1XB6A

The k24r mutant of pseudomonas aeruginosa azurin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDRSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Effects of a novel disulfide bond and engineered electrostatic interactions on the thermostability of azurin
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 33
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1xb6A00
2AZUA 4AX3A 2HX8A 2HZHA 3PCYA 1AZUA 3N55A 3D12B 3SBPA 1SF3A 1BQ5A 3AG4B 2YAPA 3MX0B 2YXWA 1SHXA 2IH9A 1BQKA 2HXAA 2QT6A 4Q89A 1L9OA 1AZCA 1PF3A 2GHZA 1RZPA 5I5IA 2YXVA 1ET8A 2PP7A 4WTQA 4ENZA 2VN3A 5D4IA 4N8UA 5B7EA 2UX7A 2W8CA 4QLWA 4BXVA 1BEXA 1HAWA 3QQXA 2VSKB 4G72B 2YQBA 3UACA 1JVOA 2H5UA 4DP5X 1NICA 2CCWA 1N70A 3OMIB 4A66A 2X88A 3EF4A 1AG0A 2YAFA 1E5ZA 1PY0A 3ZIYA 3ABLB 3NJGA 5TK4A 4YSPA 3NJLA 1HAUA 3CG8A 1E67A 1PNCA 3FU7A 5D4JA 4JKNA 4BDVB 1E5YA 3ZDWA 1M57B 3S8FB 3FS9A 5I5MA 5I28A 1E30A 2UXGA 4YL4A 1NPNA 2WO3B 1ADWA 2VW4A 1WA2X 1OCCB 1JZGA 3V9EA 1W8EA 2IDTA 3UABA 2PPDA 5FC9A 3X1GA 2EIJB 4DPCX 4YVUA 4P5SA 1JZIA 3AW5A 5I5JA 1BQRA 3EH5B 5B7FA 1NIAA 5AFAA 4KO7A 1ID2A 1RZQA 1NINA 1BXAA 2QDWA 1NIBA 5IY5B 2YAHA 1NTDA 3H56A 8PAZA 2XLLA 2B3IA 2A3TA 1MZYA 4KO5A 1ET5A 3PXLA 3G5WA 1CC3A 3L45A 1XB3A 1XB6A 3NJFA 2H47C 5I6PA 1DYZA 1NIEA 1CURA 3FQ2A 4YSAA 4RH4A 1CYXA 1PMYA 3HB3B 2IWFA 1GSKA 3FQYA 2ZXWB 4HAKA 1KYAA 1AAJA 4KOBA 4P5RA 3T6WA 4G70B 4YSOA 3JTBA 4HCIA 1V54B 4MFHA 3OMAB 2VSMB 3PAUA 3NSFA 4AKOA 1J5DA 1ET7A 1PNDA 2XX0A 4G7QB 2EILB 2NRDA 1J9TA 1FFTB 2J55A 5A7EA 1VLXA 5I26A 3OQRA 3CDZA 3UAAA 4AKQA 2TSBA 2CUAA 1WS8A 3MBWB 4ZK8A 1X9RA 3ASNB 2AVFA 3FU8A 2FJSA 3BVDB 2QDVA 3H4FA 2VW7A 5B1KA 1NIDA 1PLAA 3WG7B 1AZRA 2P80D 2R7EB 4DPBX 4HHGA 3V9CA 1QLEB 1A4CA 2J56A 2BP0A 2BWDA 1ZDSA 3S3CB 4E9TA 2XUWA 2BW5A 2Y1AA 1NWPA 3KW8A 1V10A 3T6XA 2Q5BA 2FNWA 1NPJA 1SDDB 3BQVA 3WNIA 2JKWA 3FYEB 3SQRA 5B7MA 3X1EA 1AIZA 4BK5C 1JZJA 1SF5A 2XVBA 4AZUA 1SHWA 2TSAA 3FQ1A 4A2FA 2FQGA 4NB7A 2HRGA 2CJ3A 2MRYA 1J9SA 2X87A 2YAMA 4AI7A 2YAEA 1FA4A 2EIMB 1KDIA 1FWXA 1OCOB 1OCRB 1X9UA 3QJUB 2QPDB 3U25A 4BWTA 5E9NA 5I6MA 3CVDA 2HRHA 2P80A 3N2JA 3FSWA 3X1FA 2YAOA 1JXGA 4G7SB 4A2DA 2H3XC 4E9RA 1SFDA 5B1JC 2BP8B 4QKTA 2IDUA 2E86A 3GDCA 4KNTA 2PPEA 4W9ZA 1AOZA 5D4HA 3QJSB 1NZRA 4YVNA 1JXDA 1AG6A 3S3DB 1BAWA 1AQ8A 4UAHA 6PAZA 3QJVB 3ASOB 2JFCA 4AKPA 1WS7A 3X1NA 1PZCA 4G7RB 3TBBA 2PP8A 4HIPA 3PAVA 4KOCA 1WA0X 4YSQA 1ETJA 3QJTB 3TA4D 1F56A 3QJRB 5AZUA 2DYRB 5F7BA 4E9QA 1KGYE 2CAKA 4YSUA 1BXUA 3NJIA 3ABMB 1GYCA 2I7SA 1AACA 2UX6A 1PZBA 3FPYA 4E9XA 1EZLA 4NERA 2BZCA 2HLEB 2HX7A 2PPCA 3CVCA 2DY2A 1OOWA 3FSZA 4TXVB 2GIMA 4FAAB 3AZUA 3HEIB 4M3HA 2Y69B 3X1BA 4BDVA 2LLNA 1JZHA 4BXSV 3TU6A 1JERA 4DPAX 4DP4X 4DP2X 3T6ZA 1GY2A 2JXMA 1URIA 3FPXA 1AZBA 2FQFA 3NJKA 1I53A 3S8GB 2VMJA 4A68A 1ZIBA 1TKWA 5ANHA 1T5KA 3OMNB 4WKXA 2DWSA 3RYMA 4GP4B 4GYBA 3GXUB 1KCBA 2WO2B 4HHWA 4W1TA 4GXFA 4F7KA 1N68A 3UADA 3WI9A 3OD3A 3NJJA 2I85A 1JVLA 2AZAA 1W6LA 4DP0X 2FT7A 1JOIA 2EINB 1MG2C 3UAEA 4A2EA 1A3ZA 3PLYA 2IDQA 4BWWA 3EH3B 1WA1X 1MDAA 4A67A 2UXFA 5AKRA 3FSAA 4E9SA 1NWOA 2N0MA 1R1CA 1ZDQA 1ZPUA 2CALA 2Q9OA 2XWZA 3NP4A 3IBOA 1ASPA 4EF3A 4DP7X 4JHUA 1OCZB 3NP3A 1YLBB 4K9JA 1IBYA 2XV0A 1KV7A 2OCCB 2UXVA 1E65A 4KO9A 2I7OA 3T6VA 3DTUB 1GR7A 2PCFA 2IH8A 2FWLB 2GI0A 2DV6A 2XYBA 4KNSA 4YSSA 4E9VA 1JZEA 1AS8A 3NJMA 1NIFA 1ILSA 1OV8A 2VM4A 1UATA 3OM3B 2XXFA 3CVBA 2WSDA 4M4RB 1PLBA 3C75A 4KNUA 3DIVA 3WKPA 4F2FA 1J9RA 1AR1B 1JXFA 2PPAA 1ASOA 4PCYA 5TK2A 1L9RA 1IUZA 4N4YB 1ASQA 3EHBB 5PAZA 1CUOA 3QPKA 1RCYA 3TASA 1GS8A 1XB8A 4KO6A 2UXTA 1AZNA 4HCGA 7PCYA 2R7EA 1MZZA 4YSEA 2GBAA 3AY2A 2DYSB 2XXGA 2J57A 2BW4A 4PAZA 1HFUA 3FU7B 5PCYA 1GY1A 1QNIA 5F7AA 3UGEA 4DP6X 1A4BA 4GP5B 1KBWA 2EIKB 1BYPA 1GW0A 4YSDA 1AANA 3X2QB 1SDDA 3S3BB 2PCYA 4F2EA 2XU9A 3DKHA 3FT0A 1OE3A 1TEGA 3TBCA 3AG1B 3T9WA 2FTAA 2GB2A 2IWEA 2BWIA 1TEFA 2GSMB 4L0PB 1AS6A 3FYIB 1QHQA 3KW7A 7PAZA 3ZBMA 2RACA 1ZV2A 3QJQB 2ZWNA 3AG3B 1OE1A 3PPSA 5I6LA 3SBQA 1TU2A 2FT8A 4E9YA 2FQEA 3NJHA 1A4AA 3WKQA 1L9SA 3NSCA 4YSTA 1PZAA 3GYRA 2YAQA 1IKOP 4UANA 5I6KA 2J5WA 3IN2A 3IN0A 2BP8A 3ABGA 4G71B 2AANA 4GY4A 2XV3A 4DP8X 4UF7C 4YSCA 1PCSA 4HALA 2BHFA 3IEAA 4CSPA 1IBZA 3H4HA 2VM3A 3NSDA 3ERXA 1B3IA 1NDTA 3NSYA 3T71A 1GS6X 4Q8BA 4FA7B 3ABKB 2ZOOA 4BWUA 3EH4B 1MG3C 2HX9A 1A8ZA 1WAEA 1PLCA 3NJNA 2DWTA 1J5CA 1V55B 1XMEB 4X4KA 1KBVA 1M56B 5B3SB 3NYKA 4A2HA 3JT2A 3CDZB 4E9WA 3NT0A 2FQDA 1JZFA 3IE9A 1M9WA 2GC7C 3FSVA 1EHKB 5EHFA 2PP9A 4DP9X 1DZ0A 1ILUA 4HZ1A 5B1BB 1RKRA 2YARA 2XX1A 4GP8B 1PAZA 4HCFA 2IDSA 1SNRA 2OJ1A 2W88A 1BXVA 1L9QA 1L9PA 1W6WA 2BP0B 2ZONA 4JHVA 5I6NA 4DP1X 2BZ7A 2IDFA 3WNJA 2PLTA 3SBRA 2AFNA 1SJMA 1GS7A 1ZIAA 1IC0A 1BYOA 2MTAA 3FU9A 2FT6A 1OF0A 3AG2B 4NAJA 4CSZA 9PCYA 4A2GA 2QPEB 3WIAA 2B08A 1OE2A 6PCYA 1KDJA 3ZX1A 2IAAC 1SFHA 2CBPA 3CZUB 5I6OA 1CYWA 5B1AB 1A65A 2IWKA 5LDUA 1AS7A 2PPFA 2BO0A 5B1JA 3PAZA 2GC4C 2XV2A 1J9QA 2VW6A 1KCWA 1L9TA 2OV0A 4YSRA
chains in the Genus database with same CATH superfamily
