSZA 1XC8A 1R2YA 3GQ5A 2J5YA 4K0KM 3FRHA 2F4VM 1GO5A 4LGMA 3L29A 4MGYE 1K3XA 4NXNM 1GTQA 1QZEA 1SXJD 1YUBA 4B7HA 4NXMM 4AG5A 2DWZB 4B3TM 2ZM6M 2DAMA 2LXEA 1NY6A 2LH0A 2X49A 4KLNA 4OVZB 2M60A 4DV5M 1L2CA 4NTNA 2BWBA 3DFZA 3J7BA 1GVNA 3K8ZA 4WURA 3ZQJA 2L09A 2NQ8C 2L7IA 3KVWA 4QHSA 3TWKA 1X37A 1QQWA 2DHYA 3PXGA 3U6QA 2DWNA 4JXJA 3U6CA 1OKSA 3AFHA 2H5XA 3LVWA 1T3TA 4LJ7A 3A98B 2LTUA 3AKZA 2R18A 1NJFA 1IXRC 3HY5A 3MHVC 4LG2A 3GRRA 5E6JA 3D7JA 4AKIA 4MGHA 3U6DA 4F1IA 1N33M 4P17A 5DNYA 2X8AA 4KODA 3B7NA 4B7FA 2QNJA 3M7GA 5FTJA 4DBGB 1T6OA 4DR5M 1G59A 5EQTA 3RGPA 4L16A 2V6ZM 2R44A 2L6OA 2O5RA 3K1JA 3LMMA 2JXNA 3HU1A 3NBIA 2FH0A 4IJEA 2XFSA 3KXEC 3VFDA 3KS4A 1Q3CA 3K9PA 1C7YA 1QYRA 3DA1A 3GLIB 1J7KA 3GLFE 2C99A 4G4RA 2I7NA 1NV9A 2UUBM 2CP8A 3ZCBB 2DHRA 2VIIA 1UM8A 3DZDA 3MMPA 4R3DA 1QZMA 4M0DA 4XK8F 2WZJA 1MX0A 1TDHA 3QAUA 1IBLM 3U6SA 3L25A 4L4UA 1NV8A 1HQYE 1IN8A 5EXSA 2QQ8A 4D82A 4HEOA 2QPAA 3NBXX 4QHTA 3NWLA 5KPZA 2Y0TA 3QYEA 4LF9M 1JR3A 1B66A 4PDGA 1MU5A 2Y20A 4QNRA 5L8RF 2VQEM 3LCUA 2JY5A 3HHXA 2KHHA 3HKPA 2HCBA 3HGIA 1V92A 4LRTA 3B74A 1TR8A 3C3DA 2QBYA 2Z8YM 3DOAA 3A46A 4MB7A 3FYCA 1S3SA 2QZ4A 1UFZA 3C9PA 3TE6A 1L1TA 3UZUA 2VF7A 5ITQA 3LZEA 2RRUA 1R5LA 1OQYA 1WGLA 2XLJA 2EO2A 1G8PA 2QHOB 4GMQA 2F5SA 1IN6A 1TH2A 2OO9A 5DYIA 3SARA 8CATA 2LHGA 3GPPA 2EKFA 1K3WA 4CISA 4GH9A 4NC6A 5EP3A 4LJ8A 1Z59A 3FUUA 3HU3A 3M0NA 4M9XA 1I4WA 3ZC7B 5C18A 3H4MA 3KW6A 1R7RA 4DR1M 3FUVA 2DENA 1Y13A 3E46A 4B3SM 1VDDA 2G5GX 1OTRA 1Z5AA 4I5SA 5IZ7D 3TQSA 1XMOM 5KQDA 1D0KA 2CRUA 3MJ5A 2ZTDA 3I51A 3GQ4A 4M0WA 4LF7M 3FTCA 4GIPA 2MGWA 3R8FA 2LVOC 3B89A 4PDIA 2DAKA 3SC3A 2F5NA 3FUTA 5E26A 3QN9A 3J81S 4DV2M 1VQ1A 2CEAA 2UXCM 4BB9A 1ZMWA 1F4IA 4RKUF 3FE3A 3A42A 4L78A 2F5PA 2QBYB 3AV0A 4FWGA 3T15A 4DR7M 4AKHA 2R4EA 4II7A 1ORYB 1HT1E 5EP1A 4NRWA 1N77A 5LMNM 4FCWA 4FVGA 1XB2B 4I8OA 2KNAA 4I81A 2N35A 5KPTA 2HHHM 1XXHE 1G3IA 5ITTA 3KSXA 4FWHA 3KOZE 4R7GA 4AKGA 1AUAA 2KZSA 4KO8A 2C98A 4CHTB 2KNZA 3VLFB 1GL6A 4X64M 4DUYM 3C3EA 2FFJA 2QP9X 2CE7A 3SHFA 2J7NA 3VDPA 3W67A 5BR8M 4MGIE 5JI2E 3GPYA 4LCBA 3T38A 1W5TA 1L2BA 4DR6M 3D8LA 4GKKM 3Q8GA 2BNKA 3GLIA 1G41A 3BBZA 4IBFA 2DTTA 