1XB9A

The structure and function of xenopus no38-core, a histone chaperone in the nucleolus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
b'SQNFLFGCELKADKKEYSFKVEDDENEHQLSLRTVSLGASAKDELHVVEAEGINYEGKTIKIALASLKPSVQPTVSLGGFEITPPVILRLKSGSGPVYVSGQHLVALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleophosmin
publication title The Structure and Function of Xenopus NO38-Core, a Histone Chaperone in the Nucleolus.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Chaperone
total genus 14
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 1xb9A00
4N8MA 2VTXA 1XE0A 5EHDA 3T30A 4CA9A 1XB9A 2VTXJ 1NLQA 1K5JA 2P1BA
chains in the Genus database with same CATH superfamily
3ZR5A 1CPNA 2H0VA 5K9YA 2DFBA 4HK8A 3V0BB 2Z5WA 3ZN6A 1XNTA 3AKSA 2W08A 5FQ0A 1RYYA 1S0GA 3DF0A 4O7XA 3TOJA 1IQDC 3AP9A 5IVEA 3QH7A 2RS12 4I0AA 4HSJA 1W9SA 2WDBA 4QXBA 3O12A 2WN3A 4P9IA 5HI0A 1XNCA 1W8UA 3AP4A 3VHNA 2D6LX 1LHOA 3M1HA 3SITA 2PLV3 2R073 4N43A 3VBSB 5DPNA 4E8CA 1S0CA 3GZEA 1KS4A 3ST7A 1IGOA 3HT1A 3OEAA 2EF6A 1LJ7A 1AL23 4NHXA 4QD2A 4N53A 4D8MA 5AC92 2R49A 5DAWA 5H9QA 4FPLA 3WNLA 5GLVA 4CEWC 3OUHA 1ZYBA 2WR9A 4YYOA 1YJLA 3I2FA 5G05L 2HWB2 1VB2A 1J1LA 1SLIA 5GZEA 5J7MA 1GP4A 2VPVA 2VUJA 4LORA 4QB2A 3T30A 1JI6A 1PIV1 2LROA 3SH5A 1D4VB 3LSEA 2C9KA 1F2NA 2LM3A 5A33B 3VBRC 1RUD3 2ARCA 3JU9A 4HETA 5FZAA 3SCFA 3ACLA 4Y33A 5A3OA 3AKQA 5C9AC 3OGGA 2DCYA 1POQA 3ASIA 1Q8OA 2ZGTA 4FPKA 2AZ5A 5FYYA 1FOD1 5LB6A 1NCQA 1C8NA 2XJSA 4BJ0A 1OC1A 3I2HA 2DDUA 4PBPA 1X7NA 5ANQA 1RUH1 4A6SA 4KL1A 2YB7A 2OUHA 2XB6C 4LNVA 4CU7A 5C8CB 1JZ2A 5IJRA 3ZKYA 3BTZA 1XU2A 5T5JA 4GH4B 3NNJA 2DVDA 2VOVA 4NRMA 3ZIXA 1OH3A 5FKCA 5CG8A 3OD0A 1J3PA 2FDKA 4DZGA 3USSA 4B7KA 3AKTA 5BNPA 1O8PA 1JYCA 2XONA 5JXHA 4NRPA 2JWPA 1JZ5A 4CU9A 2VD7A 4YZ4A 4CTEA 1SMVA 5A80A 4UI9L 3J8F3 1RC6A 1WCDJ 4KH9A 3OOXA 5T54A 3SLIA 2VMFA 2ZGMA 1ZBA3 1XNBA 2WUHA 1YCIA 2P6HA 5BNOA 5JZGC 3JCIA 2ZGKA 1FPN2 5F3CA 2ZMLA 4GA9A 1SPPA 1PK6C 2WQ8A 3D8CA 4NMIA 4B7EA 1M06G 1RUJ1 1UZYA 1DQ2A 1H2KA 2PTMA 4MLOA 4GZ9A 2UYBA 2VMIA 1DIWA 1GNZA 2RM22 2W94A 3AYCA 3HNMA 4I30A 4HN1A 4NAOA 4FAHA 5CFCC 2KA3A 2ZGOA 2GMMA 2G19A 2W0XA 1QJY3 2ERFA 3AFKA 3QOPA 4M3CA 3ZXLA 1CX1A 2R30A 3T0AA 2WNVC 3FUOA 3WD5A 1HXS3 1DQ4A 3RWKX 4K3UA 3WW4A 4NIHA 2DWRA 2ZX2A 2C4XA 2B39A 3BPSA 1DF0A 3E97A 3PDQA 4IV3A 1J84A 3KCYA 4Y4YA 1NA1C 3AVRA 4XMIA 3RMYA 5FLIA 1RUE1 2JB8A 3B5LB 4XEZA 4KG0A 3VBHA 4C1WA 3C7GA 4CVUA 3FBYA 5EYYA 2ARAA 1DBNA 3RJ2X 2VNVA 1W9TA 1S0IA 4XMAA 2CDPA 5B2GB 1D4M2 4G3YC 1NX9A 1C8M2 5T5LA 2JDKA 4AQTA 5JR2A 1LEDA 4IE6A 1H1AA 3VKMA 4HFSA 4D6QA 3H1MA 4NIGA 1Y9GA 4LO5B 4CDXC 2QQMA 4JVAA 5LA2A 2X5IC 3C7EA 4W6XA 1FYUA 4YW1A 1LKNA 5AFEA 4KNCA 5DAVA 2VL4A 1BBT3 4O9EA 3ZXGA 4QGLA 4KQ7A 1W6OB 2MEV3 3GYDA 5LA0A 3BTXA 4BDVB 3T0DA 1POV3 1VRH2 2WZEA 3PJQA 1R092 3B93A 2HBUA 1DZRA 5FZHA 3NWKA 4EZHA 2OZJA 4IEWA 1DFQA 1R081 2E53A 2PAMA 4IGQA 1DGWA 1W2TA 2ORXA 2VW1A 1RUOA 2VBBA 2BV4A 1Q8VA 1V9U1 3UKTA 2HJIA 1QQP1 3THPA 2ZAAA 4CSWA 2D97A 2ZJCA 1O91A 3FFZA 4WZFA 2VECA 1URXA 4Y4RA 5EHDA 5F39A 5JOYA 3E5XA 3PMSA 4TTGA 4NIDA 4XF3A 2X09A 3NNMA 4P00B 5I93A 5K0UB 1IQAA 4YW5A 5KC5A 5IK5A 1OLQA 4FT8A 4BCUA 4JQRA 1L7QA 1UN1A 3B9IA 5FRAA 4CDQC 5LA1A 3EO6A 3PU3A 1JZ4A 4LBJA 1VP6A 1G86A 2VTXJ 4KBZA 5C71A 1QJZA 1OBNA 4XJZA 3ZM8A 2OVUA 4R52A 3ZYGA 5FOBB 5F5AA 5DMYA 4Y1UA 2UWBA 3CQOA 4OYUA 4C8DA 2P2KA 1XYPA 1VAMA 1Y43B 4BQ1A 2VJXA 4JHZA 3PURA 5FZ1A 4CCDA 1E57A 1AYN1 4XPVA 3QBQA 1JW6A 4ZHNA 1TMF3 5FFOC 1QY4A 1XC6A 4FOQA 4MGQA 2ET1A 1UD1A 1RHI3 1ASJ2 2VTFA 1NY72 2XJPA 2YHJA 1MS1A 3BKZA 3UV9A 1NLRA 4Q8KA 2A3YA 4QX0A 1X82A 4HN0A 3KVBA 4RR3A 1QXJA 3ZKUA 1OUXA 2BNOA 5J09A 4DQAA 3AKPA 3AMMA 1MZFA 4HPKA 4LOSA 4TSVA 1GV9A 3ATGA 4B4PA 4MGSA 1ZREA 1Q3EA 1JYVA 1HV1A 2W87A 2JG9A 2PHDA 2HYKA 4LKSA 5FZDA 2IVJA 4K8RB 1W8TA 4L0PA 2L9LA 4Q1RA 4MGZE 4OMDA 2OW4A 3LFIA 4MHUA 1ZRCA 3P1IA 2Q30A 4M3CF 2HEWF 5CISA 3WV6A 4QU2A 1H8TA 5GALA 4NPLA 5FYMA 1XNAA 4BQ3A 5JUVA 1XSQA 1HV0A 3RPQA 2BRTA 1JYXA 4Q0PA 3ZSLA 5EJ3A 3RS6A 1KS5A 4TZDA 2WZ8A 3AFGA 3T09A 4CE8A 5IWFA 3ZFGB 4BQ4A 3G6JB 4P9YA 5FQ0B 2OYZA 2BOIA 2BQPA 5EFUA 3AZVA 4MSVA 1IZ3A 2WC2A 2XOMA 3N9MA 3PHMA 2ZX0A 1JBCA 5F3EA 3J7LA 1U5ZA 1AYM1 2Q8DA 2VZPA 4HKWA 3WUCA 1W9FA 2J7MA 2ZGRA 4LO7A 4LHNA 4NOTA 3IPVA 4CZSA 4YM0A 3H3LA 4PIXA 5A7SA 4LIUA 4GKXA 1WW6A 2D5HA 3WDWA 2LALA 3PVEA 1WD4A 1XOYA 3HN3A 1NKGA 4UXAA 2K0GA 4CEWA 1O8SA 2IUWA 1NCRC 3GBFA 4LBOA 4AVVA 1RUI1 2GP3A 1WA6X 1H6YA 1SLLA 1ULCA 5FP7A 1CR7A 1EAH1 1Q8PA 1S2EA 1O4ZA 4AXOA 3N3HA 3L9JT 1QHDA 3VBRA 5DUXA 2LUWA 2EXIA 2IXKA 1VE0A 3JBG1 2Y6GA 3H1YA 2YGMA 3J7MA 5T55A 1AR81 4Q27A 4XURA 3E5UA 1W05A 1PIV3 2XDVA 1CQ9A 4OFGA 5IUQA 5SV5A 5HPOA 4FVVA 4HT1T 2DUQA 2VMCA 4K40A 4UFJA 3U75A 2YMZA 2IXIA 4IV1C 4AI9A 4JHTA 2RJKA 1DU3D 2FZ1A 4QPIA 4EN7B 4WVVA 3KT4A 2P34A 1FNZA 4XACA 2FDFA 2VW2A 1FOD3 2YBPA 3VDDB 5FZCA 1UKGA 3WW3A 4OI1A 5FY1A 1RUH3 4XQWA 5DZGA 1DQ0A 1X36A 1CGPA 1Q43A 3ME2A 3G7DA 1CZSA 1UZWA 3LDKA 1ULGA 1O3TA 1RL3A 4ZU5A 3LPFA 5FYVA 2QQLA 1GWLA 1UOFA 1YQ5A 1AR71 4K1ZA 3LOIA 1GZCA 5J98B 3K3OA 1NQJA 3HR9A 5LK7B 2PHXA 5JOWA 5DAPA 1KFUL 2P5BA 3U10A 3J4UH 5JZGA 5AVPA 5A1AA 1FMD2 1OOPA 4QXKA 5C7GA 1PK6A 1LGNA 3OBAA 1LRHA 3NAPB 4FPCA 1C5HA 2ZX4A 1WD3A 3D3AA 1N1YA 2XLAA 2JIGA 1RITA 2E31A 2PAKA 3AMPA 4E27A 4YFZA 4YGCA 5L36A 5BNOB 5D1IA 1SHWB 2WS93 1A8DA 3MIBA 5L73A 2R062 1YFXA 4MO3M 2ARXA 2HWD1 4XQDA 4UBHA 5EXOA 3T4HB 1I5ZA 4URAA 2XKPA 1RUJ3 1KJLA 1SPPB 1W6QB 2WO2A 3SC7X 4CYDA 4HL0A 3HJRA 1WLWA 2WT1A 3AB0A 3EYPA 2GU9A 4AGVA 3EQEA 5C70A 4IEXA 1YHFA 2D6OX 4M3CB 3VGIA 5JXJA 4DS0A 1R1A2 4UOJA 4XAAA 4QKFA 2LW8A 2C24A 4BLJA 2VXJA 3MW3A 4K7JA 3ZPOA 4GIQA 3AYEA 5DDJ2 1RUE3 1H2NA 3ETQA 5EZWA 2D7FA 2G9GA 3BCWA 4N90A 3MV01 3IMMA 4RHV3 1QIQA 3VBHB 3ZFFA 3FZ3A 4P9JA 1WZXA 5LRSA 5JCTA 2VMEA 1AXKA 1AHSA 2XBO3 2D6PA 2ATFA 1IOAA 1L3JA 5T5PA 3RYRA 1RUNA 2Q0AA 3N9LA 1BMV2 2YYOA 3NV1A 1PGW2 1WKYA 2QQUA 4DB5A 2R041 2VMHA 1NT0A 4QX5A 2YXSA 3NVCA 4ARXA 3V0BA 5GZGA 1W6MB 5KC6A 2ARBA 2E26A 2HWE3 3ZVXA 4PF1A 5BNNB 3BUCA 3RG0A 1XB9A 4COZA 2ZGPA 1DLCA 1QMJA 5FZLA 5FZ8A 5IVVA 5A70A 4BMBA 5IK7A 2OS2A 1DG6A 4XXAA 3SMHA 3WP3A 1W39A 3RFRA 4AHXA 4RS5C 5C4WC 1DLLA 2CL2A 4Q4V2 3DYMA 4JTOA 1UX6A 1J3RA 3P3NA 1R083 1IS3A 4WM8C 5H9PA 4F7ZA 3MIDA 4QB6A 5IK8A 4YW2A 1V9U3 5CIRA 5C3QA 1QQP3 2VZ3A 3E1F1 1TME2 2Z2SB 4CDQA 3O14A 1Y3TA 3HAGA 1VAKA 1YQCA 3O1SA 1WA4A 3LB9A 2YV8A 1ZRDA 1T6GC 1C57A 5FZKA 4HVOA 5EPAA 4WVZA 3ZO0B 2VMGA 4XJAA 1VALA 2ES3A 1MQTC 5LY2A 4BQ5A 4D7SA 1DGWX 1REEA 2YROA 4XIKA 2BBVA 4XDPA 3ELNA 2ID4A 5FWEA 2BFUL 5DZFA 1W90A 1HB3A 1OLMA 1PO12 2WAOA 2XKOA 2QE3A 1HQNA 4JC1A 4KGQA 4COYA 4F3JA 5DZEA 5I8YA 5A7OA 4NIIA 5FZGA 4B3NA 4DRVA 1QJU3 4QX1A 1AX2A 4JCKA 2DCJA 1VBD2 4RQPC 3SEPA 3ZN4A 1H2LA 4Z07A 2A5ZA 3S5QA 1XSRA 3R4UA 4FO9A 2ZZJA 4XBLA 1QJFA 3GCWA 4YWAA 3ZN5A 2ZBJA 2QBXA 3T4VA 2OA2A 2UY9A 4FPGA 2W5FA 4R9BA 4Y5SA 3ZIWA 4A45A 2RS11 1AR62 3ZMNA 1PGL2 4FPJA 4AVTA 5F7UA 5EJ1B 5A6YA 2WZPP 2BW8A 4X8PA 2Y26A 3C8XA 4M4PA 1VAVA 2RHPA 4CDWC 1K5JA 4RGAA 4P14A 5C8CA 4ZS2A 3TRSB 3AYDA 4RR3B 3OCPA 5ACA2 2WAAA 1TQ5A 4YVSC 3FFQA 1S55A 4C90A 2NLRA 1C5IA 1O4TA 2OKXA 4LULA 2BZDA 5FMDA 4FOWA 5A7WB 4XDOA 3DV8A 2YC0A 1KFXL 5FZBA 1HQWA 4AGRA 3OGVA 1DDLA 4YGBA 2XJTA 2VY0A 4UBGA 1KEXA 1W06A 2HWB1 3NKTA 3RGBA 5DXDA 1JN2P 3PMEA 3PU8A 3DCQA 1MR5A 1W9WA 4PQ9A 3VD3A 5FPUA 3OB8A 4J25A 4ZZ8A 1YWKA 4IXLA 2DV9A 1FI2A 5LEJA 3J7NA 4MZUA 2QQIA 4B4QA 2GN7A 3MEPA 1UWWA 1WMFA 4S2DA 3VB9A 3KV9A 2VNGA 2JDHA 3JQXA 5GJ6A 3CLPA 1CWPA 2GNTA 3WNPA 1GZTA 2Q1FA 4QPGC 1NZCA 4S2HA 1O3SA 2DYCA 4AVCA 2GALA 4GMP1 4WM7C 1AYM3 1KJRA 3U78A 2RJ2A 3KQ4B 4TXWA 5G04L 1N1SA 2GNMA 4DIQA 1Q8QA 4V1PA 5CKNA 4CA9A 4XHXA 2JE7A 5DN2A 2YDEA 3JQWA 3WXPA 4CXWA 4FI9A 2QQWA 2FCUA 1LB2A 1QOOA 1NE6A 4CEWB 4DXRA 1RUI3 1S0FA 1JOBA 5LY1A 1Q8SA 2V4VA 2BFUS 2WQZC 2W91A 3CIHA 3MF6A 5KHGA 4BPZA 3WDYA 1EAH3 1ZZ9A 1RMU2 5HCFA 2WFF2 1PMHX 4ONUA 1FAYA 4HVQA 1W28A 1AL0G 4CP9B 1HRV2 4YRDA 2HEVF 3VBRB 3JBG3 3R4SA 5HXVA 1ND3C 5C9AB 3AJZA 1N1TA 1SLAA 2AACA 1QDOA 2GC2A 4GJZA 1GWMA 2EICA 3OYWB 4YM1A 2RM21 4DY5A 4OHYA 2WLPA 2ZACA 1S0DA 2W1UA 4Y22A 2IFRA 3A21A 3FC0A 3MO4A 1Y4WA 4CPBD 4TYSA 4AHYA 4A42A 4RFRB 5BXXA 2ZKNA 3Q9OA 5CNAA 5C5UA 4UAPA 2VVDA 2XLGA 4OI0A 5FMCA 4GALA 5HCBA 4FFFA 2VE1A 3POGA 4YARA 2PELA 5CZKA 3SNMA 1UPSA 1BJQA 5K0UA 2W95A 4AI3A 3GXUA 