1CFSA 1HXMB 4U3SA 2HZHA 2MPAH 1KIPA 3CLEL 4QT5A 2DQFB 4YHZL 3TWCL 1BQ5A 2VDRL 3WD5L 1UT1A 1AVAA 4IIQA 4P2RD 1N7ML 1U3NA 3CFCL 4MAYA 3L3GB 1CICD 1P9MC 4OF5A 4F7TB 2DQJH 4FQXD 3ZUCA 4NNPH 4NBYB 2W8CA 4S0HA 2V6HA 1KNOA 3UYPA 4IDJH 5C9JB 2VSKB 2F54D 3E1ZA 5A2LH 2CDFA 2VH5L 1VFAA 2EXTA 2YAFA 3PGDB 3U1SH 2X4UA 3P9MB 4B53A 3M6DA 5D1XE 3MBEA 4KH9A 3NJLA 4KJWD 2V7HA 1DUZB 4O2EB 4KMQA 4NJAL 2YGOA 1MELA 2HCZX 3SJVB 5HDQL 2DKSA 3FONB 3W0WE 2ZNXA 4H8PA 5I5MA 1LGVA 2HLFD 1NC4D 4X9YA 4Z0BH 4BZ2A 2XBZA 1QD0A 5ES4B 1ADWA 2VDOH 5KSAA 1G0DA 4TTDC 2ZXQA 5DJCB 3DJTA 3BT2L 1YEJH 2EEAA 4PJXE 2C9VA 3NZSA 4UAOC 32C2A 2UV3A 1VZIA 5D2NB 1EO7A 1KPUA 4GS7C 1OAZH 4KK8D 2K6YA 2B0SL 3MDJA 4HIEB 2J72A 3QDJA 3I3EA 5H2BA 4FJZA 3IGAB 3GM0A 3S2CA 4AG4L 1A6AB 3B9VA 4DW2L 1R5IA 5I8EB 4Q9QH 4LVOC 1T21B 2IQAB 2PO6C 1WQVT 1FC1A 2XICA 3NVQA 4E5XA 4YXLH 2JTYA 3BP6A 1RJLA 4YDIH 2WOBA 2PABA 2DIAA 4H8VA 3NTCL 5DMIL 2ENQA 3QWRA 5IVZA 2WSPA 1WEJH 1UB6B 5HTSA 3VB9A 3MJ7B 1JWUA 3FCUB 1GH7A 1MIML 5GJSH 4F92B 2MNWA 2JE8A 5I66A 1BWMA 5HHPB 2D9CA 1U8JB 2NNCA 4PJCF 3RLSA 4ZMLA 4P5RA 4YSOA 1XIWA 1HHIB 3ARZA 4RNRB 1V54B 4GW1A 2DQGH 3QFDA 4FQIH 2VOTA 4XN9A 1ET7A 1PNDA 4HEPG 2AHIA 1JNLL 2P5PA 5KANI 4DJMA 5EOCL 4IRZL 1J0KA 4PGBA 4EVNA 3KG5A 2HKHL 2E9BA 4YFDB 3HI5L 1FYTA 4K5LA 1QR1B 1ZHLA 1MIEH 4R4FH 4RFOL 2VITB 1HCYA 4OF7A 3T3ME 1INEL 1WBXA 3P0YL 3EGSA 4M1DL 4FXGB 1FL6A 2G2RB 4KQ4H 2QDVA 5T5NF 4C56B 2FHCA 3H4FA 3MRJB 1FNSH 2BNRA 5F97E 2DJ4A 3VTMA 1AQHA 5AKSA 1FH5H 4K3JH 4HHGA 4BSWB 5MHSE 3V6OA 2FH8A 4KX8A 2OMNA 2C7UB 3FT2B 2VC2B 3LEYL 2WWNA 5JW5A 2D31A 3MC0A 2FGWH 3W2DH 1UZ6F 4BH7A 5LJYH 3KNBA 4HVBA 5HHNA 1U2CA 1CDJA 3M86A 4YGVB 2RFXA 1QBLL 2D03L 4QWWD 5DJ0A 2VDML 3WNIA 1JP5A 2AAVA 2G3NA 1IAOA 4MB3A 5TGBA 1UD2A 4NUGL 2XACC 2CKNA 5DR5L 1CXLA 1Q1PA 1ACZA 1RJZA 1R75A 2Z31D 3ZSSA 3O41A 2EIMB 3B6SB 4Z7UA 5K9JL 2VN7A 3D85B 1NCUA 4XP4H 1DBJH 1C7TA 1YPZB 4FTVE 4KHTL 4HT1L 4HMEA 1E7VA 3NQIA 4BV1A 2YA2A 3VDCA 4PJHE 1MCIA 3VO0A 4RDQF 1J5IA 3M1BB 5AOKA 2EDRA 3OKYA 4OI9A 5C2UB 4UUJA 3IKCA 2DYPB 2VQTA 4ES8A 1AGBA 1U93A 1NZRA 5GZNC 5SWSA 1DSYA 5JZ7C 1ZSDA 1MWAA 1MCLA 3I9GH 4PWKA 1OLZA 1FFQA 1YMMB 3KM2A 4ICWA 3ZO0A 4WGKA 5JORB 3HNTH 1IBFA 4FFTA 1H0DB 1OLLA 4I85A 1I1RA 4I77L 1YEHL 1IFRA 4J5VA 5TE7H 1FO0H 2ZT9C 3MRIB 2D7OA 2J88H 4YHIB 3SE4C 3KBHE 1MOEA 1RPKA 3M1CA 2P5EA 3MACH 4P59L 5E99H 4BUHA 2R2BA 2WQWA 4U7MA 5KJ7E 4OLVH 1EFQA 2OTPA 5D1ZI 3TV8A 5LGJB 4PR5A 1PVHA 2J1KA 4FAAB 5DYOB 1OGSA 4RRPM 4M3HA 4M6MH 2L0DA 2LLNA 4KTYA 4OCRL 4X7SH 5TJWK 2N7SA 4MQXD 1A0QH 2X4SA 3GSXB 3OKMA 3N43F 4DP4X 5D1XA 1D5RA 4H25B 5CP7A 1QRND 2FQFA 1NFKA 5DHVB 4NIYE 1NBVL 3ARQA 4PTTA 2V5TA 4WJKB 5F6HI 4WKXA 3W0WA 4LCIL 4Q9BA 1HYSD 3V0GA 1T6BX 2C3XA 1OAXL 4YXKL 4E41E 4QY8B 2Q3AA 5AENA 1GCFA 4F7KA 3EJPA 2JCCF 3L3OC 5HI3C 3UADA 3V4VA 1T7VA 3ZE2E 4OD3H 4YFLI 4PJXA 5E4OA 3H85A 4FX5A 4IYKA 3TO4D 5KSBF 3SDAA 4K8RD 3UAEA 1K4DB 4Y8DC 1VENA 2XKNB 2PWFA 3CSYA 3OPZH 2F1BA 2AP2A 5HYQA 2X89A 2J43A 1QFOA 1E5BA 1FRGH 1R3KB 1ZPUA 4H2AA 4PWFA 5AWNL 1E6OH 3CD4A 4ZTPH 5BCAA 4W9HC 4UOW0 1N0LA 2ZG1A 2WP3O 4DESA 2Y0SA 2P47B 3QIWC 3U0TB 2OCFD 4YZFF 2MH4A 1H3TA 4QOKD 1Z5HA 3D52A 3BPLC 1E65A 2G2PA 1P4LA 1ZJBA 1WTLA 2Q20A 2AJXH 2PCFA 4UQIM 3RTLA 4JJ5B 5F9JB 3E6FA 3VFMA 4PJEB 1XVSA 1MCBA 4YSSA 2XYBA 3C9NB 3P4LA 3UEQA 4E9VA 1LWJA 1P9MA 3QISA 5FX3A 5KG9B 1HL9A 4UAOB 4KJQD 5HPMA 1FUNA 3U46A 4K5NA 5G5DA 5EUOF 3TN0B 1R3HB 2OMZA 3RL1A 2HUEA 3BGMB 3EDJA 5T1JA 3T8XA 4CJ1A 1ASOA 1LO5B 1GTFA 4BELD 4KX7A 4LVOB 1TZIB 4X5XA 4ZAKA 3BOVA 4F8PA 5HI5C 1XWVA 5FDWB 4N4YB 1K8IA 5BOZG 2VSDA 2WOYA 4FYQA 4Y9BA 7FABH 5PAZA 3L1EA 2BIMA 1OB0A 5ELIA 3CH1A 1VFMA 2R2CA 2W0FA 3SDCC 1AZNA 1UA6H 2E7CA 3KJ4C 2ZX9A 3EO0B 4PGJA 1DN0A 3AQYA 5D2LF 1NFDF 2HVBA 3T0XA 3HI6H 5DD3H 5LLIC 1AY1H 3FU7B 1MLCA 3IFPB 3KEDA 2APXA 2VUKA 1ZHKB 5BRPA 5KVMC 2WLYA 3IPEA 1JMXA 4F57H 2C9RA 2JI2A 2XZCH 4I7ZC 4OFVA 4DEUA 3WFZA 2CK0L 3BLKA 2IAMA 2AQPA 5CP3H 5EZOH 5I1LB 1TJHH 4HCRL 4N2OA 1E4XL 1X4XA 2WMPB 5CGMA 3S88L 1AS6A 1DQVA 2RB8A 3LQZB 5F1NA 3MV7B 1B2WH 3EXJA 2Y7QA 1OW0C 1L9NA 3D2UD 2DM2A 2V8LA 4TL5A 1J1OH 4UINL 4JQXA 2VR3A 4GOSA 1MVUA 3VWJC 1JGDA 3K2MC 1PZAA 1FNLA 3MRCA 3MZTA 5DGQA 5ICXB 2B7DT 4UANA 4WFGD 4FHKA 3RDTD 1NAKL 3NIFE 4OF6A 3RKDD 3X3FL 3VUAA 2A74C 2FO4B 4M1CC 4AYEC 4OKDA 3FFCE 4FTVA 4S0SD 1RZGB 1TG8A 1HHHA 5EO9A 3TV3L 1UVQA 5DD1L 1P6FA 1PCSA 1JGLL 5GJTL 2CNYA 2IBZY 1P7QD 2P46B 4PJHA 3QORD 2H26B 1JGVL 3CUPB 2Q8AL 4Y16D 2O72A 5F0PB 4IRZA 2A7BA 3QA3B 2WUCH 4LGSB 1UQSB 4C8XA 3EYFA 3BFQG 1E8ZA 4TQHA 1GS6X 1RVFL 2IALB 3BZFB 3ESOA 3OAUL 1A7QL 4OAWA 3N91A 4X6EA 4ZUTA 3WHXA 2DWTA 4J4PC 5C0BD 2J8UF 4CDHA 4GAJH 5HYJE 5IVNA 4JY6B 1TYRA 1UM6L 2CDEB 2EDXA 1N8OE 2NY5L 3CV5A 2C3GA 2ZCLH 3FU5A 4YX2H 3HS8A 1N6QH 3Q01A 1M42A 4PG2C 4W9FC 1GAFH 1ZEAL 3NCFB 3VXOA 4FFZH 1DQDH 4I0KA 4KZCA 3K7UA 1TMCB 1QW8A 3X3GH 3LOWA 3F7PC 1NC2A 4CW1B 3CFJA 1BXVA 1CD8A 4F7EA 4RZCB 4YPGB 4JFHE 1JRHH 4HIQA 4WWKC 2XG5A 1ZV9A 4QJ4B 3BZEB 5CLZA 4URKA 5JYLA 1AGDB 4Y9FA 2GJ6B 2IMMA 4TVPL 4E41A 2Z7YA 3BP4B 1E90A 2VXQH 3CBJB 4RMVA 3AG2B 4NAJA 2VQ1A 1TYJA 9PCYA 1XF5A 2ZX8A 2QPEB 