1Z6TA 2R65A 3B9PA 2V1CA 4I4LA 4LJ9A 2XGNA 4B3RM 3QYBA 4IBKA 3HU2A 4JI4M 4JI5M 3KS8A 4BLCA 4NL4H 2DJ6A 2R46A 2DWLA 2D7EA 2MJ5B 2K0BX 4F2LA 3BK6A 2ERCA 3GRUA 1IN5A 1TTEA 1L8QA 1VG5A 2VF8A 4LJ5A 4CIZA 4LJ6A 4DV6M 2UU9M 1QVRA 1IM2A 2HKJA 3GRVA 4FCTA 1ZMUA 2OPFA 4NSRA 1QAQA 1E32A 1R2ZA 3PVSA 4IBIA 5DFLA 1IQPA 5BPVA 1DGHA 5FTKA 2Z4SA 4DV7M 5DYGA 2C5RA 4RF0A 2V1UA 2L7HA 2Q2EB 4G3OA 1N78A 2WSCF 2I7PA 2LHCA 4EIWA 4IBGA 1NHWC 1OAIA 1WHCA 4DV1M 1G71A 5FTLA 3SYKA 2OOAA 4LGYA 1LV7A 2JY8A 1E94E 2CFOA 2MROB 4FWDA 4GHAA 3K9OA 3J80S 3VK8A 2XH9A 1SXJC 5KPRA 1EIJA 3LVVA 4RF1A 3L28A 3JR5A 2OQ4A 2DAIA 3CF2A 2XZFA 1MJGM 2JZ0A 3LQRA 4M9SA 3U6OA 3TL4X 4QOZC 1PRBA 4LF5M 1TDZA 5FLXS 3HJQA 4LZJA 3KFUG 1E9SA 3THGA 2VQFM 3EIEA 3KSJA 2CHVA 2YNMD 1NO1A 3AOGA 3WHLA 1HNWM 3PNVA 2UUCM 4FW9A 1XNQM 1LTMA 1WIVA 4Z8XA 3U6PA 2G3QA 3KP0E 4FVJA 2QENA 4LJAA 1ZV1A 3GLIE 4IBBA 3T1HM 1Q02A 2R4JA 1PJTA 5KQ8A 4IJFA 3FRIA 1DGHB 1AIPC 1L2DA 4AQYM 3FTFA 2XF3A 2J7OA 4JI2M 1V33A 1A5TA 4R71A 2UUAM 2EUCA 1PM5A 2XSZD 1IBKM 2DXIA 3GPXA 2RGOA 2ZANA 2RGHA 2UXDM 4NOOB 1MN3A 3U61A 1EE8A 1PJSA 2M5ZA 2VDBB 2DWMA 4MH0E 1OJLA 3J7AS 5ITUA 2AHMA 3PNYA 1NY5A 1OAOC 2JWSA 1SXJA 2QCUA 1KFVA 4LZZA 3CF6E 3W0FA 2O25A 2Z3XA 3IECA
chains in the Genus database with same CATH topology
2BWBA 1DO2A 1HT1E 2B3TA 2DHYA 1XB2B 2OOBA 2KNAA 1OKSA 1XXHE 1G3IA 1WGNA 2H5XA 2LTUA 1TFEA 2KNZA 2DAEA 1IXSA 3H4JA 1HJPA 1F4IA 5JI2E 1CUKA 3F92A 4F1IA 1G41A 3BBZA 2QNJA 1VEJA 2DAGA 2JY7A 2L2DA 2KNVA 1T6OA 2JY6B 2QSFX 4DBGB 2JUJA 3IHPA 1BVSA 2MJ5B 3LCVB 2JZ1A 2K0BX 2ZTCA 4F2LA 3K9PA 1TTEA 1C7YA 1VG5A 2O25A 3GLFE 1NV9A 1VDLA 2CP8A 2DKLA 3MMPA 1IM2A 1P3QQ 1ZMUA 1JR3E 1Y8GA 2WZJA 3GLGE 3GLHE 2JP7A 1YLAA 2LVPC 2R0IA 5DFLA 1WR1B 1NV8A 2LVAA 2L4EA 1HQYE 3E21A 1DO0A 4G3OA 4HEOA 2DZLA 4WP2A 1OAIA 2LBCA 1WHCA 2JNHA 2OOAA 2JY8A 2JY5A 1E94E 2HAKA 2MROB 2MR9A 3LCUA 2KHHA 3K9OA 2HWJA 1V92A 2LVQD 1TR8A 2K9DA 2DAIA 2JZ0A 1UFZA 2CWBA 2DNAA 3T6PA 1VEGA 2RRUA 1OQYA 1WGLA 2QHOB 2OO9A 4Q7JA 2LVNC 2EKFA 2EKKA 1WIVA 2G3QA 2DI0A 1WJ7A 1ZV1A 2DENA 1DV0A 1HT2E 3E46A 3GLIE 2L4FA 1Q02A 1OTRA 1KYIA 1PGYA 1T43A 4UN2B 3FRIA 1AIPC 2BWEA 1A5TA 2ZTDA 4R71A 1G4AE 