1XB9A

The structure and function of xenopus no38-core, a histone chaperone in the nucleolus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
SQNFLFGCELKADKKEYSFKVEDDENEHQLSLRTVSLGASAKDELHVVEAEGINYEGKTIKIALASLKPSVQPTVSLGGFEITPPVILRLKSGSGPVYVSGQHLVALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure and Function of Xenopus NO38-Core, a Histone Chaperone in the Nucleolus.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Chaperone
molecule keywords Nucleophosmin
total genus 14
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 1xb9A00
1XE0A 4N8MA 1K5JA 3T30A 1XB9A 2VTXA 2VTXJ 4CA9A 1NLQA 2P1BA 5EHDA
chains in the Genus database with same CATH superfamily
1PO13 5F37A 1DQ5A 3PJYA 4TYSA 3JU9A 2GH8A 3ZFFB 2FDIA 4AVAA 3LIHA 5I0UA 4K7JA 3ZR6A 4AI8A 3S7IA 5DXDA 1W6MB 2XH6A 2OW4A 5LK5A 3CJIB 5C3SA 2P3YA 2BTVC 5C3RA 3D4KA 3TYJA 4Q4W3 3KMHA 4CP9A 4LHNA 1W3XA 1F5JA 1GV9A 5B2GB 2B46X 1US2A 3CJXA 2R0HA 3POSA 3WDWA 1OI6A 2XKOA 3IMNA 1DHKB 2HEYF 3OBTA 4XAAA 2Y26A 4XZPA 4YZ3A 1W0PA 3RWKX 4QX0A 2JG9B 2WDBA 1LGNA 4N43A 4BMEA 1ASJ3 3POIA 2FHRA 2V5DA 3HR9A 3WW1A 3BOWA 3OJBA 3ZVXA 3VZOA 1WW5A 5A3PA 4XYXA 5EJZB 3RFRA 3THTA 4GMP1 2WS92 4Q0VA 3VBOB 2B39A 3TN92 1H2MA 3AXEA 3N9QA 4AXOA 3F2ZA 4LK7A 4YW1A 5LCWL 4L99A 5L9BA 5FY4A 3N9NA 1UYPA 2XWJB 2LRPA 4HPKA 4P08A 2DFCA 1ODMA 3WP3A 5FPBA 5L36A 1KXGA 4HBNA 1OOPB 4A3XA 1NXMA 4LBLA 4BK4A 5C6CA 3HN3A 1BLZA 2VZVA 2WRAA 4XBQA 1K45A 2R7EB 4GWJA 2HWC3 5T54A 1STMA 3CJIC 2ZX1A 3WV6A 3EYPA 4QD2A 3WXPA 1SLBA 2JJ6A 4MGTA 1SBFA 3OUHA 3IT8A 3MLJA 1RUC2 2XBO1 2BEOA 2R071 2VXJA 4BDVB 5FP3A 5F3EA 3WW4A 4ZS2A 5FKCA 5KHKA 1S0GA 3OD4A 5F6KA 3VBSB 3GNEA 1GZ9A 5JZGB 1JZ8A 3UETA 4E27A 3DGTA 2LW8A 1JZ7A 3AVSA 4MGKE 1ULPA 3U0ZA 3OBZA 1UZVA 1WLCA 3O14A 4CVUA 4LQRA 4RR3C 2AZ5A 1W8OA 2WZPP 4PIXA 1G9FA 2B42B 3ILNA 3LWCA 4GJZA 1F2NA 4GH4C 4LLOA 1UY1A 1B35A 4QPYA 2ZJCA 5LA9A 1RUE3 2EAAA 3FUQA 4CDWB 4XOGA 4N53C 4AI3A 3BUCA 4AVSA 1RHI1 2WO7A 1ZZ8A 2IVIB 2PAMA 4GKXA 4BLIA 4EWDA 2ORZA 2JDUA 4AG4A 3KV4A 2GALA 1RUNA 1H6XA 1FYUA 3A21A 2CNAA 4RGKA 3A22A 5GZGA 3RSJA 3AJZA 1CGPA 2O8QA 2WLPA 5DG1A 3BIWE 4K1YA 4XJ9A 1AR82 4AHYA 2IUWA 3JQWA 3LA2A 3OY8A 1MQTB 5LY2A 1R1A1 2D98A 4S2HA 1BEV2 2UY9A 4CUGA 4E4HA 2RE9A 5A7WB 3EXUA 3I2OA 4GZ9A 1SLIA 1NQJA 4P9GA 5AVPA 1SLTA 3ZN6B 2X5IA 4KH9A 5BNOB 2JDZA 4HSJA 2HLEA 1SDWA 4YM3A 4HANA 3O1PA 2E7AA 4IESA 3BB6A 2NP0A 2VNRA 4RR3B 4K9SA 4Q4V2 5AVAA 5FP8A 3HWJA 2OXBA 1RXGA 2YC2A 4NAMA 4XJUA 3T3YA 2D5HA 3WHUA 3JUUA 1O3TA 2ZGOA 2ZEYA 2WZR2 3J8F2 4HL0A 5F3GA 5IAVA 3ZN5A 2WNEA 4AI9A 1AR62 1UKGA 2R073 5FZ0A 1F8VA 5FK8A 1JU4A 2ZTNA 1J3RA 2D5FA 5FJHA 1H2NA 4M4PA 1ND2C 3VHRA 1CX4A 2VVFA 3GBWA 2RS52 3ZYBA 1EV13 2HH9A 1AL0G 2J22A 1GLHA 2R072 1BVP1 5ABJC 3TB0A 1Q8SA 3SISA 1XBFA 3S30A 3BPSA 5FYUA 5GM0A 1HB1A 2YYOA 2ZGPA 2Q8EA 4K21A 4OULA 1W6OB 3VBUB 4AE2A 1HLCA 1RUG1 4UOJA 5BNOC 1VBE1 2WINB 4FAGA 5BNNA 3RYRA 4ISQA 1WCDJ 4LKFA 1WWYA 2RHPA 3OGSA 3ETQA 3NKTA 4UAPA 4R9AA 5LA0A 1XYOA 3LZZA 4Z07A 3UKNA 4XJZA 1CAUB 4S2FA 1DGWA 3RI9A 4FOVA 3NJVA 1QJU1 2WNVB 3ACHA 4GAZA 2J1AA 4PLMA 4BIFA 4DPNA 2E7QA 4WVVA 3VBRC 2VO5A 2MPFA 3K3OA 1VBA3 3GZUC 1Q8QA 4XFHA 4Y1ZA 1LEDA 1VBD1 2EXKA 4XQ4A 1YNAA 1UX7A 2JD9A 3T2QA 3N3HA 3I4IA 1D2QA 4FP2A 4BH9A 1NX9A 3AKSA 5JPNB 4PF5A 5LA1A 3O1MA 3DXTA 4TN7A 4NWWA 3U4SA 2BRTA 1BEV1 3T09A 4MO3M 5ABJB 2XL7A 3B9CA 3W5MA 2W1UA 5FZGA 3MDPA 4XAEA 3O1TA 3C7HA 4ZZ5A 1PGW1 2D3SA 5IFPA 5CG9A 1Y4WA 3FLPA 1V6OA 3ACLA 3ZXLA 4V2VA 4UW4A 3ACGA 3IAPA 1JBCA 4WM8C 1LECA 4AGGA 1ZBE2 3IZOA 5LA2A 2Y34A 1VBB1 3VBFB 5SV5A 4XIOA 4QDRA 3PDQA 2GNMA 4D94A 4J25A 4Y20A 4ZXEA 4IETA 4BWOA 4JRLA 1NA1A 3NNJA 5DAXA 5IK5A 1SLCA 1VBA2 3WOGA 1E57A 2AENA 4OI4A 3VBHA 5J36A 4QB6A 2VUJA 3FL7A 3HOBA 2PHXA 5GLWA 1ND3C 3I3MA 1GQPA 3KVBA 2GN3A 4JGZB 4PDWB 3V56A 3BOPA 