1XB6A

The k24r mutant of pseudomonas aeruginosa azurin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDRSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of a novel disulfide bond and engineered electrostatic interactions on the thermostability of azurin
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 33
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1xb6A00
3EH3B 3AY2A 3X2QB 5E9NA 3OD3A 4A2EA 3OQRA 1NTDA 3T6XA 5B7FA 2XWZA 2VSMB 2IWKA 1PMYA 1OE1A 3PXLA 5I6MA 2H3XC 4DP1X 3NSFA 3NJFA 2H5UA 4HCGA 2QPDB 5TK4A 1PNCA 1RZPA 1PLBA 3H56A 4M4RB 5AZUA 4DP6X 2UXTA 4BDVB 1E5ZA 3ASNB 2H47C 5EHFA 3X1GA 4GXFA 1TU2A 1E65A 4DP9X 4X4KA 3WKPA 1ID2A 2FQDA 1MG3C 4FA7B 2QT6A 4PAZA 1MG2C 4E9QA 1IC0A 4K9JA 1ASQA 1E5YA 2YAQA 1OOWA 2AFNA 3UACA 4AKPA 2LLNA 3FSWA 1NWPA 3JT2A 2BZ7A 1BYOA 3FU7A 2ZONA 1ADWA 2CALA 1EHKB 5AKRA 3WG7B 2BO0A 2WSDA 5PAZA 3T71A 5D4HA 2XV0A 3SBQA 2PPFA 1SHXA 4NAJA 3FU7B 4G7QB 1ZV2A 3ZX1A 1AOZA 3FQYA 1KDIA 2PPAA 5LDUA 4AZUA 1GS6X 2X87A 4KOBA 1GY2A 1A4CA 4A66A 3AW5A 2IDSA 4KO7A 1ET7A 3H4HA 5ANHA 5B3SB 5PCYA 4DP4X 1NIBA 2DYSB 1PLCA 1GSKA 2PCFA 4KNTA 1M56B 4YSOA 2ZOOA 1WA1X 3TU6A 1SF3A 1AZUA 1L9PA 1AZBA 3NSCA 4TXVB 2FT7A 1A3ZA 1SDDB 2DWTA 2XYBA 1N68A 5I26A 1VLXA 3AG4B 3NJNA 3NT0A 4UF7C 1J5CA 5FC9A 3PLYA 3IBOA 3SBPA 1QHQA 2EIMB 2FT8A 4GP8B 4N4YB 1W6LA 3T9WA 3D12B 3TBBA 1JOIA 4G71B 1E67A 1JZGA 2QPEB 3X1FA 2AVFA 3EF4A 2IH9A 3BVDB 2XLLA 3L45A 3NJLA 3NJJA 3NP4A 3V9EA 4E9YA 2IDTA 1SHWA 3MBWB 3C75A 3FYEB 4GYBA 4E9XA 2XV3A 4GY4A 3CG8A 4HIPA 2B3IA 2HX9A 1ASPA 1MDAA 3EH4B 2OV0A 3HB3B 3QJTB 4HALA 5TK2A 2XU9A 5B1JA 1EZLA 3ZBMA 3CZUB 1KCWA 2GSMB 3N55A 1PCSA 1OCZB 4M3HA 3FYIB 1BEXA 3WNIA 2AZUA 1AACA 4A2HA 2XXGA 3AG3B 4F2FA 3N2JA 5I6LA 1OF0A 1OCRB 3ABGA 5I5MA 2DYRB 2R7EA 2WO3B 2IWFA 2Q5BA 4HHGA 2VW4A 4YSRA 1AIZA 4RH4A 3OMIB 3SBRA 4W9ZA 5B1BB 1HAWA 1XB8A 1J9QA 1J9RA 1ETJA 1BXUA 4A67A 1KV7A 1PF3A 1GS8A 1J5DA 4GP5B 3QJQB 4Q8BA 1V10A 2DWSA 2YQBA 5I5JA 2RACA 1DZ0A 3WI9A 1TKWA 3DTUB 4BDVA 2P80A 1YLBB 4BK5C 2YAPA 4YVUA 3NJKA 1CYXA 3ZIYA 4FAAB 3IN2A 2X88A 2HRHA 3S3DB 1ZDSA 3EH5B 4AKQA 1OE3A 1M9WA 3WNJA 1AANA 1V54B 2FQEA 2ZWNA 1KGYE 1L9RA 2EIJB 1JZEA 3BQVA 3H4FA 3IN0A 2CAKA 3T6ZA 4YSCA 3SQRA 2Y1AA 2IAAC 1SJMA 4WKXA 5B7EA 1MZZA 1L9QA 3FS9A 1AZNA 1NPNA 2UXFA 1AR1B 1HFUA 1NWOA 2HZHA 1J9TA 1A8ZA 1BQKA 3U25A 3AZUA 1ASOA 1NZRA 1JZHA 1XB3A 3AG2B 5B1KA 2E86A 2Q9OA 3GXUB 2FQGA 3ASOB 3KW7A 3PCYA 4EF3A 2GC4C 4E9RA 3X1NA 1CYWA 2J55A 4BWTA 4UANA 2TSBA 1T5KA 3NYKA 4KO5A 2EIKB 2XX1A 4QKTA 4DPAX 1JZFA 3HEIB 1AG6A 4HHWA 2MRYA 3NSYA 1WA0X 2YXVA 2PPCA 2FNWA 3CDZB 2FT6A 3G5WA 2JXMA 1V55B 1J9SA 1ILUA 3GDCA 4HCFA 1KYAA 1KDJA 4DP5X 4E9WA 1BXAA 1NDTA 2YXWA 1IUZA 4HAKA 6PAZA 4DP8X 3JTBA 1SFDA 2EINB 1JXDA 3ZDWA 2BWIA 2PP8A 2QDVA 2XXFA 3PAUA 1TEGA 3TA4D 2GBAA 3QJUB 1FWXA 1MZYA 2A3TA 1ZDQA 2JKWA 3ERXA 2GIMA 3DKHA 3GYRA 4DP0X 1AZRA 3OMAB 1NIFA 1N70A 1ET8A 2UXVA 3DIVA 4KNSA 2YAFA 4G70B 2BWDA 2AANA 1SFHA 2FJSA 3TASA 1NIDA 1KCBA 4YSTA 1DYZA 2DY2A 9PCYA 1E30A 1BQ5A 1A65A 2ZXWB 3S3BB 1JZIA 5B7MA 2R7EB 2UX6A 2W8CA 2XV2A 2JFCA 4YSEA 3ABMB 3UAEA 1KBVA 4HZ1A 4E9SA 4MFHA 4KO6A 3KW8A 5I6KA 3UADA 3CVBA 1CURA 2PPDA 2PCYA 1SNRA 2BP8A 2P80D 5I6PA 1NINA 1AG0A 2IDFA 7PAZA 4NB7A 2YAOA 2HX8A 1JZJA 1RZQA 4N8UA 2VMJA 2EILB 1IBYA 4E9VA 1L9OA 1TEFA 4G7SB 1XB6A 2FQFA 2GI0A 1JXFA 1A4AA 5I6NA 1UATA 2VM4A 3UGEA 3IE9A 1BYPA 3NJHA 1JERA 4YVNA 5B1AB 4JHVA 1ILSA 4G72B 5IY5B 2IH8A 3X1BA 1PZAA 4AKOA 1GR7A 2IDQA 3WIAA 3WKQA 1QNIA 3FSAA 4BXVA 1AAJA 2I7OA 2I85A 4F7KA 1W8EA 3NSDA 6PCYA 3ABLB 1JVOA 3V9CA 4GP4B 2OJ1A 2BZCA 2BP0A 2VSKB 4A2GA 4DPCX 3AG1B 3S8GB 1QLEB 3NP3A 1GY1A 3CVDA 2XX0A 3ABKB 1CUOA 2CJ3A 1NPJA 3QJRB 2Y69B 3TBCA 3FU9A 2W88A 3FQ2A 4P5RA 2CCWA 4WTQA 3IEAA 4E9TA 2IDUA 4HCIA 3MX0B 2XVBA 3NJGA 3FSZA 2PP7A 5A7EA 4AX3A 1OCCB 5D4JA 3UABA 2CUAA 1X9RA 3CVCA 3S8FB 2YAHA 1SF5A 2PPEA 4KOCA 4W1TA 1F56A 3FPYA 4CSZA 1PLAA 2AZAA 1I53A 4F2EA 4PCYA 1AS8A 1B3IA 1FA4A 4YL4A 1PY0A 2GHZA 4CSPA 1IKOP 4DPBX 1PZBA 1AZCA 3QPKA 2FWLB 4NERA 2YARA 4L0PB 3OMNB 4DP7X 4ENZA 2J5WA 5I28A 2BW4A 3QQXA 3T6WA 4A2DA 2BW5A 1AS6A 1HAUA 1ZIAA 1OCOB 2GC7C 4QLWA 4ZK8A 4G7RB 1ET5A 1URIA 1WAEA 2N0MA 2I7SA 1NICA 2XUWA 3QJSB 3S3CB 2VW6A 1L9SA 2J57A 4YSAA 3NJIA 1GS7A 2UX7A 2IWEA 4YSPA 4A68A 3PAZA 1JVLA 1OV8A 2BP0B 4KNUA 2HXAA 3PPSA 4YSSA 1CC3A 4A2FA 4YSUA 1WA2X 5D4IA 2VN3A 3FPXA 1NIEA 2DV6A 1ZPUA 3NJMA 4P5SA 3QJVB 3OM3B 5I5IA 1KBWA 1AS7A 2PLTA 8PAZA 1FFTB 1BXVA 3FT0A 4BWUA 1SDDA 3CDZA 4UAHA 5AFAA 7PCYA 5F7AA 2OCCB 1L9TA 4DP2X 1X9UA 2YAEA 2HRGA 5B1JC 1AQ8A 4KO9A 2TSAA 4JKNA 2YAMA 3UAAA 1NIAA 1R1CA 2BHFA 1A4BA 4YSQA 2PP9A 1BAWA 3PAVA 1WS7A 3EHBB 2WO2B 3FQ1A 1GYCA 1PZCA 2HLEB 2VW7A 3RYMA 4JHUA 4AI7A 2J56A 4YSDA 4BWWA 4Q89A 2BP8B 2UXGA 1IBZA 1RCYA 3FSVA 1M57B 1XMEB 2MTAA 2CBPA 2FTAA 5I6OA 3X1EA 1WS8A 1BQRA 3FU8A 2QDWA 2GB2A 2B08A 1W6WA 2NRDA 1ZIBA 1PAZA 3T6VA 1GW0A 5F7BA 1OE2A 2HX7A 1PNDA 4BXSV 2VM3A 1RKRA 1JXGA
chains in the Genus database with same CATH superfamily