1VEKA 1SG9A 1MN3A 1ZMVA 2MGWA 3FRHA 2LVOC 1R4GA 3B89A 1GO5A 2DAKA 1QZEA 1IFYA 1EFUB 1VQ1A 4GEWA 1ZMWA 2DAMA 3FE3A 2EJSA 3IECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWB A;  1DO2 A;  1HT1 E;  2B3T A;  2DHY A;  1XB2 B;  2OOB A;  2KNA A;  1OKS A;  1XXH E;  1G3I A;  1WGN A;  2H5X A;  2LTU A;  1TFE A;  2KNZ A;  2DAE A;  1IXS A;  3H4J A;  1HJP A;  1F4I A;  5JI2 E;  1CUK A;  3F92 A;  4F1I A;  1G41 A;  3BBZ A;  2QNJ A;  1VEJ A;  2DAG A;  2JY7 A;  2L2D A;  2KNV A;  1T6O A;  2JY6 B;  2QSF X;  4DBG B;  2JUJ A;  3IHP A;  1BVS A;  2MJ5 B;  3LCV B;  2JZ1 A;  2K0B X;  2ZTC A;  4F2L A;  3K9P A;  1TTE A;  1C7Y A;  1VG5 A;  2O25 A;  3GLF E;  1NV9 A;  1VDL A;  2CP8 A;  2DKL A;  3MMP A;  1IM2 A;  1P3Q Q;  1ZMU A;  1JR3 E;  1Y8G A;  2WZJ A;  3GLG E;  3GLH E;  2JP7 A;  1YLA A;  2LVP C;  2R0I A;  5DFL A;  1WR1 B;  1NV8 A;  2LVA A;  2L4E A;  1HQY E;  3E21 A;  1DO0 A;  4G3O A;  4HEO A;  2DZL A;  4WP2 A;  1OAI A;  2LBC A;  1WHC A;  2JNH A;  2OOA A;  2JY8 A;  2JY5 A;  1E94 E;  2HAK A;  2MRO B;  2MR9 A;  3LCU A;  2KHH A;  3K9O A;  2HWJ A;  1V92 A;  2LVQ D;  1TR8 A;  2K9D A;  2DAI A;  2JZ0 A;  1UFZ A;  2CWB A;  2DNA A;  3T6P A;  1VEG A;  2RRU A;  1OQY A;  1WGL A;  2QHO B;  2OO9 A;  4Q7J A;  2LVN C;  2EKF A;  2EKK A;  1WIV A;  2G3Q A;  2DI0 A;  1WJ7 A;  1ZV1 A;  2DEN A;  1DV0 A;  1HT2 E;  3E46 A;  3GLI E;  2L4F A;  1Q02 A;  1OTR A;  1KYI A;  1PGY A;  1T43 A;  4UN2 B;  3FRI A;  1AIP C;  2BWE A;  1A5T A;  2ZTD A;  4R71 A;  1G4A E;  1VEK A;  1SG9 A;  1MN3 A;  1ZMV A;  2MGW A;  3FRH A;  2LVO C;  1R4G A;  3B89 A;  1GO5 A;  2DAK A;  1QZE A;  1IFY A;  1EFU B;  1VQ1 A;  4GEW A;  1ZMW A;  2DAM A;  3FE3 A;  2EJS A;  3IEC A; 
#chains in the Genus database with same CATH topology
 4NTK A;  4DR2 M;  1HNZ M;  1IY2 A;  1DO2 A;  4ANR A;  2R62 A;  3LX3 A;  2B3T A;  3E9S A;  1GKI A;  1FNN A;  2KXE A;  5EJC A;  1H6U A;  2UXB M;  1DGB A;  4QNM A;  1D0M A;  1WGN A;  2FNA A;  4DV0 M;  5IT9 S;  2XEP A;  3KOY E;  4PT5 A;  1XNR M;  1B6Z A;  1J09 A;  3JYG A;  1TFE A;  4YY3 M;  3U6E A;  4DV4 M;  1Z5C A;  3H4J A;  1HJP A;  3I4Y A;  1IY1 A;  3AOE C;  3F92 A;  4G4Q A;  3BOS A;  3M6A