3H42B 1TME3 4QDSA 2AR6A 2D6NA 1ZRIA 1ZRDA 2XJQA 4NHXA 5A3UA 2A6ZA 3HEIA 4LLFA 4W65A 3SKJE 1RUD2 1VLNA 2BGOA 1G86A 4I02A 4A6OA 1PM4A 4UF0A 4IL7A 1BJQA 3VDCA 2EIDA 5BNNC 5BY5A 4Y1UA 2OYZA 3SEEA 2VXRA 5CISA 4Q4X1 4AL9A 4I0BA 2WS91 4MXWB 4FPYA 2RDQA 1Q8OA 5IWFA 2XMLA 4U2AA 1U12A 2A6XA 5DABA 3NAPA 4K1ZA 3WF4A 4EZHA 5LEJA 4AEDB 1ZBA1 1A8MA 1T2XA 4D0QA 1TME1 1D4M1 1WCSA 1HW5A 2JDKA 3HT2A 1GNHA 4FP3A 4YW7A 5CFCC 2JENA 1P8JA 2VMCA 1IG3A 4WM7C 3N7JA 1A3KA 1LESA 2WFF1 1QMJA 3I2DA 1N1TA 4HN1A 4XIKA 3URFA 2Q8OA 4CCJA 3EB7A 2VZPA 5A7NA 1H1AA 5FZBA 1C28A 5DAWA 1HKDA 1QJX2 2J1SA 3TRSB 4CXXA 1NZIA 1MZ6A 5JDBA 5I0SA 4P5YA 5HI0A 4JGZC 4PDWC 4ET7A 1GQHA 4BQWA 3F95A 4XDQA 3VKOA 2BPA2 4Q4V3 1BZWA 3MV11 1OA3A 4QU1A 4JTNA 1XYPA 2V4VA 5K9YA 4YLZA 1KD7A 1AYM2 1MPXA 1I5PA 2J1EA 3OPWA 1OC1A 1CZSA 1J83A 2A6YA 1XNBA 4QPGC 4OHYA 4RHV3 1GOGA 4FOWA 3BU0A 2SLIA 5LBCA 4QQLA 4A44A 1D2SA 1PVXA 1NLQA 3T1MA 1T6BX 1ULFA 1EUTA 5FZ1A 1COV1 3K77A 1POV3 3BGAA 4W6WA 4ZONA 1EY2A 3VN4A 2ZMNA 1LOEA 1S0DA 2Y6HA 1GR3A 5CKQA 4K3UA 2QQKA 1S0IA 4U36A 2ADEA 1RJ8A 1V9U3 3ZSJA 1UCXA 1GSLA 1Y9MA 2VZ1A 3ZIXA 4C8DA 2WL1A 2P34A 2BJSA 4XFFA 2GC1A 3W58A 3HBKA 1WBLA 4QX1A 4IE0A 4LKSA 3CNAA 5F32A 3P3NA 1YJKA 5LEKA 3IM0A 1QQP2 3SH4A 2HWD2 3M4FA 3MFAA 5FWEA 2ZCWA 4F8AA 1NLSA 2G9ZA 3WHTA 2R061 5F9TA 4CEWC 1C1LA 1ZRFA 4JTOA 1GZWB 3NNMA 3CHXA 1IKQA 5A3WA 3FFQA 4UFHA 5A33A 5T55A 1F4HA 3TEXA 3AL6A 5EV7A 3J8F3 2VQUA 5F5QA 5LBFA 3ZXEA 3WW2A 4OMCA 1O4YA 3MW3A 2WNOA 5J1XA 3KZ4C 1TNFA 1XQNA 4GB33 4XEZA 1HJGA 4OI0A 1FOD1 2VZOA 3JBG2 2A1XA 4LKEA 3KT7A 1AR72 2AEYA 5C8CB 4WVWA 5CEHA 2B9UA 4AFCA 2EXJA 2R1BA 1PIV3 5FIXA 4CCDA 5CA6A 2ET7A 2XUMA 3IAQA 4XUOA 3AMQA 2RS31 5T5OA 4BB3A 1J59A 4AI0A 2XJTA 3TN93 2W08A 3CJIA 4KWUA 2WS93 2DCTA 1XSQA 4BHPA 2QUOA 5DUWA 1DZRA 4CP9B 2RJLA 3PIGA 4DQAA 2BYVE 4NHYA 4DMIA 1R1A3 4XBLA 4BOWA 3H3LA 4M0HA 1RUF3 1AJKA 3T0DA 3M3EA 4Y26A 3T2OA 4PLNA 5T5PA 3SNMA 4HONA 4JVAA 4CTEA 4IEXA 5BNPB 5FO7B 3WNNA 4PHZA 1CONA 4JGYB 4N43B 5I0TA 3RZJA 4CCCA 1C8NA 2VCAA 4HKWA 3PJQA 4LBQA 4R9CA 3U11A 3FN9A 3WG2A 4EYUA 2VUDA 5A7QA 2YFZA 2FDFA 1GYKA 3GDBA 1OLME 4IDZA 3K48A 5FYHA 2XDVA 1WMFA 4QX7A 2VVEA 1XNAA 3H9AA 1VBC3 3GHNA 2XUEA 2PFWA 3EBRA 2WSVA 4FPGA 3WDXA 1DQ4A 1ZA4A 1JYTA 4KWLA 3ZKUA 2WC2A 2XLGA 2XGXA 4GB32 1QJY2 1CJPA 4HOOA 3DPRB 3ATGA 1DIWA 1GQGA 3QH6A 3TNQA 4CE8A 3ZFEA 3WT3A 1OD3A 1RUF1 2VVDA 4GWMA 4MSVA 4CEWA 4KQ7A 1XOYA 2OIIA 1NCQB 5LATA 5IW0A 2J1UA 4YGCA 2R062 1ENQA 3TN91 3VBSA 3TEWA 5J37A 5JZGA 4WZFA 4YW3A 2JDMA 2ZEWA 4MVTA 2DBIA 4KU8A 2IXHA 2ZGTA 2RS32 3ILFA 5HCBA 3MICA 3NJZA 5M0TA 4MOAA 1B35B 3WUCA 3AZXA 5IATA 2J7MA 1K5MC 2XBO2 2Y6JA 1VBE3 4CYDA 2XJPA 4GWNA 1SG3A 4N53B 3V0BB 5CIRA 3P3PA 5DZFA 1ENSA 4DEQA 2VZRA 4XFAA 4E8CA 1AYN1 1GNZA 2VNGA 2JG9C 4AGRA 1O7FA 3FBMA 4IV1B 1IPKA 4EWAA 1UYYA 3AM2A 3LQCA 2DURA 2VCMA 1CN1A 1CVNA 3LFIA 3GZTB 3RYKA 3SHRA 5CFDA 5L7OB 4FPJA 1RUD1 5H9PA 3BU7A 3FJSA 3N4MA 1JUHA 4GD4A 3Q9OA 1BHGA 3C8XA 4N9IA 5BNOA 3IDEA 4M3CB 4RL7A 4A7ZA 2W5FA 4YARA 1H0BA 1UY3A 3ZDSA 2KM2A 1V9U2 2E32A 3I59B 2EVXA 3N9PA 3R4DB 4OHXA 1IS4A 1DLCA 1QDCA 5E89A 3U10A 1LOFC 2JDPA 2HWB1 1W8UA 3AYEA 2QQIA 4AEMA 4R4ZA 1RUI3 1IS5A 2I74A 4IE5A 4GQ7A 2D43A 5DMYA 5JXJA 1AVBA 3AL5A 4FI9A 3GBFA 1CIYA 3BODA 5FBJA 2B9VA 1QGLA 3EQEA 4LA2A 4Q27A 5C3OA 3IBMA 1XU2A 2YV8A 1QJY1 1LOAA 3INAA 3OSDA 1C8M3 1BBT2 2IXIA 3KV9A 2OQ7A 2EIGA 1BK0A 3AP7A 1RVF1 4K20A 4IV1C 5EYXA 1DZTA 1O3QA 1ZBE3 1WCQA 2QJVA 1S4CA 3BTAA 4D8MA 1SPPA 5J7MA 3GCWA 5LK7B 2JIGA 2BFUL 1ULEA 1AXYA 5FY7A 3I2FA 2A71A 2ZACA 2R043 2KR2A 3O12A 4RSUA 1ONAA 4WM8A 4W50A 2NLRA 2OT7A 3EO6A 2J1TA 3KF3A 4D7TA 3KQRA 1VRBA 3BTXA 2D40A 4HFSA 1TMF1 4IQPA 3AP5A 5A1AA 2RS51 4QX8A 2YC4A 4CDXB 4S2DA 4TTGA 2WFF3 1R1ZA 1HRI1 5EIYB 2WNVA 1QIQA 5FOBB 2IXKA 3D0JA 1L7QA 1H1MA 2A7AA 2XVLA 