5C9JA 4LLQB 4J3OD 5A2JH 3U6XS 2ARJA 5DD5L 2MTPA 1RUAL 5GRUH 1XXFC 4UOZA 2CA4A 5ABAA 3TBSA 3MACH 1V05A 5GGRA 3NSFA 2OAAA 1CF8L 3CSTA 4JG5A 4KGJA 4FQJL 5KBPA 5I1DB 4PEEA 1W2KT 2VXQA 4W9GC 4GXVH 1V8HA 1DVYA 3NRPA 1BFVH 2R69A 5FYJD 4BGDA 4K23L 4XVJL 1SOSA 1JPGA 1M1XA 4JKLA 3NEXA 3MODL 1CICD 2Z31A 4YIQA 4Q52A 1NKRA 2C7FA 3BKYL 1CGXA 3L1EA 4E9QA 4UOW1 4CA4A 2X9YA 4FF9A 2P49B 1MEXL 4QHMA 5HI3C 4ODTH 3UG5A 4TOYL 1BP3B 5DMKB 4P4RA 1E27B 1A4JB 2Z6FA 3KLAB 4FI6A 4ORGB 5F7LB 2EE0A 2WSDA 3MMEB 1MVFA 1FRGH 2F7OA 1QBML 3O6FB 5B39G 1CF1A 5BS0E 4OZGE 5T3XE 5K33A 1JNLL 5B39A 2EXYC 4HYTB 5F9WB 1MJ7L 1C16B 1I7RA 1OB1B 3LTVA 1CLOL 4ZMNA 3MJ9A 3BKML 5L4IA 5EEZA 4FQIH 3A4EA 3U9PL 2VN4A 5TE4L 1I9IH 4M43H 4G7VL 4P2RD 3D07A 1PDKA 5MI0C 2OTUB 3BH9A 4KO7A 3EO1B 5DVLA 4YHLH 2ESVB 3MV7B 4OQ1A 5EU5A 3UBXG 1Q72H 4CBPA 4TUJA 2DWDA 4OZGB 4EN3B 4ZBJA 2RTTA 1R19A 2UUDK 2JELL 3HE7C 5E6RB 5MEND 3LN5A 1RI8A 1PY9A 3ULVF 5KUKA 3F7YA 8FABA 2NY6D 1A3ZA 1RQ5A 1SDDB 2DWYA 2X5PA 1FVEB 3DBXA 3FOMA 3L5XL 3Q8BA 2J6EH 2I25N 2YEZA 3NJNA 1W0WB 4QRSB 5HHQB 5D6DA 3V4LA 1SXSA 1XF4A 1S9YB 4QHPA 4GMSH 1ROWA 3FB5B 5FV1L 5HHNA 5I0WA 1K9TA 1WAPA 3RAJL 4MQ7B 4JFEE 2WLLA 3BVDB 4WWKD 3LDBC 3FTGB 3QUKA 3CE1A 3HNSL 5E1IA 3OF6A 1I1AA 4IOIB 2ICCA 4GY4A 4G6FD 1KBGL 1PQZB 3ULUC 2WBKA 3TH4T 2VAAA 3M8OL 3HB3B 4PJ5D 4KVNL 1WUZA 4LT7A 2X9XA 5FYKD 5CD3A 2JJTC 3ZMEA 4POZC 5DJXA 3RNQB 4NIKB 3RL2B 1GHFH 2IQ9L 2VIRA 2RQEA 1G9NL 2F7IA 3RGVD 5GGSY 3HBQA 5DLML 2VWEC 1WV7T 1JXJA 1GSMA 1QUNB 4G59C 2AP2A 4U1KA 5HBBA 3FQTB 2EJ1A 3G6JF 2WQSA 2XN2A 3MRPA 2DYRB 5DT1H 2MKWA 2VQ1B 1UA3A 2VO5A 4KROC 5C0JA 3DOSA 3MFFB 3DV4A 4L37B 1QSED 3L3DA 2C1OA 4OTXL 4HFWA 1JGDB 4U1GC 1T2JA 3RWIB 2HT4D 1MN4A 4BZ2L 1NOAA 3KL5A 4P9MH 4F7EB 1JN6B 4GP5B 1Z2KA 2VLKA 3EKCA 5IHZB 1OXYA 4PJ8B 3ZT6A 4PJEA 5JO5A 1TQBC 2CG9X 3KNBA 4GAYA 4LXFA 3CPLB 4HS3B 2PO6D 3TGXA 4I2XE 3NDYE 5CEYA 2BSTB 4AIZB 2HRHA 1OEZW 4NCDA 1U8NB 1Q0YL 2YOAA 3PWNB 4CNIB 2EDWA 4UQ2B 4X4YA 3BQVA 4L8DB 4QRSA 3RILA 3DGGB 3FF7A 4G8EB 1SUHA 2BNQB 4HULB 4MD5B 4FFTA 1YEJL 1D6VH 4WFED 4Y9BA 4W9FC 3B37A 1J0JA 2CA3A 4XT1C 5KVGE 5C2BH 3ZE0E 4KZDH 1WBZB 2BXZA 4LVNC 1P9MC 4RVBA 2WZAA 4F1SA 3GM8A 3U2IA 4KWUA 3VFWB 1HWHB 2BFVL 2C1OB 2BSSA 2PYFA 2VLME 4IRSA 3MLUH 4Y8AA 2VLMD 3IE4A 4JM2A 4Z77B 3UJJH 1IQWH 3GTVA 4LPCA 4PRNB 5ISZE 3BE1L 4GXUN 4OGQC 3UGXA 2Q76B 3MBEB 4R96A 2MRYA 4L1TA 1XGRA 3NSYA 3CBJB 4N2BA 3PWJA 3FT4B 1ZXKA 3B3IA 4HWNA 3BSHA 4JKWA 2J44A 4R26L 3E9UA 4F57L 5EU6E 3NVQA 4QJ4B 4HC1L 4OJCA 4RFOL 1D5ZA 4YDMA 2Z8RA 1XL6A 1IEAA 3NFSL 4IJ3B 2AS5M 3Q06A 2J1WA 1QSFD 4KH2A 5BRZB 1DJYA 4QHMB 4XX5A 3TA4D 4CJ1A 1G0YR 3MPCA 2W81C 4I9XA 3P77A 5D1QD 2YPKB 2KERA 3H3KA 3E2HB 4J3UA 5F7DB 3GNML 3P73A 2A2QT 4ICXA 3WUZA 4EI5B 1KYFA 2ZCHH 2NY7H 2DQDL 3IDIB 3OHXB 1HHGA 1IAOA 4FXGB 3NZ8B 2ZUQB 1B3JA 2PCPB 4BINA 3V10A 4KNSA 2AANA 3SKMA 3H9SB 2XKNA 1G4MA 3RKDC 5EC1B 9PCYA 4BUQA 3WKML 3U0TB 4A7SA 5D7SL 4Z7UF 1O5PA 1VCAA 2J8UA 4LLWA 4PJXA 3SDCA 5KW9L 4NO0B 5BZDB 3K46A 1PX4A 4FHJA 1N12A 2F54D 1Z7JA 1TZ8A 2H0PA 3MJGX 3QB7C 3L6FB 2OTWA 3STZB 4KXAA 2ARJB 3BP6A 3ESMA 3A21A 3QWRA 4RMVA 1R6VA 2AAAA 3CBKB 2WJ7A 3HZVB 4PBWD 1F90H 1JSYA 2ZKYA 3EJTA 1D9KD 4LCIL 1MFBH 3W11C 5BS0A 2DWDB 4JR9L 3FN0H 4OZGA 4ZAKC 4KTEL 4KDTC 1DLHA 1G6RH 5DRNB 2PCYA 5IEHB 1KTDA 2P80D 4MCNA 4UB0L 1SXNA 3E7JA 3AMKA 3DO4A 3W0WB 4MCZA 3VFRA 5D6CA 1OQOA 1QBLL 2W0FB 3KJ4C 4I0PB 4BGLA 4HOMA 2XQYK 3OAZK 4I0CC 3R0NA 4KTEH 4Y4KC 4MNHA 4JRLA 3QCUH 3MRRA 4P99A 3CCHA 4ZMVA 2P48B 2X0WA 5TD4A 5IVXA 4PQXA 2B1OA 2EDEA 3KS0H 3OC5A 1O9ZA 3EFOB 2NNCA 4HAGA 1DEEA 3PHOB 1LK3H 2CGRL 3ULVL 3Q5YA 1XDTT 2EIZB 4RAUB 4OZIE 5FO9B 2EXSA 5IIEA 3N42B 1J87A 2NY3B 2YGNA 3F2LA 3WEXA 4M7KH 5BRQA 3S36L 3ULVH 1OAXL 4XN7A 1MLBA 2WXMA 1JRHH 1R24A 3GS7A 3VO0A 3WDIA 1G6RA 1QNZH 1DCEA 1XSIA 5C3TA 1FHGA 1YQ2A 5FA3B 2UY7B 3FU0A 2EDTA 4TSAH 4P23A 2XBZA 2KQNA 1LILA 4M5ZH 3ZTJG 2LR4A 4PCKA 3RA7H 1RPUA 2JKJA 1IGFH 4UQEA 2Z92A 3ZDZF 2R8SL 3VXSE 2IPTL 3EZJB 3BQUB 3HG5A 4W4NA 3W82A 1QZ1A 2PO6B 3HHSB 1T1XB 3PWVA 4ZNCD 2J8OA 3PGDA 5I0XA 1UH3A 4W9CC 5E1QA 4YN3A 3LKRB 2IADA 1X5JA 4PJ8D 4L37A 4MJIE 2ZOWA 3LS4H 1Q9OA 3JWDL 3FH7A 4DKAA 3OR7A 4F9LC 2CUAA 5F97E 3T1FA 4HVBA 2KLRA 3CVCA 4HDIA 3WS6C 3PWUB 2X2IA 1UZ8B 2ZUYA 4JANB 4KZCA 2VN5A 3ASWA 1NC2D 4PGZA 2ZWYA 1QSEB 2CHDA 3Q1SL 4NWUL 1LP9F 3TBWA 4DN3L 3JVFC 2D31B 3O3AA 4GKZB 1RSYA 2W9EL 3VMPA 3LEXB 4M8QA 1N7MH 3SCMA 1A64A 2GHZA 3E3QE 1IKOP 4DF9A 1TQUA 4L3CA 1S8DB 3HS0C 3TWCL 3V7AE 2AVGA 3GS4A 4I3RH 4K7PL 1MCSA 3M46A 2PXYB 1J8RA 3DX9B 5IVZB 3B9DA 4LIQH 2R2EA 4UZUA 2BINA 2JJTA 3GEFA 2DJSA 1RULH 1JGVH 2FATH 4F3FA 1QA9B 4HH8A 3N0PB 4ETQA 4OB5L 4MYPA 4KGLA 4X4MA 2BNQD 5FAAA 4GRWB 3T3MB 5TDOA 3HE7D 5DHEA 3EO9L 3BSZA 1VADB 1UT9A 2VN6A 1BFSA 3HRPA 4TQIA 1NCBH 1UXWB 4A6YB 4EJ1C 2L7EA 3S34L 1BQHG 1T1YA 1JD7A 3BKCH 4MRCA 5CBAB 1U3NA 3K1DA 2H9GA 5D2LA 3JV0A 5D4IA 2CWRA 3QRLA 2DV6A 4WW1A 1KJ2H 4GW1B 3V5DA 2CO6B 2ERJB 1NANI 3NRFA 3OM3B 3PG2A 1IFRA 1AS7A 4N5UA 1KEML 4Q6KA 3TA3D 3VFPB 5I1KH 2Y24A 4TMPA 2CJUL 5C0CB 2BSRA 4IDLA 5HGHA 1MLCA 2BVTA 2ZSVB 2AKRB 1PJWA 2P24B 1FNLA 2HRGA 5EBMB 3X14A 4E41D 