1QSED 5IHUL 3HHSA 3HBGA 6TAAA 5FKAA 3FL7A 2ICES 4V11A 2CBOA 4G9DB 4U1IA 2WVVA 5E9DB 4LDEB 4MDJA 2R4SH 3HE6C 2YD0A 4Z5RB 5E8EA 1I3RA 3BXNA 1AS7A 4GW5A 4LLDB 3VTTA 3D39B 1WPCA 4MBOA 4UIMB 1K6QL 1MAJA 2APVA 2OSWA 3UP6A 3PXHA 3WEXB 3FQUA 2IO5A 5J1SC 3B1UA 4RIRA 2AZUA 3WUWA 1WWAX 5C0NC 5IMMA 5I19L 4S1RL 1LTXA 4W81A 4WU5B 15C8L 4OLZH 5D7KE 4N8CL 3GQFA 1TUPA 2ODIA 4LMQE 4ZS6D 1FFNA 4YBHA 1ZLUH 2D8KA 3QUHA 4JM4L 5DD5L 2OMTB 2C3VA 1XD1A 4L0ZA 3W39B 4Z7WE 2GTQA 1WBZA 1A6UL 1FZMB 2X6BA 4GG8B 4NKOA 4X7TB 2VR6A 1YYMH 5DEZA 3L3OB 4MD4A 3X11B 2BVYA 4C59B 5FK9B 5JQIB 4YXHH 5F3BA 3L6FA 1JN6A 1IGYA 3ZIMA 4JPIB 3ARBA 4I5BA 5F7KC 1FYHB 3BZ4B 3G3LA 4S2SA 1EAOA 3EDKA 1A9BB 3CFUA 4AYBA 4F8OA 4DP5X 5BO1L 2O5YH 1CD0A 2W91A 4OVVA 1JWMA 3JTTB 4KXZI 3OXRB 4GW4B 3KGRA 1WBYA 4Z8FH 4TVPE 4YZWA 3UTTB 3QIWB 2ITEA 3U9PL 4H0HB 4HJ0C 3S8FB 2X4RA 4AT6B 4DNLA 5AW0B 2X4PA 3AT9A 4DCQA 5F7UA 1D5XB 4JVUA 1KOAA 2PR4H 3TC9A 4KJPC 1VGKB 3V9EA 5DUMH 1EO8L 1W8EA 2A6KA 3MLTB 3P11L 4PJ5E 3IAGC 1TKWB 3BWAA 3QUYA 1HHGA 3BAIA 4HJJL 4P3CL 4P5KB 4XMTA 1WFUA 5DS1A 1KJMA 2ATKA 3VXTA 3SZKC 3QDGB 2DQEL 3ARFD 4OJYA 4Y4KC 5GS1C 1IJNA 1A7RH 1NIAA 1SYVB 2EKSB 3L4VA 1LO4H 3MNVA 1F4WL 2IANE 1D5MA 4HUVB 3O4LD 1TJGL 4PPTA 4JHWL 2Y25A 4HF5H 4LRNH 3EXLA 4P2QD 8PAZA 3ZTDC 2BY2A 1Q94B 5EU5B 2VZ1A 1S5HA 1C12B 2ATPA 1F58L 1N5YH 3VFGH 4ZPVB 1EGJH 2MQ3A 4GBXB 4I1PA 1BAFL 3SDCB 4ALAC 2QQKH 3WJJA 1G1KA 3DRTA 3M17A 4PJIE 4F8LA 4MNHB 2FZ3B 1XCWA 3QUZA 1AJ7L 1EEZA 4LCCB 2O5XH 2WIIA 1IGML 4YSAA 1BQLL 3HPLA 5AOIA 2JLPA 3BH8B 3GMPA 2BVUA 4LKXA 4PG9B 3JTSB 5F7FA 4F7PA 5KJRL 3TEYA 4YHLH 4L8CB 2WXPA 5BPPA 1CT8A 2Q86B 4A37A 3ULVF 2WKLA 3BKML 2RCSL 4MFHA 2EE9A 3X13A 1ED3A 2ED7A 2O6FA 3INUH 4P46A 5TQ2H 4NZDA 4NZ8A 3QNYB 1ZWIA 3ZHFA 4Z7NB 2F19L 3ULUF 3NCYP 3SYQA 2E27H 4D9RE 3UAAA 3IWVA 1U8QA 2AJZB 1YHPA 3PHQA 2BOCB 3JUZA 2Z8RA 5HYJA 3OKOB 3FU8A 1PX3A 4H7VA 1FJ1A 2QGEA 3X17A 2JMRA 4FQHB 3OKNA 1JMZA 3SPVA 5B1KA 3SD2A 5D5ME 3V52L 3DX0A 4JPKL 1X6LA 2X1XR 2V0AA 1BPLB 2A74B 1HSAB 4MD0A 2BP0A 4HCRA 5F96L 4EAEA 3ATEA 3QYCA 3S48A 1FIGH 2HFEB 4I4WA 3QEUA 5FA4B 2WB1A 3N85L 1G4MA 2BRRH 4WK2B 3EBIA 4H20H 1MFDH 2X5PA 3QCVH 5EZPA 5AW9B 4I0PB 5HHQA 5IEKB 1NPJA 5DMKA 3X1EA 3BIAX 4W9JC 1CMOA 5GS0L 3CDFA 3IXTB 4JG5A 2K4AA 1IT9H 3V7MA 3DTXB 2CXGA 3GSNB 2DWDA 4WUKH 3GRBA 1Y7VA 1U6AH 5IIEA 1X7QB 1TU2B 2YO3A 1IC5H 3EFDL 1E2ZA 3I9IA 1FWXA 4M5TA 4AVHA 1KLUB 2Q3ZA 3U25A 1CGTA 3I6GA 2Z91A 2VLJB 4Z7QF 4WUUB 4HG4K 5T8IA 4HAFA 4PP2A 1BFVL 3MREA 3T3PB 2XHNA 3VXNB 4U6HB 5C3IA 1PIFA 4OY9A 4OD1L 3LPWA 4Y8AA 5IF0B 4L3CB 2Y5EA 3OLDA 1IBBA 3GDCA 1I9IH 4BSVA 3S3DB 2BOBB 4BQ6A 2G5RA 1AQ8A 2YD6A 3ET9F 3OLIA 5D1ZD 5J8OA 2JELH 1U8PB 3GMQA 1PZ3A 4KDVA 4CU7A 3LKPB 3GHPA 4NRXB 5ICUA 1IBGH 3CSPA 1SBBA 3BDXA 5GRJH 5E4EC 1KLGB 4FQCL 4Z7WA 3TA4D 4HISA 2N7AA 4NO0A 1IEAA 5BJTB 1AHWB 3QCUH 3RAJH 3LN4B 1PDKA 2GJRA 3CQFA 2WLHA 1A14H 3OKKB 4WRLA 4E9XA 4J3TA 4X0NA 4NZUL 2ZCKH 3VGHA 3HE6B 2MCMA 1S78C 3A6BL 4OGAD 3AZUA 3X1BA 5IB2A 4BDVA 4Q97A 2BNQD 4PRAB 1MFVA 5ALBH 5EBWA 1OPGL 3GMMA 3KWVA 1MJ7L 1IBHA 3P9LA 3GSWA 3CJJA 4WWKA 1URIA 2D2CC 4G59C 2VLKE 4XVTH 5KW9L 1V3LA 4L4VE 4FI6A 3RIAF 1EBAA 4HEMA 4ECNA 3TNNB 2YEVB 3KPLA 3OPUA 4PJ6A 1RZIA 3WV0A 5L6YH 2AV7A 3MJ8B 2Q87A 5HVHB 1AXSB 4EUPH 1U91A 2FJGB 4PJ5A 4XMXA 5KYYB 3AY4C 3L9YA 4MD5A 2EINB 4PREA 5J6GB 4QRPB 2X2JA 1A3ZA 3CXHK 3J7HA 4JFYB 3ZXAC 4JPWH 3B5GA 3CIAA 5IEHB 5MEPA 3H9YA 2E8ZA 1HZHL 2CBTA 4QRTA 4OI8A 4APQD 4K55A 4F15C 4G7YL 3OF6D 4N1HB 2IANA 5FFGA 3IBOA 3WL9A 3TVMC 3V10A 3Q5OA 2ESVE 4P3WA 2WK2A 5D1QD 1YUKB 4JE4B 4DP7X 3C60C 4LBEA 3VMNA 1AGFB 1JHLH 3NSXA 1KV7A 4ZXBD 2OCCB 1AI1L 2UXVA 2YKKA 5IM7B 4ZFZB 2G60L 3DPDA 3QXAA 4ZX4A 4QI3A 2VLRE 2OP4H 4PJIA 5T1LD 1G7QB 4MLSA 1WWCA 3S5YA 3KYNB 3G5ZA 2DQDL 4OCNC 4JR9H 2HMID 4WEEA 3MA9L 3G04B 2PF6A 4N2IA 4F80A 2J1YA 4F9PA 3FB5A 3MOBH 2P3YA 1HSBA 4HGWA 3PWNA 3IDIA 3EADA 5E8OB 1AXIB 2F9BT 3S37L 3FB8B 3LZFH 3EGDB 3O3DA 5MEOB 1J1XL 2K1MA 2QKIC 4ZFGL 3CFMA 4WI0A 2EDKA 3CSGA 3EOTH 3PIQA 4YDVA 4OFYA 5FYJU 2FLRT 3KLAA 3VFNA 3ZYOA 9CGTA 3QPKA 5ENWA 1NOLA 3LKNB 1MRCL 4OIAA 4WI2A 1FAKT 1T66D 5EZLA 4NJ9L 4XNYH 3BPNC 3SBWA 3IDJB 35C8H 5L2KB 1RUAH 1CS6A 1YYLH 4JFZL 4TLTA 5E5MB 2G75B 1KXVA 3BKCH 3UG5A 3HB3C 1R9FA 1TSHA 5D5MA 1NLBH 3LHPL 1BYPA 3NFNB 4ADGA 1OANA 3T65B 5GSVA 2V5SA 1MI5A 3FT0A 5LUMA 4Y4KA 5E6UB 3GJFH 5CJOL 5GS1A 2BWIA 1OXYA 1FZOB 4N2EA 2EE0A 5KVGH 4GQQA 5ILTL 5GZOD 4OV5A 3DGGA 4JQVA 5DO2D 4JFEE 1J5OL 5DS8A 3RWFA 4GXVL 2A0LC 1TQBC 1CICB 1QLEH 3N1MC 1ZOXA 4O4YL 4NN6C 4UM8B 5LBSL 3T0EE 3WJMB 3C6LA 3ZBMA 1L5GA 1WDAA 2ZWNA 5F7WC 4HQQH 2DLHA 3UO1L 2FT8A 1GKOA 1T2QH 5DK2B 5I75B 1NQBA 1CF1A 5LCVL 4CC1A 4UIKL 4EDWH 2VMDA 1Q9OA 3KCPB 1DQJB 4FE9A 4WJ5B 4PRBB 1PSKH 1U3ZA 1WWWX 1CDIA 1MPAH 3K2UL 2V7NA 2WYTA 3IN0A 4ETQA 1ANUA 5IFAL 1FL5B 5JLZB 3LCYA 3SE8H 5D6DA 4NPJA 4YHML 4F8NA 5IBTH 3N41F 2A6DB 3QH3B 1TQVA 4A6YH 3DOHA 3ME0A 3HRZA 3CX5K 1BZ9A 5LGHH 4OJDH 1DUYB 5F1OB 4HX1A 3QQNA 4O2FB 3TYGL 3M8OL 4KVNH 4LRIA 1P5UA 5E51A 1CLZL 5FM5O 2AJSL 5ESVA 4MA1B 2ZPKH 4JW3A 3G6JE 4NUMA 3QZMA 