A;  4KT0 F;  4JI0 M;  3SBJ A;  3VKG A;  4FVF A;  2KDL A;  4LFB M;  1Z5B A;  2Z7J A;  4DR3 M;  1VEJ A;  2DAG A;  2JY7 A;  2L2D A;  2Y21 A;  3I01 M;  3K2L A;  4PD2 A;  4B3M M;  3IHP A;  4IBJ A;  4LFA M;  1L1Z A;  3QN0 A;  5EP4 A;  4MM3 B;  4JYA M;  1ZAE A;  2ZTC A;  3LCV B;  1ZQ9 A;  3U61 B;  3I04 M;  3PFI A;  4OU7 A;  3CF0 A;  4TUW A;  2KZU A;  3TPZ A;  2A0S A;  1VDL A;  1GL7 A;  2K47 A;  1QDR A;  1SXJ B;  2CV2 A;  1JR3 E;  1GAB A;  5ITX A;  3J27 B;  1GLN A;  4GC5 A;  4JV5 M;  2JP7 A;  5A2Q S;  1K82 A;  4G4N A;  1WR1 B;  2LNH C;  4KHP M;  3E21 A;  5ITY A;  3GLF A;  3R9X B;  4BBA A;  2RPB A;  5FTM A;  3HHW A;  4GKJ M;  1DO0 A;  1WIN A;  1DGF A;  1QDT A;  1OIZ A;  4A3V B;  2DZL A;  1JR3 D;  4X62 M;  4IIW A;  2LBC A;  4NRV A;  3L26 A;  4AI6 A;  1J5E M;  2JNH A;  1TH3 A;  3D8B A;  2C9C A;  1IY0 A;  3FYD A;  3HX3 A;  4GIT A;  5C1B A;  3SAW A;  5F3W A;  1N36 M;  2HAK A;  2F5O A;  3AOE A;  3JAM S;  4JI3 M;  3OTO M;  3BXW A;  3EIH A;  3HZJ A;  3GPU A;  3FD9 A;  1E9R A;  1QAM A;  5FSW A;  4L8R C;  4CGY B;  4REZ A;  1NJG A;  4IBD A;  2CWB A;  2FS1 A;  1RU3 A;  3A45 A;  3FTD A;  2HL7 A;  3B7Z A;  3T6P A;  1N32 M;  4FD2 A;  1OIP A;  4B7G A;  3KDS E;  4Q7J A;  1IBM M;  2XFT A;  2LVN C;  1XWI A;  2H1R A;  2Y0Q A;  5H37 D;  1IN7 A;  3MK6 A;  1HNX M;  2D7G A;  2EKK A;  3LW5 F;  3U6M A;  3SAV A;  2DI0 A;  3U6L A;  3GLG A;  1I94 M;  5EXP A;  3GLH A;  3M0E A;  2DZN B;  4LJ4 A;  3QNA A;  3AL0 C;  2FOI C;  2CV1 A;  1TH4 A;  4IBC A;  3FKE A;  4UN2 B;  3GP1 A;  3V76 A;  3ILK A;  1NSF A;  3AJI B;  2ZAO A;  4QOS A;  4G4O A;  1PJI A;  3I4V A;  4FCV A;  3HHZ A;  1XHB A;  4HL4 A;  3L2A A;  3GLF B;  4PCZ A;  4DV3 M;  4LF8 M;  1WXQ A;  2WSE F;  2A5Y B;  1G4A E;  1VEK A;  1DGG A;  1SG9 A;  3CTW B;  3QWL A;  2G64 A;  3I2B A;  1Q39 A;  3HJ8 A;  3U5Z A;  1ZMV A;  3FUW A;  1R4G A;  1NHG C;  4P16 A;  5IRE B;  3VK7 A;  3GQ3 A;  1IN4 A;  4S12 A;  1IFY A;  1JQJ C;  1EFU B;  3J2P B;  3W68 A;  4GEW A;  4LF6 M;  2EJS A;  3CGW A;  1YSY A;  5ITX E;  1GJS A;  3U60 A;  1OFI A;  1OFH A;  3KP1 E;  3L27 A;  2DVW B;  4DR4 M;  3UGJ A;  4WW0 A;  1QAN A;  3IG8 A;  1N34 M;  2OOB A;  4JI7 