2ADYA 3P4MA 4TQEH 4NQCE 5IW1B 3GJFA 3DV6A 3GXDA 2IH1A 4JJ5A 3PV6B 3QARA 4HLJA 2HFTA 2NXYB 3TL5A 5AVQB 3BPNC 2CRMA 2J20A 2R56L 2MTAA 1CXEA 1CFSA 3BD5A 3FCTA 2LVEA 3KEDA 3U0WL 1PPIA 3GZQA 5EU3A 1IE5A 3SSGA 4OZHF 2NRDA 1E8YA 1DJHA 1GOFA 2ICWA 1S7UA 1KBKA 1IQWL 3MLXH 4AQZA 1JXGA 4DGYL 1IBDA 3GZKA 1Z9PA 2CU9A 5C6WH 2JH2A 4RWYH 2XWZA 1FVDB 2YD0A 1DBKH 4FQ1L 1KN2H 4Q0XL 3TWYA 3G6JA 1NCUA 4Y2LA 1AKPA 3O6FD 5DO8A 4ZUTB 2MIZA 3OX8B 3ZIMA 4Z3FA 4PGEB 2XWDA 4HCGA 2Z4QB 4P2CG 3LQZB 5EUKB 2MPVA 1BAFH 1XR9A 4CVWA 3FMGH 3SDDD 4JE4B 3GLEA 2EDKA 3U1PA 5EWIL 5C07A 3WKPA 3AS0A 4B9CA 3KBPA 4ZUUB 1MG3C 5ABDE 2QT6A 1U8CA 2O6CA 3WUWB 1GPOH 3OZLA 3VTMA 4XPBH 4F93B 3Q05A 5GGRB 4N0UE 4H2CA 2YMTA 2F7QA 2LLLA 4EI0A 4JFDA 5EN2B 1HH6B 2LLNA 3FSWA 3QR2A 1S7TA 1YN6B 5B22A 4AH2B 1QWUA 2DYPD 3PE9A 3QIWD 4UAOC 4C56A 2F5AH 1UWFA 2CALA 3FQRA 4J3WA 3ZDXE 2QVKA 2HJFB 5D7IB 1YYML 3BO8B 4RAVB 4M1GH 2IQ9H 2V33A 4J6IA 4Z76A 5HYQA 4FQHA 3VRJA 1AGEB 4MKMA 1ZV2A 2PNDA 1FC1A 3EBAA 5IB5B 3VSVA 1KGCE 2PPAA 1KGUA 5FKAA 4HPHA 2FD6L 5JHDA 5TQ0H 4QCIB 3AUVA 4DW2L 2EEFA 2VDKB 4JFVA 3IGAB 3SY0B 4BELD 3TYFB 4LPUA 1JWUB 3EAKA 1T20B 3UC0L 2K6ZA 3ZMNA 2G5UA 4NWUH 4ABVA 3DSFH 5C0BB 4P4KD 5C0AD 3AB0C 2WWMD 1J86A 5LLIC 1OZUA 1SF3A 5D2NA 1HWGB 2ATPB 4O58H 2F61A 1VCBC 4OSUH 3EH1A 2FRGP 3DYOA 4NNYA 1DBAL 2VGLM 3IDJB 1OTUD 3O3BA 4IHBA 3ZU8A 1BMWA 4S1SH 1KIUA 3E8VA 3M8OH 3N50A 1VLXA 4HSQA 5JXEC 3F6LA 5J0BA 2V4LA 2FHBA 3CFKA 4RDQF 2V17L 3T9WA 3FFCA 2MJWA 4JM4L 3MUZ1 1S9KC 4X6FA 4NYLA 3L1OL 4UQDA 1JAEA 2ZWZA 5F0MB 2SEBA 5FLUA 4R8WL 5ADOL 1FO0A 1GYWA 1BLNB 3QEUB 1AKJA 1EJ8A 1OAXH 1WIUA 4AE0A 5A2KH 5T5NF 3NCJL 4WWPA 4K3EL 3WSQH 4CMHB 3PWLA 4HJTA 1AQHA 4Y5YC 1E2VA 3C5ZC 5D1XB 4C59B 1FNAA 1QI5A 5EEUA 2APBA 4KAQL 1FNHA 5CU9A 4Z8FH 1CK0H 5FF6A 1Z0NA 1CD9B 2ADJA 3CZUB 5KYUA 1HIMH 5IQ7L 5E94A 2R9HD 1BLIA 1LO5A 3MRQA 5DJDB 5IMMA 1OK0A 2PW2B 4XRCB 5KBNC 2C9PA 2OXGB 5ECGA 2YFNA 3Q2NA 2JIXB 1VFBA 4XNBA 3GMMA 1I7UA 3FQRB 1A14L 4PJEF 3WGUB 3HHMA 1I3GL 4MBRA 3HUJF 5E2JA 3QWOA 1F3RB 4LCUB 4NSKA 2IWFA 4J4PD 5A16B 3H9SE 2W0KA 1JZ7A 1AIZA 3OMIB 4OZIA 5KYXB 4Y4KB 1XGPA 4DWHA 4NP4H 4PJ7E 4F8PA 3TF7C 4EAEA 3ARWA 3QDGD 1X5AA 5TFSL 1V10A 1BIIB 1I7TA 4QI3A 4EI6A 3L54A 4MB3A 3A67L 3SGKA 5HD8D 4ZFOL 1EHLL 3ZDYB 4NUGL 2A9DA 2ZP8A 1FORL 2FK9A 4GG8A 3TH3T 4JCLA 3K81A 4HAFA 5DUPH 2RBLA 3GMLB 4FI7A 2DQUH 2DH3A 1A6TA 2GY5A 2P1YA 3D2UB 1JI1A 2B9BA 1S8DA 2GJ6D 1C16A 3C08H 3NOIA 5BXFA 1SQ2N 4DO6A 4M8QB 2W80C 3WHE1 4K07A 5IM7B 1GKEA 3OJDB 2OXGA 3BAIA 4Y5XC 2WXLA 2QQKH 5E00A 2F18A 5I75B 5EU3B 3KWWA 4BE6A 1WP6A 2B1AH 3RDTC 2CMRH 3T3PE 5IZ7A 3HLAB 3QC6X 1CFSB 3VWKC 5TDNB 1CYWA 3QQ4B 1RUAH 2ZUQC 5GRUL 1FF5A 2DQEL 1AP2B 1GC1H 3HNTL 3P9MA 1N6VA 2J71A 3PJLA 1JPGB 1M1XB 1M2VA 2ZSWA 1JUFA 1JPEA 3KCPB 3MRIA 4HHWA 4XCFL 2NZIA 3QI9C 2CHWA 1OAJA 1I1RA 2NY4B 3RWFB 1KXTB 1F86A 2JQAA 4Z7NB 1F0LA 1TTAA 2BNQA 1SMAA 3BUTA 5FA4A 2ZJSL 2KL6A 2L7JA 2ENSA 1VEPA 1W80A 3OR6A 3WMPA 1I8IA 1BVZA 1H8LA 2YPVL 3UZQA 1ZVHA 4EZKA 3V4PB 2GBAA 4YAQA 4KUZL 1ZDQA 3LV3B 4XPTL 2R2BA 2A9CA 3ULUF 1KCRL 3GDBA 3KPQB 1O7DC 3CFMA 3SKJL 4AYMC 3AS2A 3KLLA 5D72H 1QA9A 1X5KA 1LNUB 3C6SA 5TE7H 1SFHA 4B0MM 1LQSR 1MELA 4PGDB 1N10A 4JM0A 3T3ME 1EX0A 5D6CB 3ILDA 4JRYD 3SQOL 1DVFB 3V4VA 5GGVH 3QJXA 1EK3A 1A9EB 1OSZA 3SYAA 2CPCA 1MW0A 3G6JB 3UTSB 3QZNA 5HYQB 2CLRA 2ZT9C 1ACYH 2Y4SA 1C5BL 1QRKA 1F42A 2BHYA 2NY2D 3I3BA 3LRLA 4XC1H 4FFZA 4ZSOE 5G4MA 4YK4C 5EU7C 2MEJB 3UAEA 3J27A 4YGAB 3WN5B 2RB8A 3VH8B 1S9VB 4UT7H 4MFHA 5L88H 1E4KC 2LE9A 2NY6C 3F65A 1WBXA 3GUTA 2J4WH 2GFBB 4HV8B 4QIRA 5DVKA 5MP6H 5DHYA 2I69A 5SWZD 3N1FC 1GKOA 1OTUC 2DQGH 3U4AA 1AO7A 1IAIH 1GIGH 4J3TA 1WFIA 3QQ4A 4JJ5B 1AHMA 3BZFA 2BZDA 3IJ9A 4KHTL 5DJCB 2VMJA 4E2OA 4GMSL 3T0EB 1UXMA 5DRXA 2HLFD 5HP5A 4PLKD 5H94A 2F1EA 3RPBA 2Z9TA 3IDUA 2EH7H 1NUFA 4DHLA 3EDEA 3O4LA 2QVFB 4OVVA 1NOFA 1QSFA 4ADIA 4ODWB 2B16A 4LIQE 3P0VH 3WY4A 1CDGA 2CK2A 1YY9C 2QQNL 5FO8B 5L4MA 3DMMC 2JKSA 2EDMA 2BHUA 1KTJA 4FXTA 1X5LA 3C5ZD 4X2UA 1U92A 2J1ZA 2YBGA 4N24A 3NG5A 3O8XA 4ZD3H 4XO4A 4O51B 4F7CB 2XNAB 4QNPF 3LDBB 3VCLA 4FOMA 1ZLUK 3V5HB 2VR3A 4Z78A 1NCBL 5JW4Q 3BHBB 1KSRA 4TF4A 2WZPA 4Y2DC 3WFHB 4CMMA 1DQQA 2MOQA 2YK1L 3L95B 5IB4A 3S35L 1UJ3C 3FU9A 3VXPB 2E0PA 4PRHE 4OD2B 5IHHA 1ACZA 3F04A 2ENPA 4QHKJ 3MX0B 5EEYA 3D25B 2E4TA 2Z8WC 5A6LA 1ZE3H 5KYWA 4Y0GA 1I7ZA 3V6OE 5D1XE 4X6CA 1TJMA 2VZVA 2WKOF 1T7WA 1LDPL 2HKFH 4B60A 4WHDA 1H3XA 4G80A 4YHML 1ZOXA 4ZMYA 1N8OE 3DGGA 1E5BA 1G7LB 1NCWL 1RHFA 1Z66A 3PWUA 3GMNB 3SE9H 2PYEA 4DPBX 1BXXA 1XIWB 2ADGA 4M93C 3MLSL 1AZCA 3EFDL 3T09A 3MRMA 4HXBL 5FEBA 4BIKA 1ETA1 5I28A 1CI3M 3T6WA 4HQQH 2IFFL 4N5ED 3H9SA 2B2XL 4PUBL 4YL9A 1CGSL 1QW8A 4WHYH 1S7SB 3EGSB 4PS4L 4E5XA 4OZHE 4I1PA 1T5XB 3QNYA 4G8GB 4Q6IB 5C08B 2MSPA 1TPXC 4FQLL 4FERA 4OFDA 1Q4NX 1JVLA 3I75B 3MRGB 1UM5H 4Q56A 2Q86B 4UI2A 3OKEB 1CC3A 1W8OA 3OBAA 4EBQH 3GWJA 3INUH 2KT6A 4JEGB 3QRBA 4YHKH 5LCVA 4ZS6D 3Q43A 5FWQA 4L3CB 3ULSB 3QDGE 3VXUA 3KWVA 2ADIA 5F3BB 3D39B 1IEAB 1NC4D 3B9KB 1DQLH 3UZEA 1HZHL 2DMGA 2B7DT 3GXMA 1K4CB 4IU2A 4M6ML 1IM9D 