1TDQA 2C9PA 5IB5A 3T8MA 3EF7A 3HPJB 3BAYA 4ZMOA 4M7LL 4XC3H 4AE0A 3L7EA 5E23A 5IB4A 3IS0X 2WLZA 4H8WH 4QTHA 2GITA 3ZO9A 3MRGA 1J5CA 4X7FC 3RI5K 3U7WH 4WEBL 4NM8H 1E27A 3QI9C 4PD4K 1HXYB 2ICWA 1L0XA 1G5AA 2E59A 5EF1A 2CHXA 1WCQA 4K7FB 4ZO8A 4N0CC 1E6JH 4OGZA 25C8H 3SPGA 4RWYL 1YNTF 3EO1A 1HN1A 1YEDB 3Q5YA 2J71A 3BEWB 3D4ZA 5HXMA 3HAEA 2Y7MA 1OARL 3CC1A 4B7IA 4GRWH 3K4DA 1XGYH 1Z5LB 1QLFA 5B1BB 4M7KH 4R0LA 3ZSTA 2M26A 3ZR5A 2MJWA 3L08A 2IDSA 5J1AA 1UEMA 5I1IH 4FQQA 3MGAA 5IG7A 2UZYB 4KKAC 1HKFA 1ZA3A 2NNXA 5DQJA 5IR1A 4FHBD 4IGBC 2BZ7A 1RIUL 3C87A 4DKFL 2NTFB 2VLKA 1SOKA 4GQRA 3K8KA 5K39A 2VDPB 4HP5A 5DURB 2Z7WA 4L4VA 1CDHA 4FG6C 3SDXE 1MLBA 1ORQB 1RL1A 1MW1A 4ORZC 5L0QB 1WCBA 1OF0A 1B0RA 3WS6C 4ZOEA 5LWYL 3JVFC 1LK3H 2MHAB 1H5BA 5HHOD 1SQ2N 2XWBA 3BYYA 3QWOB 3LPOA 2X38A 3VI4E 1B0GB 4NS0A 4K9EC 1SXBA 2IWGA 3S35H 1Z9NA 5BZWA 3H9SE 3ULUL 3ZE0E 3BN9D 2AXHA 4K7PH 4GUPA 5F9WC 1LEIA 4OZFA 3RNKA 2ESVA 2GKIA 1AZUA 4WHCA 3KL5A 4PWGA 2YUXA 5KEZA 2IADB 3UOAB 1QNZL 3VD2A 5D7SL 3F04A 3MX0B 3ZDZE 4KROC 1VERA 3A5VA 2HPTA 2QT6A 1HDMB 5F3FA 4EN3C 1E50A 4MS8C 2VLRA 5IP4A 3DBXB 5FO2A 4L3FA 1AC0A 3B7UX 4HJEA 3S2AA 4G1EA 4NSKB 4NFCA 2BC4A 3KYOB 3NIGE 3K2IA 1M7DA 1AP2A 2BNUA 4ZTOH 3O0LA 3D08A 5CBAA 1NGPL 4LIQL 1JS4A 3PAYA 1A5FH 3HE7C 3JWNC 4NRYA 1L0PA 3GTNA 3K6NA 2AITA 4G72B 1WC7B 2Z31B 4LSSL 4PVMA 2WZPD 4EDXB 5FYLH 1N70A 1YAZA 2DIEA 3MNDA 1AG0A 5AUMB 1XCTA 3BAWA 4MQTB 2R9HD 1DVFC 4XO3A 4L0YA 2X6AA 1U8MA 2R29L 4AQ8A 1KY7A 1PNCA 3G7TA 1DJWA 3STLB 3V5HA 5T3ZL 3FH7A 1SEQL 2QBWA 3L3IB 1EQWA 3RWGA 4UDUB 3FO1A 5EOTA 5FO9B 3DV4B 2WJ7A 4XNXH 3NPSB 2OI9C 4HUMB 2J3SA 3JQOB 4AZ8A 3CFQA 4HIHA 3GMRB 5FUCC 3FN3A 2GY5A 1QBMH 2ENPA 1OB1A 4W6YB 2ZUUA 2IPTH 4G6ML 3KZ8A 1S5IH 5J1TC 3KDMA 1Z1WA 3ULUE 3UAFA 4E42B 3I6KA 3R7RA 3WFBL 5IFHH 1GPOH 1RZQA 1U8KA 4XCYA 4KTEL 4GUCA 4K3GA 2F7QA 2QKIB 3EHBC 4JFEA 3TVMA 1EUTA 5LKNA 4GG6B 2NX5D 4ZQKB 1U8NB 4LU5L 3T0EA 5FW8A 3C60A 5C7XH 2XVGA 4XZUA 5DFAA 1IC4L 1RY7B 1VKXB 4HJGA 1ROCA 4GQPH 4UOJA 5FAAA 4FXKC 5C07D 5B39A 4U6YB 4I87A 2F8IA 4OLXH 1XV8A 2HWZL 1MFCH 3NRFA 2EO1A 2R1WB 1NDGB 3DX4A 4LIQE 3I6LE 4NM4H 1QRNB 3KXFE 3FTWA 3UPCA 4Y2NA 3CCHB 3FQTA 3HB3B 4M61A 1RIVL 1QAWA 5SX4I 3TO2B 3S3PA 1FDLL 4AVJA 3HZYB 5HDRA 5I1CL 2JF1A 5KYXB 2VMCA 2X10A 1QBBA 5B8CB 1ZA6A 2ED9A 1E9OA 3BQUA 1QWNA 5I18L 5G4OA 3OMAB 3RVXD 3VXMB 2AEPL 4ZSOB 3IPBA 3MODL 4JN1H 4PJBB 2OZ4H 3OJDA 3V4PH 4UM9D 4Q14A 5T3ZE 4AQEA 1HHJA 3FB6B 4CU6A 5GSRA 4CAGA 4HSAC 1T7YA 3AU1A 3G6JA 3VXRE 4S1DD 3LNEA 1TQBB 5I1GH 2B9BA 4NN6B 5FIEA 1KT2B 4IHOA 1OAQH 4NUJA 5I8KL 1QO3B 1A47A 1S9WB 4FQ1L 1LM8V 2WLIA 3BVDB 3TNMA 4HXBH 2X1PA 4JLRA 4U1NA 2GK0A 4DEPC 2EDFA 4DEWA 4ODWA 3GMOA 3QYNA 4LNVA 5L9DH 1KCSL 1Q0EA 2G3ZA 3NUKA 1GYAA 4KPHH 3LVTA 2C1OB 4JFPB 1E4KA 3VFSB 2H6PB 2E5EA 4L05A 4MDIA 4OZHE 2LGNA 2ZG2A 3PF2A 2NPLX 5LBSA 2G30A 5C09D 3UJJL 3V5KA 4J7RA 4ZDHA 4BSJA 5CLWA 1BLNB 1KFGA 3K1DA 4LLVA 5LCVA 1IV8A 1S9YA 2LFEA 2NYYC 2WXRA 4ADIA 2QVIA 4NKDB 2C9SA 2XVBA 1ZLVK 3VD5A 4EOWL 1KCVL 3K72A 4WFEE 2FIKB 3IFLH 1II4E 3SDXA 3QHZL 1F86A 1TJIH 2JKXA 1JXJA 43C9B 5GGQH 1GTNA 4N5UA 3A24A 1WICA 3MO1B 3MXVH 3ALXA 4I18A 4PGCB 2QSCL 1Y6KR 3F58H 2ZWKA 1ACYH 3VI4A 3KE0A 2ZCZA 2PTTB 3LZOA 2OS7A 2YAOA 1DQML 3JWDL 4XP6L 1U3HB 5CUSH 2P9RA 2AEQL 2BVEA 3CZLA 4J3BA 3ZMNA 2AJUH 3O8XD 2ZG3A 3NDYE 4IBTA 3UTPE 2YHGA 3H9SA 1F3DJ 5INDB 1UM5L 2B16A 1JXDA 2DQHL 3RBGA 4RFNC 4YE4H 1KGIA 1P4IL 3ASOB 3C5ZD 1S8DB 2WXMA 2FHBA 3GHEH 4IGBB 4PY8J 4UILH 5I0ZA 1W2KT 4F7MB 2E7BA 4LSRH 3BYTA 4HIPA 5INCB 3OC8A 4QNPE 4N0UB 3WENA 1VGEL 3BIKA 3LSOA 1QOKA 4HIIB 1KGYE 3E1F1 1K5NB 3QQ3B 5AOMA 4OGXH 5FHAL 1OAKH 1FLTX 1PZBA 5DXWA 4JO2H 2FX9H 4F1ZA 2KZBA 4PCKA 1RZJC 3D18B 3SGDI 1CR9H 1ZS2A 2WB7A 5JR1H 1A6WH 3H6AA 4EIBA 3MLRL 2FATL 1AQDA 1IGJA 1RZJL 2CKBB 3F3HA 3RDTB 1UD5A 4W9EC 4DPAX 1OKEA 2J2ZB 2BS71 3OJ2C 5DRWA 2LHAA 3DX8A 3GEWB 4F2MB 4Q2ZB 3WUZA 5F89B 5T3XH 3Q8AA 4HIJA 2QHRH 4Z3HA 2WZ0A 1SXCA 5F8QC 3PWUB 1P7QB 4ODHH 1M2OA 1T5KA 3QORB 4Z7AA 2HVKA 5BRZB 4W1TA 1UA7A 1CFTB 3DDGA 1FCGA 5IQ7H 3WS6A 1N68A 4ZMZA 1NKOA 4EI5D 2F8XC 5GGVY 3AWGA 4YGAB 4EN3B 3FAXA 3NJJA 5J3HC 4P5MA 4W9LC 3O9WD 3UPAA 4I3RH 2GJJA 1X5ZA 2YPLD 1PKQE 3L95B 4WW2C 5DVOA 5EZIH 5IJCC 5JNYA 3ESVF 4JO1H 4DH2A 3ZGIA 5C0BB 3ZDXE 3VSQA 3LRSA 1BJ1J 4MMZA 1PL3A 1THAA 4XX5A 4C56E 1R1CA 2VXVH 3A3YB 1QLRB 5ACZA 2YA1A 3DX6B 4FFWD 1UOLA 5D7EA 1QKZL 1KCUL 4GQ9L 1OIOA 3DHUA 4C47A 2K0RA 3KYMA 4JE0A 2CM5A 4RCAA 3EO9H 2ZXGA 1HH9A 2VLLA 3FZUD 1FSKB 1CDGA 4Z78A 4R7DB 3D4GA 2Q2EB 5EO0A 1BJMA 2WNWA 5HBBA 4J3VA 3CMGA 3RWHB 5K9OB 2GI0A 2OTUB 1W72L 4LVNB 5B4MD 4NO3A 3VFWB 4JRXD 2BSED 1I8MA 5IBLC 2EH8H 4D7BA 4XVUD 4F8QA 1LEGB 1AR1D 1LLAA 5FO7B 3Q6FB 3MYJA 5F88B 2DW5A 5CJ8A 4RWHA 4ELKA 2NQ3A 3QULA 2R29A 5GGSY 1E28B 4RGMB 1J9RA 4B5EA 4WW1B 4F2FA 3S34H 4DZ8B 2H1PH 3VD0A 4TUKH 3JV4B 1YPZE 1QSEB 2VDOB 4UT9H 4Y4HA 3ZZSA 5I1KL 5EU7C 4OJFH 1XQ4A 3RWIA 3EHBB 3MRMA 3VXRA 3BDBA 3GXFA 4UBDC 1GS8A 5DD6B 2HFFA 4TSCH 2UXTA 2WINB 2XQYK 7PCYA 1QI3A 5IHZA 5TPWH 5JQ6H 4N3UA 3DVNB 1FGNH 4FCHA 2LLGA 4N86A 1SEBB 