4NIIA 5A32B 4ARYA 3MEPA 5A3TA 3RZGA 1ZRRA 2CYFA 1FV3A 2HEVF 4C91A 1MS8A 3N7MA 4CPBD 4NHLA 4B29A 3WLUA 2VH9A 4FXKB 5JOYA 3DXUA 5FBZA 4CEYA 1GP5A 4PQ9A 5FMOL 4NRPA 1YC61 1NY72 1CAXA 5JR2A 5ANQA 3DCQA 3MI8A 2A70A 4HG6B 2MHFA 1Z7S2 1GZCA 1AF9A 3NV2A 1H2KA 1ZNPA 3C7EA 2ZZQA 4P9IA 1SLAA 2HBTA 1O5UA 1S0BA 1QJFA 4YW4A 4MGSA 4BYYA 2WIIB 1FMD1 2WR9A 3HT1A 3TNPB 1LHWA 1AYM1 1YFXA 1JHJA 4XFBA 1PMHX 5IAXA 3E1F1 4GH4A 3SCFA 1LGBA 4YFZA 1Q3EA 1JUIA 3VZMA 4Q4Y2 3L2YA 1UXXX 2CSGA 4QPIB 2P4EA 2ZEZA 1QJEA 1O4TA 2WN3A 4META 2F6BA 4R9DA 3H1MA 2W68A 4P00B 5FZ6A 1ULOA 4XCBA 1IZ3A 5H9RA 5C9AB 4K8FA 2L9LA 4AR2A 2ES3A 5GJ6A 4TSVA 3CBNA 1WCKA 4RYDA 3HMYA 3WCSA 4QKFA 3ZYIB 3ZYJB 3SQOA 2RMU3 3AP9A 2XWBB 5KC5A 1RUH3 1TQ5A 1HQNA 2CAVA 2OS2A 1UN1A 4CUAA 1SDDB 3KWVA 1REEA 1MZ5A 3M70A 3R4UA 1VBD3 2WLQA 4FQZA 1QOOA 5LB6A 1JODA 1CR7A 1DLLA 2CWMA 5GLZA 1JZ4A 4LTAA 1CD3G 5AC93 2P1BA 1C5IA 1W03A 2ZOEB 2BBVA 4CZSA 1LNSA 1QXRA 4CCMA 2JX9A 4NVPA 5KHJA 1W9WA 4HN0A 3POFA 3RDIA 4B4QA 5K0UC 5DZEA 1WMDA 1KQRA 3AYAA 2BWAA 5CYYA 2PHLA 4LBKA 1A6CA 3AVRA 2DU0A 2GZWA 4GMP3 2BNMA 3VL8A 3BTZA 1TMF2 4INDA 4N90A 1EPWA 1F35A 4NPMA 4QX5A 5EJ3A 2YDEA 5FQ0A 3VHNA 1UIJA 2GC2A 1EAH1 3KQ4B 2VC9A 1MS3A 1QY4A 3QH7A 3P6BA 1JHNA 4YPJA 5FYYA 4KBZA 4Y33A 1OKOA 2A3XA 1CQ9A 4FFIA 1FAYA 4FPCA 4A3ZA 4AAPA 4EN8B 3I97A 3AKQA 3O0WA 4QQPA 3VBFC 4YVWA 5FZAA 4AAXA 1YQCA 2WT2A 1OF3A 2ZS6B 4AGVA 1N3PA 3GBGA 3OB8A 3NRUA 3S6PA 2BP6A 3C7FA 5GZEA 3GM8A 3O1VA 3H8RA 4XF9A 4CDQA 2GMPA 1QOSA 4FO9A 1PK6C 5KHHA 5FMCA 1ACCA 2WWUA 2YY1A 2G19A 3B02A 2PELA 3PUQA 4XW3A 3B69A 4BQ4A 1PM7A 1LJ7A 1AUYA 4COZA 2A6WA 2QDRA 3H7JA 4C1WA 4CU7A 1V6MA 4DNYA 4NHKA 3ZFFA 1ZZCA 4EJRA 2WYFA 1PX3A 5I8YA 2WO3A 2YROA 1V6KA 1X33A 1YIPA 4Z2WA 3VB9A 1ZRCA 3A7QA 4YGDA 1W6MA 2BZDA 1LENA 1LU1A 2GC3A 1W3VA 4LITA 4ASLA 3VDDA 2VNOA 4FPLA 2RG4A 1S0EA 4H7LA 5EWSA 4YG3A 2VY0A 5FZEA 2W91A 4AFMA 1YQ5A 2B7YA 5CBLA 3M3IA 3ES1A 1MEC2 5JVVA 3V0AA 1HV1A 3WCRA 5A33B 2FZ1A 1YQ8A 4OLLA 1XYNA 2HWC2 3J7LA 3KB5A 4XJ8A 4Z8BA 4CXWA 1KDMA 1A34A 2R49A 3LKJA 1XRUA 4DXTA 3CLPA 2VR4A 3HNMA 2EALA 2AC1A 4KI5M 3VBHC 5KXEA 3JXSA 1FXZA 2I45A 5DAQA 2BDRA 1D7PM 3I3BA 3ZN4A 2BOIA 3R4SA 1OD5A 3VD9A 4LULA 1W6QB 4CDUA 1OOPA 1UMZA 1Z7S3 3AFGA 1W9TA 5C5TA 1IG0A 5FKBA 4EN9B 2UYBA 3WF1A 4HXCA 1AHSA 2J42A 3I3QA 4W4ZA 5F5AA 5F2WA 3ZIWA 5E88A 4Q8KA 1JZ3A 1C3HA 1F31A 4MLOA 1XE0A 1KDKA 1OFSA 4CDQC 3DEMA 1R083 5KXDA 4O61A 4NPLA 2XONA 3ZSMA 4P9YA 4ZKTB 1QJU2 5BNPA 1YFYA 3KF5A 2VQAA 5T3NA 3NWKA 4XUPA 2VTXA 3UKVA 5JLVA 5AC91 1DQ2A 4LXLA 5CFCA 2V5YA 3CEWA 2ZHLA 1N1VA 4QQ2A 4ZXKA 1LTEA 1UU5A 1ZZ9A 4KGQA 2Q1MA 3LGRA 5G04L 1QDOA 1ZBE1 2DVDA 1EV11 3IWZA 3PURA 4UW5A 5FWJA 3RZKA 1RUG2 2YBSA 2R32A 2ZGMA 1GP6A 3C7OA 3CO2A 3UJOA 5L9VA 1EYBA 4EROA 3WY6A 4FTBA 2JG8A 1PNGA 3N9OA 2YFUA 5FZ7A 1O8PA 1WUVA 5IUQA 1VRH3 4NN0A 1W0NA 2HWE2 3DPRA 4MGIE 1ND3A 2RDNA 1BBT3 2XKPA 2ZGSA 2Y33A 4Y1VA 3GYDA 4R4XA 4B7EA 1UO9A 4WM7B 2VOXA 4CEWB 5HXVA 5D8AB 3KS7A 1GZTA 1OBNA 2I07B 1OPOA 1O59A 3PU3A 1W8WA 4HKLA 4OFGA 3ZXGA 4V2WA 2I2SA 2OZJA 4Y22B 5FCCA 3SH3A 1LEMA 2WQ4A 3OYWA 4LR4A 4MYEA 4DIQA 1RTVA 2KXLA 3VD5A 1YHFA 3ZSKA 1CPNA 3L9JT 1RUH1 5L73A 3ZN6A 4Z2AA 2UU8A 2X5IB 5CU1A 1DBNA 1AYM3 1OLMA 2CHHA 2X53S 4NOTA 4XHBA 2PYTA 2OKXA 1TE1B 5EPAA 1W8FA 5JOWA 1M4WA 5FUPA 5TSWA 4QX3A 1FPN2 3AZZA 1VBB2 3HNBM 2RJKA 5IHRA 3WNLA 2PLV3 4YVWC 5LWBA 3FHAA 5J09A 5JAXA 1LAJA 4N53A 3POJA 3V0BA 1QJX3 4TXWA 1K5MB 4M3CE 1FNYA 4QB1A 3K2OA 4I3GA 4E4DX 2AH2A 4FTEA 2DDUA 3O1OA 5IVYA 5BNPC 3MIBA 3UESA 2HWD3 3ZYGA 3IKWA 3R05A 4AQTA 4DY5A 4CP0A 1VE0A 5FPLA 1BK1A 2VW2A 4H7MA 3ENRA 4A2UA 3M7AA 2ZGNA 1J84A 4LOTA 1OQ1A 1FMD3 3THPA 3WX5A 3PVNA 4O7XA 2WWJA 2HWF1 5CFDB 5L7OA 3AYCA 5FZ3A 2XBO3 3PLQA 4PI2A 2OVUA 2WWSA 1W9FA 3E97A 1W6OA 3K3NA 2GMMA 3SCGA 1YIFA 4RS5C 4Q8LA 2HWC1 1C5HA 