3L9EA 4R7DB 5FYLL 4Q9RL 4N22A 3POHA 4AM0Q 3U46A 2A83A 3PWPB 4R7LA 3ZKXC 3TC9A 4BH7B 1FL5B 4XNXL 2WQXA 4XPFL 4LP5A 4UWQB 1T5WA 2TSAA 4KO9A 3IFPA 3C6LA 4LZKA 5DMGC 3S48A 1ORQA 2ORBH 4LSTL 1NGQH 5EZIL 1MHPL 4H26B 3OJ2C 4MJ5A 2OMUB 2HLEB 3ALWA 3EGXA 3GHBL 1GZPA 4NQED 1ZVSB 3O9WB 3C2AL 2YD5A 3MBEC 5CZVL 3B9EA 1OGAE 3PIQA 1ZCRA 3KR3H 1MAMH 3X13B 1BG1A 1BZ9A 1IC7L 3KPLB 2GB2A 4UU9A 1IBHA 5AAWC 3UO1L 5JW5B 2E75C 4PB0H 3UTTA 3OJDA 5F7BA 5EN3A 1LGVA 5MENA 1O75A 2GKIA 3AWFA 1R24B 4LFHG 4MXVE 2NXZD 3UTSD 3AY2A 1PSKL 1S7VB 3EW3B 4NS0A 4PJDA 1K85A 4IM8A 5B8CC 3T77B 4JHWH 1MCBA 1S7TB 5CGBA 4AH2A 3NZSA 2R1WA 3PXLA 5E5MB 1NLDL 5AAMA 3T4AC 5FOJA 2H5UA 4TRPL 4FYQA 1TMCB 1CFTA 4PJ9D 3SGJC 1CXHA 1AY1H 3KDMB 2JJSA 4EI6B 1PAMA 5EHFA 1RIVL 3H6JA 3KLSA 1TU2A 1E65A 2F1AA 4Y1SA 3TCXA 1QVOB 5AG8A 3B5HA 4XCEA 4PAZA 3PJSB 1BVNT 1VFAB 2QSCL 1MFBL 4LMQE 4X7CC 1E5YA 5IFAL 4V2BA 2Z65C 5HHME 3L7EA 5AD0A 2OMNA 4F20A 1D7CA 1SJEB 2OI9B 2X2UA 2VQ1A 2FIKB 2OZ4L 3FH5A 1EUUA 1J0HA 1IL1B 4OLVL 3GIVA 2APVA 4Z7OE 3OZ9L 5AKRA 3TF4A 2R69H 4ZOAA 1F8TL 5FUOH 4AYGA 2FUQA 5D5MF 4BCZA 2AEQL 3B2VH 1F6AB 4ZSOA 3V4VL 2BNRA 4O2CB 4WAFA 3D0LA 4L1DA 4NUJB 3J07A 4ES8A 4MDJA 3BI9X 4D3CL 1JXKA 7FABL 1JGLH 5IFHL 1HCZA 1HNFA 2X87A 4OLWL 1CG9B 3HG1D 5J13B 4PS7A 4GSUA 1EIBA 4IEFB 4NC2B 2H1PL 2QKSA 3QUXC 3QUML 4N2IA 3ZE2B 3HHSA 3PWVB 3VG9C 3ZJAA 1B2WH 1SDAB 1HQRB 3C5ZB 5I1IH 1YEFL 1JGUH 4AEHH 5KG9B 4UINL 5C0GB 2H26A 4U1HB 25C8H 4YSOA 1PIGA 3O8XC 3ZDXB 1KENL 4CC1A 1ES0B 2WNGA 2WXPA 1YPZA 3HAEH 3L4TA 3QR0A 3VFPA 2AITA 4JREC 1WG3A 5LB1A 5E8PB 1I3RA 2CO6A 3HI6H 3OL2A 3ZE2F 5E9AA 3TO4A 2NX5B 1CTMA 2EDJA 5CCKL 4GG6F 3HJ0A 4JO1L 5F9WC 3O3EB 4OCNC 3BP7B 5JOEA 5T3ZH 2ZD0A 2YGOA 5D2NB 2D7PA 3MBEA 3KPRE 2G30A 3C6SB 2ENQA 2J73A 3K8LA 2EDXA 3D4GA 3NJLA 3GHPA 1V3KA 5I8KL 3V0IA 4QAMB 5ESAB 3U4BL 1KTLA 2CKBH 4K9EC 1BZQK 3FC8A 4DEPB 1D5MB 1RZKL 2BY2A 5FYKH 1CGUA 1J05B 2IGFH 4UQ3B 4NHUB 1J1PH 1FH5H 1I31A 3P2BA 3MBWA 2IBGA 4IRJB 2E59A 1EBAA 5MP6L 5DVNA 4KXBA 4KK6C 4R2GD 3N55A 2E27L 4QRRD 4B9FA 3VNZA 3TN0B 1C08A 3TO2A 3O6FA 3BAKA 1INEH 4X5WA 2F53A 4PSRA 3SJVE 1K4DA 4XPAH 2XXGA 3QHFH 4HIXH 4OLUH 8CGTA 3MZTA 1OF0A 4RAHA 4NO3B 1KTKE 1A6AB 4PJIE 3OVUB 4B9KC 1IKNC 3FUNA 3O4LD 3KYOB 2BDNH 4MAUL 3OC8A 2XA8L 2K70A 3V0VA 4AOFA 2X41A 3LN9A 2FWSA 1ETJA 2XTJC 4A67A 3NIGF 5C0AA 5TDNA 1FIEA 4LVOB 4GSDH 4RNRA 2ZUSA 1BF2A 3V6FB 4ZFGH 5C0CE 5F9AC 5HYSG 1LK2A 2H8PB 2A9ML 3L3OC 4HD9A 2EKJA 3ARDC 3DTUB 1INDH 2YAPA 1CFVH 3FRPA 4X5XB 3IN2A 3QDGB 1U8HA 3G08A 4X6EA 1BGXH 5HYJE 2NSQA 1AY1L 1ZDSA 2YXFA 2NY4D 1DO6A 5I16B 2PYEB 3IXAA 4L1HA 2CLZB 1JZ5A 4JY6B 5IBTH 1S78D 2FWUA 4JZNA 3DBXB 2AV7B 1PLGH 4MBOA 1CGVA 4LNRB 3F7YB 1IGYA 2BXYA 2AGJL 4RGND 2UWEF 5JORB 2DM7A 2FLBT 2F1BA 5GRXG 4RQQB 4FFYA 4F58H 3MLRL 3PGFL 4NFCA 4OVUA 1ZGLP 1F11B 4EIBA 4G6AC 1CJYA 4YBLB 4G6JL 4PJCE 4FMFA 2WINB 4WEBL 3LRSB 3P9LB 4LGRB 3IU4L 4W4OC 5IB3A 2V8MA 4HCRA 2BMKB 2RJMA 1CD1A 3DXAA 4JZOA 4C4BA 5ACZB 3RPKA 3Q1SH 1NFDE 4DN3H 1I9IL 2EE6A 2DOCA 4M43L 4QTFA 5EZIH 4JFTA 2DEXX 1IGCL 3GMRA 5EBMA 3VSQA 2FEDD 1W8NA 1WA0X 3MV01 3CHQA 4M03A 2FT6A 2OYKA 2YA0A 1XTLA 5FYJH 3TJEH 2WHVA 2B5IB 3LNGA 3QCVH 2X7LB 1H15A 2XPGB 4WK0B 1IUZA 1DN2A 2F54A 4L0ZA 3T3PF 4ATWA 1HHHA 4MMYA 3CAFA 2V9UA 4I4WA 2PP8A 4K7PY 1P4LA 1XZ0A 1AD0B 2VDPB 4EEEA 1TCMA 2QVTA 2B15A 4AK1A 2JKTM 3ERXA 3MRDA 3TBTB 3IRZA 4TPRL 3VI3B 3QFJA 3D5OF 3FO1A 5JO5B 3HJEA 1E6OH 2VXSL 4QXUH 4IYKA 3PIQB 3DIVA 5IB2B 4YFDB 4Z3EA 2L04A 1J12A 5ADPL 4OIIH 3U9WA 3PP4L 1QUPA 1YEGL 5C0AB 3RWIA 3UAJD 1R5WA 2OTPA 1MFAL 3HKZA 1NL0H 3PDDA 4HLZG 5HD8C 4MLIA 3B9KC 4LSPH 3RHWK 4EXKA 2ZYRA 3L3DB 2WLIB 3KYOA 5DR5L 2A1WH 2FL5B 1BREA 2F5BH 2NQ3A 3K4ZA 4NZ8A 1ZLDA 5DZNA 1A6AA 2XIIA 3LEVL 3QG6A 4O2CA 4Q14A 1TOXA 3C5SB 3BSGA 4GB9A 3AROA 4LSPL 2G0LA 2K78A 2I9TB 1D3CA 3QBTB 1JCKA 2PTTB 4IMLA 4PP1D 1MY5A 4H25B 5T1MB 3S2AA 3J7HA 3N40P 1B4TA 2ICEB 4IGBA 4YE4H 4MJ6A 2WQRA 4NKIL 2L8AA 3S8WA 3OKOA 3TT3H 2XC8A 4E0RA 2CH8A 3V8OA 3LXCA 2OKMA 2VXVH 2B1HH 3U6RA 4FTVD 2IADB 3BIKB 15C8L 3MOBL 2IG2H 2V3EA 2BVEA 5ETUA 2IDFA 4XCEB 3S98A 3ULVC 5L6YL 4NZTH 9CGTA 3CFDA 4LSRH 1U8KB 2WXNA 5BW7A 4ZOCA 1TTRA 2XI9A 3N06B 4M5TA 1YUKB 1A7RH 4WHTA 5MI0B 5KVDL 3VAEA 4DFHA 4F8QA 1HL9A 4OM0L 1G87A 3BGFB 4WW2B 2FJFA 5IUSA 4ODVL 5D71H 3AB0B 2XWRA 4HUCA 1KGCD 2AERT 3MRLA 2VUKA 4JO3H 1IM3B 2FYYA 1T22B 2OCJA 3LKOA 3C9NB 5DUBB 3UP6A 1BFTA 3O3EA 4I48A 4E42A 2X0VA 2XA3A 4UTCA 4X6DA 3WIAA 3MV9B 4XP5H 2RHEA 5J6GB 2WANA 3FUMA 1GRWA 3WTSA 2NPLX 5T5NG 2IBZX 4NKQB 4I1RA 2I85A 1OWRM 4NN7C 1P1ZA 3FSOA 3FB7A 4PJ5E 4G5ZH 1E9OA 3V9CA 3O0LA 1DHKA 1YC8A 1U6AL 4S0HA 5F6IB 4X6CF 2X4QB 4KITB 1NBQA 1H8OA 4JZJC 1P2CA 3FU3A 3KH4A 3HRZB 2YPLA 2OJZL 5D1XC 5KG9A 3MLTA 3RWJA 5FHBL 3QJRB 5E5UB 1D5RA 5CN3A 3QW9A 3ESUF 5DRZA 3P54A 2BNUB 2Y1VA 3BZ4B 3IS0X 4HCIA 1N18A 1Z9SA 3DPBA 4PYGA 5IJVB 3RKDD 1XT5A 2MCMA 1TSRA 2PP7A 3HOGA 3NBNA 1I8UA 3AREA 1BQLH 1KCUL 1FVDA 3RY5A 3LHPL 4ELKB 4OKVA 4MAYB 1YN7A 4LLVB 4DT2A 3FPYA 3V5HA 4BFEA 3MCKA 3JWNH 1JNNL 1S7XA 1FH5L 3T8XA 5HYSB 2NOYA 2P7TB 4O51A 5EU6D 3DYPA 