3WHUA 1AR73 4QQOA 4YZ2A 4FOVA 4QMAA 3HMYA 1D4M1 5JAXA 1QF3A 1IG0A 4EN9B 4PLNA 3P5BA 3POBA 2O0OA 4R9DA 5F2SA 4DEVA 5J37A 3DL3A 3ACHA 5FYBA 1H0BA 5JZGB 2IC1A 4AYUA 4LBQD 2HH9A 2JE8A 2V5DA 2TBVA 5BNQA 1PK6B 4CCEA 1OD3A 1UOJA 5FPBA 4EWDA 2W1SA 1QXPA 3TAYA 3LDBA 1IS6A 3H9AA 4LJHA 4QPYA 5ABJC 5FO8B 1AX0A 3K51A 1R091 4ZXEA 5CFCB 4QQ2A 1JTZX 2HWD3 2JKBA 5FOJB 2BBAA 2JD9A 5CKMA 2Q1ZB 4LQRA 2WNVB 3OPZA 2XL9A 3I7DA 1UYPA 1JYNA 2UYAA 4CP2A 4OI2A 3KGLA 3U14A 4H7LA 2Z42A 3PUIA 1NA1B 4AW7A 3GBWA 4YPJA 4Y3OA 4CCMA 4FCAA 1LHWA 4LXLA 2P37A 1YFWA 2UURA 5DAQA 4BQXA 4D6RA 5D8AC 2WA4A 1RXFA 1KDKA 4ZXKA 5JXIA 1LENA 3NJVA 3QH6A 1LOBA 4EQVA 4ZS3A 1YNAA 5BY5A 1UQXA 1L7RA 1UY4A 1MEC2 3Q8AA 5A7NA 3WG1A 3AZZA 4DUWA 2WNUC 2W9XA 2ZX3A 5A3PA 4CDXB 3OPTA 4BIFA 3WNNA 3K4DA 3VHOA 4Z92B 2X5IB 4RGGA 4Q4W2 3SISA 2YZ4A 2ZGSA 4P02B 1JUHA 4YNIA 3K2OA 3U07A 1J58A 4ZPIA 4UF0B 1MPXA 2NQYA 4KWUA 4ZZ5A 2CGPA 3H7YA 5C4WA 2XJUA 1MS9A 1VBB2 1XJAA 2I2SA 2NYYA 5FPLA 5DAXA 5JR7B 1N1VA 3ZFGA 4YFWA 1NY71 1ZBE2 1WCKA 3NO8A 4D69A 2E9QA 1UMZA 2QUOA 4Q4X3 2J1SA 2VULA 2OQ6A 3H0OA 1OQDA 3PVNA 1LR5A 5A1FA 1CESA 1W8WA 2LS6A 5A6QA 4D3WA 3GHNA 1DGLA 5I0DA 2XGXA 3CU7A 1ZX5A 4ISRA 4Y1YA 5KXEA 1CJDA 1FX5A 3WR0A 4D7YA 1UYZA 1WW5A 4H55A 1PHMA 1MQTA 5FYUA 3ZDSA 5FPXA 5HCAA 3WX5A 3ZX7A 4QWNA 5HBAA 3ACGA 4CDQB 3MBWA 4Z8BA 5A1LA 2VW0A 2VO5A 4JAAA 4CEYC 3K4ZA 4E2QA 4L9BA 4QX7A 2JDPA 2Y6KA 1TNRA 5IAVA 3R4DB 1OFNA 1V70A 3ZYRA 3ZYJB 5FBZA 4A6OA 5FDBA 1MVQA 2RR12 3OD4A 4K9SA 3KT1A 4AEJA 4JGZC 4XFHA 1AXZA 3NV3A 3PUQA 5H9SA 4DO0A 3HD8B 2FCTA 4BQYA 1N3PA 1WW4A 5F9TA 2VVFA 3SXWA 3T2TA 5CFDC 2BNMA 2E6VA 4AEMA 4IE0A 3THTA 4AK3A 2VZRA 2OIIA 4OVEA 2VOXA 1SEFA 1BEV2 2KD7A 3IDAA 2H6BA 3MPPG 4NRQA 1L7LA 4NPRA 5FYSA 5FZ4A 3WINE 2RS13 5JPNB 5LCWL 3RZGA 4MGYE 2J1RA 2FDJA 4YVSA 3U4SA 3VDDA 1A8MA 1J83A 2Q1MA 3ACIA 3WLUA 1HN0A 1K5MC 3VBOC 1SCRA 2VAUA 3R0RA 1D2QA 5FXZA 4L11A 2VQ0A 4LBNA 4MXWB 3N7LA 1F35A 1ZBA2 2WIIB 1YFYA 4BK5A 3BVCA 3SKVA 3VBUC 1APNA 4GULA 3ZXEA 3IWZA 4U2AA 5F3IA 2WL1A 4K1YA 3ZYFA 2ZX1A 4LLFA 2I07B 1WUVA 1OFSA 2MPFA 4XFIA 3U1XA 4AFMA 3K4AA 1UX7A 4BE3A 3LE0A 3NSTA 1QWRA 3NJYA 3ZOIA 4AI2A 1WLDA 2DVBA 1W04A 3A23A 1RJ7A 2TUNA 2HWB3 1LCLA 3VHPA 1V6IA 3NAPA 3I2OA 5FY9A 1EPZA 1QJY2 1LECA 1UPIA 3IMNA 2PQQA 2JEMA 3MLJA 3N7MA 4QQLA 3FWEA 4R9AA 3I3MA 3O0VA 4NAMA 1GBGA 2B9UA 5EV7A 3TN92 2E7TA 1W6QA 4J1WA 2LTNA 3WF2A 4E2GA 3T08A 4MGTA 4CP1A 2AUYA 2DCTA 5FAXA 2KXLA 3M3IA 4UWDA 3KCXA 4E8DA 2OXBA 2J42A 1GMMA 5FZ9A 1SLBA 2D6KA 3RYKA 5C3OA 3MZHA 4ARYA 3OY8A 5FY0A 2NPIA 1HKDA 1ND2C 3IIIA 2ZGUA 4AF9A 4E9KA 2F6BA 2XHKA 3DYPA 1NCRB 1B35C 3NNFA 3IM0A 4X6RB 5CU1A 3VZJA 1BBT2 2RMU3 5C33A 2GDFA 1GOFA 1P8JA 4PIZA 1GNHA 1F4HA 3HIFA 5KHIA 5LRRA 1RXGA 4FQZA 1CVNA 3RZZA 4AI8A 2DF7A 2VH9A 1CZVA 3POEA 3Q8FA 4NWWA 3FHAA 3GBGA 3LEGA 1Q5OA 2A7AA 4Q2FA 2VQAA 3IIAA 3D0SA 3VZKA 5CADA 4FTSA 1E5SA 2ET7A 3Q8EA 1EUTA 4P5HA 4V2VA 1JMUB 4BYYA 1W6MA 5FZ7A 4JKKA 4LR4A 3ZYIB 4UFLA 1A3KA 2OPKA 2A6WA 2DFCA 2R061 4Q0QA 5T52A 4H14A 3WNMA 2YY1A 4IV1B 5BNNA 1OLRA 2KR2A 4Q29A 2VOKA 3HOBA 1YJKA 2GC3A 4XFGA 4AEDC 5EYXA 1G9BA 3DECA 5IFTA 5J3UA 2RM23 3PUSA 2B4KA 1YIFA 3SKJE 3OJBA 1CPMA 1XE8A 4IDZA 1OH4A 5FJHA 5FIXA 5FKBA 1KITA 2IXJA 2NN8A 1R1A1 4BH9A 3W5MA 3UL2A 4Y22B 3QD6A 4YG3A 2O8QA 4IE7A 4QDSA 1BVVA 4DOUA 4G9SB 1NOVA 3D0JA 4L99A 2WN2A 5DUVA 5DDJ1 2CAUA 4B29A 3SH3A 3B94A 3LF7A 4LEJA 5CBLA 1UOBA 2VCBA 3AMHA 3N36A 1GQHA 3IAPA 1LNSA 1VBC2 3KD4A 3N35A 3PVOA 5L9BA 4ES9A 4QKNA 2PHLA 3VZNA 1YIPA 4BMEA 3HVDA 4CUBA 1D4M3 1T2XA 1UIJA 2BGOA 2MHFA 2PYTA 1T6BX 1LOFA 3POWA 4LITA 2K2SA 1BMV1 1IS5A 4NHKA 1PGW1 5TSWA 4EN6B 2UWCA 2YG0A 4KG8A 3UNPA 1R1ZA 1WWYA 1LESA 5A6XA 1RUF3 1ZRRA 4IERA 2C0ZA 1HRI2 4XUTA 3VKNA 4FPHA 4I3PA 1W2NA 3A0NA 3HN1A 1DZQA 2WRAA 4DFSA 2XQXA 4BOWA 1DQ6A 1NLSA 5A6ZA 1R093 2FDHA 3EMRA 4TN7A 4EE2A 3UGHA 4Q4V1 2V4AA 2QTWB 1OPOA 4B1MA 3L2HA 3JXSA 5IAXA 1HIXA 2GC0A 2A70A 1OF4A 5LWBA 1UYXA 2JDYA 1DYPA 3A4UA 4Q0SA 2BDRA 4E4DX 5FK8A 5H9RA 1TME1 3WVJA 3CBNA 1DGRN 5FPAA 4ZU4A 1GLHA 4B4RA 2RS32 4EWAA 1IHMA 2EXJA 1E5RA 5A7WA 3NKGA 2GNDA 1H30A 3KMHA 4EYUA 1XPWA 1G8WA 4W8JA 3B69A 4IEQA 2UU8A 3I3QA 1W3VA 1PO11 3B01A 1PZ8A 5FLJA 2E51A 4GB32 3OBTA 3BIWE 3C7HA 5GM0A 3TYJA 1BK0A 1VBE1 2JDNA 3DPRC 4LE4A 3AZXA 1H4GA 1DQ1A 3T3YA 4BWOA 1VBD1 4JDNA 4OHWA 4Y24A 4LO6B 2J1UA 2BYVE 2PAEA 3A7QA 3CKHA 1RUG2 2IFWA 2H0BA 4YVWC 4OQ9A 3ZYPA 1AR61 5KBFA 1LHVA 1TEIA 2VTXA 1WGPA 5C4WB 1PGL1 1PM4A 4QXCA 4RS5B 4MYEA 2GMPA 1WCUA 2UY8A 4KU7A 4JDMA 1MZEA 1V6KA 4WM8B 3J7HA 5L7OC 1C3HA 1FV3A 1VBA2 5FY7A 1PO22 2V09A 1W8OA 4P9WA 1D2SA 1QEXA 2AH2A 4CEYA 2X29A 3OF1A 2ZHMA 2HKXA 5E89A 4EN8B 1AR91 4CDUC 1HDKA 2D6NA 2VZSA 1MQTB 3AMQA 3WUDA 4CCLA 4AHWA 2W39A 3CZUA 2W47A 1DP0A 5IYYA 2ZA9A 1PNFA 5KR7A 2XWJB 5FY5A 4AVSA 2YPDA 2I74A 2HWC2 2ZGNA 5A7QA 4FP2A 5LBCA 4UFHA 3RI9A 2Y60A 3W5NA 2YGLA 3WW2A 5F8PA 4RQPB 4Q26A 4CP9A 1QXRA 3TBDA 3NRUA 1XU1A 3AJYA 5C9AA 3MI8A 2FD8A 4LUKA 1Y9QA 3C3VA 3W59A 1R64A 2JDMA 3OYWA 1JH5A 2QZ3A 4XILA 3WG3A 3AYAA 1UNBA 2VZOA 4W6YA 4YM3A 1ULDA 2HYXA 2QJVA 2WWSA 2W68A 2WZR2 1N3QA 3KVAA 1K5MA 1GKBA 5FZ0A 3IB3A 3V56A 4RYDA 1HW5A 2CGOA 4CCNA 4M0NA 4CDWB 2WJSA 4PF5A 4AQSA 5FP3A 4TLFA 2CAVA 2Y8KA 4LBKA 3WDUA 4YVSB 2WYFA 3VDBA 1YC61 3D4KA 2ZPXA 4I0WB 3HNYM 2KM2A 2QZ2A 4HMZA 2XVGA 4BU2A 2W52A 1I3HA 1QNYA 1OQEA 2P1BA 1V6JA 4TWTA 5L19A 3AXEA 1QH6A 2DCZA 1WBLA 4O9GA 5FPZA 4DEQA 4DNYA 2JENA 3MFCA 4INDA 4COVA 3WF4A 4XUOA 2WS92 2DCKA 2AC1A 1OKQA 2PHTA 4Y26A 1QJX2 1GQPA 3SCHA 1RMU1 2WFF1 5FMBA 1O5UA 3U11A 1ZRFA 1CAXA 3B02A 1SBDA 1HRV1 2J1VA 1COV1 3GJAA 2X05A 2W1QA 1GR3A 4MVTA 3FN9A 5JVVA 1GICA 3T0BA 1YQ2A 1CZTA 3AP7A 4P9LA 4XBNA 4O61A 4BB3A 1JYIA 3K48A 5JI9A 3LGRA 4JKLA 1PNGA 3AL6A 4LA2A 5CFCA 4KBBA 3RQ0A 3WDTA 2D44A 5FYHA 5LW9A 2DBIA 3JUUA 4AEKA 2WNVA 1RTVA 4AFCA 5E1RA 3UKVA 4XTPA 4QPGB 3TEXA 1UZ0A 2VQTA 4RHV2 3PUAA 3PL0A 4WM7B 1KRIA 2R1DA 1B35A 5KHKA 1NA1A 4XBQA 4MOAA 3OUIA 2AEYA 2WINB 2XJVA 5IW0A 2XBO2 1H9WA 1JXNA 5A3NA 5L9RA 3I54A 3CHXA 3OY8B 4EJRA 4L8QA 5FBJA 3KF3A 3GGLA 1KXGA 4NN0A 5FUPA 3GDBA 5I0UA 3WQ7A 5IVFA 4AGGA 1BLZA 4JGYC 5F1RA 5EJZB 1OF3A 4UFMA 5LBEA 2HWE2 2Q8CA 2GNBA 4CDXA 5GZFA 2WLQA 3LKJA 2X5IA 4NIAA 1JOJA 3MUZ1 1EP0A 1N47A 1PX3A 3LSDA 3W58A 4FPOB 5JMCA 4UF0A 1STMA 1V0AA 5CEHA 1H1MA 1JS9A 4R4XA 1BK1A 1MS3A 3UESA 3WP5A 4YGDA 1ZZBA 2WO1A 3TB0A 1Y9MA 1VIWB 2Y6LA 4NWVA 2R063 3S7IA 1XE7A 1RUC2 1FXZA 1E5IA 2PN5A 3RWNA 4XUPA 3O1TA 2F4PA 4M01A 3P3PA 3JD72 4PLOA 4MADA 4NROA 4PDWC 1BKZA 3NJXA 2YFZA 1UMHA 5CKQA 3E6DA 2WO7A 1R1A3 1U12A 3LA3A 3WOGA 2XJQA 2K9ZA 3HBKA 1OI6A 2G9ZA 2FZ2A 5EWSA 3O0XA 1HB1A 1WBFA 3DXUA 3B7MA 4LHSA 5BYNA 2ORZA 3AVSA 3ILRA 5DDJ3 1D0GA 1QJU2 3KHCA 1CD3G 1QOTA 1GZ9A 4R4ZA 1TNFA 3BB6A 4YZ3A 1JU3A 3VBFC 1MEC1 2P3JA 4OI4A 1ZZCA 4HKLA 3FHIB 5DABA 1GP6A 4XQ4A 2CY6A 4Q4W1 4BQWA 1UU5A 3MIFA 4NUBA 4DUXA 3A0KA 1KD7A 1LTEA 2YU2A 4GMP0 1IPSA 4HBNA 1FV2A 3UKNA 4CCOA 5FXXA 3B3QE 4FFGA 4L92A 4R8HA 4CCKA 5AVAA 4META 1C1LA 5ABJB 1CONA 1DZTA 1G6NA 1RIRA 1SCSA 1VBB1 1VMHA 2ZGQA 4YG0A 4I2OA 3VD5A 1DCSA 2LRPA 3LEMA 1ZBE1 3DYOA 4AAXA 5FO7B 1O7FA 5F6KA 3F95A 2A3WA 5I91A 1AYN3 3M2MA 2XH6A 5K7PA 2W46A 5A3WA 1U0AA 4N43C 1JHJA 4Q4V3 3VDCA 2IVIB 1VPHA 1EV12 2PXJA 3DXTA 4FPYA 5DUWA 3RMXA 4DXTA 1I1EA 4ITCA 4W4ZA 5C6CA 5FYCA 2A1XA 3POIA 5FP9A 3I4IA 2Y38A 4C0BA 3I2JA 4MXWA 4QKDA 4YW3A 4PHZA 1AZDA 1C4RA 1WMXA 4N53C 4QPWA 5D8AB 3VL9A 5JXGA 1NLQA 1NXMA 4LOTA 1UCXA 1ENQA 4GKYA 1UY1A 2WNUB 2PA7A 5E88A 1IKPA 1W99A 3AKRA 3DPRA 3NMBA 4LKEA 5AC91 3POSA 1FT9A 3CNAA 2E63A 5HV0A 4BZ4A 5FK7A 2RR11 1OKOA 1QGLA 2IXCA 4ES8A 1PO13 4TLGA 4IEUA 1RVF2 2WYSA 3WEZA 1IPJA 1VMFA 4IL7A 3AMNA 3ZXAC 2V73A 5F2WA 1IG3A 4OHVA 3HQRA 4WBBA 4YVWA 4RA0A 1VBE3 2QKDA 1LAJA 1W03A 2WBKA 4IEVA 4AFDA 1LU1A 3VD7A 1VBD3 3WNOA 4YM2A 1ENXA 4R9CA 2Y0IA 4QAWA 3U37A 1NCQC 5CA6A 1NUKA 5JLVA 3MICA 3NL1A 4LHLA 4LKDA 5L7OA 2FDIA 1UZZA 1BEV1 3AX4A 3CF6E 4GWMA 2VCCA 4XUQA 5IT6A 1UXXX 4Y1ZA 2X8KA 5LATA 5F3GA 1B09A 1ZM1A 3D82A 5GLZA 4DY3A 1CAWA 2DU1A 2Y0OA 4CDUA 2N7GA 4FAGA 2VZ1A 1Q56A 3T2QA 2WT0A 4UFIA 5F5QA 5BNPC 1Z7S2 4NJ4A 1ZBA1 1NCRA 3ES4A 5AFBA 2OX0A 4E4SA 4CEYB 1G7YA 1X9PA 3ALQA 3DN7A 1AR93 3O1RA 2ZEYA 4AFAA 3O1PA 2CV6A 3TWIA 2WA3A 1UL9A 2DTYA 5A3UA 1M4WA 5F5IA 3BI3A 1OUSA 1YQ8A 2E32A 2JX9A 3LOBA 2YC2A 2VM9A 4Q4Y2 3HNBM 4JTNA 2AREA 2D3SA 3AP6A 5GLWA 4JGZB 5JI7A 2O8OA 4RN5A 1QJY1 