1UD1A 1Q8VA 3NNGA 5FOJB 1QOTA 4I01A 4XQDA 4DXRA 3AKRA 3WEZA 3ZM8A 4LKDA 3ZXKA 2DVBA 4LHLA 4LNVA 4XTMA 4Y4YA 3H1WA 4UFIA 4MHUA 1FMD2 3FBYA 5T50A 3POYA 4QGLA 4AQSA 1U5ZA 3B3QE 3VZNA 2QQJA 5C71A 2TEPA 4OQ9A 5FPUA 2ZX0A 1NCQC 1R64A 2OUHA 1CWPA 3TEYA 1R082 3VLBB 4JDNA 1HV0A 1YCIA 1PGSA 3BIEA 5CZKA 1YXWA 1ASJ1 1NQDA 2BBAA 3VL9A 4ZZ8A 2BNOA 3IMMA 1YI9A 1WA4A 5FP7A 2DCJA 4PF1A 1OUSA 4XE9A 4L9BA 1VBB3 1SPPB 4YZ4A 5ABJA 4LO8A 1Q56A 2YBKA 1I3HA 2R041 3OEAA 1DGLA 3K4DA 4IGPA 1RGSA 4HK8A 4A42A 4IV3C 3LFMA 1UZ0A 1LHNA 4W6YA 3RI8A 4Q0QA 5C3PA 3QOPA 1GU3A 2D3PA 1YJLA 2CY6A 1C8M1 5EJ1B 2GAUA 4YM0A 4R9BA 2D44A 3D82A 2XPJA 2Q4SA 5DDJ1 4CDXA 3OPTA 4EN7B 2VMDA 4OUEA 4MADA 4EN0A 1US3A 5FR3A 4QU2A 3W20A 4Q4Y3 5FV3A 3ZYRA 1JYCA 2XB6C 2Y6LA 3B01A 5FPVA 3UYJA 2QQMA 4ATFA 1YUDA 3THDA 4Q29A 1VRH1 1V00A 5CKMA 4WVMA 3RVHA 1I9RA 5FO8B 2YC0A 4QM8A 5FYBA 3S57A 1PO23 4XZUG 4KG0A 1M06G 1LOGA 2VBBA 3ST7A 1UNBA 4C90A 4GWIA 2HWF2 1J1LA 5KC6A 3KT1A 4MGZE 4UF0B 3HPNA 3FFZA 2FDHA 2DUOA 4DRRA 3BKZA 3USUA 4LBOA 1SQ4A 4K40A 1RUG3 1V6NA 1C57A 3USSA 3H0OA 2BU9A 1JZ5A 4OVEA 4YZ2A 4AVVA 3PVOA 1LU2A 2IC1A 4AEDA 2ILMA 4AK3A 1J3QA 4D7SA 5BPXA 4IEUA 1AYN3 3RZMA 1CAWA 2VGDA 1DQ0A 1N1SA 5HV4A 1HX6A 3AX4A 3P1IA 2IVJA 1R091 1RMU2 1IQDC 2YBPA 3D3AA 4FFHA 4QPIA 2E26A 3VBOC 4DRVA 2QZ3A 4HK9A 2XG3A 3SITA 5C9AA 2IFWA 2VQ0A 3I3DA 1AR71 4BLJA 1OFNA 4AWDA 2WZR3 4PLOA 1J1TA 2BNNA 4LBNA 5JSRA 2RJ2A 1OF4A 2VCBA 2WSUA 5FZKA 4EE2A 2VZTA 2UWBA 1COV3 1UX6A 3MW4A 2A3WA 4UFKA 3ZXDA 1CJDA 4LIVA 5FLIA 4BJ0A 2ZGUA 5B4XA 2LUWA 4CUCA 1TMF3 4HT1T 1RINA 3D5OA 4FPEA 1E5HA 2SBAA 2G9FA 3DL3A 4L92A 4S2GA 3CKHA 2DVFA 4DXSA 2WZ8A 4DUXA 1MVQA 4COVA 1DYPA 2W0XA 2Q5TA 3LF7A 4MX3A 4XACA 5JXHA 5FDBA 3E6BA 4ONUA 2LALA 1JYXA 2FDGA 1G7YA 3WNPA 4QQHA 2VOWA 3QBQA 1QU0A 3VD7A 3TOJA 1DGRA 2QQLA 3CQOA 2NPIA 1HRV3 2DFBA 2YUEA 4NO4A 5JXIA 5FPXA 5K0UB 3GGLA 3T1LA 3NV3A 4HLTA 1K5JA 1UMIA 2VL4A 3H3ZA 4JHTA 1KS4A 4BQ3A 5D2AA 5KR7A 2IZWA 2FZ2A 3FLTA 2JE7A 4QHOA 5FQ0B 1COV2 1ZZ7A 2GNDA 5FZ8A 3DKWA 4AHXA 1OURA 1HJFA 1ENXA 1NE6A 1NCRB 1O91A 1JTZX 4E2GA 5K8SA 1X9TA 5E8AA 4UW6A 2V4AA 4AVCA 2A75A 4ES8A 4TZDA 3C7GA 1SFNA 2HBUA 1LOCA 2PHTA 3PMEA 4IEZA 2Y6GA 1W2UA 4LK6A 5FY0A 2WAOA 3LDKA 4J1WA 3J8F1 4BMBA 4HKOA 1VIWB 2D3RA 4NAOA 4E4ZA 2H0BA 2ARAA 5FXWA 2DV9A 2G4IA 2RVAA 3VKFC 4JV4A 2P5BA 3U14A 1H6YA 2CU5A 3I2KA 5FZCA 1DF0A 4F83A 2KD7A 2VUAA 4IE7A 2BVBA 2JDYA 4IEQA 3ZKYA 4P14A 5I93A 1BVVA 2Z4FA 1DGRN 5C8CA 4CDUC 3M3OA 4IV3A 5F6LB 1UL9A 1W8ZA 1OPMA 4OQ8A 5A6XA 4FT8A 5SV8A 3AMPA 3O0XA 1Y43B 1Y9QA 4XJAA 2W94A 4AI2A 3OTFA 1ND2B 2OZ6A 2UYAA 3O0VA 4FOYA 1YWKA 4G9SB 4LT5A 3I7DA 2R063 3ZLIA 2QTWB 2GN7A 1UAIA 1NCRC 2V09A 3QLQA 2RDSA 5F3IA 4H2AA 5C5UA 4BE3A 3O1SA 2RR11 2EXHA 1ULCA 1AR91 4ZU4A 4O65A 4DFSA 1FOD2 1W6NB 3V0AB 3MBWA 4QDQA 3OGJA 1OLRA 5JMOA 5G05L 3W21A 1QQP1 1ENRA 4LBQB 4BXSV 3IPVA 4K8RB 1S0FA 4E2QA 3HQRA 4RHV1 3AZYA 1JU3A 2RMU1 1NG0A 4H14A 2JG8C 2GP5A 4X8NA 1MS5A 4A6SA 1VBC2 4KWJA 1XB9A 1BKZA 1SFYA 3KCXA 4NWVA 2E33A 4HVQA 5IVFA 3WDYA 1H4GA 1L7LA 1AL21 2CTVA 2Y6KA 4XC9A 4QMAA 4XMIA 3RPQA 3DUIA 4Z82A 2FCUA 1OVPA 4OYUA 2VTXJ 4CCOA 5L19A 2WZEA 3M8LA 2DU1A 2PHDA 2Q1ZB 2E51A 4QKNA 4OUSA 3T2PA 3ZFEB 1BMV1 4YG0A 2IFRA 4NPRA 4G4FA 1NLRA 1QNWA 1RUF2 2JDHA 3MLLA 4BZ4A 4RGAA 2QBXA 1R1A2 3ZFGC 4YRDA 1W39A 4I09A 4UW3A 1V6IA 4FSJA 1GWKA 1H30A 5LBEA 2ZMKA 5H9QA 2PXJA 3POBA 5A7OA 3AXDA 2ZGRA 4UXAA 3UT0A 2C1FA 4BXFA 1PZ7A 3RQ0A 4Y5Z0 4Q1RA 4COYA 1LB2A 1PIV2 1ZBA3 3WG1A 4GJYA 5C70A 4YSFA 1QXPA 5FZFA 2DCKA 4Q4X3 4QQOA 1YEWA 4I30A 2RV9A 4CUBA 2WNUB 4MHRA 1IOAA 2V72A 1VMJA 1HXS1 2N7GA 4XXAA 5ACA1 4E2SA 5C3QA 3JD73 3CL1A 3NAPC 4OUMA 1LHOA 4EWEA 4YZ5A 3I2GA 1UOFA 1JOJA 1ND3B 2VMEA 1PMJX 1EUUA 4ES9A 5IT6A 1JS9A 3SLIA 3AMHA 1D4M3 2OA2A 2VZUA 5IVCA 2UWAA 3VBRA 3H7YA 4GB31 5FYSA 4OHZA 