4F2EA 5ISZB 1KXVC 5E2UH 2E9IA 4UQ9A 2DKMA 3SDAC 5KJ7E 5B3JE 1G7QB 4XO3A 5IW6B 5BZDA 1JNNH 2CLVB 3D2UA 2EYRB 2Y22A 4NERA 2A6JB 5AALA 5L8LB 2G2NA 3ATAA 1AMYA 3L3IA 4J8RA 2YD9A 2FWOB 3H1ZA 4UBDC 4I18C 4CVUA 1TF4A 2VRKA 3UYPB 5I15L 5I66B 4QTHA 5DJ2B 3ZTDC 4G1EB 4WI3A 5IMOA 3LKNB 3HG0A 1DUZA 1HU8A 1URIA 1WAEA 4OUUA 2N0MA 5A2CA 3MYJB 2I7SA 3HE6D 5DJ0B 5DEFA 2XUWA 1QG3A 2C7UA 3WAJA 3UG4A 1EHAA 2J57A 4NQEB 4EI5A 2X4PB 3MNZA 1OV8A 3O11A 5KOVC 5CEXA 2V2XB 3RL1B 3U7YL 1YDPA 1XF4B 2AK4A 3U4BH 3U2JA 3LZRA 2NZ1A 3E8UH 1HNYA 5EC2A 1I1FB 2O6DA 4L4JA 4ZTOH 3QJVB 3IJ7A 1OF2A 4FKHA 4PP1C 4ZMOA 3GO1H 5I5IA 1KBWA 3MV9A 3APMA 1KIRA 3DMMD 5F1NA 3QH3A 1S7XB 3BH8B 4NPYB 3N1QC 1X9UA 3BWAA 4HEMA 3VQLA 4Y16B 5HDLA 3RBGA 4DETA 4S1DD 1NJ9B 5F1IB 1MH5A 1T83A 2PXYC 1JE6A 3JTSB 3D69A 5EO1B 3UOAB 4JZOB 3E3QC 2YAMA 5IROC 3RJDA 1NIAA 3TM6A 2BHFA 1EWHA 1V27A 3L3JA 1A02N 1NFDB 3MXWH 4N0RA 4QR7A 1I3VA 4WO4B 4XN4A 1IBZA 2R69L 1DZBA 3U9PH 4HUVA 4IS6B 4ONFH 1OGAD 5AW1B 3RUGB 1XGQA 4NENB 4Y7MA 1BJ8A 1U8QA 5F7WC 5G5DA 3MCG1 4KK8C 4MD5A 3DDGA 3LNHA 3T6VA 1KT2B 2X2YA 4D9RD 2VM3A 4V2CB 4X6FB 1AJ7H 4H44C 1UD4A 4B7IA 2VDNH 1KIQB 5FDWB 4XNDA 4LSRL 2BOLA 3FKUS 4I7ZC 4W9HC 1NTDA 4F2ME 5CJ5A 2MPAH 4NHCL 1C9SA 4N2AA 4B27A 1DBBH 1IAIM 1MEXH 3I6GB 1E4WL 1QQDA 4KU1A 1LE9B 2QPDB 3KPSD 4KMQA 2QVIA 4P04A 3H56A 4JFHE 3M17B 4GRLD 1KNOB 4W6WB 3DIDA 3RWHB 2H47C 3SDXB 1T3FB 4JFPB 2VZSA 2OQJA 3MSPA 5GS0L 2EDNA 3VXTB 3SOBL 4M5SA 4P5MA 4Z7OF 3WEMA 5EG6C 4IEFA 1MW3A 1OKEA 4OLWH 1KYOK 4PB9L 3SDAA 2YAQA 2VDOH 4UTBA 3W39A 4OT1H 1ID5I 1MSPA 4PG9B 5ERWB 3UMTA 1C12A 3VQ1C 3H54A 4CW1B 3OKOB 4HKZA 1YECL 4GUCA 3ILPB 4HJGB 4HWBL 1S78C 3S0PA 2BO0A 2XG4A 5ICXB 2JV6A 3DHPA 3TURA 2XTLA 2IGTA 3I02A 1DVXA 4O2EB 4KTGA 5IVXB 1SHXA 3KPNA 2OMXA 4LQFL 4YFLF 3G5YA 4M6NH 4MYWB 1P5VA 3I6LE 4XE5B 3QXUA 2FZ3B 3OGCB 2DQEH 4OZGF 1FAIL 1LWRA 3T1WA 1NFIA 5SV4A 4LL4A 4Y4HC 2BMKA 1A5FH 2WNWA 1VFAA 5DJAA 1X4XA 3P9LA 4OF3A 5CSZA 3LCYA 2WBJA 1NIBA 1GSKA 4XPHL 4KNTA 5E70A 1MUJB 5KSUB 1G1YA 1NCGA 1S46A 3REWA 4IRJC 3GLAA 5IQ9A 3QORA 2FT7A 3LB6D 3L08A 4Q2ZA 4OJDH 2LU7A 3DOHA 3HNSH 1EEYB 1Z0MA 3RP1A 4GW4A 2VITB 4OW6A 4Y1AA 4ZS7H 1HWWA 5EO0B 1HK6A 1N5YL 2EUWA 1K5NB 2MKLC 2W65A 2MOVA 5CZRA 1ED3B 2HRPL 4GT7A 3BN9C 1QHQA 5KJRH 3KXFD 5E8NB 4MNGE 1MRCH 3D12B 3DROB 5CMAA 4YUEL 1HH9A 1HKLH 4DZ8B 5D2LE 3EG9B 2WLNA 4NUGH 1JOIA 3N3EA 4C83A 4ZYKA 1F02I 4YOKA 3ETTA 4XNZB 5IB2A 1YMHB 2R0ZH 4XP9L 2V9RA 5CJXC 1E6JL 2RALA 4LVOC 3PQYD 3BDYL 3FYEB 4OM1H 4GQPH 3JWNG 3U30B 2HX9A 3DARA 1IGMH 3FONB 5GRWA 1Y6KR 2YZ8A 1SYVA 1T21B 4G6JH 4WFHE 4LP8A 1HILB 4NRXA 5IJKC 1TCRB 4NXSA 1WGOA 1AIFB 2PETA 2WLHA 1G1KA 4L4VD 4KKCD 2RCSH 4JG0H 4ZSOB 2AZUA 2ZXCA 4NQUA 1AACA 4H1LH 4PWHA 2FSEA 4M9OA 4L4TD 4XH2A 3AG3B 1AZZC 3UTSE 2FR4A 5IB1B 2X4UA 4EOWH 1FFPB 3PJNA 4GEIA 2WKGA 5I9QC 1E4HA 1KB5A 2W07A 4OD3H 2UZIL 1C08B 2WVVA 1KACB 1CQYA 3FFOA 5ALCH 4FA6A 3WJMB 4HZAA 1K5NA 1NBVL 4PS4H 1MCEA 1T03H 2AQPA 3WTWA 3V7MA 1J5HA 3PAYA 5EZOH 1MCLA 4P3WA 1UUSA 3HCVA 5JA9A 3BZ4A 5K1VA 3AFLA 4HJJH 2E6JA 3TTSA 5CINL 5JQIB 43C9B 5BRZD 1P0SE 2WWMC 3JTTB 4BHUI 2N1TE 3INUL 1UEMA 1QSFE 5DVPA 1YZZA 3F5WA 3REVB 1AC0A 3ZT7A 4RMRA 1YNKL 5G4OA 1RZKC 4Q6IC 3GS0A 3IFOA 4PVLA 2Z93B 2GT9B 5C07E 1Z32X 1G9MC 5CD5D 3U0PA 1DVFD 1IX2A 2HT2C 1KXQA 2YXMA 3BGMB 2EIJB 3FQUA 5F6IC 2CAKA 3RHWF 4X6EB 1MCKA 3NN8B 2Y1YA 1EAPA 4HJ1A 4AC2A 5JZ7D 1TJGL 5MENB 4GAYB 1HJBC 5CLZA 4AV0A 3D09A 3KNBB 1XEDA 5CFHA 1X5IA 5KBLA 4ERSL 1A8ZA 4G9FE 3F05A 3GMPB 4M02A 4U3XA 1NZRA 2K7PA 4RGNE 5F21B 2APTA 4HPYL 3DNKA 1L7IH 4KDVA 4MB4A 4X4XA 3P0VL 1UWXK 3SPCA 2ZXGA 2QFPA 2I60H 1D6EB 5I71C 1U3HC 1JL8A 3ZHDA 3HCVB 2E6QA 4HT1H 1MI5D 4NQQA 3RWDA 1LEIB 2PO6A 1DDHA 4NEHB 1W72A 1UQSB 1THAA 4M00A 1JZFA 2DMCA 4FFVC 2Z92B 3K2UH 4AXWA 4DPAX 2H32H 2NZ9C 4G6FB 5MEPB 4FXKA 4CU7A 5JDSB 1IC4H 2D7OA 3RX7A 4IKIA 2YXVA 1XR9B 1XF5B 4M4RA 4P9ML 3RLSA 3VFVB 5CUSH 2YUZA 1L0QA 1ILUA 4ZODA 1KCVL 4JY5L 4DP5X 3UXFA 1FGNH 2HJLA 4OTXH 3FUHA 4DVBA 3K7UA 1TCRA 4A7GF 4M29A 3RWGA 1V3LA 3FT9A 4GPVA 4E36A 2OP4H 2VJ8A 3IJSA 1L9NA 4KK5C 3WLWC 2QDVA 2R4RH 1KCVH 1IJ9A 1QASA 2HJKB 3KD4A 2K6YA 3I3DA 3MGOB 2DQIL 4TL5A 4DK5A 3VXMA 4D94A 5CR8A 4ZTOL 1Q8MA 1T6BX 4DP0X 1RFDL 2H26B 4U1HA 1JWSB 1F8TH 5F7YC 5FUOL 1HL8A 3AQYA 4IS6A 4LRIC 2EH8H 1AHKA 5TQ2H 1YQVH 3CLFL 2OZ4H 4UIKH 3BUYB 1RV6X 4I88A 2ROXA 4YSTA 5HSFA 2B0SH 5TE6L 2OLDA 1BCIA 1T6WA 1RPQA 2WTPA 5CLTA 1DLHB 3VD1A 4OZIB 4ALAH 3B9VA 4QTIL 2NX5A 3BSZH 3RTQD 5TPWL 3GMNA 1NANH 3RNKA 4N26A 5A3ID 3ELAT 1WBYB 2PWGA 3SQOH 3ZRSA 4AM0B 1L9MA 3DLQR 4NPYA 4PIRF 1VESA 2FB4H 4DGVL 1FVEA 2DBLH 2QHRL 1PG7H 3QHTC 1CN4A 3SDCC 3IKCA 2PKDA 1K2DB 3NIGB 4LARL 3MV8E 4MJID 4GW1A 4YFLI 4Z23A 4FL4C 2WBJB 4JFXA 4JPVL 2VSCA 4A1RA 3UZVA 3M1BA 3VFMB 3MX0A 2XZAL 2HB0A 3L4UA 4U1MA 2WOBA 1U8CB 5F9JB 3QEQB 4QHUB 2MCPL 2XOTA 3LNFA 4L8BA 5HJGA 4HPOL 1H5BA 2HX8A 1BQHB 4MJIB 3MREB 3HNVH 3CD4A 3QZPA 2JJWA 4LIQL 3UTQA 6TAAA 5E6IB 4PRHB 5BJTB 1W0VA 1OAUH 4RDBA 4X6BB 3JVGC 2VM4A 3MROB 4PJHB 2A83B 1BDYA 4PSPA 4NT6A 5ILTH 5DTFA 2ZCKH 4UOJA 3EJCA 4JN1L 5AB9A 