2JKXA 1DYKA 3RSJA 4AHZA 3KM5A 1RGSA 1F9KA 3I2GA 1KDMA 2CYFA 3V65A 4HKOA 4CXXA 3I3EA 4XYXA 4OMCA 5CFDB 1FPN1 1YXWA 3TN91 3UGGA 4IV1A 4ASLA 2ZGLA 3THDA 1CAUA 4D6SA 3OBRA 2VG9A 1AR83 3MW2A 3PTRB 2QDRA 3VUOA 4OQ8A 4COUA 1PVC2 1W2OA 1OD5A 1W8NA 2VNRA 4FQ4A 4P9XA 4AZZA 4FTBA 1NXD1 2IXLA 2WWUA 4QQPA 4RSUA 4AWDA 1K5MB 4HOOA 1SDDB 4IV3C 3LQCA 3WDXA 3CJIC 4ATEA 5F37A 3GJBA 2BVVA 3LFMA 4I3GA 3RDIA 3URFA 2X10A 5C8WA 4ZU7A 1VLNA 2YPJA 4U36A 4WZCA 1DQ5A 3K75B 4HG6B 2XWBB 3QACA 3VBUB 5DG2A 3H3UA 1OXCA 1BBT1 2EAKA 5C3PA 3HEIA 3VD9A 2NP0A 2BNNA 4XFAA 3ZFEC 3GM8A 3CJXA 3ES1A 5J96B 2OQ7A 5FREA 1NZIA 4XJ9A 3HBZA 3LWCA 3MIHA 4Z2AA 1C8M1 2C6SA 3GHMA 4XFFA 2HWF2 3UGFA 3ITQA 4QQHA 1JOPA 4HONA 5FYIA 5FZOB 5CB7A 3WNKA 1W8FA 3I3BA 2ZMNA 2FQPA 2WFF3 3I59B 3S7EA 1OSGA 1XRUA 2B45X 1HRV3 1PZ9A 1COV3 3R05A 4XC9A 1CAXB 5FZIA 3DUIA 5A32A 3X29B 1GOGA 4F83A 4LMFA 4UT5A 5LA9A 1WLTA 3LCPA 3M3QA 4XHBA 1U5XA 1UIKA 5IVYA 2XL7A 3IKWA 2P3YA 5JSOA 1VRH1 1TG7A 3WF1A 4PQQA 4GD4A 1ULFA 2QFEA 5C5TA 3FMGA 4IE4A 4AQ2A 3LD8A 5IHRA 3VD4A 3VZLA 1ND2B 3I2KA 1X9TA 5I8TA 1OQ1A 4I02A 5GZCA 2C5DA 3FL7A 3ZMOA 2XUMA 5JMOA 2GSYA 2W1WA 4GWNA 3UETA 2O1QA 1SBFA 1B35B 2J22A 3H8OA 4S2FA 4GXLA 2JG8C 2RS52 1QKQA 1CAVA 4X8NA 4BHPA 2ZTNA 5BUVA 5I0SA 3IDCB 4QHBA 1SZBA 1WW7A 1VBC1 4Q0VA 3V64A 3TEYA 4AL9A 2B9VA 2W3JA 5CVRA 3E6BA 3KCCA 3I3DA 2EAAA 3WDVA 1H1IA 3VHRA 3AP5A 3BGAA 3P6BA 4SLIA 4XZUG 2EXHA 2VC9A 2F17A 5JIUA 2NM1A 3POFA 2XUEA 4Q4X2 4J6GA 1HRI1 1NAEA 2BWCA 1U5YA 3K77A 5EIYB 3N9OA 2ZEZA 3N9NA 4D0QA 5FCCA 4QGNA 4XFCA 2R043 2SLIA 4AEDB 3C2UA 3ON7A 1AJKA 4A3XA 4V2WA 2Q4SA 1MS0A 1OHFA 3KV6A 4RS5A 2PLV2 4GQ7A 4ATFA 2R072 5GKAC 3MFAA 1A34A 1ASJ1 4I09A 4N7UA 2BUKA 4WM8A 4WVMA 5FJKA 5FZMA 3R6SA 1AL22 1V00A 1DYOA 1W9YA 2QDNA 5DUUA 2VXRA 2JG9C 2RS31 2VCAA 3SHRA 4H3WA 1F5FA 4L2NA 4MHRA 2GH8A 4AVAA 1PM7A 3OTFA 3RZMA 3MGUA 5JSPA 4BQ2A 3D5OA 4XF4A 4YW4A 4CRQA 3MLKA 4XZPA 3S30A 4XABA 2WNOA 1W8HA 4XF1A 1RJ8A 4NO4A 3BODA 3WCRA 4KWJA 1WMEA 3CEWA 1MEC3 1G9FA 2W92A 1S2BA 3J26N 1MVEA 4N9HA 4PJYA 4GB31 3H8RA 1H8TC 2E7AA 1RUD2 1V6LA 4E4HA 1XNKA 2WT2A 4Q4W3 1H9PA 4JQTA 3KWVA 4RQPA 1ENRA 1TE1B 4JKMA 5ISLA 4M4RA 2GMEA 1YQ6A 2A6XA 1ULPA 3TEZA 2UWAA 1RUG1 1XBFA 3ACFA 4QHZA 2P17A 2PHUA 3ORJA 5IATA 1LGCA 5F32A 1VBB3 1CJPA 2OZ6A 5F6LB 1OVSA 1JUIA 3MDPA 2EIBA 1ZBE3 4LBQB 2AEZA 4PI2A 5FMOL 1IKQA 1TVGA 4CDWA 2C9AA 1BCXA 1A6CA 1OVPA 1SLCA 1IPKA 1HX6A 3AZYA 1VBA1 4IE5A 3OGRA 2EVXA 1PO21 2OPWA 2ZKLA 1GSLA 2YBKA 2XVLA 3LPGA 4PBOA 4C1XA 5CAZA 3GZUC 1GZWB 4LA3A 3KV5A 5GLTA 1UF2C 2VBDA 3S57A 3RZJA 3J8F2 4Z2WA 4GWIA 1CIYA 1ST8A 3RI8A 2F4LA 1EPWA 5KXDA 5I8SA 3OGJA 2XPJA 4ISQA 4XTMA 2Y34A 4ZKTB 1WLCA 4UW3A 5LEKA 2HWC1 4GWJA 2DVFA 1ULEA 3KV4A 3PUHA 4LHKA 5DG1A 5AC93 3AC0A 2Z79A 2BU9A 3AXDA 3DPRB 3GNEA 1QH7A 3N9QA 2RR13 1UYYA 2J1EA 4D7TA 3DEMA 4Y5TA 1H2MA 2FHRA 3POYA 4KU8A 3UT0A 2RV9A 4CUGA 4GJYA 4XF9A 4HLTA 3VL8A 4IUGA 2RE9A 1GUIA 4YVWB 4QPIC 3OUJA 1LHUA 1HXS2 5JPMB 2WZR1 1OLME 1X8EA 3BOPA 3M7AA 5B4XA 1NE4A 1YUDA 1BXHA 2CWMA 2K46A 1BEV3 2QCSB 4WVWA 3MUY1 4QPGA 2GC1A 5L7OB 3O5SA 3OPWA 2P3KA 4WV8A 5FV3A 3E6CC 5EQUA 2RMU2 4WM7A 4YGEA 5IK4A 1OA4A 3O1UA 2Y6HA 4XJWA 2FMYA 1CAWB 3FUQA 3DGTA 3GALA 4CDUB 4W6WA 1ODMA 4GMP3 2G1MA 3ILNA 1HQLA 1PZ7A 5FXWA 1OOPC 4Q1PA 2WS91 4Y1XA 4A44A 4LLOA 3I97A 3CZJA 5KWRA 1QJX1 1MS5A 1QOSA 2MEV2 2MNGA 1FMD1 5KHHA 1UXZA 1S2KA 2A3XA 1ND3A 2PQSA 1KQRA 5FXVA 3ZR6A 5J48A 3WZ1A 4OZXA 3CDZB 2C26A 4LUMA 4NPMA 1W3XA 1W6PA 3Q8CA 4NVPA 1V6NA 3VLBB 3ZPYA 1FPN3 3GF6A 3TN93 5LK5A 3Q8BA 4XFBA 5D21A 1XYNA 2GN3A 3CJIA 1CAUB 5A3TA 2R6QA 3NW4A 4ASKA 5FMOS 4ORFA 4RHV1 4GAZA 5FWJA 3HT2A 3TNQA 2B42B 4RFT0 3IN9A 2JJ6A 1JZ8A 4IEOA 4XETA 3VV1A 4W65A 3NNGA 1GYKA 1H8VA 2XBO1 3AZWA 1REFA 4BISA 1Y7BA 3EHKA 1YFUA 3ECQA 4FXKB 3ZFEA 1DHKB 1G9CA 3WP4A 4IGPA 3ZSMA 3OEBA 2ETEA 2BVBA 4XIOA 3ZFFC 1UMIA 3WG2A 3KS7A 3KHBA 1MZ5A 1RUF2 2ZXQA 4XF0A 1QU0A 4A4AA 4YZ5A 1QJEA 2HWE1 4UW4A 4CUCA 3IBMA 2XR4A 1U5IA 4QX2A 1S0JA 4QDQA 2DVAA 1C8M3 2ZHLA 1TMF2 3W20A 4DINB 3KQRA 5A3MA 1US3A 5B4NA 1RHI2 2A73B 4YG6A 2RJLA 1SDWA 4JRLA 2Y6FA 5ABJA 3INAA 1H6XA 2JDZA 3IZOA 1W6NB 1BQPA 4KWKA 1RUC1 3MLLA 5A32B 4BK4A 1YRZA 4B8EA 3JD71 4EZ4A 3VDAA 3RYPA 2BGPA 4QM9A 3H50A 4IW3A 3ZYHA 4A3ZA 1EY2A 1VRH3 5FZ3A 4C0HA 2XQRA 2B8MA 3VBSC 3MHZA 3LIHA 1GP5A 3BIEA 2OT7A 2JG8A 2PHWA 5EP9A 2B7YA 1FNYA 3PVBB 3ZSEA 2D5FA 2WKKA 1S0EA 5D8AA 2IZWA 5KXCA 3HQUA 3KF5A 4COWA 1NQDA 1QJU1 2Q8EA 4JGYB 5CG9A 5FZFA 4OHXA 4NHMA 3ZLIA 1C28A 1CAVB 2GP5A 3HWJA 2WNUA 3BU0A 1VBC3 3VN4A 3T2OA 4EWEA 2IWGB 2W2IA 4FXGB 3NV4A 4Y20B 3PIGA 1J59A 1JU4A 5L9VA 3EB7A 2VQUA 2WNEA 2Z4FA 5K4LA 1JYWA 1S1AA 3ZSJA 3AL5A 4K8FA 3ZXDA 1OPMA 3H3ZA 4H7MA 1SFYA 5CYYA 1UO9A 3I2IA 5I0TA 2VZVA 4AR2A 1UU4A 3THCA 1HRI3 1W2UA 3BOWA 1IS4A 2A6YA 2YFUA 1ODNA 4YW6A 3WW1A 3TEWA 1NG0A 2RDQA 2ZMKA 3D6EA 2ZABA 1SQ4A 2JB4A 4PDWB 3USUA 2FMDA 4H2AA 5C8CC 1LU2A 2IXHA 2VZQA 3OSDA 3LDRA 1EV11 1ASJ3 2AENA 4AI0A 4GH4C 4LBLA 1WMDA 3LEIA 3WG4A 5JIAA 4BLIA 4FFHA 2D3RA 3IDEA 4WVMB 2BEOA 2D43A 2VVEA 4B1LA 2J1TA 2BP6A 3M4FA 4JDOA 4Q5OA 1SACA 3WF0A 4C91A 1PGSA 2TEPA 5ACA1 2RS33 4NHYA 5A7PA 4DRRA 4ASMB 3VBFB 2DVGA 2EA7A 2VZUA 4RL7A 1K3IA 1PMJX 1UOGA 1VB4A 3MF9A 5IVCA 2VBPA 1W0PA 3PNAA 4AVBA 1F4AA 1PIV2 2EXKA 1UW8A 1RVF1 4QX8A 4JGZA 4GB33 3ZN6B 4IESA 4XJUA 4HSLA 3RNSA 4LO8A 3GZTB 2E33A 2V72A 1DGRA 3HPNA 2A71A 3M3EA 4XJ8A 5CFDA 1FOD2 3ZSKA 3QLQA 1RUG3 1LEMA 5A3LA 1ACCA 5FUNA 3NJZA 1BHGA 1RUH2 4ZY9A 1ZZ6A 4HK9A 3FX3A 5D2AA 3GZAA 3LIGA 5GLUA 2EIDA 2RDSA 4N43B 4J1XA 4Q0UA 5T5OA 5SV8A 4MG2A 5ANNA 4IEZA 3SH4A 3VBOA 1E5HA 5FO9B 1HB4A 4D94A 2GZWA 3WP6A 1VBA3 2Q8OA 1O3QA 1PO23 2WSVA 1N3OA 2ADEA 1Z7S1 4N53B 1RINA 3LA7A 1UY3A 4QHOA 3UJQA 2ZZQA 4OZOA 3VBUA 2DUPA 1ZNPA 2R0FA 2O14A 5I0RA 3W9AA 2ADDA 2BGCA 2D98A 4PIYA 3WCSA 4I01A 4DMIA 3S0MA 2QQOA 5HV4A 2X53S 2A6ZA 4Q4Y1 3EBRA 4A7YA 1LULA 1W8ZA 2HWC3 2VNOA 1O59A 2ENRA 3I2DA 2GAUA 4LPLA 5FZOA 5FTTC 1W2AX 3ILFA 1VRBA 1NYWA 1RUJ2 3I59A 4OCTA 4CCCA 3BYWA 5M0TA 4K21A 3OG2A 4OULA 4AFBA 1NCQB 1LOEA 2PFWA 4JRAA 4KI5M 1I9RA 2AR6A 3L2YA 3WHTA 5FR3A 5T3NA 1BVP1 1A78A 3CO2A 1Z0HA 2ZHKA 4P5YA 3S5AA 1PVC1 4DXSA 2EIGA 2WZR3 3FHQA 4IQPA 2JXAA 5FUIA 4CCJA 3WT3A 4FP3A 2VUDA 2VUCA 1ND2A 1RUE2 1YLLA 3FLTA 3KLSA 3POJA 3V0AA 1OT5A 2JDUA 3ZXJA 2JIJA 1UKRA 1X33A 4E2SA 2B5HA 5BNPB 5K0UC 4XCBA 1G9AA 2ZEWA 2CGNA 4CXYA 2ZEXA 1O3RA 2PHRA 1SFPA 2VMDA 3WF3A 2XMLA 5K8SA 3ROUA 2P4EA 4QX3A 3UJOA 4QKBA 2CWSA 4PI0A 3HQXA 1AF9A 3WQ1A 5IVJA 3TNPB 4A41A 3FBMA 3JB4C 2HWF1 4EN0A 3H8XA 1LOCA 1PX4A 5FYTA 4IETA 1QJX3 1WCSA 4AE2A 1XYOA 3IT8A 2R1BA 1I5PA 2VUAA 3IDBB 3PLQA 3VKLA 1FMD3 3EXUA 4YLZA 3N7KA 3UK9A 4Q8LA 1ND3B 2DU0A 4AEDA 5DQ0A 1OA2A 2RDRA 3SEEA 1R082 1SFNA 1W6PB 1CIWA 4UYBA 1V9U2 2D6MA 5HXMA 1QQP2 4IV3B 3S6PA 5FP4A 2I45A 3CJIB 2CNAA 2VU9A 4IEPA 4FPFA 1UU6A 4A2UA 3KGZA 2RS51 1QNWA 2PHFA 3NQHA 5J1XA 2XLFA 1O5LA 4X6QB 2DUOA 3U0ZA 4QDRA 5FLHA 2C1FA 1TZOA 2AYHA 3T2PA 4ET7A 4OHZA 1EYBA 2XXZA 4SBVA 3ZFEB 2VOWA 4XCAA 4CPBA 2QVSB 5ERLA 4M3CE 2FDGA 4PLMA 2D93A 4XW3A 5JOZA 3MW4A 2CU5A 4EV0A 1LGBA 4JX0A 1ALYA 1PMIA 2EALA 4M00A 4ZONA 2WABA 3VKFC 4Q4X1 4UW5A 1AYN2 4K6BA 5FZ6A 2NMOA 4AG4A 4NE9A 3BPZA 1ZZ7A 4FBFA 4Y1VA 2H6CA 2P3IA 3ZFGC 1LOGA 4EROA 4FTEA 1UY0A 1HJFA 3VZOA 3OBZA 2BJSA 3RJRA 2HEYF 1XNDA 4W50A 2BERA 3VBSA 1YEWA 2XVKA 1RUC3 2PLV1 4E4ZA 2R071 5JWPA 1JYTA 2XG3A 2WQ4A 4LBQA 3JD73 2QQPA 2G4IA 3MPBA 3A22A 4QU1A 4CUAA 3LZZA 3BU7A 1GOHA 1ENSA 1MS4A 1CN1A 1W0OA 5LASA 1AL21 4I0BA 2BOJA 4IGOA 3VZMA 3EJKA 1GZWA 3BN6A 4MUVA 1SBEA 2JG8B 3ZYBA 4S2GA 2G9FA 3MIEA 2AGSA 4G4FA 4XUNA 1K45A 5BPXA 4JZRA 3O0WA 1TME3 5J36A 1VBE2 1SG3A 1MS8A 5A33A 4LTAA 5C3RA 3SQOA 4FFIA 1RUD1 2D3PA 3ETPA 1UY2A 5E8AA 1GFF2 3RZKA 3WQBA 3DKQA 3O7OA 4AQ6A 4A7KA 2JDAA 2VGDA 4Z1VA 3M3OA 2V5YA 2VOTA 3M3CA 5JDBA 3LA2A 4KMQA 1PVXA 4XAEA 3FLPA 1K42A 3FLRA 4AI1A 3FJSA 4DXZA 4RGKA 2ZS6B 3CL1A 3O1VA 3RZLA 4GH4A 1KGYA 3B9CA 2R7EB 4HVRA 1AYM2 4XOGA 3VDDC 1RB8G 4KWLA 4MGIE 2PMWB 4HPKB 1QDCA 4O65A 1XXNA 4LO4B 1POV0 3W21A 4OUSA 3WQ0A 3MV11 1AXYA 1AR63 1AR92 5JSRA 5BV6A 4PCRA 2E7QA 3USUB 4BXFA 1EV13 3LAGA 2YBSA 2JG9B 4IEYA 4HANA 4MGKE 1HJGA 4A7ZA 3J8F1 1RUI2 1AX1A 1OMIA 2CHHA 1J1TA 2BPA2 3ZDVA 3C7FA 3H7JA 3B00A 5ACA3 1EAH2 4CU8A 1OA3A 2P6CA 1SLTA 2WFPA 2EIEA 4JV4A 2CDOA 2VR4A 3K46A 5KHJA 5KXBA 1H8TB 3JBG2 1K12A 3NAPC 4FPEA 2QQJA 2JECA 1AR82 3C7OA 