5BZXA 4ZYKA 2LABA 4WO4C 1UGKA 3Q2LA 4KK5D 5I6XC 3US0A 1CTOA 2WQVA 4TRPH 5EN2A 1QSFE 2DQFA 12E8H 2F8OA 3L1OH 4BKLA 3DKHA 5CSZB 1OE3A 2XRAL 1KPVB 3OHXC 4KAQH 1AO7D 3O2VL 4OZHA 5LG6A 4IS6B 4JQIL 1BEYL 1RK7A 1UWGH 3CVHL 3HMWL 5KN5B 7PAZA 2OK0L 2UZPA 5F6IB 2PKDA 1FE8L 5C8JA 1G1CA 5BOJA 1YJDH 3DETC 1AR2A 2QSTA 4FXKA 3MV8D 3GINA 2FX8L 5IHHA 5I1HH 3P9MA 1BOYA 2ZKYA 3IN2A 1CD1B 3GI8H 3EYQD 4O2EA 4U1MB 4X9BA 3SJVA 4D3CH 2F6AA 1L4IA 1NSNH 1TF4A 1OAJA 2RALA 3AGWA 4XE0A 3QFJB 4L8DB 3O4OC 3RZCD 3LKQB 2NR6A 1ZTXH 3ECVA 1URZA 3HC4H 4D0DB 4H8UA 5DJCA 3ERXA 1EHLL 2Y1YA 3KJ6L 1BCIA 3PL6D 5EU7E 5EU4B 3VQ2C 1UD3A 3NSYA 3BI9X 3BUBA 1PGRB 2ILLA 4Q8BA 4XBEH 3ARGD 2MCAA 2ZOOA 3BPCB 3KWWB 3ARFB 4Z3JA 2OTWA 1A6AA 5IB3B 2CWRA 5JHLL 1F90L 4HIXL 3AM8A 5HHMD 1SY6H 1P1ZB 3NACH 4HGKC 3WBDA 3FCGA 4PJAF 3O4LB 4ODUA 4O51A 1BVLB 1S7XA 2XWJA 1F3DH 3WY4A 1M9WA 2DLFL 1SPDA 3LS5H 3MFFB 4C4UA 5J56B 1XR8B 4CJ0A 3ZQ9A 1IIIA 1RMFL 2P7TB 3IB4A 3VFRA 4JM2C 2MCG1 2XVKA 3S35X 3B9KC 2WBJD 1SOSA 4MZ3A 2SEBB 1XXFC 3WTUA 2XX1A 4K7PX 4Y4FD 4KY1L 4PJEE 4XBMA 3MJ7A 4HCFA 4G8FA 2W88A 3BLBA 3RE0A 1IQDB 4X50A 1O7SA 4Z18A 2Y6TE 5HHPA 1S7SB 1JV2B 3OX8B 1GS7A 3HJEA 3GI9L 2CR0A 4RFNB 5KWYC 5AW8B 3OKDB 5FYJH 3D0LB 4LB8A 6CGTA 1A02N 1RHHB 3SE9L 4CC4A 3MRDA 4E0RA 4PJFE 4LLQA 1RU9H 4UV7L 1XTLA 1UKSA 1CB4A 5C0DB 2OLDA 3OXSA 4TS6A 4ETYA 3FTGA 1PKQA 5CEXA 4XPAH 3U9UB 2LQRA 1F4XH 4MJ4A 4GI8A 4FXGA 4KU1A 2NZIA 2MFNA 3PAZA 4LEOB 1G6RH 4RX4D 4C56A 1FO0B 3O45B 4FG0A 2QSQA 3MRJA 4HS6B 4MXQD 2VXTL 1JG9A 1PIGA 1OSPH 5B22A 1GHFL 1V3KA 2D2OA 3BGFC 3GLZA 1V27A 3QRLA 4MMYA 1UXLA 1XDTT 2VR5A 2V2WB 3JWOH 1I7ZB 4XO9A 2EDDA 3WNKA 2BRQA 4X6FB 4XPTL 1BJ1H 2HAZA 3AREC 4JO8A 1TLKA 5E95B 1CGVA 3UC2A 2Y7LA 4KKQA 4EN2A 5GIRB 2GHZA 2XQYG 3O6ML 5H35A 2FBRA 2Y5TB 2HN7B 5DHYB 5JW3L 3RA7H 2HH0H 2VDLH 1T03H 4JY4B 3QQXA 3AXLA 4R97C 1HZKA 4X6DB 4WU7B 5DUBB 3OGCB 1QI5A 1IC1A 1NCTA 3WLBA 1UD6A 1I8IA 2D7NA 3JYCA 1EDQA 1RERA 4D0BA 1YPZA 3LDBB 1KLFB 2X40A 3BUYB 5HJ3A 2X4QA 2H2SD 1R3LB 5I24A 4LHUD 3M1BA 1O9ZA 2G2NA 3JWNG 2YPVL 3PQYD 2WNGA 4JFUA 3FU3A 4YL4A 4XAWL 1NCAL 3UAJD 5BS0D 5IK3B 3T0WA 3QIUA 4IM8A 3BKYL 5DSCB 4ZW8A 3KPQB 2ZICA 4NP4H 5JORA 5D1ZB 3CFDB 4NNYB 4XWOD 1R3IH 4YHOL 5I1JH 1QSFA 2X70A 4MNQD 2G4EA 2JJUA 5DA0B 1M6OA 4F7CB 4JGNA 4EQ2A 3MRIA 1JGIA 1IQWH 4YHPB 1YQVL 4YHIA 4KO7A 1P4BH 3NCJL 5CCKL 3IDXL 5I0YA 3WMPA 2OJZL 1CXEA 1E9QB 3L3KA 1OL0A 4N0YH 4TULL 3VA6A 2KBGA 2VDKH 4M56A 4OZGE 4Z7NF 5IY5B 2ZJSL 1F4YL 1AE6H 3DSNB 1T5XA 3NABH 3UYOD 3H3PH 1CF8L 1HOCA 2XPGB 5LGJA 5EOQH 5F1IA 1ZD6A 3PXLA 4NXKA 1DEEB 5DYOA 4EEEA 3DJZA 2BNQB 4XCEA 5ADOH 4YNYB 1DQTA 4IBUA 3BZDA 4JANA 4RISH 2Q10A 3TEWA 1FG2A 4WO4B 3NMEA 1CYXA 1PMYA 1ZE3C 4H25A 4AQZA 5EDXA 1S7WB 4ZUUB 4MVBC 4PRPE 3T4YB 1DHKA 4NPKA 3SOBH 1R4XA 2GJ6E 3REWA 4BZ1H 1J1PL 4U0QB 4PB9H 3HR5B 4PS7A 4QY8A 2E74C 1U8HA 2APTA 2LV4A 2PXYA 3B43A 1Q0XL 3OHXB 3QSKB 1MEXH 5ID1B 2FR4B 2Y36L 1ZT4B 5D7JA 1JBJA 3IM1A 4OIFA 5E00B 2GEEA 2NXYD 3OQRA 2ZYHA 2XKNA 1KYFA 3D39E 4XMKL 2NY0C 2PCPB 3MBWB 2FECL 4I3GA 3V0VB 3QEGH 5BOPA 2W92A 4U1KA 3ISWA 3S9DB 1V7NL 5F44A 2HJLB 5FS5A 1JF5A 3GSRA 4IRSD 4AE1A 5B38B 4C4BA 5E6RB 3OKLA 2X1QA 1PLAA 2ARWA 3TEUA 4Z23A 1SJVA 2ROYA 5C7ZA 2W0LA 2HA1A 3ZR6A 3GRGA 2CHWA 4LVEA 3EOBB 4ZXBB 2YUVA 4JQIA 4WVRA 4EE2A 3CVHA 1A7NH 3D0VB 4GO6B 5T1LB 1HU8A 3HN8A 1QHOA 2M2DA 3B4NA 4LLWA 3TBVB 5F9JA 1SMAA 2FNWA 4PJEA 3K5SA 4C83B 4H5SA 1QASA 4ODXB 4GEIA 3VDAA 5ESQB 4P9HL 5CMAB 3G5VB 5KG9A 1CFQA 3SGJC 1E4JA 4PGEB 3WNLA 2X3AA 5I76B 3W9EA 2ARJB 3K46A 5T3XD 3TN0A 4AEIL 2YA0A 4PJDE 1FQ9C 5K1VA 1NGYB 1JYNA 2MRYA 5DD0L 2BDNH 5EU3B 1LO5A 3WHE0 2YPKB 1TZIA 4QD2E 1SRDA 3FN0L 4PJFA 1U8CB 5FDWA 4BM7A 3KPMB 1HC1A 2Z8SA 5D7HA 2VZTA 3VG0H 5CHNA 3CVIH 1H3PL 1QA9B 1A4KB 4WSKA 3UIYA 2Q8BH 4C55A 2BP8B 3EYUH 3B9KB 4Y2LA 2F53D 4P2OD 5EEZA 4JAMB 5AL0A 3P1VA 4P23D 5DVPA 5HY9B 1ZHKA 1R0AH 3ZGHA 4XN1A 1UHVA 5JHLA 1Z3GH 1BMZA 1CXHA 1P7KB 4ESKA 3K2KA 5E8DL 3X1NA 3QDGE 4X80H 5KANG 5I1LA 2WMPA 4G7VL 2XJLA 5C2BH 4NWTL 3DIDA 2Q3XA 2O5ZL 3DI3B 3LQZA 3MV7A 1YNKH 3TT1H 1A22B 4HUXB 4U7KA 4IMKA 3ROLA 4LCYA 4NQED 3ULVH 1N59A 1BXUA 5JIDA 3BVWA 4NPYA 4QGYA 3CFBB 4M48H 3U82B 1JD7A 3DOIA 1MFAH 3V2AR 3ZT7A 5H37G 3PABB 5MERA 4A7TA 3EG9B 2XWEA 5EU6D 3UC0H 2FO4A 3FCBA 1N5AB 2BMKB 3MA7B 1GY2A 1Q4NX 2PR9A 1NCNA 1EUUA 1BZQK 2VMJA 1ZIBA 4BK4A 3F7RA 4WTZA 1NAML 1KCBA 2BP3A 1LNUB 3LZRA 3QA3A 4K94H 2R2EA 3ECUA 4U0RC 3PV6B 1MKFA 5EA0L 4YHYC 4OTXH 1DBKH 3SKUD 1MHCA 4HLEA 2UWEB 4PV9B 5E08L 1DDTA 1JPGA 2JTDA 1BIIA 3PU7A 4OKVB 5JW4R 3JZ7A 1KBGH 3H42H 1UGNA 3FSAA 4CMMA 2EE6A 5EUKA 3WTXA 1ZDQA 2WW8A 5KYUB 4P4RA 5A7BA 4MDRA 2K9FB 1Q72L 1BDYA 1MVYA 1P4UA 2ZSVB 4TQIA 4OZGA 1QFWH 4MAUH 3RI5F 3L3JB 5IROC 1JK9B 1I8LC 3CMOH 3U4BL 3L5WB 1XL6A 4L1DA 1MH5A 2G4GA 3SY6A 4KKLD 4U3CA 3CDGA 5EULV 1LHZA 1OSZB 2NDFA 1ECYA 3QFGA 4UOW1 4RZCA 3QEQD 4KK6C 3AGVA 3ZW3A 2EO9A 4OF3A 1CZ8L 1OTTD 1N2RB 4PRPA 4ZS7H 1IIKA 3CVBA 2GJ6A 1FORL 3WKPA 1JF1A 4KI5C 4PS4L 2MOVA 3Q9PA 1TFPA 5GS3A 4Z7IA 5J13C 1P0SE 4UDTA 2CRIA 4ERSL 1MHEB 1QR4A 1M3IA 4FZEL 1ASQA 1PD1A 