1BM3H 3OLGA 1OIOA 1A1OB 3GHBH 1DJSA 2CLZA 4F15C 2E9BA 2DJ4A 3PYCA 3GBLA 4HK3J 5I1JH 5AKSA 4NQDB 4TUUA 4CC0A 2X4NB 1VIWA 4DVBB 5T3XD 4FABH 2C4FU 5D2LF 5BUAA 2XN9D 2VLRE 4PG2A 4WU7B 2DL2A 1OD7A 2P8PA 4GUPA 5C0BE 3N44B 4UU9B 1QLFA 3LQMA 4JANA 4P3DB 1YN7B 5C3LD 1LK2B 2H8PA 1WAAE 4Q6IA 2PMZA 3NIFE 4QRUA 4FJZA 2YFOA 4QXGL 2N56A 3SDXA 1U42A 4PGJA 5E99H 1RK1B 4D0DA 2G4GA 3D1MC 2W88A 3FXIC 2QQLL 3GM0A 4TTDD 5E08L 4WHCA 5FUCC 3FT2B 5IG7A 1FNSH 3LH2H 4M8RA 1VEMA 4ZW5A 2WZ6A 4WNJA 3HC4H 5I8OH 3NJGA 1M42A 1A2YA 5LN8A 5D4JA 1X9QA 3MGAA 3O45B 3FN9A 5GJTH 4NRYA 4GKSA 1CICA 5JW3L 1DQMH 3LPGA 4AEIH 4G6MH 5DQJA 1K8IA 4LF3B 4FLSA 2RH0A 5HI5D 4AGOA 1I8MB 2QJDA 3VI4A 3D85B 1FA4A 2X9WA 3PDOB 1TFPA 2YUVA 1NC4A 3UTSA 2XY2A 4Z3GA 1AXSB 1BBJB 5L2KD 3WL9B 3ARRA 2R4SH 2O26U 2J5WA 2J1YA 1A6VH 3K3QA 4MJ4A 1GZPB 3R1GL 2QTEA 4GAFB 1I8KB 1OCOB 5ESAA 4Z7NF 1P7KA 2W5PA 2WXIA 2IQAB 1CLYH 5B38A 4O02B 1VKXA 3CSYA 2K4WA 1DUYA 3QRGH 3RGVC 2P9RA 3QJSB 2N01B 2NMSA 1TJXA 2EDFA 3LV3A 2WK2A 3RIKA 1GS7A 4P2RA 4L8BB 5F2FA 4RGOL 5JDJA 1MAJA 2A74B 1X3DA 2O5XH 3TONA 1A6PA 4JRXE 3UZVB 5IMLB 1AQDA 3MA9L 1MJJB 2ADGB 4XHQA 4CN4A 1GJIA 3K72A 4E41B 4WTZG 1THCA 3P9WB 2A73B 3BZDA 1CR9H 4YGVB 4FNLH 4J28A 5CEXB 1E9QB 2BIIA 1NKOA 4ELDA 1F3JA 4U1LB 4ZDHA 5CP3A 1IRAY 3V0DA 5AFAA 1L9TA 1IGCH 3FUEA 3MRIB 4AGLA 3MROA 3LZOA 4C4KT 4KJQD 4FQCH 1KZYA 4X5LA 4YBLC 3UTQB 4NQVA 2PN5A 3L4CA 3T2PA 5H2BB 1A4BA 3CMGA 4KVCL 5FF6B 2WLYA 3QSKB 3S36H 4KKPA 1WGVA 2HFFA 1GYCA 5K9KB 3QA3B 4ILDA 2AQNA 4XN1A 2NW3A 3ARFC 4QRUB 4XMKL 3TS8A 3QHFL 35C8L 2EO9A 1FFRA 2A77H 3FTGA 3QUKB 4EKJA 3D0LB 4ZMXA 3T2NL 4JQXC 2WYZA 5AWNH 2XN1A 4WUKL 1F6AA 4IRZH 5L9DH 3GTNA 4D7BA 3QIUB 1MIML 2Q6WA 1WICA 3QEGH 1J1PL 3VFOB 4R83A 1KY7A 4CRPA 3BPCB 3KYMA 1YSOA 3TBYA 5E4EC 3O6LH 1M7IA 4F8LA 3HFFA 3NJFA 4UDTB 2HG5B 3V4VB 2D03L 4H20H 5LQBH 3EFOA 3KVDD 3R4DA 3H42L 1IARB 1Q0YH 3MBXL 4UTAH 4HXAH 4G9DB 4UILH 5TPWH 3MLTB 1FV1B 4H2AA 3O6LL 2X89A 5FECB 3U6XA 2CO4A 2Q1EA 4I2XB 4FFWD 4PJGB 3D3VD 3IJYB 3ZHKA 3Q0HA 2IQAA 4XNYH 5CS7A 3P4NB 3VCLB 1DDHB 2AJUH 4UM8A 1JWMA 3A6CH 4FA7B 2WP3O 1B0RA 4FI8A 2V7HB 5L8KB 3GSNL 4BZ1L 2EDDA 5AVVB 2HFEB 3VW3H 1ASQA 1Q9KB 1TQBB 2GFBA 5KOMC 4H8WL 4N2OA 2V3FA 1D5BB 4XNYL 3HFML 4Y88A 4B95C 1CDBA 1J5IA 1NMBH 4O9HH 1DVFC 2HT2D 5HDBF 2BZ7A 5EEVA 1BZDA 2ZOLA 2YUWA 1ADWA 5TF1L 1HSBB 2DQIH 4OF5A 2BY3A 1MPAH 3NAAH 2R56H 2WPGA 5D4HA 1TJIL 3PWPE 1T89C 2A6DA 4XXWA 5HHXH 3BE1H 2LFGA 3BFQG 4G7QB 4KXCA 4OUOA 5ID0A 4Z6AT 5KN5A 4WUUD 4JFDB 5LWYL 2XWBB 5D5ME 1GS6X 2PXYD 4WZ9A 1AP2A 2VH5L 3D39E 4AGQA 3FRPB 2AMUA 4Y2DA 4KX9A 1OPOA 4Z7WA 2QKIC 5EBWA 2N59A 3VA2C 5A7BA 3NFSH 1ZT1B 4G5ZL 4PD4K 4TN9A 5GZNC 3SO3B 3K5RA 3U46B 1FO0B 1YEEL 4XVTH 1CVRA 4P3DA 1T7VA 5CJXA 3ECVA 3VI3F 2PWFA 2DDQH 2XYCA 2NXZB 2XCMC 3OXSB 4AGMA 3P3RA 1I8IB 3TNNB 3QJHB 1H3UA 2VQUA 3MLYH 3QUYA 1ZT7B 4MSWA 3W5MA 2DRUA 3D3VE 3P11H 4LDCA 3IBOA 4K94C 4PMFA 1MCPH 4GH7B 3FUJA 3QZWB 3D2TA 4FMKA 3RVUD 1RZKH 1S7QB 5DHVB 2QSCH 4LDEB 2FR4B 4FXGC 2E6PA 2CGZA 4UIMA 2N3JA 4L48A 3WHXA 5HPMB 5J6HB 1XGRB 3T0ED 5EU4A 1I9JL 2JKIS 1Z5LB 2J6EL 1M3JA 3T8MA 3G5ZB 1OQXA 5D9SB 3QEQE 5E6IA 1Q9LB 4JRWA 3WMQA 4HUVB 1QI3A 1CU4H 4GYBA 1TITA 1HL5A 2F5BL 1BQHA 1QYGH 3ARGA 3L4WA 4FJ6A 2X2HA 4MJIA 3SDAD 4H1LG 1ASPA 4ZX5A 4MWFB 4RX4A 1PYWB 3ULUL 2IPKB 1HE8A 4HJUA 2VDLH 3RDJA 3TEZA 3QE5A 2AI0L 3L5WA 3WNNA 3WFEH 4BKSC 3PHSA 2F0CA 2QELA 3WFZA 1AGBA 3P4MB 3PGCA 4ZUSB 3ROLB 1MY7A 5D5MB 1UM4H 5HGHB 4I87A 3S5LB 4OGAC 4A2HA 2WQAA 4KH9A 3EJYD 1KIRB 3N1PC 3EDDA 2NQCA 5FYLD 1HQ4B 5LBSA 1NFAA 1JGUL 3SDCD 1NCCH 3ABGA 4AJ0A 1M2OA 5DC9B 5D7IE 5GJSL 2OSWA 3WJLC 2XBDA 4I0PC 5KSAC 3ARBA 5KYUB 2J8UB 3IFOB 4LLWB 4J12A 5DYOB 3ABZA 1P1VA 2BIQA 3FAWA 5T33L 3R06B 3HC4L 3SY6A 2HVJB 4HLZH 1RZGA 1KV7A 1NEZA 2V8LA 3RB5A 5DZVA 3LYRA 4DH2A 3DX6B 3HUJB 5J9PA 5D1ZI 3KG5A 4BJLA 4Z7IA 3TIEA 2OR7A 4JFZL 4CADB 1ZHBB 1WEJH 2NY5C 4FYTA 2P80A 1PIFA 2ALWA 3LKSA 1QBAA 5KTEH 3NFPB 4PRIE 3ISRA 5T3XL 4FAAB 1XGPB 4K23H 4XVJH 3OX8A 2YPKA 3T0EE 1D5XB 1BJ1J 3HN3A 5F3HB 1XSOA 3L3IB 2XQ0A 4AL8H 4MXWL 1FO0L 3MRNA 4JFED 3SPJA 4DEWA 4M62L 4Z7VB 3FZUC 4BA0A 4Z3IA 3H4FA 1U8JB 2VXSH 1CS6A 1S3KH 4QXUL 4PIBA 3QUYB 3GJEB 1XCWA 2Y1AA 4FNSA 4NQEE 4TOYH 4FXKC 3MZGB 4X98A 2F74B 4OY9A 4L23A 4NQCA 4OCSL 3ARFD 2V5YA 1DBJH 4M1CC 1SDYA 2WNXA 1OVZA 3L9RB 1IU1A 3NABH 2VDPL 2OMWB 3FTWA 5ENWA 3LRMA 3VI4E 1QD0A 4ZQKA 1HIML 1VDGA 3U1SL 3VD3A 5CSZB 3K71B 1CMOA 2AGJH 1OTTC 3V79C 4DGVH 4FD0A 3STBA 2W9DH 1E4WH 3ESPA 3KBHE 1AGEA 2F9BT 4GRLC 1QTYT 4U1LA 4ZDHB 5BV7H 2B0SL 5TE6H 4P5KB 3UYRH 5E8NA 2YXWA 4OJFH 4PJ7F 1KGWA 1S2EA 3AU1B 4KJWC 3PUCA 1OSZB 4LSSH 3GIZL 3VVVA 5HHQA 4UQBA 5D93C 5DZAA 1A0QL 1XGTB 3H8NA 4FG2A 4BKLA 1CE1H 3AITA 3ZDWA 3JWOL 2IPKA 5I75C 1TQVA 3DPDA 1G43A 1R3JA 5DVMA 4LCCA 4E41E 3HS8A 5IF0A 5J11C 3RGVB 5GQBA 1YECH 3TPKA 2DDQL 4RMQA 1R3LA 3GYRA 5G5DB 3S5ZA 4WI2A 4LCWB 1CCZA 1AZRA 1C5CL 5AZEH 2A6KB 3MV11 2WCGA 5TF1H 2UYLA 1KPRB 4M8UA 2OFQA 4FQJH 3ARDD 1YJDL 1YNLH 2F7RA 2W9LA 2Z4TA 2EDYA 4X99B 3TYFA 4PLNC 2FYVA 1NMAL 3N9GH 4PV8B 2DY2A 3L8QA 3VSUA 