1XE0A 2B46X 4FOYA 4LE3A 5F5CA 1D0HA 3UYJA 2FBEA 1ZZ8A 1RVF3 4Y5Z0 1US2A 4BM8A 1C1FA 5BNOC 2A6VA 3ZXKA 4XE9A 5T50A 1V6MA 4K20A 4BIOA 4YSFA 3GCXA 4XXPA 1OURA 2R16A 2ZAHA 4NR1A 4FSJA 1HXS1 5FY8A 2RG4A 3O1MA 1F8VA 1BZWA 3KSCA 4XVHA 3PJYA 3J9SA 2ZOEB 4LK7A 1I6XA 4OLLA 3U4XA 3IPVB 2JD4A 2RMU1 2Z69A 4P9GA 4URTA 3N9PA 1GU3A 1H4HA 2WO3A 3N7JA 4UW6A 1D7PM 2FCVA 1AR72 3I8TA 5E16A 1F15A 4OUEA 3VBOB 2WWJA 3JB8A 3H8UA 4DPNA 4MX3A 3VBHC 3WSOA 5E6HA 1O4YA 1Z7S3 4QXHA 3SCGA 5FPVA 4F8AA 2J1AA 2YUEA 3M70A 3RZHA 3CMGA 1LHNA 2BWAA 4HZFA 1W0NA 1HN1A 1COV2 4RD7A 3KT7A 1Z78A 2Q5TA 2QNKA 2CSGA 1LODA 1W6OA 2YU1A 1F5JA 2YC4A 3BALA 2QQKA 3FE5A 2MEV1 4Q4Y3 1XQNA 1LOAA 4QT6A 2VZTA 4LK6A 4UFKA 4AAPA 1POV1 1ULOA 4AOCA 3ABZA 4MV2A 2OUJA 4YW7A 2HWD2 5BNNC 1UZVA 3IAQA 2BTVC 3K3NA 1RMU3 2WSUA 3RVHA 2ILMA 4QPIB 4BXSV 3BTAA 2NMNA 1O6UA 5FY4A 1W6NA 5FZEA 1ZA4A 1MZ6A 1AUYA 1GQGA 4LBMA 1ZA7A 5LBFA 4PT6A 5APAA 4P08A 3QCWA 2Y64A 4N8MA 2VCMA 2HBTA 4MH0E 5C3SA 1PVC3 2QQNA 3APBA 5IVBA 1X50A 1F31A 3KZ4C 4Z82A 1JHNA 3ENRA 3KB5A 3NNLA 1VJ2A 1S4CA 2HLEA 3E5QA 1G9DA 4LT5A 2Y6JA 1J3QA 4XDQA 3PIJA 3NV2A 5FYZA 5IFPA 1HB2A 2Y33A 3V0AB 4L97A 1JODA 3BTYA 3PTYA 4QM8A 5LBBA 3OGSA 1V6OA 1HLCA 4JGYA 4LIVA 1RUF1 4QB1A 1OOPB 5GZDA 2JE9A 1GWKA 2CTVA 3JZVA 1LOFC 4OUMA 3F2ZA 4DUVA 1REDA 2R042 2DBNA 2XJRA 4CP0A 1FATA 4M0HA 2R32A 3MIGA 3RRDA 1EUUA 1GANA 4Y20A 1AJOA 1AVBA 3LEKA 5LZ6A 1TMF1 2HWF3 2RVAA 4BA6A 5FP8A 2GH2A 2SBAA 1VMJA 1RHI1 4KGGA 3ZXFA 4HXCA 2RDNA 4CU6A 3AK0A 1X8MA 3DKWA 1YI7A 1ONAA 4N9IA 4LKFA 3AM2A 3O1OA 5HCHA 2JICA 4NHLA 5JOXA 3VKOA 4N7IA 4PDWA 2DURA 2ZCWA 1YO8A 1S0BA 1BYHA 1VR3A 4QGMA 1ZVFA 1MACA 3H42B 4RR3C 3H1WA 1JZ3A 2QQVA 2A75A 1YI9A 3M8LA 3T1MA 3ZFFB 2ZHNA 4MXVA 1JZ6A 2R0HA 3MYXA 3WY6A 2XHNA 2D40A 1YYNA 1ZRIA 3T1LA 2RS53 3N4MA 2NZ9A 1WCQA 3WNXA 1UAIA 3VBFA 1GNYA 2TNFA 2DTWA 1CX4A 1JZ7A 3I49A 4YZ1A
chains in the Genus database with same CATH topology
4N8MA 2VTXA 1XE0A 5EHDA 3T30A 4CA9A 1XB9A 2VTXJ 1NLQA 1K5JA 2P1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8M A;  2VTX A;  1XE0 A;  5EHD A;  3T30 A;  4CA9 A;  1XB9 A;  2VTX J;  1NLQ A;  1K5J A;  2P1B A; 
#chains in the Genus database with same CATH topology
 3ZR5 A;  1CPN A;  2H0V A;  5K9Y A;  2DFB A;  4HK8 A;  3V0B B;  2Z5W A;  3ZN6 A;  1XNT A;  3AKS A;  2W08 A;  5FQ0 A;  1RYY A;  1S0G A;  3DF0 A;  4O7X A;  3TOJ A;  1IQD C;  3AP9 A;  5IVE A;  3QH7 A;  2RS1 2;  4I0A A;  4HSJ A;  1W9S A;  2WDB A;  4QXB A;  3O12 A;  2WN3 A;  4P9I A;  5HI0 A;  1XNC A;  1W8U A;  3AP4 A;  3VHN A;  2D6L X;  1LHO A;  3M1H A;  3SIT A;  2PLV 3;  2R07 3;  4N43 A;  3VBS B;  5DPN A;  4E8C A;  1S0C A;  3GZE A;  1KS4 A;  3ST7 A;  1IGO A;  3HT1 A;  3OEA A;  2EF6 A;  1LJ7 A;  1AL2 3;  4NHX A;  4QD2 A;  4N53 A;  4D8M A;  5AC9 2;  2R49 A;  5DAW A;  5H9Q A;  4FPL A;  3WNL A;  5GLV A;  4CEW C;  3OUH A;  1ZYB A;  2WR9 A;  4YYO A;  1YJL A;  3I2F A;  5G05 L;  2HWB 2;  1VB2 A;  1J1L A;  1SLI A;  5GZE A;  5J7M A;  1GP4 A;  2VPV A;  2VUJ A;  4LOR A;  4QB2 A;  3T30 A;  1JI6 A;  1PIV 1;  2LRO A;  3SH5 A;  1D4V B;  3LSE A;  2C9K A;  1F2N A;  2LM3 A;  5A33 B;  3VBR C;  1RUD 3;  2ARC A;  3JU9 A;  4HET A;  5FZA A;  3SCF A;  3ACL A;  4Y33 A;  5A3O A;  3AKQ A;  5C9A C;  3OGG A;  2DCY A;  1POQ A;  3ASI A;  1Q8O A;  2ZGT A;  4FPK A;  2AZ5 A;  5FYY A;  1FOD 1;  5LB6 A;  1NCQ A;  1C8N A;  2XJS A;  4BJ0 A;  1OC1 A;  3I2H A;  2DDU A;  4PBP A;  1X7N A;  5ANQ A;  1RUH 1;  4A6S A;  4KL1 A;  2YB7 A;  2OUH A;  2XB6 C;  4LNV A;  4CU7 A;  5C8C B;  1JZ2 A;  5IJR A;  3ZKY A;  3BTZ A;  1XU2 A;  5T5J A;  4GH4 B;  3NNJ A;  2DVD A;  2VOV A;  4NRM A;  3ZIX A;  1OH3 A;  5FKC A;  5CG8 A;  3OD0 A;  1J3P A;  2FDK A;  4DZG A;  3USS A;  4B7K A;  3AKT A;  5BNP A;  1O8P A;  1JYC A;  2XON A;  5JXH A;  4NRP A;  2JWP A;  1JZ5 A;  4CU9 A;  2VD7 A;  4YZ4 A;  4CTE A;  1SMV A;  5A80 A;  4UI9 L;  3J8F 3;  1RC6 A;  1WCD J;  4KH9 A;  3OOX A;  5T54 A;  3SLI A;  2VMF A;  2ZGM A;  1ZBA 3;  1XNB A;  2WUH A;  1YCI A;  2P6H A;  5BNO A;  5JZG C;  3JCI A;  2ZGK A;  1FPN 2;  5F3C A;  2ZML A;  4GA9 A;  1SPP A;  1PK6 C;  2WQ8 A;  3D8C A;  4NMI A;  4B7E A;  1M06 G;  1RUJ 1;  1UZY A;  1DQ2 A;  1H2K A;  2PTM A;  4MLO A;  4GZ9 A;  2UYB A;  2VMI A;  1DIW A;  1GNZ A;  2RM2 2;  2W94 A;  3AYC A;  3HNM A;  4I30 A;  4HN1 A;  4NAO A;  4FAH A;  5CFC C;  2KA3 A;  2ZGO A;  2GMM A;  2G19 A;  2W0X A;  1QJY 3;  2ERF A;  3AFK A;  3QOP A;  4M3C A;  3ZXL A;  1CX1 A;  2R30 A;  3T0A A;  2WNV C;  3FUO A;  3WD5 A;  1HXS 3;  1DQ4 A;  3RWK X;  4K3U A;  3WW4 A;  4NIH A;  2DWR A;  2ZX2 A;  2C4X A;  2B39 A;  3BPS A;  1DF0 A;  3E97 A;  3PDQ A;  4IV3 A;  1J84 A;  3KCY A;  4Y4Y A;  1NA1 C;  3AVR A;  4XMI A;  3RMY A;  5FLI A;  1RUE 1;  2JB8 A;  3B5L B;  4XEZ A;  4KG0 A;  3VBH A;  4C1W A;  3C7G A;  4CVU A;  3FBY A;  5EYY A;  2ARA A;  1DBN A;  3RJ2 X;  2VNV A;  1W9T A;  1S0I A;  4XMA A;  2CDP A;  5B2G B;  1D4M 2;  4G3Y C;  1NX9 A;  1C8M 2;  5T5L A;  2JDK A;  4AQT A;  5JR2 A;  1LED A;  4IE6 A;  1H1A A;  3VKM A;  4HFS A;  4D6Q A;  3H1M A;  4NIG A;  1Y9G A;  4LO5 B;  4CDX C;  2QQM A;  4JVA A;  5LA2 A;  2X5I C;  3C7E A;  4W6X A;  1FYU A;  4YW1 A;  1LKN A;  5AFE A;  4KNC A;  5DAV A;  2VL4 A;  1BBT 3;  4O9E A;  3ZXG A;  4QGL A;  4KQ7 A;  1W6O B;  2MEV 3;  3GYD A;  5LA0 A;  3BTX A;  4BDV B;  3T0D A;  1POV 3;  1VRH 2;  2WZE A;  3PJQ A;  1R09 2;  3B93 A;  2HBU A;  1DZR A;  5FZH A;  3NWK A;  4EZH A;  2OZJ A;  4IEW A;  1DFQ A;  1R08 1;  2E53 A;  2PAM A;  4IGQ A;  1DGW A;  1W2T A;  2ORX A;  2VW1 A;  1RUO A;  2VBB A;  2BV4 A;  1Q8V A;  1V9U 1;  3UKT A;  2HJI A;  1QQP 1;  3THP A;  2ZAA A;  4CSW A;  2D97 A;  2ZJC A;  1O91 A;  3FFZ A;  4WZF A;  2VEC A;  1URX A;  4Y4R A;  5EHD A;  5F39 A;  5JOY A;  3E5X A;  3PMS A;  4TTG A;  4NID A;  4XF3 A;  2X09 A;  3NNM A;  4P00 B;  5I93 A;  5K0U B;  1IQA A;  4YW5 A;  5KC5 A;  5IK5 A;  1OLQ A;  4FT8 A;  4BCU A;  4JQR A;  1L7Q A;  1UN1 A;  3B9I A;  5FRA A;  4CDQ C;  5LA1 A;  3EO6 A;  3PU3 A;  1JZ4 A;  4LBJ A;  1VP6 A;  1G86 A;  2VTX J;  4KBZ A;  5C71 A;  1QJZ A;  1OBN A;  4XJZ A;  3ZM8 A;  2OVU A;  4R52 A;  3ZYG A;  5FOB B;  5F5A A;  5DMY A;  4Y1U A;  2UWB A;  3CQO A;  4OYU A;  4C8D A;  2P2K A;  1XYP A;  1VAM A;  1Y43 B;  4BQ1 A;  2VJX A;  4JHZ A;  3PUR A;  5FZ1 A;  4CCD A;  1E57 A;  1AYN 1;  4XPV A;  3QBQ A;  1JW6 A;  4ZHN A;  1TMF 3;  5FFO C;  1QY4 A;  1XC6 A;  4FOQ A;  4MGQ A;  2ET1 A;  1UD1 A;  1RHI 3;  1ASJ 2;  2VTF A;  1NY7 2;  2XJP A;  2YHJ A;  1MS1 A;  3BKZ A;  3UV9 A;  1NLR A;  4Q8K A;  2A3Y A;  4QX0 A;  1X82 A;  4HN0 A;  3KVB A;  4RR3 A;  1QXJ A;  3ZKU A;  1OUX A;  2BNO A;  5J09 A;  4DQA A;  3AKP A;  3AMM A;  1MZF A;  4HPK A;  4LOS A;  4TSV A;  1GV9 A;  3ATG A;  4B4P A;  4MGS A;  1ZRE A;  1Q3E A;  1JYV A;  1HV1 A;  2W87 A;  2JG9 A;  2PHD A;  2HYK A;  4LKS A;  5FZD A;  2IVJ A;  4K8R B;  1W8T A;  4L0P A;  2L9L A;  4Q1R A;  4MGZ E;  4OMD A;  2OW4 A;  3LFI A;  4MHU A;  1ZRC A;  3P1I A;  2Q30 A;  4M3C F;  2HEW F;  5CIS A;  3WV6 A;  4QU2 A;  1H8T A;  5GAL A;  4NPL A;  5FYM A;  1XNA A;  4BQ3 A;  5JUV A;  1XSQ A;  1HV0 A;  3RPQ A;  2BRT A;  1JYX A;  4Q0P A;  3ZSL A;  5EJ3 A;  3RS6 A;  1KS5 A;  4TZD A;  2WZ8 A;  3AFG A;  3T09 A;  4CE8 A;  5IWF A;  3ZFG B;  4BQ4 A;  3G6J B;  4P9Y A;  5FQ0 B;  2OYZ A;  2BOI A;  2BQP A;  5EFU A;  3AZV A;  4MSV A;  1IZ3 A;  2WC2 A;  2XOM A;  3N9M A;  3PHM A;  2ZX0 A;  1JBC A;  5F3E A;  3J7L A;  1U5Z A;  1AYM 1;  2Q8D A;  2VZP A;  4HKW A;  3WUC A;  1W9F A;  2J7M A;  2ZGR A;  4LO7 A;  4LHN A;  4NOT A;  3IPV A;  4CZS A;  4YM0 A;  3H3L A;  4PIX A;  5A7S A;  4LIU A;  4GKX A;  1WW6 A;  2D5H A;  3WDW A;  2LAL A;  3PVE A;  1WD4 A;  1XOY A;  3HN3 A;  1NKG A;  4UXA A;  2K0G A;  4CEW A;  1O8S A;  2IUW A;  1NCR C;  3GBF A;  4LBO A;  4AVV A;  1RUI 1;  2GP3 A;  1WA6 X;  1H6Y A;  1SLL A;  1ULC A;  5FP7 A;  1CR7 A;  1EAH 1;  1Q8P A;  1S2E A;  1O4Z A;  4AXO A;  3N3H A;  3L9J T;  1QHD A;  3VBR A;  5DUX A;  2LUW A;  2EXI A;  2IXK A;  1VE0 A;  3JBG 1;  2Y6G A;  3H1Y A;  2YGM A;  3J7M A;  5T55 A;  1AR8 1;  4Q27 A;  4XUR A;  3E5U A;  1W05 A;  1PIV 3;  2XDV A;  1CQ9 A;  4OFG A;  5IUQ A;  5SV5 A;  5HPO A;  4FVV A;  4HT1 T;  2DUQ A;  2VMC A;  4K40 A;  4UFJ A;  3U75 A;  2YMZ A;  2IXI A;  4IV1 C;  4AI9 A;  4JHT A;  2RJK A;  1DU3 D;  2FZ1 A;  4QPI A;  4EN7 