M;  3TWM A;  4JI8 M;  4DUZ M;  3GO8 A;  4LFC M;  2G8L A;  2YQZ A;  2ZBK B;  3SAS A;  2C9O A;  5ITR A;  1TGU A;  3VDU A;  2DAE A;  4OX9 M;  1D2N A;  3SFZ A;  3FTE A;  1IXS A;  4D81 A;  1NNU C;  4RNA A;  3Q8X A;  3B7Q A;  3SMS A;  1CUK A;  4NSO B;  3SYL A;  1W5S A;  2CV0 A;  3GLG B;  2JA2 A;  5FTN A;  3GLH B;  2Z4R A;  2FE8 A;  1XXH A;  4X66 M;  2R6F A;  2ZAM A;  4JN6 A;  1C1K A;  2APL A;  4B08 A;  4GC9 A;  5JI3 E;  2KNV A;  2K6B A;  1QUS A;  2JY6 B;  2QSF X;  4Z6Y A;  1XMQ M;  3VKH A;  2JUJ A;  2LWX A;  5EXX A;  3KOW E;  1HQC A;  1FJG M;  3W0L B;  2KW0 A;  3SMP A;  1BVS A;  2JZ1 A;  2KRU A;  5LMU M;  2BJW A;  3U5Z B;  1IXZ A;  2X4A A;  4AG6 A;  5KO3 A;  1R6B X;  3E4R A;  2DZO B;  2CHG A;  2DKL A;  2CHQ A;  5EXT A;  4NTM A;  3T1Y M;  1P3Q Q;  1HR0 M;  4MGK E;  3GRY A;  1Y8G A;  1PJJ A;  4G6Z A;  3GLG E;  4W5W A;  3GLH E;  2GQF A;  3HJS A;  4LY6 A;  4ITQ A;  3U60 B;  1JB0 F;  1YLA A;  2LVP C;  2R0I A;  4JI1 M;  1QAO A;  2KA6 B;  4XBO A;  2LVA A;  2L4E A;  1V34 A;  1TF0 B;  2YR0 A;  4MGZ E;  3WHK A;  4CJ6 A;  7CAT A;  4GRI A;  2MH8 A;  4Y28 F;  2YFQ A;  4OW0 A;  4LF4 M;  4D80 A;  3HWS A;  4WP2 A;  2W82 A;  4XGI A;  3TWL A;  1GJT A;  3UK6 A;  1IXS B;  2C96 A;  3ZH9 B;  2MR9 A;  3SAT A;  3UJN A;  5GKN A;  2P5T A;  3RE8 A;  2HWJ A;  4FVM A;  3IG5 A;  2LVQ D;  4OVZ A;  1XXH B;  2K9D A;  1NNJ A;  4L15 A;  3RFW A;  2XZU A;  2EA0 A;  1D0L A;  2O01 F;  2DNA A;  2KEB A;  1N75 A;  1Q3B A;  1VEG A;  4X65 M;  3JR4 A;  4HLQ A;  3HHY A;  2KRK A;  4YHH M;  1QUT A;  2RKO A;  2WSF F;  3LQQ A;  3KOX E;  5EP2 A;  3SHG B;  3UMM A;  3C58 A;  2R45 A;  4GHL A;  2E5L M;  3FUX A;  4M9Z A;  4AW4 A;  2GNO A;  2CUZ A;  4IBE A;  1WJ7 A;  3K92 A;  3RGS A;  1NVM A;  4AZF A;  1DV0 A;  1HT2 E;  2L4F A;  2F5Q A;  1KYI A;  1PGY A;  1T43 A;  4ZPX A;  1KSF X;  2OBA A;  5IWA M;  4L6V 6;  2D7H A;  1SXJ E;  4JI6 M;  2BWE A;  2BJV A;  4LRS A;  1YE9 A;  3SAU A;  1PJQ A;  2XSZ A;  1XC8 A;  1R2Y A;  3GQ5 A;  2J5Y A;  4K0K M;  3FRH A;  2F4V M;  1GO5 A;  4LGM A;  3L29 A;  4MGY E;  1K3X A;  4NXN M;  1GTQ A;  1QZE A;  1SXJ D;  1YUB A;  4B7H A;  4NXM M;  4AG5 A;  2DWZ B;  4B3T M;  2ZM6 