1QRND 2EEBA 3HBGA 1WISA 3MV9E 4K4KA 5E2WL 3UC0H 3HC0B 4ZFOB 2JCCB 3PRZA 2O4EA 4QRRE 3CLEH 2D4DA 4ZMZA 1K6QL 4G2AA 1WT5C 3O2WL 3T6QC 1NBYB 1AGCA 3P02A 1JNHB 4UILL 2CNYA 1E4JA 4Y9FA 3VWKD 4AWJC 1KBVA 2WWNA 4E9SA 1OAYL 2KLTA 4C4UA 2Q3ZA 1FFOB 2P8MA 1BD2A 4G6AD 5J1AB 2Z8VC 5LGKA 1N3NB 1YHPA 4F7TB 1JV2B 3IVKA 4HD5A 2VLKD 1FC2D 3A0OA 1X6LA 4YHMH 1IGTA 3SKNB 4PWKA 3BXNA 3L4YA 3UG3A 4GS7C 4PGCB 5I6PA 3D2UD 2PYEE 3QA3A 4HS6B 1IC1A 1XWVA 7PAZA 2Q8BL 1Y1DA 4ESKA 4D0DB 2YAOA 3V6BR 4AJYV 3Q8FA 4I13B 3RB7A 3HG4A 2L0DA 3D4YA 5FKAB 2O5YL 5ADOH 1MHHB 1PEZA 4KX7A 4FFZH 2G60H 3VG9B 4ODXA 1HSAA 1HVXA 3BPNB 3ZDYE 3X14B 5DSCA 2OR9H 5ITFB 3KPRD 3QH3B 2FWOA 5FFLA 4X0NA 3B56A 4RRPM 3VH8G 4QOKD 4ANVA 3E6HA 2ZOLB 3M07A 3FQUB 3MUGB 1LYQA 1LLAA 4MJHA 5D4QA 4KZDL 2FGWH 5FLVA 4FZ8L 1PKOA 4OJYA 1HHHB 4MMYB 1AAJA 3NSDA 2QQQA 6PCYA 2OR8A 3LKPB 1RY7B 2ICWB 3FQXA 4KXDA 3MUY1 2C26A 4XP5L 4F7MB 5I1EL 2QR0B 4M1DH 2JQZA 4NENA 4JGNA 3TX4A 3IJYA 1CL7L 1DVQA 3M1OA 3MCLH 2CJ3A 1NPJA 2VSDA 2CIIB 4OCMC 4TVPE 4YJZL 4X9FA 3L3OA 4IBVA 1HEZB 3ZGIA 1EEQA 2ZX5A 1CFTB 2EKSA 4K8RC 3VQ2C 3L1GA 4EMZA 1GOGA 3VFSA 5K5YA 3UTOA 3S4SA 3MLZH 1TQCC 2OSYA 1EERB 4KFZC 5C0RL 4MA8L 4KVCH 4MCYB 3KCWA 1NCIA 2BX5A 1W15A 3BHBA 1GIGL 1PJ9A 1DQTA 1GA2A 4KOCA 5E2VL 4BBWA 4BZYA 4HJJL 4Y19B 4PRDB 4JPIA 2A9NH 1M4KA 2CK0H 2VNCA 2AEOA 1UWYA 4ZI8A 1ETZA 4S2SB 5JXAL 1A7QH 1PY0A 3I6KA 4CSPA 3QIBD 3AQDA 4UNIA 3US1A 1PS3A 2OXHB 2FWLB 1T0PB 3N42F 4ODVH 1XGUB 1RUKL 3T65A 4L5FH 3QQXA 4HJ0D 4BCYA 2VXUL 4JZJB 4DNLA 3GSXB 3DPBB 3D33A 1BVKB 1SEQL 1CTNA 1ORQB 3ZTNL 1BPLB 5H2BA 1KULA 2BJMH 5K9OA 4Z5RA 1IIIA 2B4CC 1JCVA 2R59A 2WUCL 4M56A 3OAYK 3NCEB 1T7XA 1OGTB 4XNAA 1U95B 4CC4A 2J5LB 3QVAA 2FE0A 4LSVH 5B21A 3ARDB 5KYNA 5C0BD 4ZXBD 3D0VA 5I8CA 4OLXH 4Y8DC 1R3KA 3VXRD 2ORBL 6CGTA 3DOSB 2VLRA 5GGSA 2JKRM 4N8VB 1LDSA 4CVZB 4V1DE 3OKEA 3RUGE 4JFSA 5ITBL 3IDJA 1OM9A 4LLQA 1T22A 2LOEA 4HKJB 2DL9A 2H2SD 3CHRA 4OM1L 5BVPH 3REWB 4B53A 5AVXB 1UOVA 4ANUA 3GBNH 3CSYB 1EDQA 2D7TL 1GGCH 4LU5L 1XX9C 5DJXB 1GOHA 3RNQA 5KSBE 3V2AR 3WIIH 1YMMD 3UAAA 3N1MC 1CDJA 1Z9SB 3KPSA 1EZUA 1H5BB 2EC8A 2DBJA 2EXYD 4PREA 5C71A 3VFRB 5DRZB 2WXJA 1N5AB 3EADA 2RCSL 3I85A 4JG0L 4N1EA 4XNQA 4NNPH 2XVLA 4NC0B 3OKKA 2BSDA 4OQTH 4X9HA 1SN0A 2FTAA 1TPXB 2A38A 3HRZA 2P5WD 2WIIB 4W4OA 3UX9B 3ZZ1A 1RIUH 2X4QA 1SXAA 3DURB 3MRDB 1ZIBA 5AW2B 1OE2A 3CSBA 2NUTB 3X17A 4TSAL 2AJZA 4PV9A 1HSBA 1E50A 5MEQA 4HQQL 4IBTA 5CEZH 2ITEA 1E8ZA 4M48H 1PMYA 4L3EB 2UVEA 4P46B 4KK9D 1U93B 2MQGA 5E23A 4I48B 3HR6A 2YSTA 3C6LD 4GRWE 5E4IA 1FGVL 5LVEA 3RTQC 3BP4A 3FUKA 1L4IA 4FLOA 4PJ8A 3HVDA 4L9LB 4NQEA 4P2AA 3CFEA 4R5XA 2FB4L 1N5YH 4W9EC 1KWKA 1TYRA 5DEFB 4Z5RB 1X7QA 5CZXD 1JF5A 2HTKC 3OXRB 4ICWA 1AI1H 4EUPA 3PQYA 5TE4H 5CM1A 4JCWA 2F8IA 1IC0A 1U92B 1IGFL 3P77B 3VGAC 3DHUA 4GQRA 1EXHA 2W94A 4OFYA 2PWDA 1FYTA 2XZAH 2W91A 3G5XA 2QGCA 1GMIA 3ILEA 3VWJA 2XA8H 2FBOJ 1P5UC 4N85A 5I76B 4NAQA 2HJLB 2VC2B 4XX1G 4NQCB 4XXDB 2YN5A 4UV4H 3TJHD 2E7HA 2HVBA 1R75A 1SJHA 2NDFA 4X8JB 2LFEA 1FZJA 1EXGA 4O2FB 4UDUA 4L4TA 3QDJA 5C86A 4PJXB 3SDCB 4PRPE 4EPSA 2WLIA 4Q9BA 4P8QA 2QLVB 3KBFA 2GJJA 4X9GA 3GMLA 1XCTB 4H8UA 5K9KA 2BSBA 3COOA 5DRWA 4WSGA 5KW9H 1BX2A 4WCYH 4D0BA 2QMJA 4KROD 3ARQA 2MNUA 1QP1A 1ZRUA 3DX7A 5DQDH 3VFWA 1MRDH 3KYNA 3ZTJH 3BRGC 1F2XK 1S4IA 4M1GL 5ANHA 4B9GA 1U4EA 5SX5K 5CILH 3FUIA 4S1SL 3CFEB 1WA1X 1K2DA 2KDYA 3BWAB 3NGBC 3NPSC 5JW4N 3GSWB 4ZFFB 1IC5L 4MMXA 2DQDH 2HFGL 2BP5M 5E6IC 5CJBA 4BSWB 1QFUL 4LKXB 5HY9B 1WBYA 2H45A 3F7PC 2A73A 2EVGA 2VR9A 4A7GA 4XMUA 5ES4B 1EJOH 4L4VA 2R23B 2ALAA 4WEBH 2J88H 2IJ0C 3RL1A 3ZW3A 3ZYOA 4ZT1A 3FOMB 4RBPK 4K8RL 5DD1L 2XFXA 4C58B 3ATBA 4ZX3A 1P84K 3BP5A 1VACB 5KSAB 1E67A 1WH0A 1ZA3B 3TZVA 5B38G 3W37A 4OFPA 5HYJD 1DUYB 2FJFB 1QSEE 1HSAB 2IWGA 2XLLA 3E80A 2LLGA 1C5BH 5DEJA 2AEPL 3DX7B 2RFXA 4H0LC 2ZCLH 5C2UB 4TVSa 2XV3A 1UD8A 4N20A 4GI9A 4FLQA 3VXUE 2WLMA 5FV2A 1KF9B 2QV2A 3B43A 3QPQC 4LNVA 1SLXA 4D0CB 3EOTH 1YY9D 2MFNA 3OKNB 3BMVA 3FHEA 3QXVA 1AD9A 1U58B 4GEJA 3TBVA 5GRYA 5JMOC 3GBNL 5FK9A 2WYHA 3II3A 5KVDE 3FYIB 1BEXA 3CMOL 4Q9QL 1Z5LA 4MZIA 2HH0L 2SEBB 1PBYA 4O4YL 3OAUL 4MAYC 1LMKA 4JZNB 2Z34A 2YRBA 2CPUA 5IVXE 3FQNA 5E2TL 1SBSH 1CZ8H 5I6LA 3MQIA 2Y5QA 4X7SH 5IP4A 3G5XB 1ZMYA 5I0YA 4L1BA 2FECL 3D39A 2HH0H 3K74B 4UTAA 3CZJA 5T1LD 3OR7B 1FBIL 4AXWB 1R17A 5JHLH 3SDAB 3D8MA 2CRYA 3NUKA 3Q2CA 4PN6A 5E8DL 2W60A 3RWDB 3AACA 1RMFL 2DLFH 4BH8B 4F5CA 2K3HA 1PF3A 2G75B 3WENA 5KZCB 1WLHA 3F7QA 1RK1A 5HHMB 1MFDL 3KDPB 4XOBA 1O7SA 2CO7B 4IIZA 3GSNA 4HETA 1KJ2A 3VJ6B 5SWZA 3M17A 4D3CH 5EZJA 1YEIL 2VLJA 2XACC 2WW8A 3MJ7B 4GOSA 4AIOA 3PL6B 2MCG1 2YMOA 4TSCL 2H1LM 2P42B 4GRMA 1ZT4A 1YJDH 3HKFA 3PWNA 2EDLA 2IGFL 1L9RA 3PHAA 4UZGA 3MRJA 4V11A 4FCAA 4KK8D 5F71A 4YXKL 5AOKA 2EACA 1D9KB 2G5RA 3DX2A 1SJMA 3LNDA 4WFFD 2HZHA 1R34A 3QORB 4X6BA 4TUKH 3RUGA 3SGEH 1PSKH 4ZFFA 3FCGA 5DLMH 3HI6L 4GXUM 4HC1A 4NXKA 4K7FA 4OLZH 2Z91B 3GXUB 5DHMC 4PJCB 1KLFA 1EJFA 5FGBC 1WCBB 3DX3A 2XKSA 3ARFB 5GGUA 4YDLB 2KHAA 1OZTG 4HUWB 4JY4A 1QVOA 4P23C 5E9DD 2G2RB 3OSVA 1F11A 1G7MA 