B;  4WVV A;  3KT4 A;  2P34 A;  1FNZ A;  4XAC A;  2FDF A;  2VW2 A;  1FOD 3;  2YBP A;  3VDD B;  5FZC A;  1UKG A;  3WW3 A;  4OI1 A;  5FY1 A;  1RUH 3;  4XQW A;  5DZG A;  1DQ0 A;  1X36 A;  1CGP A;  1Q43 A;  3ME2 A;  3G7D A;  1CZS A;  1UZW A;  3LDK A;  1ULG A;  1O3T A;  1RL3 A;  4ZU5 A;  3LPF A;  5FYV A;  2QQL A;  1GWL A;  1UOF A;  1YQ5 A;  1AR7 1;  4K1Z A;  3LOI A;  1GZC A;  5J98 B;  3K3O A;  1NQJ A;  3HR9 A;  5LK7 B;  2PHX A;  5JOW A;  5DAP A;  1KFU L;  2P5B A;  3U10 A;  3J4U H;  5JZG A;  5AVP A;  5A1A A;  1FMD 2;  1OOP A;  4QXK A;  5C7G A;  1PK6 A;  1LGN A;  3OBA A;  1LRH A;  3NAP B;  4FPC A;  1C5H A;  2ZX4 A;  1WD3 A;  3D3A A;  1N1Y A;  2XLA A;  2JIG A;  1RIT A;  2E31 A;  2PAK A;  3AMP A;  4E27 A;  4YFZ A;  4YGC A;  5L36 A;  5BNO B;  5D1I A;  1SHW B;  2WS9 3;  1A8D A;  3MIB A;  5L73 A;  2R06 2;  1YFX A;  4MO3 M;  2ARX A;  2HWD 1;  4XQD A;  4UBH A;  5EXO A;  3T4H B;  1I5Z A;  4URA A;  2XKP A;  1RUJ 3;  1KJL A;  1SPP B;  1W6Q B;  2WO2 A;  3SC7 X;  4CYD A;  4HL0 A;  3HJR A;  1WLW A;  2WT1 A;  3AB0 A;  3EYP A;  2GU9 A;  4AGV A;  3EQE A;  5C70 A;  4IEX A;  1YHF A;  2D6O X;  4M3C B;  3VGI A;  5JXJ A;  4DS0 A;  1R1A 2;  4UOJ A;  4XAA A;  4QKF A;  2LW8 A;  2C24 A;  4BLJ A;  2VXJ A;  3MW3 A;  4K7J A;  3ZPO A;  4GIQ A;  3AYE A;  5DDJ 2;  1RUE 3;  1H2N A;  3ETQ A;  5EZW A;  2D7F A;  2G9G A;  3BCW A;  4N90 A;  3MV0 1;  3IMM A;  4RHV 3;  1QIQ A;  3VBH B;  3ZFF A;  3FZ3 A;  4P9J A;  1WZX A;  5LRS A;  5JCT A;  2VME A;  1AXK A;  1AHS A;  2XBO 3;  2D6P A;  2ATF A;  1IOA A;  1L3J A;  5T5P A;  3RYR A;  1RUN A;  2Q0A A;  3N9L A;  1BMV 2;  2YYO A;  3NV1 A;  1PGW 2;  1WKY A;  2QQU A;  4DB5 A;  2R04 1;  2VMH A;  1NT0 A;  4QX5 A;  2YXS A;  3NVC A;  4ARX A;  3V0B A;  5GZG A;  1W6M B;  5KC6 A;  2ARB A;  2E26 A;  2HWE 3;  3ZVX A;  4PF1 A;  5BNN B;  3BUC A;  3RG0 A;  1XB9 A;  4COZ A;  2ZGP A;  1DLC A;  1QMJ A;  5FZL A;  5FZ8 A;  5IVV A;  5A70 A;  4BMB A;  5IK7 A;  2OS2 A;  1DG6 A;  4XXA A;  3SMH A;  3WP3 A;  1W39 A;  3RFR A;  4AHX A;  4RS5 C;  5C4W C;  1DLL A;  2CL2 A;  4Q4V 2;  3DYM A;  4JTO A;  1UX6 A;  1J3R A;  3P3N A;  1R08 3;  1IS3 A;  4WM8 C;  5H9P A;  4F7Z A;  3MID A;  4QB6 A;  5IK8 A;  4YW2 A;  1V9U 3;  5CIR A;  5C3Q A;  1QQP 3;  2VZ3 A;  3E1F 1;  1TME 2;  2Z2S B;  4CDQ A;  3O14 A;  1Y3T A;  3HAG A;  1VAK A;  1YQC A;  3O1S A;  1WA4 A;  3LB9 A;  2YV8 A;  1ZRD A;  1T6G C;  1C57 A;  5FZK A;  4HVO A;  5EPA A;  4WVZ A;  3ZO0 B;  2VMG A;  4XJA A;  1VAL A;  2ES3 A;  1MQT C;  5LY2 A;  4BQ5 A;  4D7S A;  1DGW X;  1REE A;  2YRO A;  4XIK A;  2BBV A;  4XDP A;  3ELN A;  2ID4 A;  5FWE A;  2BFU L;  5DZF A;  1W90 A;  1HB3 A;  1OLM A;  1PO1 2;  2WAO A;  2XKO A;  2QE3 A;  1HQN A;  4JC1 A;  4KGQ A;  4COY A;  4F3J A;  5DZE A;  5I8Y A;  5A7O A;  4NII A;  5FZG A;  4B3N A;  4DRV A;  1QJU 3;  4QX1 A;  1AX2 A;  4JCK A;  2DCJ A;  1VBD 2;  4RQP C;  3SEP A;  3ZN4 A;  1H2L A;  4Z07 A;  2A5Z A;  3S5Q A;  1XSR A;  3R4U A;  4FO9 A;  2ZZJ A;  4XBL A;  1QJF A;  3GCW A;  4YWA A;  3ZN5 A;  2ZBJ A;  2QBX A;  3T4V A;  2OA2 A;  2UY9 A;  4FPG A;  2W5F A;  4R9B A;  4Y5S A;  3ZIW A;  4A45 A;  2RS1 1;  1AR6 2;  3ZMN A;  1PGL 2;  4FPJ A;  4AVT A;  5F7U A;  5EJ1 B;  5A6Y A;  2WZP P;  2BW8 A;  4X8P A;  2Y26 A;  3C8X A;  4M4P A;  1VAV A;  2RHP A;  4CDW C;  1K5J A;  4RGA A;  4P14 A;  5C8C A;  4ZS2 A;  3TRS B;  3AYD A;  4RR3 B;  3OCP A;  5ACA 2;  2WAA A;  1TQ5 A;  4YVS C;  3FFQ A;  1S55 A;  4C90 A;  2NLR A;  1C5I A;  1O4T A;  2OKX A;  4LUL A;  2BZD A;  5FMD A;  4FOW A;  5A7W B;  4XDO A;  3DV8 A;  2YC0 A;  1KFX L;  5FZB A;  1HQW A;  4AGR A;  3OGV A;  1DDL A;  4YGB A;  2XJT A;  2VY0 A;  4UBG A;  1KEX A;  1W06 A;  2HWB 1;  3NKT A;  3RGB A;  5DXD A;  1JN2 P;  3PME A;  3PU8 A;  3DCQ A;  1MR5 A;  1W9W A;  4PQ9 A;  3VD3 A;  5FPU A;  3OB8 A;  4J25 A;  4ZZ8 A;  1YWK A;  4IXL A;  2DV9 A;  1FI2 A;  5LEJ A;  3J7N A;  4MZU A;  2QQI A;  4B4Q A;  2GN7 A;  3MEP A;  1UWW A;  1WMF A;  4S2D A;  3VB9 A;  3KV9 A;  2VNG A;  2JDH A;  3JQX A;  5GJ6 A;  3CLP A;  1CWP A;  2GNT A;  3WNP A;  1GZT A;  2Q1F A;  4QPG C;  1NZC A;  4S2H A;  1O3S A;  2DYC A;  4AVC A;  2GAL A;  4GMP 1;  4WM7 C;  1AYM 3;  1KJR A;  3U78 A;  2RJ2 A;  3KQ4 B;  4TXW A;  5G04 L;  1N1S A;  2GNM A;  4DIQ A;  1Q8Q A;  4V1P A;  5CKN A;  4CA9 A;  4XHX A;  2JE7 A;  5DN2 A;  2YDE A;  3JQW A;  3WXP A;  4CXW A;  4FI9 A;  2QQW A;  2FCU A;  1LB2 A;  1QOO A;  1NE6 A;  4CEW B;  4DXR A;  1RUI 3;  1S0F A;  1JOB A;  5LY1 A;  1Q8S A;  2V4V A;  2BFU S;  2WQZ C;  2W91 A;  3CIH A;  3MF6 A;  5KHG A;  4BPZ A;  3WDY A;  1EAH 3;  1ZZ9 A;  1RMU 2;  5HCF A;  2WFF 2;  1PMH X;  4ONU A;  1FAY A;  4HVQ A;  1W28 A;  1AL0 G;  4CP9 B;  1HRV 2;  4YRD A;  2HEV F;  3VBR B;  3JBG 3;  3R4S A;  5HXV A;  1ND3 C;  5C9A B;  3AJZ A;  1N1T A;  1SLA A;  2AAC A;  1QDO A;  2GC2 A;  4GJZ A;  1GWM A;  2EIC A;  3OYW B;  4YM1 A;  2RM2 1;  4DY5 A;  4OHY A;  2WLP A;  2ZAC A;  1S0D A;  2W1U A;  4Y22 A;  2IFR A;  3A21 A;  3FC0 A;  3MO4 A;  1Y4W A;  4CPB D;  4TYS A;  4AHY A;  4A42 A;  4RFR B;  5BXX A;  2ZKN A;  3Q9O A;  5CNA A;  5C5U A;  4UAP A;  2VVD A;  2XLG A;  4OI0 A;  5FMC A;  4GAL A;  5HCB A;  4FFF A;  2VE1 A;  3POG A;  4YAR A;  2PEL A;  5CZK A;  3SNM A;  1UPS A;  1BJQ A;  5K0U A;  2W95 A;  4AI3 A;  3GXU A;  3WHU A;  1AR7 3;  4QQO A;  4YZ2 A;  4FOV A;  4QMA A;  3HMY A;  1D4M 1;  5JAX A;  1QF3 A;  1IG0 A;  4EN9 B;  4PLN A;  3P5B A;  3POB A;  2O0O A;  4R9D A;  5F2S A;  4DEV A;  5J37 A;  3DL3 A;  3ACH A;  5FYB A;  1H0B A;  5JZG B;  2IC1 A;  4AYU A;  4LBQ D;  2HH9 A;  2JE8 A;  2V5D A;  2TBV A;  5BNQ A;  1PK6 B;  4CCE A;  1OD3 A;  1UOJ A;  5FPB A;  4EWD A;  2W1S A;  1QXP A;  3TAY A;  3LDB A;  1IS6 A;  3H9A A;  4LJH A;  4QPY A;  5ABJ C;  5FO8 B;  1AX0 A;  3K51 A;  1R09 1;  4ZXE A;  5CFC B;  4QQ2 A;  1JTZ X;  2HWD 3;  2JKB A;  5FOJ B;  2BBA A;  2JD9 A;  5CKM A;  2Q1Z B;  4LQR A;  2WNV B;  3OPZ A;  2XL9 A;  3I7D A;  1UYP A;  1JYN A;  2UYA A;  4CP2 A;  4OI2 A;  3KGL A;  3U14 A;  4H7L A;  2Z42 A;  3PUI A;  1NA1 B;  4AW7 A;  3GBW A;  4YPJ A;  4Y3O A;  4CCM A;  4FCA A;  1LHW A;  4LXL A;  2P37 A;  1YFW A;  2UUR A;  5DAQ A;  4BQX A;  4D6R A;  5D8A C;  2WA4 A;  1RXF A;  1KDK A;  4ZXK A;  5JXI A;  1LEN A;  3NJV A;  3QH6 A;  1LOB A;  4EQV A;  4ZS3 A;  1YNA A;  5BY5 A;  1UQX A;  1L7R A;  1UY4 A;  1MEC 2;  3Q8A A;  5A7N A;  3WG1 A;  3AZZ A;  4DUW A;  2WNU C;  2W9X A;  2ZX3 A;  5A3P A;  4CDX B;  3OPT A;  4BIF A;  3WNN A;  3K4D A;  3VHO A;  4Z92 B;  2X5I B;  4RGG A;  4Q4W 2;  3SIS A;  2YZ4 A;  2ZGS A;  4P02 B;  1JUH A;  4YNI A;  3K2O A;  3U07 A;  1J58 A;  4ZPI A;  4UF0 B;  1MPX A;  2NQY A;  4KWU A;  4ZZ5 A;  2CGP A;  3H7Y A;  5C4W A;  2XJU A;  1MS9 A;  1VBB 2;  1XJA A;  2I2S A;  2NYY A;  5FPL A;  5DAX A;  5JR7 B;  1N1V A;  3ZFG A;  4YFW A;  1NY7 1;  1ZBE 2;  1WCK A;  3NO8 A;  4D69 A;  2E9Q A;  1UMZ A;  2QUO A;  4Q4X 3;  2J1S A;  2VUL A;  2OQ6 A;  3H0O A;  1OQD A;  3PVN A;  1LR5 A;  5A1F A;  1CES A;  1W8W A;  2LS6 A;  5A6Q A;  4D3W A;  3GHN A;  1DGL A;  5I0D A;  2XGX A;  3CU7 A;  1ZX5 A;  4ISR A;  4Y1Y A;  5KXE A;  1CJD A;  1FX5 A;  3WR0 A;  4D7Y A;  1UYZ A;  1WW5 A;  4H55 A;  1PHM A;  1MQT A;  5FYU A;  3ZDS A;  5FPX A;  5HCA A;  3WX5 A;  3ZX7 A;  4QWN A;  5HBA A;  3ACG A;  4CDQ B;  3MBW A;  4Z8B A;  5A1L A;  2VW0 A;  2VO5 A;  4JAA A;  4CEY C;  3K4Z A;  4E2Q A;  4L9B A;  4QX7 A;  2JDP A;  2Y6K A;  1TNR A;  5IAV A;  3R4D B;  1OFN A;  1V70 A;  3ZYR A;  3ZYJ B;  5FBZ A;  4A6O A;  5FDB A;  1MVQ A;  2RR1 2;  3OD4 A;  4K9S A;  3KT1 A;  4AEJ A;  4JGZ C;  4XFH A;  1AXZ A;  3NV3 A;  3PUQ A;  5H9S A;  4DO0 A;  3HD8 B;  2FCT A;  4BQY A;  1N3P A;  1WW4 A;  5F9T A;  2VVF A;  3SXW A;  3T2T A;  5CFD C;  2BNM A;  2E6V A;  4AEM A;  4IE0 A;  3THT A;  4AK3 A;  2VZR A;  2OII A;  4OVE A;  2VOX A;  1SEF A;  1BEV 2;  2KD7 A;  3IDA A;  2H6B A;  3MPP G;  4NRQ A;  1L7L A;  4NPR A;  5FYS A;  5FZ4 A;  3WIN E;  2RS1 3;  5JPN B;  5LCW L;  3RZG A;  4MGY E;  2J1R A;  2FDJ A;  4YVS A;  3U4S A;  3VDD A;  1A8M A;  1J83 A;  2Q1M A;  3ACI A;  3WLU A;  1HN0 A;  1K5M C;  3VBO C;  1SCR A;  2VAU A;  3R0R A;  1D2Q A;  5FXZ A;  4L11 A;  2VQ0 A;  4LBN A;  4MXW B;  3N7L A;  1F35 A;  1ZBA 2;  2WII B;  1YFY A;  4BK5 A;  3BVC A;  3SKV A;  3VBU C;  1APN A;  4GUL A;  3ZXE A;  3IWZ A;  4U2A A;  5F3I A;  