3O3BA 3T3PE 1SJEB 4HCGA 1T22A 3HFMH 3D39A 3WJLC 3GSQA 3ZJAA 2OAAA 1F2QA 2NQCA 3BO8A 1USQA 4QXVA 2CLRB 4TUOA 3WEXA 2GPZA 3C08H 5BZDB 4LPYA 1RK0A 2QQLL 4G5ZH 3MSPA 1ACXA 1LEKB 2WBKA 1SDDA 1NMAL 3S3BB 5EEXA 2JLLA 2OMTA 3O6FC 4L0PB 2BIPA 5LXGL 4A04A 1KBPA 4X7TA 4D0CA 2R0LL 4ZUWB 4QJ5B 4G43B 4MXWH 5DC4B 5FK9A 3RP1A 3VRLF 1D5ZB 2YQGA 1IJ9A 4UTBL 1H3XA 3AG3B 3MRRB 4JPIA 5E2TL 3VM5A 3FB7A 3BZ4A 3IBEA 2FQEA 1XF4B 4LCUB 1HI6B 1A9BA 2PWEA 3MOQA 3OC5A 3QO0A 4PJDA 3SGKC 5ESAA 4PBVC 5FYJD 3SCMC 4GLRH 4W4OA 3JTTA 3ABGA 4GW4A 3FQWA 2VMEA 4HWZA 4UOQA 1GC1C 3RY4A 1S7VA 4I9XA 1IM3D 1AXTL 1BQUA 3TPKA 1KCRH 4NC0B 4AYFA 1K4CA 3PWPE 1MAMH 1D5XA 2BIOA 2RQEA 3GKZA 1RUMH 4P3DA 5B38G 1ZANL 2Y2TA 3INOA 5BVPH 1VGKA 1AMXA 2FX7H 4LSVH 3MLTA 4MX7B 1H19A 3RU8H 2NXZC 4AEHL 4L1TA 3O81A 5T1KA 2X9YA 1LO3L 3ABKB 1UEYA 2HX9A 1A8ZA 3K1KC 3QDGA 3N1FC 2VERN 2B14A 4XB8A 1I9JL 1SYVA 4JO3H 5J9PA 4RGOL 4YDMA 1TOXA 4GAGH 2Z7ZA 4XNZB 4NKIH 3MLVL 2DLEA 3WFHA 3P4NB 1Q94A 1ZHBB 1C12A 4NAQA 4FI7A 4JDTH 4ZPVA 3RY6C 3QUMB 2FEJA 2JB6A 3MBXH 1DZ0A 4U1JA 1O9VA 4GBXA 4ZW3A 2ADFL 5C07B 3NGBB 2WVSA 2Z1KA 4MNHA 1A1NB 1Y1DA 1BA9A 1WGVA 3V6ZB 5EEYA 3VWKC 2GSGB 2J20A 1BF5A 3L2NA 1KEGL 1MJUH 5ACMA 3BH8A 1IFHL 3Q7JA 4PG9A 5CLXA 3JTSA 4OM0L 4P9MH 3SGJA 5L7XL 4JJHA 4M1GL 1ZIAA 5C6TH 5B3JF 1DSFH 3CHQA 2Q86A 2ZP8A 2FT6A 3W81A 2R1XB 4UM9B 2UYLB 2H32H 3WFCL 4YBQD 1YUHB 5DHDA 4IU3A 4AMKL 3QDMB 3QNYA 4HDIA 2X6CA 2BFVH 3NAAL 1TEYA 5GRVL 2GHWB 5F72S 1T83C 1XCQB 2F5AL 2AJZA 1WT5A 2IWKA 1SBSL 1TIUA 5EO1B 3D3VB 3OKOA 1JYWA 1TQTA 5E24E 2EECA 4KRNA 1WGOA 4FQHA 3PP4H 3QUXC 4POZC 4K07A 4NDMB 1RJYB 3T2NL 1WUZA 4GKNA 4U1SA 1VJSA 2R0KH 3HIZA 1KG0B 4FMKA 1HSAA 4FNLL 3SDDA 3TT3L 1OWWA 3ZL1A 3KGUA 2XQBL 3K80A 3Q6GL 4PYGA 2A9DA 4P2RE 4MSWA 4R7LA 2VAAA 3VSUA 4I0PA 4XCNA 2G3XA 5A6IA 1YMHB 3AQXA 1KGWA 5IW1B 5BV7H 3IXTA 3O3AB 4KHXH 5ISZD 2F54E 1BEXA 2FUQA 2DB8A 3SPHA 3F5WA 5J6HB 3LRMA 1NICA 4O02L 3LKOB 2X4OA 4GG6F 1DJXA 3G5YA 1CDBA 5AZEL 2WXGA 4OCXL 4MHHI 3FF7A 5TK4A 2XN0A 3BUDA 5AW6B 1XL4A 4YSPA 1KLUA 3GJEA 1BSIA 1GGYA 2B4CL 4KKRA 4EUPB 1NAMA 2NYZA 2LT9A 1WFNA 4Z0XB 4DN4H 1BBDL 3DMMC 4AY0A 2ZCHL 5IF0A 2N1KA 4B9ZA 1JZ8A 5I28A 3O8XB 2G9HA 4G8EB 4KXDA 4I2XE 2MQ0A 3Q1SH 3H9HA 1KB5L 1UG9A 3SO3C 2X4TA 2NTSP 5I0WA 2NY3C 5F21B 5HD8D 1T0PB 1Z0MA 1U8PA 5D72L 3BPOB 4H8QA 3GTTA 3PWLA 1N64H 4KZDL 5F2FA 1T4KB 2BVOB 1ZLSH 5KAQG 2CH8A 4PJBF 2NY7H 2HRPH 5F1SA 4H44C 4MNGE 3U2SB 1ID2A 1AHWA 4HKJB 2CLVB 3LN4A 5A16A 1J8KA 1W8OA 1HNGA 1SLUA 5MEQA 5J0BA 4G8GB 4LOUD 1HH6B 2B3IA 2OMVB 5D6CB 3OKKA 2A3TA 3BISA 4FQJH 4OFQA 2BSSA 1ZV5A 4OLWH 3E8UL 1XH2A 3BSHA 3QHFL 2KLSA 4G9FB 5GGUB 3FO9B 4GH7B 1XB3A 1XB6A 2DMCA 2F7IA 2YKLL 3MRLA 2H47C 3PNWA 1HESA 3PHOB 2VZOA 4LSPH 2W65B 5ID0A 1ORSB 4RH4A 5F7DA 1TVHA 1U9KA 2HRLA 3DJSA 4B0MB 1KTLB 2JKNA 2WZ5A 1GGBH 3BP7B 2GTWB 2KL6A 4HCIA 4ELMB 3GNML 1D9KD 3SE3A 2XETA 3PWPA 2OYMA 4QTIH 3T09A 4B60A 4EI5B 2XX0A 1D6EA 4G7QB 4XE5B 3S5ZA 4K73A 3CZKA 1A3LL 4MCZA 3QXTA 4TVSa 3VVWA 4YLQT 4O9HH 5DEFB 2YPLB 4WY7L 5HHVH 4JN2B 3V0AC 5HPOA 5J6GA 3ES6B 3G5XA 3U7YH 5IMLB 4JFYA 2OJEA 4AKQA 2CUAA 3MLUL 5IEHA 1KN2L 3MOAL 2XT1B 2XIIA 1ETA1 4AJ0A 4JFXB 3MAWA 1NEZA 1R19A 2VO8A 3LVEA 3VXSD 3VSVA 3ZT6A 3GJFB 4EQ3A 4ZMVA 1AFVH 4R96A 5IKCA 1DQQB 4WEMB 3IDMA 4ADJA 4U6VH 3P4MA 4AYGA 4IBVA 2FYVA 3FTXA 1JIBA 1J8RA 3WEOA 1XSJA 5BO0D 1QLEB 3HKFA 4G80B 3ULVD 2XXCB 5T5FL 5LBGA 5IM7A 4LLUB 1UZ8A 1VEOA 5I74C 2GYSA 5I17B 4L23A 4XAKE 3KW8A 2VL5A 1I7RB 3F2LA 5HGDB 2ITCA 4PJ9D 3MFGB 3IF1B 1OP3H 2J4WH 3B3IB 4UTBA 4X7EC 2KZ1B 1DLFH 1XH1A 2NY1D 2XN1A 3ALWA 4K7PY 5DRXB 1VFOA 2DIBA 3FRPA 3FYEB 4TSAH 1LDPL 4LPUA 3VQLA 4ANUA 1UA3A 1AIZA 1JZJA 3T1WA 4B9IA 4AK2A 4A6YB 4IRJD 1SHWA 5H4ZA 4WCYH 5E8OA 2OMWA 3S36H 3KH4A 1KENL 2YAMA 4LQFL 4G11A 4IQHA 3SCMA 4XXWC 2DKUA 2NW2B 2OSXA 4UB0H 5CR1A 1U58B 3BT0A 5CJBA 2NLJB 3IU3B 3TO4C 4JUSA 4HWBH 5E9NA 2FEDD 4WHTB 1CFNA 4XHQA 3EZ8A 1EHXA 5AKTA 1G7HB 1NBCA 1JGUL 3HG5A 1OGTA 1JXKA 5FW6A 3P54A 4K8RL 4U4BA 1E5UI 1UZGA 3Q5TA 2E86A 4X6BB 2WV3A 1GGCL 5CEZL 1MY7A 1GGUA 2YLKA 2ZUQB 4HFUL 3VWKB 5I2IA 2ORBH 1GIGL 1KN4L 5EOCJ 1U92B 3VRIA 1CD9B 3T65A 4OZ4B 2VABB 1XH3B 3HC3L 4X9GA 3W11D 4ABWA 1WS7A 3FMGH 2FWUA 2OQJA 2DQCH 5CILL 4MAZA 4P2RA 1AO7B 4JG0H 4P4KC 4FMVA 4RAUB 3DARA 3VD4A 2XZQH 1GZQB 3GJFK 4UM8A 3TX4A 1E7UA 1UJTA 2QQNH 4FQXA 3WJMA 4FG4A 4ZG1A 4FNQA 5EBMA 1OTSD 1AACA 3ZTNL 1NDMB 2WQ8A 2Z93A 5C0GA 4U1LB 2X7LA 2DDQL 2AQ3A 5DK2A 3RY6A 4IKLA 4JY5H 4UCFA 2F54A 3LJ3A 1GZPB 2MTPA 4Z7OE 3MV8B 4MKTA 1SDAB 2XIDA 1TETL 4L8SC 4PRBA 3H3KA 3TA3C 3WIIH 1UH4A 4S1QL 3FQXB 1JERA 4N2LA 4R5TA 4X5QA 4XBGB 1QRNE 4UI2A 1B6UA 2Q76B 5DEJA 3K5RA 3PYCA 2Z4QA 1NCDL 4A68A 1I8UA 3ZYJA 5T1DH 3RZCB 1NJ9A 3UDWA 2BERA 2OW7A 4GEJA 4MJHA 1NC4A 2KH2B 1NCOA 1M1XB 1XH0A 4P0DA 4R26L 4QJ3B 1OAYL 2CM6A 2AK4D 3B2UD 3OR6B 4IK7A 2CO7A 3DDFA 3P40A 5AVWB 5DYFA 1IB5A 4G1MB 1QTSA 4I2XA 4OM1H 4NZTH 1UXWA 4X7DC 2HG5A 4ZMYA 4FHJA 2B2XH 4XWGL 4R2GD 3HPJA 3GO1L 2FL5B 2FH6A 3ETBJ 3EYVB 4XMUA 5CZVH 2DI7A 3A21A 1N9PA 4X4ZA 1DJHA 4M7JL 3QUXA 1J0IA 1HXYA 4K2UL 2BSCA 2HT2D 