1CD0A 2DIBA 3QUYD 3H9SD 4JG1H 4CMMB 2GIYA 4WO4C 3V55A 3X3FH 5T1JA 1AG6A 5T1LB 2VR7A 4RMUA 4U1KB 2Q8AH 4DN4L 3BH8A 2X4UB 4S10A 3L9BA 4NJAL 3UL4A 3VG0H 4TNFA 4H88H 4HCFA 5JIIA 2R0KL 3IBEA 2EDRA 2YPVH 2OTWB 1KDJA 1M05B 2IFGA 3PNWB 3STZA 3WLBB 5F6HJ 3EDFA 1AYRA 2OJZH 2RMNA 3HS9A 4TVPD 3IF1A 5BUGA 1SFDA 2EINB 2BCKA 2I9LA 1ACXA 1BZOA 4FNPA 3BKCL 2EICA 4XWGL 2XICA 1S7VA 4HKBB 1UADC 3OB8A 4PJDB 4GBXB 1RXLA 3KPPA 1PL3A 5AW4B 2EVJA 3QULB 5E4EB 1ZSDB 1FWXA 2JKWA 2OSXA 4C8XA 5C0FA 4KKBD 1LL1A 1FRGL 1X5FA 1M7XA 2UUDH 1HHGB 1IAOB 4YZFE 4NZFA 2I07A 4Y9GA 2JLPA 2R1YA 1NBZB 4NKMA 4OUUB 2YAFA 5K9OB 1A8JH 1CLOH 1TNMA 3V0FA 2FJSA 3ARBC 4QTHB 5DJ2A 1KCBA 5LXGH 3BH4A 4DZBA 3PDGA 5AZ2L 4Y4FC 1T1WB 4LOFA 1QQDB 1BWMA 5TTRA 3WNKA 1MHEB 4M3JA 3GSVA 4ZW6A 3CV5A 2N7SA 3CTTA 4UDUB 4P9HL 3P69A 4NCC2 4NAMA 2XT1B 4O02H 2W8CA 3KLQA 2AV1B 5DS2A 5JW4M 5EF3A 3K0WA 3T4YA 3UPCA 1P7BA 2RQ8A 3HPJB 4YSEA 2YBRB 4BEIA 3FRUA 2I24N 3AT8A 4G9FB 3BKYH 3VMOA 2P5EA 2FEEI 3M45A 3SD2A 5FO2A 5F7HA 3KWXA 3B9KA 5F8RC 3BN9D 5C6TL 4U1GB 2ADIB 1GGIL 4HFUL 4L18A 1KOAA 3MLWH 2PPDA 3HC0A 4YWGL 4QEGA 1I1AC 2X1QA 4R4ND 1PYWA 4PV8A 1RL1A 4XN9A 2P8LB 4IBLT 2XZQL 4UMGA 5HHVL 4PREB 2CIIA 2DQUL 2QPFA 3LIUA 3E6FB 1LO0H 5DZLA 4MVBD 1OTTD 2Z91A 3DX1A 3Q5OA 5MHSD 3KZ8A 3ESVF 2V17H 3MACL 1KYUA 1P7QA 2OMXB 2R51A 3MXVH 2J2ZB 5DD6B 5ID1A 2VJXA 2AK1L 3CN0A 3Q6GL 3V6ZA 1QTPA 4FQIL 3IDYC 3NJHA 4DUWA 4QHNB 1N6UA 4GXVL 2WVSA 4P07A 3ZYIA 4NQCD 4OZ4B 1NCHA 1UD3A 3NJXA 3VDBA 2EIEA 3BAWA 4UCFA 4ZW7A 2DI9A 2WXKA 3PQYE 4JKMA 1JK8A 1S9WA 2I7OA 1ZGLB 4LHQB 2GT9A 2Z93A 1MWOA 5D7JA 2F6AA 2D0HA 1H3TA 3CPLA 3FB8B 4HS3A 3FW6A 3JSSA 1WIOA 4WFHD 5JW5A 1UWEL 2PR4H 1VHPA 1EXUA 4LSVL 4LEEA 1T5XA 3IDXL 5JNYA 1HXMA 3ZXAC 3EIFA 5EA0L 3RWHA 3TBCA 4A04A 5CKGA 1R5IB 3KYNB 2OL3H 4AG4H 1M6UA 3WBDA 4PJXE 2O5ZL 5FYLE 1MCWW 3DJSA 1GGCL 3LD8B 3FN0L 3C6LB 3HB3D 1TQTA 3BUBA 1O9WA 4XXWC 1MQ8A 1SN2A 3T0BA 3NACH 1XCQA 1QBLH 4NO2A 2NCMA 3FQTA 4GI6A 4Z7OB 3GPEA 3MC0A 4CSZA 2FCBA 3CQPA 3SPVB 3DSFL 4DESA 4X8JA 2XQBL 1YVLA 3NCJH 3SGDH 1LEGB 3U79A 4Q97A 1G7IA 2C3XA 1RAMA 4PWJA 2JKLA 4PCYA 3GSNH 1YEDA 3N41B 2JQMA 1X5MA 2BFVH 4HIIB 2C4XA 2NYKA 4Z7WE 3F8UB 3S37L 4L8CB 3NFNB 3UJJL 4H7VA 5FR3A 1GCFA 1MFNA 3OHXC 1UB5B 3EUDA 3GJFK 3OKLA 4HIEA 4JKPH 5JYMA 4DZBB 4KKLD 4MXQC 2V7HA 1WZ1L 5IVXF 5KTEL 4LGPB 1KPRA 5BJTA 4DCQB 4Y4FA 2ZZUT 1NICA 1HCFX 4G3YH 5KS9B 3QUXB 5I1AB 3FHAA 5HYJA 2PW1B 1BVKA 4YSAA 3TXAA 4I0PA 2XQYG 4LASH 1KCSH 4IMKC 4QHUA 1P4LB 1XZ0B 2HXAA 1Y6NR 4FG6D 1NKGA 3CFUA 5CGMA 4R97C 1WA2X 3UO8B 3BDBA 5EUOF 1G7PA 5A16A 1KPUB 1G7LA 1IEBB 3ZQXA 1G9EA 3SYOA 2V2XA 1PG7X 1T1YB 5BZZA 4V1DD 4BWUA 4ONFL 5KSVA 5D7KD 7PCYA 2V2WA 4RFEB 4OZFB 4DGYH 4OV5B 2K8MA 4KNQA 3TVMD 4X9YA 3AUWB 4XCCH 2R2HA 3DURA 4YHPB 4JG9A 4PWIA 4JDZB 4JKNA 4I77L 3TH2T 5EUOA 4F57H 1UD5A 2Z64C 2OW7A 4UYQA 3NQIA 3UGUA 1DANU 3CFBB 1OGPA 1O5DT 2K9FB 2V0AA 1IAKB 1WS7A 5KSBB 4WUUA 2YJLA 1ULVA 2FBJL 4LHUG 4AI7A 2VXQL 2NY1C 5E8OA 1KUMA 5DHYB 1M57B 3V5KB 3F3HA 2EVIA 4MX7A 2CLVA 3DO7A 1BQRA 4RFOH 2W0PA 2QDWA 4V1DB 2JIXD 5FM5O 1KN4L 3VU1A 3L2LA 4FP8L 3IPEA 3BC9A 4U1NB 3CUPB 3SPVA 5I76A 3MRJB 5J12B 3IU3B 4XO5A 3CPUA 4C56D 3QG6B 1T6VN 1U8MA 2ZAIA 1OE1A 5E4OA 2X4TB 3O4LB 4YEEA 1RURH 5DVOA 5GZNA 1P4IH 4JO4H 1SM3L 2Y3NA 3EOYG 3HMXL 4M4RB 5C0EB 1FNFA 4PRIA 2GEEA 5J11B 3N9GL 1KEMH 3I74A 5JDSA 1R46A 5J8OA 1R3IH 2ZSWB 2FX9H 5MEPA 3ECQA 1DBMH 5C0BA 5D70H 3BDXA 4XB3A 2XWCA 2VDRB 4HBCL 4R2GB 4BQBA 2NY5L 1HJCA 1KB9J 4HS6A 2CMRL 1HI6A 1MG2C 3OGOE 3VXRA 2E7MA 2J6EA 1EA9C 3OZ9H 4KKAD 4EIUA 4AVIA 1OOWA 4IU3B 3ULUD 2ZUXA 4K3DH 4UQAA 2QFRA 1BVOA 3ILQC 2ICWJ 1E90A 3KYKL 3O8XD 4RETB 3HLAA 4TQPA 2Q10A 5FB8A 2W38A 2PYED 3THML 3RDTD 5E51A 3LKQA 3W57A 4BFKA 5GGRY 2X28A 2FYYB 3IXTA 2QZ5A 4HOXA 4G8EA 2ZIDA 5CBEB 3FHQA 1CICB 3F12B 1UYWL 3A4AA 2JELH 3NK3A 3CXFA 1M2VB 4K94L 1G5GA 1ZK9A 1QOKA 1B4JH 1Q1JL 2HLAB 2X6AA 1AQMA 3ETBJ 4XNQB 4XO9A 5T5FL 5A2IH 4UQ3A 4MZ3A 4LKCA 2C9AA 4OD3L 2D3NA 2V9TA 1DO5A 4GS7B 3LQAC 5FIEA 3UBGA 2TAAA 5AW7B 4S1RH 1CXFA 1A22B 3SZKC 3VFTB 2C3VB 3IFPB 4PJGF 3A4FA 1YYLH 3WY2A 2DYSB 2VLKB 5AEAA 4JQIH 3QNZB 3SKOA 2VDPH 4XMTA 4IOSA 1AZBA 2F15A 4RX4D 4WFGE 1LVEA 2NLJA 3FRUB 3CN1A 3V4PA 2ZCLL 2KUTA 2O6PA 3GF8A 2DW5A 4IOFC 4U31A 4PGBB 5DUML 3UBFA 4AUJA 3DV4B 3TBYB 2OL3A 5CNHA 2R29H 2WZ5A 1KB5B 3L5XH 5DJ8B 3IGUA 4J6RH 2R1XA 4TYUA 5HI4C 1RUML 2FSEB 1ADQL 4NKMB 3BPLB 3DWTA 1W0VB 3WHE0 4KTYA 4NZRL 1ZTMA 3DO7B 2KZWA 4E9YA 4HWUA 1DJXA 4FFWC 3LS4L 4IGBD 5FCSH 2HVKB 1I75A 3ARUA 3RGBA 4NN6C 4BRJA 2EADA 4OH2A 3GSXA 3DIFA 4NJ9L 5IWLC 3HE7B 3TT3L 1FN4A 3MRMB 1VGEL 3PWLB 4OJEH 4AV5A 2P5WE 1RUKH 4GFXA 1DBJL 4UTBH 3ZGHA 5J5EA 1WBXB 3RA7L 4JQIA 4LGSB 4PHXA 2F74A 3RVXC 1L7TH 5A40E 2BSRB 2YEQA 3SCMC 4IKKA 1E7UA 4X6CB 2PW2A 5D7KE 4OT1L 1DSYA 2IXQB 1AR1C 3CDGB 1UA6H 1Q9KA 4YSRA 4TULH 4K3JL 3QO0B 4LRNH 3DJ9A 4P2QD 2A0LC 4YE0A 5ALBH 4W9ZA 2DZEA 4MWFA 4C55A 4XVSL 1GS8A 2HKFL 4PYHA 3LN5B 1WWWX 2O6EA 3QJQB 4K7FB 1TU2B 3GXIA 4OFYD 2L4OA 4PJ9C 4WGVB 1EDHA 3A6BL 5I6XC 4K5OA 2DWSA 1G4RA 1DN0B 3CFIC 1KPVB 3R18A 3QXDA 4FG0A