2WL1 A;  4K1Y A;  3ZYF A;  2ZX1 A;  4LLF A;  2I07 B;  1WUV A;  1OFS A;  2MPF A;  4XFI A;  3U1X A;  4AFM A;  3K4A A;  1UX7 A;  4BE3 A;  3LE0 A;  3NST A;  1QWR A;  3NJY A;  3ZOI A;  4AI2 A;  1WLD A;  2DVB A;  1W04 A;  3A23 A;  1RJ7 A;  2TUN A;  2HWB 3;  1LCL A;  3VHP A;  1V6I A;  3NAP A;  3I2O A;  5FY9 A;  1EPZ A;  1QJY 2;  1LEC A;  1UPI A;  3IMN A;  2PQQ A;  2JEM A;  3MLJ A;  3N7M A;  4QQL A;  3FWE A;  4R9A A;  3I3M A;  3O0V A;  4NAM A;  1GBG A;  2B9U A;  5EV7 A;  3TN9 2;  2E7T A;  1W6Q A;  4J1W A;  2LTN A;  3WF2 A;  4E2G A;  3T08 A;  4MGT A;  4CP1 A;  2AUY A;  2DCT A;  5FAX A;  2KXL A;  3M3I A;  4UWD A;  3KCX A;  4E8D A;  2OXB A;  2J42 A;  1GMM A;  5FZ9 A;  1SLB A;  2D6K A;  3RYK A;  5C3O A;  3MZH A;  4ARY A;  3OY8 A;  5FY0 A;  2NPI A;  1HKD A;  1ND2 C;  3III A;  2ZGU A;  4AF9 A;  4E9K A;  2F6B A;  2XHK A;  3DYP A;  1NCR B;  1B35 C;  3NNF A;  3IM0 A;  4X6R B;  5CU1 A;  3VZJ A;  1BBT 2;  2RMU 3;  5C33 A;  2GDF A;  1GOF A;  1P8J A;  4PIZ A;  1GNH A;  1F4H A;  3HIF A;  5KHI A;  5LRR A;  1RXG A;  4FQZ A;  1CVN A;  3RZZ A;  4AI8 A;  2DF7 A;  2VH9 A;  1CZV A;  3POE A;  3Q8F A;  4NWW A;  3FHA A;  3GBG A;  3LEG A;  1Q5O A;  2A7A A;  4Q2F A;  2VQA A;  3IIA A;  3D0S A;  3VZK A;  5CAD A;  4FTS A;  1E5S A;  2ET7 A;  3Q8E A;  1EUT A;  4P5H A;  4V2V A;  1JMU B;  4BYY A;  1W6M A;  5FZ7 A;  4JKK A;  4LR4 A;  3ZYI B;  4UFL A;  1A3K A;  2OPK A;  2A6W A;  2DFC A;  2R06 1;  4Q0Q A;  5T52 A;  4H14 A;  3WNM A;  2YY1 A;  4IV1 B;  5BNN A;  1OLR A;  2KR2 A;  4Q29 A;  2VOK A;  3HOB A;  1YJK A;  2GC3 A;  4XFG A;  4AED C;  5EYX A;  1G9B A;  3DEC A;  5IFT A;  5J3U A;  2RM2 3;  3PUS A;  2B4K A;  1YIF A;  3SKJ E;  3OJB A;  1CPM A;  1XE8 A;  4IDZ A;  1OH4 A;  5FJH A;  5FIX A;  5FKB A;  1KIT A;  2IXJ A;  2NN8 A;  1R1A 1;  4BH9 A;  3W5M A;  3UL2 A;  4Y22 B;  3QD6 A;  4YG3 A;  2O8Q A;  4IE7 A;  4QDS A;  1BVV A;  4DOU A;  4G9S B;  1NOV A;  3D0J A;  4L99 A;  2WN2 A;  5DUV A;  5DDJ 1;  2CAU A;  4B29 A;  3SH3 A;  3B94 A;  3LF7 A;  4LEJ A;  5CBL A;  1UOB A;  2VCB A;  3AMH A;  3N36 A;  1GQH A;  3IAP A;  1LNS A;  1VBC 2;  3KD4 A;  3N35 A;  3PVO A;  5L9B A;  4ES9 A;  4QKN A;  2PHL A;  3VZN A;  1YIP A;  4BME A;  3HVD A;  4CUB A;  1D4M 3;  1T2X A;  1UIJ A;  2BGO A;  2MHF A;  2PYT A;  1T6B X;  1LOF A;  3POW A;  4LIT A;  2K2S A;  1BMV 1;  1IS5 A;  4NHK A;  1PGW 1;  5TSW A;  4EN6 B;  2UWC A;  2YG0 A;  4KG8 A;  3UNP A;  1R1Z A;  1WWY A;  1LES A;  5A6X A;  1RUF 3;  1ZRR A;  4IER A;  2C0Z A;  1HRI 2;  4XUT A;  3VKN A;  4FPH A;  4I3P A;  1W2N A;  3A0N A;  3HN1 A;  1DZQ A;  2WRA A;  4DFS A;  2XQX A;  4BOW A;  1DQ6 A;  1NLS A;  5A6Z A;  1R09 3;  2FDH A;  3EMR A;  4TN7 A;  4EE2 A;  3UGH A;  4Q4V 1;  2V4A A;  2QTW B;  1OPO A;  4B1M A;  3L2H A;  3JXS A;  5IAX A;  1HIX A;  2GC0 A;  2A70 A;  1OF4 A;  5LWB A;  1UYX A;  2JDY A;  1DYP A;  3A4U A;  4Q0S A;  2BDR A;  4E4D X;  5FK8 A;  5H9R A;  1TME 1;  3WVJ A;  3CBN A;  1DGR N;  5FPA A;  4ZU4 A;  1GLH A;  4B4R A;  2RS3 2;  4EWA A;  1IHM A;  2EXJ A;  1E5R A;  5A7W A;  3NKG A;  2GND A;  1H30 A;  3KMH A;  4EYU A;  1XPW A;  1G8W A;  4W8J A;  3B69 A;  4IEQ A;  2UU8 A;  3I3Q A;  1W3V A;  1PO1 1;  3B01 A;  1PZ8 A;  5FLJ A;  2E51 A;  4GB3 2;  3OBT A;  3BIW E;  3C7H A;  5GM0 A;  3TYJ A;  1BK0 A;  1VBE 1;  2JDN A;  3DPR C;  4LE4 A;  3AZX A;  1H4G A;  1DQ1 A;  3T3Y A;  4BWO A;  1VBD 1;  4JDN A;  4OHW A;  4Y24 A;  4LO6 B;  2J1U A;  2BYV E;  2PAE A;  3A7Q A;  3CKH A;  1RUG 2;  2IFW A;  2H0B A;  4YVW C;  4OQ9 A;  3ZYP A;  1AR6 1;  5KBF A;  1LHV A;  1TEI A;  2VTX A;  1WGP A;  5C4W B;  1PGL 1;  1PM4 A;  4QXC A;  4RS5 B;  4MYE A;  2GMP A;  1WCU A;  2UY8 A;  4KU7 A;  4JDM A;  1MZE A;  1V6K A;  4WM8 B;  3J7H A;  5L7O C;  1C3H A;  1FV3 A;  1VBA 2;  5FY7 A;  1PO2 2;  2V09 A;  1W8O A;  4P9W A;  1D2S A;  1QEX A;  2AH2 A;  4CEY A;  2X29 A;  3OF1 A;  2ZHM A;  2HKX A;  5E89 A;  4EN8 B;  1AR9 1;  4CDU C;  1HDK A;  2D6N A;  2VZS A;  1MQT B;  3AMQ A;  3WUD A;  4CCL A;  4AHW A;  2W39 A;  3CZU A;  2W47 A;  1DP0 A;  5IYY A;  2ZA9 A;  1PNF A;  5KR7 A;  2XWJ B;  5FY5 A;  4AVS A;  2YPD A;  2I74 A;  2HWC 2;  2ZGN A;  5A7Q A;  4FP2 A;  5LBC A;  4UFH A;  3RI9 A;  2Y60 A;  3W5N A;  2YGL A;  3WW2 A;  5F8P A;  4RQP B;  4Q26 A;  4CP9 A;  1QXR A;  3TBD A;  3NRU A;  1XU1 A;  3AJY A;  5C9A A;  3MI8 A;  2FD8 A;  4LUK A;  1Y9Q A;  3C3V A;  3W59 A;  1R64 A;  2JDM A;  3OYW A;  1JH5 A;  2QZ3 A;  4XIL A;  3WG3 A;  3AYA A;  1UNB A;  2VZO A;  4W6Y A;  4YM3 A;  1ULD A;  2HYX A;  2QJV A;  2WWS A;  2W68 A;  2WZR 2;  1N3Q A;  3KVA A;  1K5M A;  1GKB A;  5FZ0 A;  3IB3 A;  3V56 A;  4RYD A;  1HW5 A;  2CGO A;  4CCN A;  4M0N A;  4CDW B;  2WJS A;  4PF5 A;  4AQS A;  5FP3 A;  4TLF A;  2CAV A;  2Y8K A;  4LBK A;  3WDU A;  4YVS B;  2WYF A;  3VDB A;  1YC6 1;  3D4K A;  2ZPX A;  4I0W B;  3HNY M;  2KM2 A;  2QZ2 A;  4HMZ A;  2XVG A;  4BU2 A;  2W52 A;  1I3H A;  1QNY A;  1OQE A;  2P1B A;  1V6J A;  4TWT A;  5L19 A;  3AXE A;  1QH6 A;  2DCZ A;  1WBL A;  4O9G A;  5FPZ A;  4DEQ A;  4DNY A;  2JEN A;  3MFC A;  4IND A;  4COV A;  3WF4 A;  4XUO A;  2WS9 2;  2DCK A;  2AC1 A;  1OKQ A;  2PHT A;  4Y26 A;  1QJX 2;  1GQP A;  3SCH A;  1RMU 1;  2WFF 1;  5FMB A;  1O5U A;  3U11 A;  1ZRF A;  1CAX A;  3B02 A;  1SBD A;  1HRV 1;  2J1V A;  1COV 1;  3GJA A;  2X05 A;  2W1Q A;  1GR3 A;  4MVT A;  3FN9 A;  5JVV A;  1GIC A;  3T0B A;  1YQ2 A;  1CZT A;  3AP7 A;  4P9L A;  4XBN A;  4O61 A;  4BB3 A;  1JYI A;  3K48 A;  5JI9 A;  3LGR A;  4JKL A;  1PNG A;  3AL6 A;  4LA2 A;  5CFC A;  4KBB A;  3RQ0 A;  3WDT A;  2D44 A;  5FYH A;  5LW9 A;  2DBI A;  3JUU A;  4AEK A;  2WNV A;  1RTV A;  4AFC A;  5E1R A;  3UKV A;  4XTP A;  4QPG B;  3TEX A;  1UZ0 A;  2VQT A;  4RHV 2;  3PUA A;  3PL0 A;  4WM7 B;  1KRI A;  2R1D A;  1B35 A;  5KHK A;  1NA1 A;  4XBQ A;  4MOA A;  3OUI A;  2AEY A;  2WIN B;  2XJV A;  5IW0 A;  2XBO 2;  1H9W A;  1JXN A;  5A3N A;  5L9R A;  3I54 A;  3CHX A;  3OY8 B;  4EJR A;  4L8Q A;  5FBJ A;  3KF3 A;  3GGL A;  1KXG A;  4NN0 A;  5FUP A;  3GDB A;  5I0U A;  3WQ7 A;  5IVF A;  4AGG A;  1BLZ A;  4JGY C;  5F1R A;  5EJZ B;  1OF3 A;  4UFM A;  5LBE A;  2HWE 2;  2Q8C A;  2GNB A;  4CDX A;  5GZF A;  2WLQ A;  3LKJ A;  2X5I A;  4NIA A;  1JOJ A;  3MUZ 1;  1EP0 A;  1N47 A;  1PX3 A;  3LSD A;  3W58 A;  4FPO B;  5JMC A;  4UF0 A;  1STM A;  1V0A A;  5CEH A;  1H1M A;  1JS9 A;  4R4X A;  1BK1 A;  1MS3 A;  3UES A;  3WP5 A;  4YGD A;  1ZZB A;  2WO1 A;  3TB0 A;  1Y9M A;  1VIW B;  2Y6L A;  4NWV A;  2R06 3;  3S7I A;  1XE7 A;  1RUC 2;  1FXZ A;  1E5I A;  2PN5 A;  3RWN A;  4XUP A;  3O1T A;  2F4P A;  4M01 A;  3P3P A;  3JD7 2;  4PLO A;  4MAD A;  4NRO A;  4PDW C;  1BKZ A;  3NJX A;  2YFZ A;  1UMH A;  5CKQ A;  3E6D A;  2WO7 A;  1R1A 3;  1U12 A;  3LA3 A;  3WOG A;  2XJQ A;  2K9Z A;  3HBK A;  1OI6 A;  2G9Z A;  2FZ2 A;  5EWS A;  3O0X A;  1HB1 A;  1WBF A;  3DXU A;  3B7M A;  4LHS A;  5BYN A;  2ORZ A;  3AVS A;  3ILR A;  5DDJ 3;  1D0G A;  1QJU 2;  3KHC A;  1CD3 G;  1QOT A;  1GZ9 A;  4R4Z A;  1TNF A;  3BB6 A;  4YZ3 A;  1JU3 A;  3VBF C;  1MEC 1;  2P3J A;  4OI4 A;  1ZZC A;  4HKL A;  3FHI B;  5DAB A;  1GP6 A;  4XQ4 A;  2CY6 A;  4Q4W 1;  4BQW A;  1UU5 A;  3MIF A;  4NUB A;  4DUX A;  3A0K A;  1KD7 A;  1LTE A;  2YU2 A;  4GMP 0;  1IPS A;  4HBN A;  1FV2 A;  3UKN A;  4CCO A;  5FXX A;  3B3Q E;  4FFG A;  4L92 A;  4R8H A;  4CCK A;  5AVA A;  4MET A;  1C1L A;  5ABJ B;  1CON A;  1DZT A;  1G6N A;  1RIR A;  1SCS A;  1VBB 1;  1VMH A;  2ZGQ A;  4YG0 A;  4I2O A;  3VD5 A;  1DCS A;  2LRP A;  3LEM A;  1ZBE 1;  3DYO A;  4AAX A;  5FO7 B;  1O7F A;  5F6K A;  3F95 A;  2A3W A;  5I91 A;  1AYN 3;  3M2M A;  2XH6 A;  5K7P A;  2W46 A;  5A3W A;  1U0A A;  4N43 C;  1JHJ A;  4Q4V 3;  3VDC A;  2IVI B;  1VPH A;  1EV1 2;  2PXJ A;  3DXT A;  4FPY A;  5DUW A;  3RMX A;  4DXT A;  1I1E A;  4ITC A;  4W4Z A;  5C6C A;  5FYC A;  2A1X A;  3POI A;  5FP9 A;  3I4I A;  2Y38 A;  4C0B A;  3I2J A;  4MXW A;  4QKD A;  4YW3 A;  4PHZ A;  1AZD A;  1C4R A;  1WMX A;  4N53 C;  4QPW A;  5D8A B;  3VL9 A;  5JXG A;  1NLQ A;  1NXM A;  4LOT A;  1UCX A;  1ENQ A;  4GKY A;  1UY1 A;  2WNU B;  2PA7 A;  5E88 A;  1IKP A;  1W99 A;  3AKR A;  3DPR A;  3NMB A;  4LKE A;  5AC9 1;  3POS A;  1FT9 A;  3CNA A;  2E63 A;  5HV0 A;  4BZ4 A;  5FK7 A;  2RR1 1;  1OKO A;  1QGL A;  2IXC A;  4ES8 A;  1PO1 3;  4TLG A;  4IEU A;  