3NIDB 1WV7T 4M4PA 4MNGA 2VMFA 1CN4A 1JPSH 2Y07H 5D7LD 3FCTB 3GUFA 3L7FA 1J0HA 4NCC2 2W0PA 1YEDA 4QOKE 3RTQD 3BAXA 4YDLB 3K0YA 1UYWH 2VISA 2WBJB 4K9JA 1Z5LA 5EN3A 4AEFA 5C0FB 2DTML 4Y4FB 3QNXA 1T4WA 3D51A 3KH3A 4QRSA 4XX1E 4YJZL 4KVPA 5MI0B 2Q6WB 2UZYA 4FJ6A 3TXAA 4EUPG 3QIBC 1XGRB 5HGAA 1ZGLM 4R7NB 1PS3A 3DX9A 2NTFA 4HKBA 2V3FA 4B3VA 1DJIA 1V3MA 4O02A 4QXGL 5D96C 2A4ZA 4MJIB 3OM3B 3IGKA 3ARDD 4EXKA 4ONHB 3ARUA 4YHZH 3TWCH 2DQTH 5AZ2H 1HILB 5IHLB 1OCWH 2D7MA 1G9NC 3C75A 2VDRH 3CZFB 3EFOA 3WD5H 4YAQA 4LF3A 1CLVA 3EJYD 4LPCA 2MHAA 1I8KA 1QVOB 1N7MH 4JG1L 3CFCH 2OMUA 2XWRA 3MCKA 4AZ8B 5FGCE 4HWNA 3HVNA 3ROOA 4FLRA 1B4JH 2EYRB 4OZIE 2H9GB 2R7EA 1KB5A 1WZMA 2XXGA 2HT4D 2BW4A 1VHPA 1ZJAA 2PWDA 5JXAH 1GL4B 4EZLA 1MCPL 2LLLA 3BVNB 3E0GA 3MKGA 5EFIA 3KPOB 1MCSA 3TZVC 1AANA 1FN4B 1G9HA 2IADA 2NY6D 1ONQB 4GUQA 3CLFH 5HDQH 1MHHA 3WEMA 1OALA 3MX0A 3AAZB 2GB2A 1HE8A 3NCYS 2H0FA 3RUGB 1IM9D 1A1OB 4NNPL 4FI8A 4U4IA 2Z65C 2EDQA 4AM0A 2C26A 4OCYH 3KW7A 2FJUB 4DVRL 2J12B 4NT6B 3KYOA 4HUNB 3LNGA 3BT2H 2MCPL 1RIHH 1DR9A 1GJWA 4DOHB 1MUJB 3GSVB 2Z31A 3QNFA 4AC2A 3PUUA 4WFGE 5CN3A 2CK2A 1HQ4A 4RMBA 2ENSA 1RURH 5DHXB 4OVUA 3V4PB 2P8MB 3HMXL 1A7PH 3OGOE 4WKZB 3STLA 2XA8H 1H8LA 3TONA 1DBBH 1YJDC 4NKMB 4HALA 3SY0B 4Y2DC 1ULVA 1IBZA 5K5YA 1OAZL 4AH2A 4GJTB 5ACLA 5I74B 4NNXB 3KWXA 4XVOA 1XZWA 3APMA 5BS0B 1P1VA 4GAAA 5E4IA 1SOQA 3Q8EA 1G0YR 1NDTA 1S7TB 5DJYA 4Q9QL 3QQ9D 3S4SB 4PW4A 1G1OA 1I3GL 5D7IE 2OMYA 2RAMA 2XVLA 1MW3A 3LQMA 1NCIA 3NJNA 4FMFA 4YXLL 5IHWA 1COBA 1V55B 1WP6A 2QEJA 4YDIL 3WN5B 2Z35A 1B90A 2XTJD 2NSXA 3QJFA 2QADC 3FU0A 1JSYA 2AJVL 2B1OA 3QO1B 5T5FA 3NT0A 4ZQKA 1U8NA 2XFGB 2IBGA 4ZMTA 1I7UB 4N26A 5EOCH 3HS0C 2PP9A 3H2QA 4IRZH 5GGVL 2F58L 5GJSL 3OMZA 2B3RA 2V8MA 6FABL 4KKNA 1HEZB 4RFOH 3ULSA 5JOEA 4GP8B 4Q6IB 4X5RA 1INEH 3P0YH 4U6YA 2X44D 2QV4A 1YN6A 2DQGL 2JQZA 2E3VA 3GSUB 1QRNA 4QCIA 3CCHA 4KKCC 4LT7A 4HZLA 3SBRA 3TO2A 1PZ5B 4MQSB 3FN9A 1X9QA 2JQMA 4D8OA 5AALA 5JDSB 1LP9B 3C5SA 4QHUB 5DVKA 1KJ2B 2BFGA 4R4FL 2J6WA 1QSEE 2M83A 4P4KB 5CGBA 3KGTA 2RA1A 3H2PA 2OCJA 3TO4A 3I3DA 1G1YA 5ECGA 1QBLH 2IMNA 2NXYB 5SWZE 5A43C 3BRFA 2EC8A 4WW2F 5IBUB 1KT2A 3DIFB 5HDWA 4R6UA 2EIEA 4X6DF 4K3JL 1S9WA 2BO0A 2X41A 2GC4C 4WENB 5JHAA 3E2HB 5CU5A 2LOEA 4N2HA 3X14B 1D7DA 1T6WA 2XWTA 3MXWL 4L8SB 4PJCB 2FGWL 5HGDA 3TA3B 3W2DL 3MRKB 4LLMB 2VZUA 4JO4L 2EDHA 1YY8B 2I27N 3TBTA 5K9JH 3VGFA 4Z7VF 5TDOB 3JV6B 4KHTH 4NLHA 1E4WL 4QOKA 4HT1H 3O3EB 2C1OA 4JFPA 3D7PA 2H6PA 3VFPB 4CL7A 4Y88A 3EGXB 5DFVD 1YYCA 2C4FU 3QHTC 3DVFA 4LSUH 2Y6SD 4PJ7B 2C3HA 1T0NB 5TH2A 3L4ZA 4J12A 1BZEA 1TFHA 1TZAA 2AV1A 4RGNC 4X99A 1SMOA 5HVFB 5CXPA 1EX0A 1T7ZA 3CXHJ 4MS6A 1DBJL 4QLWA 4WFHD 5K59E 1IGIL 3P3RA 3D5OF 2A99A 4A66A 43C9A 2X3CA 3HI1A 4R4BB 2BIIA 4PJ8C 1CGSH 5K69A 5EBLB 4PGCA 4NN5C 4Q74A 4ZX3A 3LIUA 3R18A 4XH2A 5KYWA 3BVUA 4XNQA 3I9GL 4OZIA 4M5ZL 1KTBA 4YFLF 3FS9A 4JL1A 1EAPB 3CXDL 1E30A 4P2OB 2IVFC 4OFDA 1I9RH 5TE7L 2F2HA 2DQIL 2X0VA 2XN9B 1K9TA 4XGZA 4BFJA 4PCTA 2EABA 2GVYA 4ZMXA 5L88L 3VX1A 2J73A 5C1MB 5E1HB 4F7MA 3AW5A 4JREB 3AMLA 1NBVH 5I5JA 4N8VB 5D96B 1G94A 5INCA 3TFKC 5F7EL 2EXWD 4DK5A 4LSQH 4HIIA 1F8TL 3CC5B 4OLVL 4AW7A 2E4FA 4P5TC 3MLWL 1A4JB 4P2QE 3D2UA 4NQEB 3SKNA 4X7SL 2NUPB 2QTVA 1KXTB 1UUSA 1KXQE 4ENED 1A0QL 1CGYA 1XGPA 4NQUA 2QGDA 4L1BA 3IMBA 4KVCH 3TJPA 2IPKB 4JDVB 5JUEH 3GBNL 1F11A 4WQOA 3UPRB 2C9XA 2CKBA 1W0WB 2IV8A 5JPNC 2J2ZA 1U3JA 1OSEA 4GIPD 3QIBA 1W80A 5F89A 2BSTB 1EVTC 3TJHD 4CGTA 2XQYA 4AK1A 2ZUYA 3QXUA 4F24A 1P7QA 5KS9E 3QORA 5AVZB 2YD2A 1RZ8A 2UY6A 4Y16A 5GHWL 1P6AB 1NCJA 2BJMH 5M94B 1OP5H 4ZW7A 4BK5A 2YOCA 3OPZL 4U31A 5JXED 4LCWB 4PRDB 3CSFA 2AEWA 4NRZB 4WHYH 5I73C 5A7EA 1FRGL 1X5LA 2HFGH 2OXHB 5D7IA 1E4XI 1NGWB 2WVTA 5KSUB 1PD0A 1SLWA 4RMQA 4UTAL 4W9KC 3B9AA 4AQ1A 2ZD0A 1G7LB 1LO2L 1XZ0B 1JF6A 3EJQA 3PWVB 2PETA 4ANXA 3DX7B 4ZUVA 2R0WH 3APCA 3V6FB 1SLVA 1T20B 1I31A 1HHKB 4IDLA 2EC9T 2M1KA 3GM8A 4JM2F 3MLSH 3NQKA 3LV3B 1X5YA 1NWPA 4XBPB 1KTKE 4R7DA 3QZWA 1J10A 5E94B 5C3LD 3BSGA 4PP1D 4PW9A 1FV1A 2OTUA 3GDBA 1A9EA 3VFWA 3T77B 2C1PB 2WIMA 3PGFL 4ZO7A 5JPMC 4UQCA 3BKJL 4NP9A 1FL3B 1I1YB 1I1AC 3WOVA 1L7TH 2CZNA 3F7QA 1KWGA 1H6FA 2FSDA 2CK0H 3HMXA 1F6AA 1BZ7A 4O00A 4WW1A 3TH2T 4PD4J 1E4XH 5I9QB 3S88H 1QSEA 3S4SG 2P24A 3BHBB 1OT1A 4FP8L 1OCOB 4MA3B 5HYIA 2HG0A 5ICZB 4Y9EA 4S11A 4LMQI 1AY1L 1MSPA 4AJYV 4GAYB 2HRHA 2P8PB 2P80A 3LH2H 2P8LB 4UINH 4G7SB 4PLJD 4Y2DA 4YK4B 2NZ9C 3FT3B 1W9XA 4F57L 5IMKB 1YMMD 2H45A 1SEBA 2I9LB 5C86A 3HZVA 1B2YA 4YR6B 5E6ZA 1OD7A 5TE6H 3L9EA 5EZOL 1NAKH 5H8DA 3NCMA 3P77A 1WD9A 3TV3H 1X4ZA 3RVVC 3L3HB 1RPQA 2NDGA 2Y9RT 5AW4B 3UO8B 5GJTH 1JGLH 2PP8A 5E6IB 4H26B 1K5WA 3QJTB 1JGVH 3I3BA 5AKVA 2Q8AH 3LAFA 5BW7C 1JGEA 3PDOB 4M93B 2DYRB 4GRMB 4JFDE 5IESL 1PZ2A 1RZFL 2BM3A 3HNVH 4X4XB 1TT6A 4MCYB 1GYCA 2UWEF 3HS0A 2B77A 4KKBC 3DXAD 3FSZA 3OAUH 2DAVA 2GIMA 1ZSHA 2VIRA 3MVSA 2K6ZA 3P73B 1XD0A 3IKKA 4L9LC 4N9GB 1CD1A 5CR8A 2LW3A 3IS1X 2E7LA 5J12C 5IBUG 1DVTA 1I53A 3ULAB 3GRWH 3L5XH 1R17A 3R1GL 4L8DA 5DEGA 1ZEAH 5EG6C 4H40A 4Z77B 1C5DA 5G4NA 