M;  2DAM A;  2LXE A;  1NY6 A;  2LH0 A;  2X49 A;  4KLN A;  4OVZ B;  2M60 A;  4DV5 M;  1L2C A;  4NTN A;  2BWB A;  3DFZ A;  3J7B A;  1GVN A;  3K8Z A;  4WUR A;  3ZQJ A;  2L09 A;  2NQ8 C;  2L7I A;  3KVW A;  4QHS A;  3TWK A;  1X37 A;  1QQW A;  2DHY A;  3PXG A;  3U6Q A;  2DWN A;  4JXJ A;  3U6C A;  1OKS A;  3AFH A;  2H5X A;  3LVW A;  1T3T A;  4LJ7 A;  3A98 B;  2LTU A;  3AKZ A;  2R18 A;  1NJF A;  1IXR C;  3HY5 A;  3MHV C;  4LG2 A;  3GRR A;  5E6J A;  3D7J A;  4AKI A;  4MGH A;  3U6D A;  4F1I A;  1N33 M;  4P17 A;  5DNY A;  2X8A A;  4KOD A;  3B7N A;  4B7F A;  2QNJ A;  3M7G A;  5FTJ A;  4DBG B;  1T6O A;  4DR5 M;  1G59 A;  5EQT A;  3RGP A;  4L16 A;  2V6Z M;  2R44 A;  2L6O A;  2O5R A;  3K1J A;  3LMM A;  2JXN A;  3HU1 A;  3NBI A;  2FH0 A;  4IJE A;  2XFS A;  3KXE C;  3VFD A;  3KS4 A;  1Q3C A;  3K9P A;  1C7Y A;  1QYR A;  3DA1 A;  3GLI B;  1J7K A;  3GLF E;  2C99 A;  4G4R A;  2I7N A;  1NV9 A;  2UUB M;  2CP8 A;  3ZCB B;  2DHR A;  2VII A;  1UM8 A;  3DZD A;  3MMP A;  4R3D A;  1QZM A;  4M0D A;  4XK8 F;  2WZJ A;  1MX0 A;  1TDH A;  3QAU A;  1IBL M;  3U6S A;  3L25 A;  4L4U A;  1NV8 A;  1HQY E;  1IN8 A;  5EXS A;  2QQ8 A;  4D82 A;  4HEO A;  2QPA A;  3NBX X;  4QHT A;  3NWL A;  5KPZ A;  2Y0T A;  3QYE A;  4LF9 M;  1JR3 A;  1B66 A;  4PDG A;  1MU5 A;  2Y20 A;  4QNR A;  5L8R F;  2VQE M;  3LCU A;  2JY5 A;  3HHX A;  2KHH A;  3HKP A;  2HCB A;  3HGI A;  1V92 A;  4LRT A;  3B74 A;  1TR8 A;  3C3D A;  2QBY A;  2Z8Y M;  3DOA A;  3A46 A;  4MB7 A;  3FYC A;  1S3S A;  2QZ4 A;  1UFZ A;  3C9P A;  3TE6 A;  1L1T A;  3UZU A;  2VF7 A;  5ITQ A;  3LZE A;  2RRU A;  1R5L A;  1OQY A;  1WGL A;  2XLJ A;  2EO2 A;  1G8P A;  2QHO B;  4GMQ A;  2F5S A;  1IN6 A;  1TH2 A;  2OO9 A;  5DYI A;  3SAR A;  8CAT A;  2LHG A;  3GPP A;  2EKF A;  1K3W A;  4CIS A;  4GH9 A;  4NC6 A;  5EP3 A;  4LJ8 A;  1Z59 A;  3FUU A;  3HU3 A;  3M0N A;  4M9X A;  1I4W A;  3ZC7 B;  5C18 A;  3H4M A;  3KW6 A;  1R7R A;  4DR1 M;  3FUV A;  2DEN A;  1Y13 A;  3E46 A;  4B3S M;  1VDD A;  2G5G X;  1OTR A;  1Z5A A;  4I5S A;  5IZ7 D;  3TQS A;  1XMO M;  5KQD A;  1D0K A;  2CRU A;  3MJ5 A;  2ZTD A;  3I51 A;  3GQ4 A;  4M0W A;  4LF7 M;  3FTC A;  4GIP