1RVF 2;  2WYS A;  3WEZ A;  1IPJ A;  1VMF A;  4IL7 A;  3AMN A;  3ZXA C;  2V73 A;  5F2W A;  1IG3 A;  4OHV A;  3HQR A;  4WBB A;  4YVW A;  4RA0 A;  1VBE 3;  2QKD A;  1LAJ A;  1W03 A;  2WBK A;  4IEV A;  4AFD A;  1LU1 A;  3VD7 A;  1VBD 3;  3WNO A;  4YM2 A;  1ENX A;  4R9C A;  2Y0I A;  4QAW A;  3U37 A;  1NCQ C;  5CA6 A;  1NUK A;  5JLV A;  3MIC A;  3NL1 A;  4LHL A;  4LKD A;  5L7O A;  2FDI A;  1UZZ A;  1BEV 1;  3AX4 A;  3CF6 E;  4GWM A;  2VCC A;  4XUQ A;  5IT6 A;  1UXX X;  4Y1Z A;  2X8K A;  5LAT A;  5F3G A;  1B09 A;  1ZM1 A;  3D82 A;  5GLZ A;  4DY3 A;  1CAW A;  2DU1 A;  2Y0O A;  4CDU A;  2N7G A;  4FAG A;  2VZ1 A;  1Q56 A;  3T2Q A;  2WT0 A;  4UFI A;  5F5Q A;  5BNP C;  1Z7S 2;  4NJ4 A;  1ZBA 1;  1NCR A;  3ES4 A;  5AFB A;  2OX0 A;  4E4S A;  4CEY B;  1G7Y A;  1X9P A;  3ALQ A;  3DN7 A;  1AR9 3;  3O1R A;  2ZEY A;  4AFA A;  3O1P A;  2CV6 A;  3TWI A;  2WA3 A;  1UL9 A;  2DTY A;  5A3U A;  1M4W A;  5F5I A;  3BI3 A;  1OUS A;  1YQ8 A;  2E32 A;  2JX9 A;  3LOB A;  2YC2 A;  2VM9 A;  4Q4Y 2;  3HNB M;  4JTN A;  2ARE A;  2D3S A;  3AP6 A;  5GLW A;  4JGZ B;  5JI7 A;  2O8O A;  4RN5 A;  1QJY 1;  2JKX A;  1DYK A;  3RSJ A;  4AHZ A;  3KM5 A;  1RGS A;  1F9K A;  3I2G A;  1KDM A;  2CYF A;  3V65 A;  4HKO A;  4CXX A;  3I3E A;  4XYX A;  4OMC A;  5CFD B;  1FPN 1;  1YXW A;  3TN9 1;  3UGG A;  4IV1 A;  4ASL A;  2ZGL A;  3THD A;  1CAU A;  4D6S A;  3OBR A;  2VG9 A;  1AR8 3;  3MW2 A;  3PTR B;  2QDR A;  3VUO A;  4OQ8 A;  4COU A;  1PVC 2;  1W2O A;  1OD5 A;  1W8N A;  2VNR A;  4FQ4 A;  4P9X A;  4AZZ A;  4FTB A;  1NXD 1;  2IXL A;  2WWU A;  4QQP A;  4RSU A;  4AWD A;  1K5M B;  4HOO A;  1SDD B;  4IV3 C;  3LQC A;  3WDX A;  3CJI C;  4ATE A;  5F37 A;  3GJB A;  2BVV A;  3LFM A;  4I3G A;  3RDI A;  3URF A;  2X10 A;  5C8W A;  4ZU7 A;  1VLN A;  2YPJ A;  4U36 A;  4WZC A;  1DQ5 A;  3K75 B;  4HG6 B;  2XWB B;  3QAC A;  3VBU B;  5DG2 A;  3H3U A;  1OXC A;  1BBT 1;  2EAK A;  5C3P A;  3HEI A;  3VD9 A;  2NP0 A;  2BNN A;  4XFA A;  3ZFE C;  3GM8 A;  3CJX A;  3ES1 A;  5J96 B;  2OQ7 A;  5FRE A;  1NZI A;  4XJ9 A;  3HBZ A;  3LWC A;  3MIH A;  4Z2A A;  1C8M 1;  2C6S A;  3GHM A;  4XFF A;  2HWF 2;  3UGF A;  3ITQ A;  4QQH A;  1JOP A;  4HON A;  5FYI A;  5FZO B;  5CB7 A;  3WNK A;  1W8F A;  3I3B A;  2ZMN A;  2FQP A;  2WFF 3;  3I59 B;  3S7E A;  1OSG A;  1XRU A;  2B45 X;  1HRV 3;  1PZ9 A;  1COV 3;  3R05 A;  4XC9 A;  1CAX B;  5FZI A;  3DUI A;  5A32 A;  3X29 B;  1GOG A;  4F83 A;  4LMF A;  4UT5 A;  5LA9 A;  1WLT A;  3LCP A;  3M3Q A;  4XHB A;  1U5X A;  1UIK A;  5IVY A;  2XL7 A;  3IKW A;  2P3Y A;  5JSO A;  1VRH 1;  1TG7 A;  3WF1 A;  4PQQ A;  4GD4 A;  1ULF A;  2QFE A;  5C5T A;  3FMG A;  4IE4 A;  4AQ2 A;  3LD8 A;  5IHR A;  3VD4 A;  3VZL A;  1ND2 B;  3I2K A;  1X9T A;  5I8T A;  1OQ1 A;  4I02 A;  5GZC A;  2C5D A;  3FL7 A;  3ZMO A;  2XUM A;  5JMO A;  2GSY A;  2W1W A;  4GWN A;  3UET A;  2O1Q A;  1SBF A;  1B35 B;  2J22 A;  3H8O A;  4S2F A;  4GXL A;  2JG8 C;  2RS5 2;  1QKQ A;  1CAV A;  4X8N A;  4BHP A;  2ZTN A;  5BUV A;  5I0S A;  3IDC B;  4QHB A;  1SZB A;  1WW7 A;  1VBC 1;  4Q0V A;  3V64 A;  3TEY A;  4AL9 A;  2B9V A;  2W3J A;  5CVR A;  3E6B A;  3KCC A;  3I3D A;  2EAA A;  3WDV A;  1H1I A;  3VHR A;  3AP5 A;  3BGA A;  3P6B A;  4SLI A;  4XZU G;  2EXH A;  2VC9 A;  2F17 A;  5JIU A;  2NM1 A;  3POF A;  2XUE A;  4Q4X 2;  4J6G A;  1HRI 1;  1NAE A;  2BWC A;  1U5Y A;  3K77 A;  5EIY B;  3N9O A;  2ZEZ A;  3N9N A;  4D0Q A;  5FCC A;  4QGN A;  4XFC A;  2R04 3;  2SLI A;  4AED B;  3C2U A;  3ON7 A;  1AJK A;  4A3X A;  4V2W A;  2Q4S A;  1MS0 A;  1OHF A;  3KV6 A;  4RS5 A;  2PLV 2;  4GQ7 A;  4ATF A;  2R07 2;  5GKA C;  3MFA A;  1A34 A;  1ASJ 1;  4I09 A;  4N7U A;  2BUK A;  4WM8 A;  4WVM A;  5FJK A;  5FZM A;  3R6S A;  1AL2 2;  1V00 A;  1DYO A;  1W9Y A;  2QDN A;  5DUU A;  2VXR A;  2JG9 C;  2RS3 1;  2VCA A;  3SHR A;  4H3W A;  1F5F A;  4L2N A;  4MHR A;  2GH8 A;  4AVA A;  1PM7 A;  3OTF A;  3RZM A;  3MGU A;  5JSP A;  4BQ2 A;  3D5O A;  4XF4 A;  4YW4 A;  4CRQ A;  3MLK A;  4XZP A;  3S30 A;  4XAB A;  2WNO A;  1W8H A;  4XF1 A;  1RJ8 A;  4NO4 A;  3BOD A;  3WCR A;  4KWJ A;  1WME A;  3CEW A;  1MEC 3;  1G9F A;  2W92 A;  1S2B A;  3J26 N;  1MVE A;  4N9H A;  4PJY A;  4GB3 1;  3H8R A;  1H8T C;  2E7A A;  1RUD 2;  1V6L A;  4E4H A;  1XNK A;  2WT2 A;  4Q4W 3;  1H9P A;  4JQT A;  3KWV A;  4RQP A;  1ENR A;  1TE1 B;  4JKM A;  5ISL A;  4M4R A;  2GME A;  1YQ6 A;  2A6X A;  1ULP A;  3TEZ A;  2UWA A;  1RUG 1;  1XBF A;  3ACF A;  4QHZ A;  2P17 A;  2PHU A;  3ORJ A;  5IAT A;  1LGC A;  5F32 A;  1VBB 3;  1CJP A;  2OZ6 A;  5F6L B;  1OVS A;  1JUI A;  3MDP A;  2EIB A;  1ZBE 3;  4LBQ B;  2AEZ A;  4PI2 A;  5FMO L;  1IKQ A;  1TVG A;  4CDW A;  2C9A A;  1BCX A;  1A6C A;  1OVP A;  1SLC A;  1IPK A;  1HX6 A;  3AZY A;  1VBA 1;  4IE5 A;  3OGR A;  2EVX A;  1PO2 1;  2OPW A;  2ZKL A;  1GSL A;  2YBK A;  2XVL A;  3LPG A;  4PBO A;  4C1X A;  5CAZ A;  3GZU C;  1GZW B;  4LA3 A;  3KV5 A;  5GLT A;  1UF2 C;  2VBD A;  3S57 A;  3RZJ A;  3J8F 2;  4Z2W A;  4GWI A;  1CIY A;  1ST8 A;  3RI8 A;  2F4L A;  1EPW A;  5KXD A;  5I8S A;  3OGJ A;  2XPJ A;  4ISQ A;  4XTM A;  2Y34 A;  4ZKT B;  1WLC A;  4UW3 A;  5LEK A;  2HWC 1;  4GWJ A;  2DVF A;  1ULE A;  3KV4 A;  3PUH A;  4LHK A;  5DG1 A;  5AC9 3;  3AC0 A;  2Z79 A;  2BU9 A;  3AXD A;  3DPR B;  3GNE A;  1QH7 A;  3N9Q A;  2RR1 3;  1UYY A;  2J1E A;  4D7T A;  3DEM A;  4Y5T A;  1H2M A;  2FHR A;  3POY A;  4KU8 A;  3UT0 A;  2RV9 A;  4CUG A;  4GJY A;  4XF9 A;  4HLT A;  3VL8 A;  4IUG A;  2RE9 A;  1GUI A;  4YVW B;  4QPI C;  3OUJ A;  1LHU A;  1HXS 2;  5JPM B;  2WZR 1;  1OLM E;  1X8E A;  3BOP A;  3M7A A;  5B4X A;  1NE4 A;  1YUD A;  1BXH A;  2CWM A;  2K46 A;  1BEV 3;  2QCS B;  4WVW A;  3MUY 1;  4QPG A;  2GC1 A;  5L7O B;  3O5S A;  3OPW A;  2P3K A;  4WV8 A;  5FV3 A;  3E6C C;  5EQU A;  2RMU 2;  4WM7 A;  4YGE A;  5IK4 A;  1OA4 A;  3O1U A;  2Y6H A;  4XJW A;  2FMY A;  1CAW B;  3FUQ A;  3DGT A;  3GAL A;  4CDU B;  4W6W A;  1ODM A;  4GMP 3;  2G1M A;  3ILN A;  1HQL A;  1PZ7 A;  5FXW A;  1OOP C;  4Q1P A;  2WS9 1;  4Y1X A;  4A44 A;  4LLO A;  3I97 A;  3CZJ A;  5KWR A;  1QJX 1;  1MS5 A;  1QOS A;  2MEV 2;  2MNG A;  1FMD 1;  5KHH A;  1UXZ A;  1S2K A;  2A3X A;  1ND3 A;  2PQS A;  1KQR A;  5FXV A;  3ZR6 A;  5J48 A;  3WZ1 A;  4OZX A;  3CDZ B;  2C26 A;  4LUM A;  4NPM A;  1W3X A;  1W6P A;  3Q8C A;  4NVP A;  1V6N A;  3VLB B;  3ZPY A;  1FPN 3;  3GF6 A;  3TN9 3;  5LK5 A;  3Q8B A;  4XFB A;  5D21 A;  1XYN A;  2GN3 A;  3CJI A;  1CAU B;  5A3T A;  2R6Q A;  3NW4 A;  4ASK A;  5FMO S;  4ORF A;  4RHV 1;  4GAZ A;  5FWJ A;  3HT2 A;  3TNQ A;  2B42 B;  4RFT 0;  3IN9 A;  2JJ6 A;  1JZ8 A;  4IEO A;  4XET A;  3VV1 A;  4W65 A;  3NNG A;  1GYK A;  1H8V A;  2XBO 1;  3AZW A;  1REF A;  4BIS A;  1Y7B A;  3EHK A;  1YFU A;  3ECQ A;  4FXK B;  3ZFE A;  1DHK B;  1G9C A;  3WP4 A;  4IGP A;  3ZSM A;  3OEB A;  2ETE A;  2BVB A;  4XIO A;  3ZFF C;  1UMI A;  3WG2 A;  3KS7 A;  3KHB A;  1MZ5 A;  1RUF 2;  2ZXQ A;  4XF0 A;  1QU0 A;  4A4A A;  4YZ5 A;  1QJE A;  2HWE 1;  4UW4 A;  4CUC A;  3IBM A;  2XR4 A;  1U5I A;  4QX2 A;  1S0J A;  4QDQ A;  2DVA A;  1C8M 3;  2ZHL A;  1TMF 2;  3W20 A;  4DIN B;  3KQR A;  5A3M A;  1US3 A;  5B4N A;  1RHI 2;  2A73 B;  4YG6 A;  2RJL A;  1SDW A;  4JRL A;  2Y6F A;  5ABJ A;  3INA A;  1H6X A;  2JDZ A;  3IZO A;  1W6N B;  1BQP A;  4KWK A;  1RUC 1;  3MLL A;  5A32 B;  4BK4 A;  1YRZ A;  4B8E A;  3JD7 1;  4EZ4 A;  3VDA A;  3RYP A;  2BGP A;  4QM9 A;  3H50 A;  4IW3 A;  3ZYH A;  4A3Z A;  1EY2 A;  1VRH 3;  5FZ3 A;  4C0H A;  2XQR A;  2B8M A;  3VBS C;  3MHZ A;  3LIH A;  1GP5 A;  3BIE A;  2OT7 A;  2JG8 A;  2PHW A;  5EP9 A;  2B7Y A;  1FNY A;  3PVB B;  3ZSE A;  2D5F A;  2WKK A;  1S0E A;  5D8A A;  2IZW A;  5KXC A;  3HQU A;  3KF5 A;  4COW A;  1NQD A;  1QJU 1;  2Q8E A;  4JGY B;  5CG9 A;  5FZF A;  4OHX A;  4NHM A;  3ZLI A;  1C28 A;  1CAV B;  2GP5 A;  3HWJ A;  2WNU A;  3BU0 A;  1VBC 3;  3VN4 A;  3T2O A;  4EWE A;  2IWG B;  2W2I A;  4FXG B;  3NV4 A;  4Y20 B;  3PIG A;  1J59 A;  1JU4 A;  5L9V A;  3EB7 A;  2VQU A;  2WNE A;  2Z4F A;  5K4L A;  1JYW A;  1S1A A;  3ZSJ A;  3AL5 A;  4K8F A;  3ZXD A;  1OPM A;  3H3Z A;  4H7M A;  1SFY A;  5CYY A;  1UO9 A;  3I2I A;  5I0T A;  2VZV A;  4AR2 A;  1UU4 A;  3THC A;  1HRI 3;  1W2U A;  3BOW A;  1IS4 A;  2A6Y A;  2YFU A;  1ODN A;  4YW6 A;  3WW1 A;  3TEW A;  1NG0 