2RR12 1EV12 1YLLA 2WQZC 4XDPA 3RRDA 4BPZA 1S2EA 2Z79A 2RS13 2WFF2 3VKNA 4XXPA 1SBEA 1ZVFA 4FQ4A 4Y22A 3OYWB 1RUC1 3JCIA 1MZEA 2C24A 4QXKA 4LBMA 1RB8G 5A7PA 2XVKA 1MACA 3OGVA 3WDTA 4ORFA 1PVC1 2VBPA 3BVCA 5IVBA 5IFTA 5JSOA 4M3CA 5K7PA 3T08A 4YVSA 4XFGA 1UZYA 2PLV1 2XJRA 4A7KA 2ZAHA 1Z0HA 3DN7A 1RITA 3FWEA 3I59A 1OH4A 5I8SA 3MIDA 4QPWA 3RNSA 2GH2A 2H6CA 5FXXA 1CIWA 1W2AX 2EAKA 1C8M2 1MS9A 3ZSLA 1XPWA 4QPGA 2NN8A 3J7HA 2VAUA 4IE6A 3M3CA 1BEV3 1UZWA 2VULA 1K5MA 1GICA 2ZMLA 2RM22 2C6SA 4RQPC 1YI7A 3VZKA 4HETA 2DVGA 3KHBA 1RUI2 1OH3A 1VMFA 5BNQA 1OLQA 4UFLA 2DUPA 1GOFA 1OMIA 3NSTA 2Z42A 4UWDA 2QFEA 3HN1A 2WT0A 3Q8CA 4PQQA 4UT5A 1BMV2 1IPSA 1VR3A 1X8MA 1X36A 1W8TA 2WFPA 1LULA 3MHZA 1RUE2 1DFQA 3E5QA 4MXVA 2UURA 1XNDA 1A8DA 3VZJA 1VB4A 3RMXA 5D21A 3A23A 1TEIA 5FMDA 1F4AA 3HBZA 4LUMA 4KL1A 4MUVA 3FE5A 1REFA 4OZXA 4Q5OA 1OUXA 3I2IA 1NE4A 1AL22 1AR93 2VUCA 3SXWA 5C8WA 2RR13 1OOPC 3FUOA 4JAAA 4A41A 4E4SA 5E6HA 2HYXA 3HVDA 1QJU3 2TUNA 1MZFA 2E63A 4CCNA 4I0AA 1VMHA 3MGUA 4XTPA 4CEYB 3W59A 2E6VA 2GC0A 2Q8CA 2D93A 2EA7A 1RHI2 3CU7A 1HXS2 1WGPA 4N9HA 5F39A 4NIAA 1PO21 3WVJA 1EP0A 1LOBA 5IK4A 2XJUA 2R1DA 4B3NA 4JGYC 4M01A 4RFRB 4FVVA 1IGOA 1Z7S1 2AACA 2RDRA 2JD4A 1XSRA 3AC0A 2QQOA 3MIFA 3NQHA 4IGOA 4K6BA 2O8OA 4L8QA 5F2SA 4ATEA 2ORXA 4QKBA 1TME2 2E7TA 2JWPA 4N7IA 2MEV2 1S0CA 2PA7A 4B4PA 1AR81 1E5RA 4LO7A 3MIEA 1I1EA 3POWA 4NROA 3AB0A 1H1IA 3WINE 4GH4B 4LMFA 3WUDA 4IERA 4XPVA 5HXMA 2QQPA 1UOJA 3ZFGA 5KBFA 1JOPA 4TLGA 4UI9L 2X29A 1O8SA 3DPRC 3THCA 5DN2A 3WF2A 2HWE3 3NV4A 1UZZA 4WVMB 1W99A 2JEMA 1MS1A 3JB8A 4QWNA 4DUVA 1H9WA 1CZTA 1QH6A 4Q4W2 4QAWA 4XABA 2XJVA 4HZFA 4DINB 2HWD1 3RJ2X 4CEYC 4NUBA 3WG3A 1D0HA 2X05A 4QHZA 2E9QA 3N36A 2LM3A 3MPPG 1SCRA 3MW2A 4BU2A 2NMOA 1MS0A 2FCTA 1RUE1 2GMEA 5J3UA 2ZHNA 1URXA 1PO12 4O9GA 2Q1FA 4COWA 1D4VB 4SBVA 5A6YA 2D6LX 3UK9A 3NNLA 3WNXA 3WNMA 1HRV2 5GKAC 3WQBA 5I91A 5JI9A 4PBOA 2A73B 4YFWA 4M0NA 5F5IA 1HDKA 4PI0A 2A5ZA 1AXZA 4MGQA 1AZDA 3FZ3A 2O1QA 4Q0PA 2BFUS 2JIJA 2Z5WA 5LY1A 2RM23 4Z1VA 3AMNA 5ANNA 4D7YA 5FZHA 5A80A 2PAKA 2G9GA 2WQ8A 1CPMA 1KEXA 4NJ4A 1Z78A 4RHV2 5CNAA 5DDJ2 4AHWA 4DOUA 5JZGC 2VQTA 2ID4A 2YPJA 4YGEA 3WSOA 3QACA 3ZYHA 1JZ2A 3AYDA 5A3NA 4Q0UA 4XF4A 2CGOA 3ECQA 3KHCA 2D6OX 3WG4A 3S0MA 1DDLA 3DYOA 4A45A 2WZR1 2ET1A 1EAH3 2ZPXA 2ZX4A 3SEPA 2XQRA 3LDRA 3M3QA 3ZYFA 3LSDA 1QEXA 5GZDA 2JKBA 4Y3OA 4YWAA 2JDNA 3RG0A 4DEVA 4LIUA 4Y1XA 3RJRA 5C4WA 1H2LA 1R093 2RS53 4QM9A 5FAXA 3OGGA 4RQPA 5E16A 4FCAA 4M3CF 3OF1A 1W2NA 3IDAA 4R52A 4CA9A 3T4VA 2VE1A 1D4M2 4CP2A 4E8DA 3NVCA 2X09A 5AFBA 1AYN2 1RUOA 4Y5SA 3ETPA 4AFDA 2P6HA 5K0UA 4COUA 1RVF3 2UY8A 2ZAAA 4Y4RA 2OX0A 4YW5A 2FDKA 2ZEXA 3WF3A 3EMRA 2P3IA 1V9U1 4NHMA 1RUH2 3VD3A 3MZHA 1KJRA 1CZVA 3RZZA 1SMVA 4YM2A 2G1MA 1LODA 3QCWA 3NNFA 1ZX5A 4CU6A 5KHIA 3VGIA 1NCRA 3MIGA 2ZKLA 1TVGA 5JOZA 1RUI1 3KT4A 3S5QA 3VDDB 4NRMA 2FBEA 2C9KA 3I2HA 4AYUA 1G9AA 1GFF2 5FZ4A 1B09A 1N47A 1XE7A 2W1SA 4AEKA 1XNCA 1N1YA 2IXJA 3K46A 3AZWA 3RYPA 1ZZBA 4GXLA 5KXBA 5FYIA 1DYOA 4JX0A 2WAAA 4BISA 1QH7A 2EF6A 5I0RA 4NMIA 4IEYA 3I2JA 1QXJA 4KNCA 3VBSC 1KS5A 3KCYA 5FTTC 3VD4A 1FATA 5FZOA 1RUJ3 1UQXA 1WBFA 3LEKA 2Y0OA 2JICA 1JZ6A 4EN6B 1JN2P 3BYWA 1UPIA 1JMUB 3G7DA 3PTRB 3HD8B 2AYHA 5JWPA 1W6QA 4CDUB 1WLDA 1W8NA 2ADDA 2XJSA 4D6RA 3NMBA 1X9PA 3PHMA 3RZLA 4Q2FA 1RUC3 3K4AA 3UGHA 2CWSA 3WP4A 5A1FA 3CZJA 3CDZB 4XILA 1H8TC 1GOHA 4FOQA 1PMIA 1IPJA 1F5FA 1W6NA 3AJYA 4WBBA 3TWIA 2JG9A 2VW1A 4AVTA 4CCEA 5I8TA 1LRHA 4NIDA 4OHVA 5CFCB 1VAKA 2CV6A 4ITCA 2Q30A 3DV8A 3IB3A 5LZ6A 1MQTC 3IPVB 4BA6A 4JHZA 2P2KA 4QPIC 3NKGA 2YU2A 3OD0A 3VBOA 1UW8A 1RXFA 4JKMA 4OI2A 5FXVA 3VDBA 2PHRA 3U75A 4JZRA 1UKRA 2QKDA 2JG8B 2EICA 2R0FA 2HWF3 1O4ZA 3NJXA 1RVF2 2AREA 1DCSA 3I54A 3M2MA 3BPZA 4M00A 1RUJ2 2JE9A 2WJSA 1RL3A 2F17A 4X6RB 4DB5A 3BN6A 