A;  2MGW A;  3R8F A;  2LVO C;  3B89 A;  4PDI A;  2DAK A;  3SC3 A;  2F5N A;  3FUT A;  5E26 A;  3QN9 A;  3J81 S;  4DV2 M;  1VQ1 A;  2CEA A;  2UXC M;  4BB9 A;  1ZMW A;  1F4I A;  4RKU F;  3FE3 A;  3A42 A;  4L78 A;  2F5P A;  2QBY B;  3AV0 A;  4FWG A;  3T15 A;  4DR7 M;  4AKH A;  2R4E A;  4II7 A;  1ORY B;  1HT1 E;  5EP1 A;  4NRW A;  1N77 A;  5LMN M;  4FCW A;  4FVG A;  1XB2 B;  4I8O A;  2KNA A;  4I81 A;  2N35 A;  5KPT A;  2HHH M;  1XXH E;  1G3I A;  5ITT A;  3KSX A;  4FWH A;  3KOZ E;  4R7G A;  4AKG A;  1AUA A;  2KZS A;  4KO8 A;  2C98 A;  4CHT B;  2KNZ A;  3VLF B;  1GL6 A;  4X64 M;  4DUY M;  3C3E A;  2FFJ A;  2QP9 X;  2CE7 A;  3SHF A;  2J7N A;  3VDP A;  3W67 A;  5BR8 M;  4MGI E;  5JI2 E;  3GPY A;  4LCB A;  3T38 A;  1W5T A;  1L2B A;  4DR6 M;  3D8L A;  4GKK M;  3Q8G A;  2BNK A;  3GLI A;  1G41 A;  3BBZ A;  4IBF A;  2DTT A;  1Z6T A;  2R65 A;  3B9P A;  2V1C A;  4I4L A;  4LJ9 A;  2XGN A;  4B3R M;  3QYB A;  4IBK A;  3HU2 A;  4JI4 M;  4JI5 M;  3KS8 A;  4BLC A;  4NL4 H;  2DJ6 A;  2R46 A;  2DWL A;  2D7E A;  2MJ5 B;  2K0B X;  4F2L A;  3BK6 A;  2ERC A;  3GRU A;  1IN5 A;  1TTE A;  1L8Q A;  1VG5 A;  2VF8 A;  4LJ5 A;  4CIZ A;  4LJ6 A;  4DV6 M;  2UU9 M;  1QVR A;  1IM2 A;  2HKJ A;  3GRV A;  4FCT A;  1ZMU A;  2OPF A;  4NSR A;  1QAQ A;  1E32 A;  1R2Z A;  3PVS A;  4IBI A;  5DFL A;  1IQP A;  5BPV A;  1DGH A;  5FTK A;  2Z4S A;  4DV7 M;  5DYG A;  2C5R A;  4RF0 A;  2V1U A;  2L7H A;  2Q2E B;  4G3O A;  1N78 A;  2WSC F;  2I7P A;  2LHC A;  4EIW A;  4IBG A;  1NHW C;  1OAI A;  1WHC A;  4DV1 M;  1G71 A;  5FTL A;  3SYK A;  2OOA A;  4LGY A;  1LV7 A;  2JY8 A;  1E94 E;  2CFO A;  2MRO B;  4FWD A;  4GHA A;  3K9O A;  3J80 S;  3VK8 A;  2XH9 A;  1SXJ C;  5KPR A;  1EIJ A;  3LVV A;  4RF1 A;  3L28 A;  3JR5 A;  2OQ4 A;  2DAI A;  3CF2 A;  2XZF A;  1MJG M;  2JZ0 A;  3LQR A;  4M9S A;  3U6O A;  3TL4 X;  4QOZ C;  1PRB A;  4LF5 M;  1TDZ A;  5FLX S;  3HJQ A;  4LZJ A;  3KFU G;  1E9S A;  3THG A;  2VQF M;  3EIE A;  3KSJ A;  2CHV A;  2YNM D;  1NO1 A;  3AOG A;  3WHL A;  1HNW M;  3PNV A;  2UUC M;  4FW9 A;  1XNQ M;  1LTM A;  1WIV A;  4Z8X A;  3U6P A;  2G3Q A;  3KP0 E;  4FVJ A;  2QEN A;  4LJA A;  1ZV1 