4AVKA 2CPCA 2ZAHA 1OT2A 4FL4B 4D0DA 5EEWA 2YQ2A 5EZJB 1AKJB 3BP5B 4X0KA 1FNGA 4L1SA 3C12A 3FTSA 1KIRA 1U4EA 3DVIA 1CTMA 2JI1A 2IDCA 4WLCA 5E1AB 2ICEC 2ZCLL 4YX2L 3BPCA 1N10A 4J8RB 3E6HA 1IZKA 4PMFA 4RGNB 4BFKA 4IKKA 2CA3A 3WE6B 1BFOB 1DCLA 2R56H 2AQNA 3PDDA 1GAFL 2SODB 5GGSA 3O4LA 1DQDL 4FFZL 1BVLA 4TVPH 1OAUL 2LE9A 5DHEA 4JZNA 5D1QE 3ZHDA 1T3FA 1J0JA 3X3GL 4P2QA 1BX2B 2ZSWB 3FUDA 5IHUH 5T5NG 1KXQA 1B9KA 4IEFB 4NENB 4JRYD 4ZQTA 4CADB 4CSSA 1JRHL 1VEMA 4TTDD 2XY2A 1KTJA 3MV9E 4FKEA 5C6WH 2E9WA 3MRFA 2A77H 4APXA 4ISVB 2QMKA 1K8DB 3BUIA 4JM0A 4TN9A 5CS7A 2XZAH 4PIBA 3RGVC 1NIFA 2VXQL 3OX8A 4WTXA 5I19H 4J3WA 15C8H 3GBEA 4BFIB 1Q9WB 1Y07A 2PO6D 3OKDA 4MJ6B 5KVFH 4M43L 4KNUA 4OUOA 5KBDA 4JM4H 4JO5A 4RQQA 2O6EA 1LK2B 3PE9A 4L1LA 4KY2A 4PJ8A 5JYMA 5DTFB 3HC2A 4JCWA 1YEGL 5C0DA 4IBZA 5AAWC 2YMOA 4P5TB 3BRGC 3AROA 4KK9C 1WFJA 2A1WH 5CLYA 2GTZA 1CUOA 2CIKB 1T1XB 3J8F7 1RCYA 3IT8D 4N8VG 3T2PA 4JS7A 3AY2A 4OLZL 2Y1ZA 4JKLA 3R4RA 2WVUA 1FO0A 3O45A 4R83A 2ZWLT 1N3NB 3NBNA 2RBLA 4K5PA 1DN2A 3UGEA 4DP6X 5JPNB 1OZTG 4OGYL 3QWQB 5L4FA 2NY2C 3HHRB 2VDKB 2QVTA 1DDHB 4E9LA 1IFGA 5IOPB 2V2WA 4YO0A 4YXHL 1TZHB 5SV4A 4X6FA 2FTAA 3U9PH 1TEFA 3CE1A 2OSYA 3OR7B 4PWEA 1NMCC 4DKDC 4HOWA 4ZFFB 3SGEI 4X6CB 1JZ2A 1ZHNB 4WNQB 2YC1A 4DVBA 3CHSA 1MCJA 2WP3T 1EO8H 5CN1A 2YGQA 1KGXA 3SBQA 4LSTH 4JDEB 5ISZB 4L3ED 1B88A 4X8XA 4P3CH 4JY4A 1WFMA 4Y2OB 5DHMC 5AQ0A 4WU7A 5DUBA 4XPBH 5AVXB 4NFBA 5LQBL 2DQEH 3FOMB 1IEBB 4HWEL 3CZSA 3HG2A 4PI2A 4TYUA 3GZQA 1RUKH 3AS3A 3BUYA 1TJGH 1G7MB 1TVDA 2PR4L 4IMLB 1BAGA 2E7MA 4GXUN 1I9EA 1R3LA 4JHWH 4DP8X 3IU4H 1INDL 2OR8A 5A2JH 2VR4A 1MW0A 2I5YH 2WXQA 2Y5QA 3DOSA 2MPVA 5DRZA 3IVKA 1WZLA 1BAFH 4WO0A 3RPBA 2ICWI 5IK3A 3VAEA 3KPQA 1MNNA 1AJ7H 3UYRH 4UTAA 3U30C 4ALAH 2DN7A 5D1ZA 1LO4L 5I16B 4IW4C 4AENB 3I6SA 1EMTH 5DJ6B 5FB8B 3SGEH 5JPMB 4F7CA 1I1AB 1QBAA 1XMEB 4YHPA 4PU2A 3WIFA 3UTQB 3H53A 4OBRA 2RCSH 4JZJB 4X8JB 3VFGL 1R46A 1JI1A 1SJHB 2PN5A 1N5YL 1ZVHA 3NYKA 1HWWA 2BVTA 2DI8A 2H1LM 4QRRD 4O5LL 4JFDA 4V1DD 4N2MA 2GC7C 3DSNA 1OK8A 4DUXA 3ARRA 2XPYA 2XC8A 4P57A 2O5XL 3T4AB 2F19H 1JNHB 4UNIA 2HVJB 1XF3B 2BNQA 1MCQA 5GZND 4YHLL 3E8VA 2DLIA 2R9HC 1KFAH 1JWSB 3EJZC 1ICTA 1WYJA 3ZRSA 4EMZA 4R7VA 1NCWL 4F9LA 2ZONA 5I6NA 5TQ2L 1PPIA 3INUL 3G08A 4JPKH 4XPGL 1XSOA 1BYOA 3JVGA 1BM3H 1D2OA 5CD3A 3T1FA 2RGSA 5E9DD 5HHOE 3N85H 2H6OA 1G9MC 5J11C 3K4AA 2JKLA 4WI3A 3H7LA 5E00A 1G9ML 2KUTA 2XFXB 2JJTA 5CIPB 3VFUB 4HV8A 3EFFA 3N5AA 4PHXA 4HBQA 5LDUA 1TJMA 3VXSB 5CP3A 1WUNT 5AD0A 2K3HA 3WNNA 4APQA 2VW6A 1FIGL 2RIKA 3B8SA 3OF6A 2OV0A 4QRUB 4YSRA 1CBVH 5D1QA 3CTTA 4L9LB 1EZVY 2FLMA 2BRRL 3QCVL 4GKSA 1TTGA 5E56A 3EOBA 4ZXBA 3GXTA 3VCLB 4FEMA 5HI3D 2D7PA 4BFNA 2R1YB 5T1LA 1Q9KA 1SHXA 2JWYA 4NO2B 2HXAA 1QQDB 4M8QA 2NY1B 5ADPH 5FUZL 4C83A 4LL9A 4Y5VC 4A7GA 2FYYA 4P8QA 4R90L 1RZPA 3VFTB 2A6JB 1J12A 5DJ2B 4OFKA 4HK0A 1U6AL 3TTYA 2ARJA 1KJVB 3LNDA 1CK0H 3MN8A 3C09B 2ICEB 5C0IB 3WTTA 2JJSA 3L2MA 2ZOKA 3VU1A 2VDPH 1U8OB 4KI5F 1KIQB 3IDGB 3UTTD 2YPKA 2OX5A 4FQCH 3QIWD 4RFEB 3ZIYA 1U8CA 1A6ZB 4GO8A 4KH2A 4FD0A 1I9IL 3GHBL 2EH7L 5IJKC 4FNTA 3CDCA 3PWJB 1CU4H 2A4EA 3BW9A 1T04A 1G7IB 1EJOL 4YEEA 2CIIB 1T5WA 4AWJC 3ZKXB 2JELL 1INQB 4KQ3H 1TPXB 3ZKQD 1TMQA 3A6BH 5AVYB 1OCCB 3FFCD 3P30H 5GRJL 4F37K 1OPGH 2NNAA 4IIQC 4RAVA 3H54A 3AWFA 2XJKA 3DV6B 4JRWA 3ZZLA 4ELMF 3QCUL 4P5SA 4MAYC 4FFZA 4CKQA 1ZMYA 3Q2CA 5HI5D 3H8NA 5GZOA 1HEHC 1A14L 4XXDB 2XBDA 4MGXA 1SVZA 2NX5E 2ZCKL 3DSFH 4MMXA 3U4EB 1KZYA 3T2OA 2BVQB 1GZHA 3SDCD 1NTDA 2VN6A 3EW3B 3LRHA 1PZUB 5KUMA 3CFBA 5ALBL 1MZYA 1DQKA 2CO2A 3T04D 3MBEC 4DO5A 3T6QC 5C0AD 5F0LB 2COQA 1P2CA 3L2LA 1TQCB 1QRKA 2E7DA 2HPOA 2EAEA 2XG4A 1IE5A 1OGPA 2VXQA 4NOBA 1HZHH 4KV5F 1FVDA 1N5AA 1ZVSA 3IDNA 4IJ3C 3GSOB 5LN4A 5BQ7B 4OQ1A 3RGVA 3VM7A 3EDFA 4N2DA 3LNIA 3KPRD 4HAKA 3D69A 4XCCL 3A4DA 5KSAC 5L6YL 2NY2B 2XNAB 4KMLB 2VDQL 5HYSA 1DANT 4TUJA 5D9SA 4B9CA 2WXHA 1LNUA 3IAQA 4ABQA 1AI1H 3QCTL 1A3QA 2G60H 4MJ5B 2CE6A 1BD2E 4ZUSB 3VWJD 1FFTB 4R2GB 2K70A 1VLXA 2DQDH 3MA9H 3MUZ1 1JK8A 1MJJA 2UWEA 4PV9A 5IB1B 1EANA 3FHEA 5KSVB 3HZKB 1FNFA 2WWMC 3B2MA 4M1CD 4I3SH 2EDWA 5I0VA 1JHLL 1R3JA 3U0PA 1UADC 1HWHB 4KRMB 2EDLA 1SN0A 4XP9L 3WG7B 3UROR 2ZYSA 3E7JA 3UBXB 3Q05A 2J56A 4HH9A 3RTQB 3GMLB 1DVYA 3WLWC 5BUAA 1HNYA 2OL3L 4E9TA 1VACB 4JR9L 4ZMWA 5C09E 3R06B 1DSWA 4XNDA 2BX5A 1OSZA 4L29A 4N87A 5EORL 3UZEA 3O0RL 3W57A 5TFSL 3BIBX 4D7PA 3KPTA 2I07A 4JFZH 5DJZB 3SQRA 3C6EA 4R5VA 2V3EA 4A1RA 4M5YH 4J4PD 2P4AB 4Y7OC 3U30B 3LHPH 4AIZB 4AGOA 3ARDB 1O75A 3EOTL 1TTAA 2I9TB 4AC4A 2GT9B 2DMKA 2HRGA 2YMXL 4YHKH 4AI7A 2VLJD 5K9KB 2LU7A 3SKJL 5HHOA 4TSBH 2CCVA 5ILTH 2B9AA 4NZRL 4PFEA 1M05B 4XNYL 4PJGB 1UJ3A 5AG8A 2GIYA 1YYLL 4IBWA 5FF6B 4H1LB 4O4YH 5D70H 4OCWL 3L1FA 5LBSH 3VI3B 3BKCL 1PQZB 3CSTA 4ABVA 4N85A 2PW1B 1FVCB 1NLBL 2QELA 5T1MB 2BXYA 3UO1H 1CBJA 5CJ5A 3RFZC 4PVBA 3V6OC 2CLRA 2IDUA 1Y6MR 3RX5A 1VPOL 4WWKD 3MNWB 4HFWB 4W9ZA 3I75B 2IIJA 3U36B 4OW6A 2HB0A 5CJQH 1Z0NA 1RHFA 3GFUA 3K2UH 2W60A 1OY3B 1CE6B 3MRBA 5E1GA 4QRQA 1A6TB 1LEKA 5IFAH 3GIVA 5KVGL 3ZKM