A;  2RDQ A;  2ZMK A;  3D6E A;  2ZAB A;  1SQ4 A;  2JB4 A;  4PDW B;  3USU A;  2FMD A;  4H2A A;  5C8C C;  1LU2 A;  2IXH A;  2VZQ A;  3OSD A;  3LDR A;  1EV1 1;  1ASJ 3;  2AEN A;  4AI0 A;  4GH4 C;  4LBL A;  1WMD A;  3LEI A;  3WG4 A;  5JIA A;  4BLI A;  4FFH A;  2D3R A;  3IDE A;  4WVM B;  2BEO A;  2D43 A;  2VVE A;  4B1L A;  2J1T A;  2BP6 A;  3M4F A;  4JDO A;  4Q5O A;  1SAC A;  3WF0 A;  4C91 A;  1PGS A;  2TEP A;  5ACA 1;  2RS3 3;  4NHY A;  5A7P A;  4DRR A;  4ASM B;  3VBF B;  2DVG A;  2EA7 A;  2VZU A;  4RL7 A;  1K3I A;  1PMJ X;  1UOG A;  1VB4 A;  3MF9 A;  5IVC A;  2VBP A;  1W0P A;  3PNA A;  4AVB A;  1F4A A;  1PIV 2;  2EXK A;  1UW8 A;  1RVF 1;  4QX8 A;  4JGZ A;  4GB3 3;  3ZN6 B;  4IES A;  4XJU A;  4HSL A;  3RNS A;  4LO8 A;  3GZT B;  2E33 A;  2V72 A;  1DGR A;  3HPN A;  2A71 A;  3M3E A;  4XJ8 A;  5CFD A;  1FOD 2;  3ZSK A;  3QLQ A;  1RUG 3;  1LEM A;  5A3L A;  1ACC A;  5FUN A;  3NJZ A;  1BHG A;  1RUH 2;  4ZY9 A;  1ZZ6 A;  4HK9 A;  3FX3 A;  5D2A A;  3GZA A;  3LIG A;  5GLU A;  2EID A;  2RDS A;  4N43 B;  4J1X A;  4Q0U A;  5T5O A;  5SV8 A;  4MG2 A;  5ANN A;  4IEZ A;  3SH4 A;  3VBO A;  1E5H A;  5FO9 B;  1HB4 A;  4D94 A;  2GZW A;  3WP6 A;  1VBA 3;  2Q8O A;  1O3Q A;  1PO2 3;  2WSV A;  1N3O A;  2ADE A;  1Z7S 1;  4N53 B;  1RIN A;  3LA7 A;  1UY3 A;  4QHO A;  3UJQ A;  2ZZQ A;  4OZO A;  3VBU A;  2DUP A;  1ZNP A;  2R0F A;  2O14 A;  5I0R A;  3W9A A;  2ADD A;  2BGC A;  2D98 A;  4PIY A;  3WCS A;  4I01 A;  4DMI A;  3S0M A;  2QQO A;  5HV4 A;  2X53 S;  2A6Z A;  4Q4Y 1;  3EBR A;  4A7Y A;  1LUL A;  1W8Z A;  2HWC 3;  2VNO A;  1O59 A;  2ENR A;  3I2D A;  2GAU A;  4LPL A;  5FZO A;  5FTT C;  1W2A X;  3ILF A;  1VRB A;  1NYW A;  1RUJ 2;  3I59 A;  4OCT A;  4CCC A;  3BYW A;  5M0T A;  4K21 A;  3OG2 A;  4OUL A;  4AFB A;  1NCQ B;  1LOE A;  2PFW A;  4JRA A;  4KI5 M;  1I9R A;  2AR6 A;  3L2Y A;  3WHT A;  5FR3 A;  5T3N A;  1BVP 1;  1A78 A;  3CO2 A;  1Z0H A;  2ZHK A;  4P5Y A;  3S5A A;  1PVC 1;  4DXS A;  2EIG A;  2WZR 3;  3FHQ A;  4IQP A;  2JXA A;  5FUI A;  4CCJ A;  3WT3 A;  4FP3 A;  2VUD A;  2VUC A;  1ND2 A;  1RUE 2;  1YLL A;  3FLT A;  3KLS A;  3POJ A;  3V0A A;  1OT5 A;  2JDU A;  3ZXJ A;  2JIJ A;  1UKR A;  1X33 A;  4E2S A;  2B5H A;  5BNP B;  5K0U C;  4XCB A;  1G9A A;  2ZEW A;  2CGN A;  4CXY A;  2ZEX A;  1O3R A;  2PHR A;  1SFP A;  2VMD A;  3WF3 A;  2XML A;  5K8S A;  3ROU A;  2P4E A;  4QX3 A;  3UJO A;  4QKB A;  2CWS A;  4PI0 A;  3HQX A;  1AF9 A;  3WQ1 A;  5IVJ A;  3TNP B;  4A41 A;  3FBM A;  3JB4 C;  2HWF 1;  4EN0 A;  3H8X A;  1LOC A;  1PX4 A;  5FYT A;  4IET A;  1QJX 3;  1WCS A;  4AE2 A;  1XYO A;  3IT8 A;  2R1B A;  1I5P A;  2VUA A;  3IDB B;  3PLQ A;  3VKL A;  1FMD 3;  3EXU A;  4YLZ A;  3N7K A;  3UK9 A;  4Q8L A;  1ND3 B;  2DU0 A;  4AED A;  5DQ0 A;  1OA2 A;  2RDR A;  3SEE A;  1R08 2;  1SFN A;  1W6P B;  1CIW A;  4UYB A;  1V9U 2;  2D6M A;  5HXM A;  1QQP 2;  4IV3 B;  3S6P A;  5FP4 A;  2I45 A;  3CJI B;  2CNA A;  2VU9 A;  4IEP A;  4FPF A;  1UU6 A;  4A2U A;  3KGZ A;  2RS5 1;  1QNW A;  2PHF A;  3NQH A;  5J1X A;  2XLF A;  1O5L A;  4X6Q B;  2DUO A;  3U0Z A;  4QDR A;  5FLH A;  2C1F A;  1TZO A;  2AYH A;  3T2P A;  4ET7 A;  4OHZ A;  1EYB A;  2XXZ A;  4SBV A;  3ZFE B;  2VOW A;  4XCA A;  4CPB A;  2QVS B;  5ERL A;  4M3C E;  2FDG A;  4PLM A;  2D93 A;  4XW3 A;  5JOZ A;  3MW4 A;  2CU5 A;  4EV0 A;  1LGB A;  4JX0 A;  1ALY A;  1PMI A;  2EAL A;  4M00 A;  4ZON A;  2WAB A;  3VKF C;  4Q4X 1;  4UW5 A;  1AYN 2;  4K6B A;  5FZ6 A;  2NMO A;  4AG4 A;  4NE9 A;  3BPZ A;  1ZZ7 A;  4FBF A;  4Y1V A;  2H6C A;  2P3I A;  3ZFG C;  1LOG A;  4ERO A;  4FTE A;  1UY0 A;  1HJF A;  3VZO A;  3OBZ A;  2BJS A;  3RJR A;  2HEY F;  1XND A;  4W50 A;  2BER A;  3VBS A;  1YEW A;  2XVK A;  1RUC 3;  2PLV 1;  4E4Z A;  2R07 1;  5JWP A;  1JYT A;  2XG3 A;  2WQ4 A;  4LBQ A;  3JD7 3;  2QQP A;  2G4I A;  3MPB A;  3A22 A;  4QU1 A;  4CUA A;  3LZZ A;  3BU7 A;  1GOH A;  1ENS A;  1MS4 A;  1CN1 A;  1W0O A;  5LAS A;  1AL2 1;  4I0B A;  2BOJ A;  4IGO A;  3VZM A;  3EJK A;  1GZW A;  3BN6 A;  4MUV A;  1SBE A;  2JG8 B;  3ZYB A;  4S2G A;  2G9F A;  3MIE A;  2AGS A;  4G4F A;  4XUN A;  1K45 A;  5BPX A;  4JZR A;  3O0W A;  1TME 3;  5J36 A;  1VBE 2;  1SG3 A;  1MS8 A;  5A33 A;  4LTA A;  5C3R A;  3SQO A;  4FFI A;  1RUD 1;  2D3P A;  3ETP A;  1UY2 A;  5E8A A;  1GFF 2;  3RZK A;  3WQB A;  3DKQ A;  3O7O A;  4AQ6 A;  4A7K A;  2JDA A;  2VGD A;  4Z1V A;  3M3O A;  2V5Y A;  2VOT A;  3M3C A;  5JDB A;  3LA2 A;  4KMQ A;  1PVX A;  4XAE A;  3FLP A;  1K42 A;  3FLR A;  4AI1 A;  3FJS A;  4DXZ A;  4RGK A;  2ZS6 B;  3CL1 A;  3O1V A;  3RZL A;  4GH4 A;  1KGY A;  3B9C A;  2R7E B;  4HVR A;  1AYM 2;  4XOG A;  3VDD C;  1RB8 G;  4KWL A;  4MGI E;  2PMW B;  4HPK B;  1QDC A;  4O65 A;  1XXN A;  4LO4 B;  1POV 0;  3W21 A;  4OUS A;  3WQ0 A;  3MV1 1;  1AXY A;  1AR6 3;  1AR9 2;  5JSR A;  5BV6 A;  4PCR A;  2E7Q A;  3USU B;  4BXF A;  1EV1 3;  3LAG A;  2YBS A;  2JG9 B;  4IEY A;  4HAN A;  4MGK E;  1HJG A;  4A7Z A;  3J8F 1;  1RUI 2;  1AX1 A;  1OMI A;  2CHH A;  1J1T A;  2BPA 2;  3ZDV A;  3C7F A;  3H7J A;  3B00 A;  5ACA 3;  1EAH 2;  4CU8 A;  1OA3 A;  2P6C A;  1SLT A;  2WFP A;  2EIE A;  4JV4 A;  2CDO A;  2VR4 A;  3K46 A;  5KHJ A;  5KXB A;  1H8T B;  3JBG 2;  1K12 A;  3NAP C;  4FPE A;  2QQJ A;  2JEC A;  1AR8 2;  3C7O A;  1XE0 A;  2B46 X;  4FOY A;  4LE3 A;  5F5C A;  1D0H A;  3UYJ A;  2FBE A;  1ZZ8 A;  1RVF 3;  4Y5Z 0;  1US2 A;  4BM8 A;  1C1F A;  5BNO C;  2A6V A;  3ZXK A;  4XE9 A;  5T50 A;  1V6M A;  4K20 A;  4BIO A;  4YSF A;  3GCX A;  4XXP A;  1OUR A;  2R16 A;  2ZAH A;  4NR1 A;  4FSJ A;  1HXS 1;  5FY8 A;  2RG4 A;  3O1M A;  1F8V A;  1BZW A;  3KSC A;  4XVH A;  3PJY A;  3J9S A;  2ZOE B;  4LK7 A;  1I6X A;  4OLL A;  3U4X A;  3IPV B;  2JD4 A;  2RMU 1;  2Z69 A;  4P9G A;  4URT A;  3N9P A;  1GU3 A;  1H4H A;  2WO3 A;  3N7J A;  4UW6 A;  1D7P M;  2FCV A;  1AR7 2;  3I8T A;  5E16 A;  1F15 A;  4OUE A;  3VBO B;  2WWJ A;  3JB8 A;  3H8U A;  4DPN A;  4MX3 A;  3VBH C;  3WSO A;  5E6H A;  1O4Y A;  1Z7S 3;  4QXH A;  3SCG A;  5FPV A;  4F8A A;  2J1A A;  2YUE A;  3M70 A;  3RZH A;  3CMG A;  1LHN A;  2BWA A;  4HZF A;  1W0N A;  1HN1 A;  1COV 2;  4RD7 A;  3KT7 A;  1Z78 A;  2Q5T A;  2QNK A;  2CSG A;  1LOD A;  1W6O A;  2YU1 A;  1F5J A;  2YC4 A;  3BAL A;  2QQK A;  3FE5 A;  2MEV 1;  4Q4Y 3;  1XQN A;  1LOA A;  4QT6 A;  2VZT A;  4LK6 A;  4UFK A;  4AAP A;  1POV 1;  1ULO A;  4AOC A;  3ABZ A;  4MV2 A;  2OUJ A;  4YW7 A;  2HWD 2;  5BNN C;  1UZV A;  3IAQ A;  2BTV C;  3K3N A;  1RMU 3;  2WSU A;  3RVH A;  2ILM A;  4QPI B;  4BXS V;  3BTA A;  2NMN A;  1O6U A;  5FY4 A;  1W6N A;  5FZE A;  1ZA4 A;  1MZ6 A;  1AUY A;  1GQG A;  4LBM A;  1ZA7 A;  5LBF A;  4PT6 A;  5APA A;  4P08 A;  3QCW A;  2Y64 A;  4N8M A;  2VCM A;  2HBT A;  4MH0 E;  5C3S A;  1PVC 3;  2QQN A;  3APB A;  5IVB A;  1X50 A;  1F31 A;  3KZ4 C;  4Z82 A;  1JHN A;  3ENR A;  3KB5 A;  3NNL A;  1VJ2 A;  1S4C A;  2HLE A;  3E5Q A;  1G9D A;  4LT5 A;  2Y6J A;  1J3Q A;  4XDQ A;  3PIJ A;  3NV2 A;  5FYZ A;  5IFP A;  1HB2 A;  2Y33 A;  3V0A B;  4L97 A;  1JOD A;  3BTY A;  3PTY A;  4QM8 A;  5LBB A;  3OGS A;  1V6O A;  1HLC A;  4JGY A;  4LIV A;  1RUF 1;  4QB1 A;  1OOP B;  5GZD A;  2JE9 A;  1GWK A;  2CTV A;  3JZV A;  1LOF C;  4OUM A;  3F2Z A;  4DUV A;  1RED A;  2R04 2;  2DBN A;  2XJR A;  4CP0 A;  1FAT A;  4M0H A;  2R32 A;  3MIG A;  3RRD A;  1EUU A;  1GAN A;  4Y20 A;  1AJO A;  1AVB A;  3LEK A;  5LZ6 A;  1TMF 1;  2HWF 3;  2RVA A;  4BA6 A;  5FP8 A;  2GH2 A;  2SBA A;  1VMJ A;  1RHI 1;  4KGG A;  3ZXF A;  4HXC A;  2RDN A;  4CU6 A;  3AK0 A;  1X8M A;  3DKW A;  1YI7 A;  1ONA A;  4N9I A;  4LKF A;  3AM2 A;  3O1O A;  5HCH A;  2JIC A;  4NHL A;  5JOX A;  3VKO A;  4N7I A;  4PDW A;  2DUR A;  2ZCW A;  1YO8 A;  1S0B A;  1BYH A;  1VR3 A;  4QGM A;  1ZVF A;  1MAC A;  3H42 B;  4RR3 C;  3H1W A;  1JZ3 A;  2QQV A;  2A75 A;  1YI9 A;  3M8L A;  3T1M A;  3ZFF B;  2ZHN A;  4MXV A;  1JZ6 A;  2R0H A;  3MYX A;  3WY6 A;  2XHN A;  2D40 A;  1YYN A;  1ZRI A;  3T1L A;  2RS5 3;  3N4M A;  2NZ9 A;  1WCQ A;  3WNX A;  1UAI A;  3VBF A;  1GNY A;  2TNF A;  2DTW A;  1CX4 A;  1JZ7 A;  3I49 A;  4YZ1 A; 
#chains in the Genus database with same CATH homology
 4N8M A;  2VTX A;  1XE0 A;  5EHD A;  3T30 A;  4CA9 A;  1XB9 A;  2VTX J;  1NLQ A;  1K5J A;  2P1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...