A;  3GLI E;  4IBB A;  3T1H M;  1Q02 A;  2R4J A;  1PJT A;  5KQ8 A;  4IJF A;  3FRI A;  1DGH B;  1AIP C;  1L2D A;  4AQY M;  3FTF A;  2XF3 A;  2J7O A;  4JI2 M;  1V33 A;  1A5T A;  4R71 A;  2UUA M;  2EUC A;  1PM5 A;  2XSZ D;  1IBK M;  2DXI A;  3GPX A;  2RGO A;  2ZAN A;  2RGH A;  2UXD M;  4NOO B;  1MN3 A;  3U61 A;  1EE8 A;  1PJS A;  2M5Z A;  2VDB B;  2DWM A;  4MH0 E;  1OJL A;  3J7A S;  5ITU A;  2AHM A;  3PNY A;  1NY5 A;  1OAO C;  2JWS A;  1SXJ A;  2QCU A;  1KFV A;  4LZZ A;  3CF6 E;  3W0F A;  2O25 A;  2Z3X A;  3IEC A; 
#chains in the Genus database with same CATH homology
 2BWB A;  1DO2 A;  1HT1 E;  2B3T A;  2DHY A;  1XB2 B;  2OOB A;  2KNA A;  1OKS A;  1XXH E;  1G3I A;  1WGN A;  2H5X A;  2LTU A;  1TFE A;  2KNZ A;  2DAE A;  1IXS A;  3H4J A;  1HJP A;  1F4I A;  5JI2 E;  1CUK A;  3F92 A;  4F1I A;  1G41 A;  3BBZ A;  2QNJ A;  1VEJ A;  2DAG A;  2JY7 A;  2L2D A;  2KNV A;  1T6O A;  2JY6 B;  2QSF X;  4DBG B;  2JUJ A;  3IHP A;  1BVS A;  2MJ5 B;  3LCV B;  2JZ1 A;  2K0B X;  2ZTC A;  4F2L A;  3K9P A;  1TTE A;  1C7Y A;  1VG5 A;  2O25 A;  3GLF E;  1NV9 A;  1VDL A;  2CP8 A;  2DKL A;  3MMP A;  1IM2 A;  1P3Q Q;  1ZMU A;  1JR3 E;  1Y8G A;  2WZJ A;  3GLG E;  3GLH E;  2JP7 A;  1YLA A;  2LVP C;  2R0I A;  5DFL A;  1WR1 B;  1NV8 A;  2LVA A;  2L4E A;  1HQY E;  3E21 A;  1DO0 A;  4G3O A;  4HEO A;  2DZL A;  4WP2 A;  1OAI A;  2LBC A;  1WHC A;  2JNH A;  2OOA A;  2JY8 A;  2JY5 A;  1E94 E;  2HAK A;  2MRO B;  2MR9 A;  3LCU A;  2KHH A;  3K9O A;  2HWJ A;  1V92 A;  2LVQ D;  1TR8 A;  2K9D A;  2DAI A;  2JZ0 A;  1UFZ A;  2CWB A;  2DNA A;  3T6P A;  1VEG A;  2RRU A;  1OQY A;  1WGL A;  2QHO B;  2OO9 A;  4Q7J A;  2LVN C;  2EKF A;  2EKK A;  1WIV A;  2G3Q A;  2DI0 A;  1WJ7 A;  1ZV1 A;  2DEN A;  1DV0 A;  1HT2 E;  3E46 A;  3GLI E;  2L4F A;  1Q02 A;  1OTR A;  1KYI A;  1PGY A;  1T43 A;  4UN2 B;  3FRI A;  1AIP C;  2BWE A;  1A5T A;  2ZTD A;  4R71 A;  1G4A E;  1VEK A;  1SG9 A;  1MN3 A;  1ZMV A;  2MGW A;  3FRH A;  2LVO C;  1R4G A;  3B89 A;  1GO5 A;  2DAK A;  1QZE A;  1IFY A;  1EFU B;  1VQ1 A;  4GEW A;  1ZMW A;  2DAM A;  3FE3 A;  2EJS A;  3IEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...