1HQLA 5A3LA 1C4RA 3GJBA 3PUHA 1V6LA 1PNFA 4XUNA 2IXCA 3CMGA 4WM7A 1ST8A 2DCZA 1SACA 4FXGB 4UBGA 5D8AA 1WMEA 1WLTA 1H8VA 4BQ2A 3I8TA 1BCXA 1VBC1 3ABZA 4LOSA 2CL2A 4ASKA 3AKPA 1L3JA 5JIAA 1G9DA 5CB7A 4IGQA 2DBNA 4H55A 4A7YA 2PHFA 1XJAA 1CESA 3GF6A 1ZA7A 3LIGA 1HQWA 4URTA 3RZHA 1JH5A 1KITA 2BGPA 5DAVA 5J48A 4LJHA 3VBUC 1HB3A 3VKLA 4UFMA 5FMOS 4CDWA 4CU9A 4ZS3A 5A3OA 3D6EA 4XETA 4IEOA 4X6QB 3B94A 2V73A 3I49A 2ZA9A 4W6XA 1ZZ6A 2B4KA 2P3JA 4QKDA 4KGGA 2XOMA 4RGGA 3NW4A 1YFWA 2ZGKA 3G6JB 5DUUA 3PIJA 5APAA 5KWRA 3WP5A 4PIZA 1AR83 5T5JA 4P9LA 4J6GA 1W8HA 1PO11 2GU9A 3OG2A 5EHDA 5KHGA 4BIOA 5DQ0A 3MFCA 4W8JA 3RGBA 5CAZA 1IS6A 1PGL1 5A70A 3TEZA 1XNTA 4DUWA 3B00A 3X29B 3OY8B 1OT5A 3WD5A 1MQTA 2WUHA 3PNAA 3WDUA 5A7WA 4OI1A 4N7UA 3NO8A 5F1RA 3H1YA 5FRAA 3POEA 1W9YA 2ZHMA 1MVEA 4FFGA 1X7NA 1OVSA 5HPOA 5FP9A 4YZ1A 3MPBA 1G6NA 3RS6A 1NOVA 2YPDA 1GWMA 2D97A 4LPLA 5GZCA 4NRQA 2LTNA 1QKQA 1DQ6A 3H50A 3KGLA 1NZCA 3VUOA 3KLSA 4G3YC 1FT9A 1R081 3R0RA 2XHNA 4FPKA 3WP6A 4A4AA 4LO5B 1QJZA 1JI6A 4BK5A 1LKNA 4XFIA 1TNRA 2JECA 5D8AC 4RN5A 1H9PA 3UV9A 3APBA 2J1VA 1R092 1RMU1 2BVVA 1PK6A 4JKLA 4UBHA 1W90A 5IVEA 1VBE2 2VW0A 3FLRA 1WMXA 1Y7BA 2NQYA 5GALA 3JBG1 2TBVA 3VKMA 1BXHA 5FY9A 1N3QA 3J26N 3HIFA 2VCCA 2W87A 3VBUA 3ALQA 5JOXA 3IIAA 3LEGA 1LGCA 2P3KA 1UF2C 3E6CC 4I2OA 3IDBB 3MUZ1 1U5IA 4H3WA 1TG7A 3P5BA 4XHXA 3N7LA 2ZABA 3OUJA 3Q8BA 1HXS3 2VU9A 2Y8KA 4JQRA 3SKVA 1KJLA 1YO8A 1OXCA 2RM21 1F9KA 3B93A 4EQVA 3TAYA 2XHKA 5CADA 5CVRA 5LASA 2JE8A 1KFXL 5HV0A 3BI3A 4NIHA 2VG9A 1W28A 4XMAA 1H8TA 4XJWA 4RFT0 5DG2A 3ILRA 5IJRA 3KSCA 3GZEA 1RUJ1 2BW8A 5FFOC 4PBPA 1APNA 3WQ0A 1PZ8A 4ZY9A 1AX1A 1Q5OA 4Q4V1 2GNBA 1QJY3 5CFDC 3GALA 1VRH2 4XUTA 4ARXA 2B8MA 2ZHKA 1V0AA 3KV6A 3VHPA 2CDPA 3N9MA 2ZKNA 2MEV3 3BCWA 4NR1A 4RS5B 5IVVA 1I5ZA 4R8HA 3T0BA 2RS33 1S55A 3USUB 3E5UA 2WA4A 4AEJA 1HIXA 1W6PB 2NM1A 4SLIA 1UY2A 2AGSA 2BERA 3WDVA 3QD6A 1PGW2 1Q8PA 2QQNA 2W46A 2FQPA 3H8OA 1G8WA 1UIKA 3OGRA 4AQ2A 1DQ1A 4C0BA 1HRI3 3AZVA 1UU4A 3VBFA 4N43C 1F15A 4ZU7A 1GNYA 5C33A 2AEZA 1CAWB 5LRSA 5LW9A 4AVBA 1W05A 1U0AA 4Y20B 3LOBA 3FMGA 2JKXA 2QDNA 4D3WA 1NA1B 2NMNA 1UPSA 1TZOA 4AHZA 1GBGA 3WZ1A 4L0PA 2IWGB 1C1FA 3VBHB 2XR4A 3MYXA 2QZ2A 4URAA 1QQP3 1WW6A 1YYNA 2R6QA 2XVGA 3FC0A 3SMHA 1SLLA 4JGZA 1AR92 4PDWA 3T4HB 3A0KA 2YZ4A 4L2NA 5JPMB 4N8MA 3LPFA 1L7RA 2XQXA 1X50A 3FHQA 1QF3A 3H8UA 1X8EA 1WD4A 1WD3A 3ZFFC 2XL9A 2CGPA 3W9AA 2ZGLA 3POGA 4XF3A 4XF1A 1HN1A 1OQDA 2D7FA 2ENRA 1LR5A 1XNKA 2X5IC 1PO22 3LOIA 3O1UA 2C0ZA 2O14A 1YQ6A 2ERFA 4KG8A 3ZSEA 1O5LA 1W06A 3TBDA 4FBFA 1XE8A 2HWB3 2DCYA 2VBDA 1MEC3 4DXZA 2YGMA 3B5LB 2WBKA 2RS12 2OPKA 3ITQA 4OHWA 4AFBA 2WKKA 1CAVA 1LCLA 3NL1A 1AL23 4Y24A 1SCSA 4Q4W1 4DS0A 3UGFA 5JCTA 2Z69A 2J1RA 1AR61 2P17A 5EP9A 4BQYA 5FMBA 4LO6B 3UKTA 5GZFA 4YG6A 1B35C 1ULDA 2ARBA 4AOCA 2HYKA 5FYCA 1MS4A 1JW6A 2DVAA 2KA3A 3ZXFA 2C9AA 3S5AA 3LEMA 5EYYA 1IHMA 1V70A 2NZ9A 4TWTA 1VBA1 2YU1A 1UU6A 3WNKA 1D0GA 1LOFA 2DYCA 2FMDA 2HJIA 2PHWA 4QB2A 5A3MA 1G9BA 5JSPA 1PGL2 4WV8A 5T5LA 2VD7A 3M1HA 5C7GA 3EHKA 2NYYA 4YNIA 1JYVA 2ZZJA 4QGNA 5F8PA 1NY71 4FPOB 5FY8A 5FY5A 3D8CA 4YW6A 4RQPB 3UL2A 2ZX3A 3ZX7A 5AFEA 1JYIA 2VZQA 3LB9A 5DAPA 5FLJA 1HRV1 3IIIA 1U5YA 2ATFA 4Z92B 2F4PA 2A3YA 2W47A 1W2OA 4XVHA 2HWE1 2HWB2 1UY0A 2EIEA 2Y60A 2YMZA 4IE4A 5DUVA 2ZGQA 5L7OC 2VZSA 3T30A 1RJ7A 4GALA 2C5DA 3I3EA 4IEWA 1IS3A 1VALA 1EPZA 2OPWA 3Q8AA 1E5SA 4IV3B 3HAGA 3HQUA 1PVC3 3AMMA 5ACA2 5JMCA 5IVJA 3WW3A 1VPHA 2QNKA 4UYBA 5T52A 3AKTA 1ND2A 2CDOA 2VMHA 3KV5A 2WA3A 4HVOA 4XURA 3LSEA 4GMP0 2RS11 3N35A 3PTYA 1QHDA 1PIV1 4PT6A 1K3IA 2DTYA 2JB8A 1K42A 2VECA 3WQ7A 1A78A 2VPVA 3OUIA 4NIGA 1FOD3 5LRRA 1JXNA 1S1AA 1FNZA 2A6VA 1OHFA 1LHVA 5DPNA 2ZX2A 5FZIA 1GZWA 4P02B 5FZMA 2Q8DA 2YXSA 3U37A 5DZGA 5FK7A 3OBAA 2E31A 5IK7A 1NYWA 1HRI2 2VOVA 5FLHA 2D6KA 3CZUA 4KWKA 4XF0A 1ODNA 4QGMA 3LCPA 4F7ZA 4YW2A 1AJOA 4QXHA 4EZ4A 5K4LA 1X82A 3DKQA 5EXOA 3UGGA 2FDJA 3PUIA 2WO2A 3FHIB 3J4UH 3C2UA 4HPKB 1UMHA 1K12A 2R042 1O3SA 3K51A 4I0WB 3NJYA 2VMGA 2QVSB 1BYHA 5F7UA 5BXXA 2YG0A 2YGLA 4C1XA 4FTSA 4X8PA 2VMFA 3IN9A 2GNTA 4CDXC 4LBJA 4PIYA 2UWCA 1KRIA 4KMQA 2JXAA 3WR0A 3ZMOA 5BUVA 1VB2A 4PJYA 1ZREA 2GP3A 2XXZA 3B7MA 3GHMA 2Y64A 4JRAA 2PMWB 1QWRA 3BTYA 4KBBA 3H8XA 4MV2A 1PX4A 2VOKA 3MF6A 1KFUL 2PQQA 4JGYA 1GKBA 1VJ2A 3PMSA 4F3JA 1POV1 2W92A 4GULA 5L9RA 5J96B 5FUNA 3NV1A 1MEC1 2ARXA 2ARCA 3ORJA 2GDFA 4JDOA 4YM1A 1N3OA 1WZXA 1W0OA 4IEPA 3PVBB 1DZQA 4JCKA 4CDWC 5FJKA 5GLUA 4NE9A 5DUXA 4KU7A 5CG8A 5FPAA 5FZDA 4UFJA 1S2KA 5F5CA 3RWNA 4D69A 2WNUA 1RUD3 1GMMA 5ERLA 2PHUA 2W95A 2W2IA 5FPZA 1UWWA 1S2BA 1HB4A 2PAEA 2QQVA 4OMDA 1S0JA 1SEFA 5E1RA 3VDDC 2DF7A 4JKKA 1XXNA 4QX2A 4XCAA 4AEDC 4BQ5A 3ZPYA 4GKYA 1NAEA 2QQUA 3ZMNA 3KD4A 5HCFA 3LAGA 1T6GC 4CU8A 3AFKA 3VBRB 1QNYA 4Q1PA 3C3VA 1NCQA 1V6JA 1ULGA 4HMZA 2W3JA 2HKXA 4FAHA 1O6UA 2JDAA 5KXCA 4BQXA 1HB2A 4ZHNA 4EV0A 3VV1A 5JI7A 2Z2SB 3MUY1 1UOGA 3AP6A 5H9SA 2YHJA 2BOJA 3LD8A 4HVRA 2R16A 1I6XA 2K46A 1VAMA 4YVSB 2WABA 2EXIA 1EAH2 1CX1A 3ZXAC 1GUIA 5FYVA 3UJQA 1IKPA 4RR3A 4CSWA 3JD71 1VAVA 2W1QA 3Q8FA 3KGZA 4QXBA 4WZCA 5FY1A 4LA3A 4AFAA 4B8EA 2WYSA 4QPGB 3O1RA 5FYZA 3HNYM 2VOTA 1HN0A 1RYYA 2GSYA 5DDJ3 1Y3TA 4AW7A 4IXLA 5CKNA 4GA9A 5BV6A 1UOBA 1LHUA 5EQUA 3J7MA 3ME2A 3EJKA 4CP1A 2QE3A 1AX2A 2WN2A 4B1LA 1ZM1A 5GLTA 4IV1A 3N9LA 3HQXA 4CRQA 4YYOA 4LORA 2ZXQA 4FFFA 4MH0E 1JYWA 2BWCA 1SZBA 1VBD2 1UYZA 3DYPA 3LE0A 2IXLA 3GZAA 2CGNA 3K75B 4AI1A 3CIHA 1DYKA 2WNUC 3PU8A 3LA7A 1IQAA 3DYMA 4YVSC 5BNNB 4XFCA 4AZZA 1AX0A 1FV2A 3ZYPA 2VM9A 2VTFA 3V65A 3VDAA 4E9KA 2WNVC 2E53A 3MV01 2R30A 4LO4B 4WVZA 1G9CA 4QT6A 1OQEA 1PZ9A 2B5HA 4OZOA 1CAUA 2CAUA 1FX5A 4LHKA 3AK0A 5GLVA 3T2TA 1YFUA 4CCKA 2W39A 3OBRA 2VMIA 1AXKA 2DUQA 4MZUA 3R6SA 1PK6B 1PHMA 1RMU3 2X8KA 4D6SA 1AR63 3L2HA 3W5NA 3U07A 2FCVA 3O5SA 5FO9B 5C9AC 5HBAA 3JB4C 4IEVA 4OCTA 4P9JA 3WF0A 5C8CC 3K4ZA 4WM8B 4BM8A 2HEWF 3IDCB 4FPFA 4ASMB 1Y9GA 1AR73 1BQPA 2BGCA 3GXUA 5A7SA 3JBG3 3BALA 5IYYA 2F4LA 3OCPA 4BCUA 4DZGA 3H3UA 4BQ1A 3A0NA 4GIQA 3V64A 2H6BA 1J3PA 3D0SA 3LDBA 1QJX1 1OKQA 3KM5A 5EFUA 2AUYA 4C0HA 2PTMA 4IW3A 1W9SA 5A6QA 2LS6A 3S7EA 5FXZA 1H8TB 1VP6A 2P37A 3ZFGB 4B4RA 3LPGA 5A32A 5FZLA 5AC92 4CPBA 5HCAA 3HJRA 2MNGA 1RC6A 2O0OA 1DP0A 2Q0AA 1U5XA 3ZDVA 4DY3A 3ZFEC 1JYNA 1FPN1 2JB4A 1SFPA 2C26A 1W04A 3ZOIA 1NKGA 1ALYA 2XLFA 3A4UA 1SBDA 2QCSB 4JQTA 5FYMA 3SH5A 3DF0A 1W2TA 1CAXB 4L97A 4Q0SA 1GP4A 3MO4A 4RS5A 2RMU2 3B9IA 2W52A 4QHBA 1FI2A 2Y38A 1POQA 3GJAA 3ON7A 4AQ6A 5FUIA 3SCHA 2K0GA 3U78A 1GANA 1W6PA 4ISRA 4PCRA 4MXWA 5FYTA 2X10A 4XQWA 2VJXA 3PL0A 4XUQA 1REDA 3NAPB 3PUSA 3JZVA 4JDMA 4V1PA 5A6ZA 1OA4A 3AP4A 1UXZA 1BBT1 4IUGA 4MGYE 5JUVA 2TNFA 1MR5A 1XC6A 3PUAA 4Q4Y1 4AF9A 4QXCA 4XBNA 3OEBA 4RA0A 5JR7B 3VZLA 3ELNA 4CXYA 5EZWA 4O9EA 2PQSA 2MEV1 4Q26A 3OOXA 5FZ9A 4B1MA 2D6PA 2K2SA 2Y6FA 1NA1C 1H4HA 2FD8A 4Y1YA 4HSLA 1ZYBA 2K9ZA 2P6CA 3Q8EA 3KVAA 2EIBA 2BUKA 4ZU5A 2PN5A 1UY4A 5IK8A 1DU3D 4LUKA 3WQ1A 5I0DA 4Y5TA 2BV4A 3ES4A 4P9WA 3ZO0B 5LBBA 1FPN3 2D6MA 3MF9A 5F3CA 2XLAA 2DTWA 5J98B 2W9XA 1NT0A 1UYXA 3KCCA 1POV0 2C4XA 5FREA 3U1XA 3UNPA 3E5XA 3PVEA 1RHI3 3VHOA 4TLFA 1OA2A 4CCLA 3SC7X 4ZPIA 4FPHA 4P5HA 1ASJ2 1WCUA 4B7KA 5FP4A 5C4WB 4MG2A 3J7NA 3DECA 2YB7A 4YGBA 1CAVB 1KGYA 1NUKA 1RIRA 5A1LA 1JOBA 3E6DA 4RD7A 1YQ2A 2FMYA 3LA3A 1Q43A 5HCHA 4LHSA 1YRZA 3ZPOA 3ZR5A 4LBQD 4DO0A 3JD72 3T0AA 3OPZA 3RMYA 3WNOA 1WLWA 2WO1A 1DG6A 5ISLA 3ROUA 1OSGA 1PVC2 3MLKA 4D6QA 5ACA3 3ACFA 2WT1A 2VZ3A 3FX3A 4Q4X2 2B45X 1DGWX 1XU1A 3JQXA 4LE4A 2ZBJA 3ZXJA 3GCXA 2DWRA 1ZBA2 1J58A 4L11A 3CF6E 1O3RA 2OUJA 2Y0IA 4YVWB 1NXD1 1WA6X 1GWLA 1WW7A 1WKYA 2W1WA 4M4RA 3N7KA 5BYNA 1E5IA 4CDQB 2BQPA 5JXGA 3U4XA 2ETEA 2LROA 5C4WC 5JIUA 2OQ6A 2VNVA 4JC1A 4I3PA 5D1IA 5B4NA 3ASIA 2QQWA 3ACIA 1SHWB 2PLV2 2H0VA 3LEIA 4XDOA 5FZOB 4LEJA 3J9SA 4P9XA 4J1XA 1WW4A 3O7OA 3MIHA 4LE3A
chains in the Genus database with same CATH topology
1XE0A 4N8MA 1K5JA 3T30A 1XB9A 2VTXA 2VTXJ 4CA9A 1NLQA 2P1BA 5EHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XE0 A;  4N8M A;  1K5J A;  3T30 A;  1XB9 A;  2VTX A;  2VTX J;  4CA9 A;  1NLQ A;  2P1B A;  5EHD A; 
#chains in the Genus database with same CATH topology
 1PO1 3;  5F37 A;  1DQ5 A;  3PJY A;  4TYS A;  3JU9 A;  2GH8 A;  3ZFF B;  2FDI A;  4AVA A;  3LIH A;  5I0U A;  4K7J A;  3ZR6 A;  4AI8 A;  3S7I A;  5DXD A;  1W6M B;  2XH6 A;  2OW4 A;  5LK5 A;  3CJI B;  5C3S A;  2P3Y A;  2BTV C;  5C3R A;  3D4K A;  3TYJ A;  4Q4W 3;  3KMH A;  4CP9 A;  4LHN A;  1W3X A;  1F5J A;  1GV9 A;  5B2G B;  2B46 X;  1US2 A;  3CJX A;  2R0H A;  3POS A;  3WDW A;  1OI6 A;  2XKO A;  3IMN A;  1DHK B;  2HEY F;  3OBT A;  4XAA A;  2Y26 A;  4XZP A;  4YZ3 A;  1W0P A;  3RWK X;  4QX0 A;  2JG9 B;  2WDB A;  1LGN A;  4N43 A;  4BME A;  1ASJ 3;  3POI A;  2FHR A;  2V5D A;  3HR9 A;  3WW1 A;  3BOW A;  3OJB A;  3ZVX A;  3VZO A;  1WW5 A;  5A3P A;  4XYX A;  5EJZ B;  3RFR A;  3THT A;  4GMP 1;  2WS9 2;  4Q0V A;  3VBO B;  2B39 A;  3TN9 2;  1H2M A;  3AXE A;  3N9Q A;  4AXO A;  3F2Z A;  4LK7 A;  4YW1 A;  5LCW L;  4L99 A;  5L9B A;  5FY4 A;  3N9N A;  1UYP A;  2XWJ B;  2LRP A;  4HPK A;  4P08 A;  2DFC A;  1ODM A;  3WP3 A;  5FPB A;  5L36 A;  1KXG A;  4HBN A;  1OOP B;  4A3X A;  1NXM A;  4LBL A;  4BK4 A;  5C6C A;  3HN3 A;  1BLZ A;  2VZV A;  2WRA A;  4XBQ A;  1K45 A;  2R7E B;  4GWJ A;  2HWC 3;  5T54 A;  1STM A;  3CJI C;  2ZX1 A;  3WV6 A;  3EYP A;  4QD2 A;  3WXP A;  1SLB A;  2JJ6 A;  4MGT A;  1SBF A;  3OUH A;  3IT8 A;  3MLJ A;  1RUC 2;  2XBO 1;  2BEO A;  2R07 1;  2VXJ A;  4BDV B;  5FP3 A;  5F3E A;  3WW4 A;  4ZS2 A;  5FKC A;  5KHK A;  1S0G A;  3OD4 A;  5F6K A;  3VBS B;  3GNE A;  1GZ9 A;  5JZG B;  1JZ8 A;  3UET A;  4E27 A;  3DGT A;  2LW8 A;  1JZ7 A;  3AVS A;  4MGK E;  1ULP A;  3U0Z A;  3OBZ A;  1UZV A;  1WLC A;  3O14 A;  4CVU A;  4LQR A;  4RR3 C;  2AZ5 A;  1W8O A;  2WZP P;  4PIX A;  1G9F A;  2B42 B;  3ILN A;  3LWC A;  4GJZ A;  1F2N A;  4GH4 C;  4LLO A;  1UY1 A;  1B35 A;  4QPY A;  2ZJC A;  5LA9 A;  1RUE 3;  2EAA A;  3FUQ A;  4CDW B;  4XOG A;  4N53 C;  4AI3 A;  3BUC A;  4AVS A;  1RHI 1;  2WO7 A;  1ZZ8 A;  2IVI B;  2PAM A;  4GKX A;  4BLI A;  4EWD A;  2ORZ A;  2JDU A;  4AG4 A;  3KV4 A;  2GAL A;  1RUN A;  1H6X A;  1FYU A;  3A21 A;  2CNA A;  4RGK A;  3A22 A;  5GZG A;  3RSJ A;  3AJZ A;  1CGP A;  2O8Q A;  2WLP A;  5DG1 A;  3BIW E;  4K1Y A;  4XJ9 A;  1AR8 2;  4AHY A;  2IUW A;  3JQW A;  3LA2 A;  3OY8 A;  1MQT B;  5LY2 A;  1R1A 1;  2D98 A;  4S2H A;  1BEV 2;  2UY9 A;  4CUG A;  4E4H A;  2RE9 A;  5A7W B;  3EXU A;  3I2O A;  4GZ9 A;  1SLI A;  1NQJ A;  4P9G A;  5AVP A;  1SLT A;  3ZN6 B;  2X5I A;  4KH9 A;  5BNO B;  2JDZ A;  4HSJ A;  2HLE A;  1SDW A;  4YM3 A;  4HAN A;  3O1P A;  2E7A A;  4IES A;  3BB6 A;  2NP0 A;  2VNR A;  4RR3 B;  4K9S A;  4Q4V 2;  5AVA A;  5FP8 A;  3HWJ A;  2OXB A;  1RXG A;  2YC2 A;  4NAM A;  4XJU A;  3T3Y A;  2D5H A;  3WHU A;  3JUU A;  1O3T A;  2ZGO A;  2ZEY A;  2WZR 2;  3J8F 2;  4HL0 A;  5F3G A;  5IAV A;  3ZN5 A;  2WNE A;  4AI9 A;  1AR6 2;  1UKG A;  2R07 3;  5FZ0 A;  1F8V A;  5FK8 A;  1JU4 A;  2ZTN A;  1J3R A;  2D5F A;  5FJH A;  1H2N A;  4M4P A;  1ND2 C;  3VHR A;  1CX4 A;  2VVF A;  3GBW A;  2RS5 2;  3ZYB A;  1EV1 3;  2HH9 A;  1AL0 G;  2J22 A;  1GLH A;  2R07 2;  1BVP 1;  5ABJ C;  3TB0 A;  1Q8S A;  3SIS A;  1XBF A;  3S30 A;  3BPS A;  5FYU A;  5GM0 A;  1HB1 A;  2YYO A;  2ZGP A;  2Q8E A;  4K21 A;  4OUL A;  1W6O B;  3VBU B;  4AE2 A;  1HLC A;  1RUG 1;  4UOJ A;  5BNO C;  1VBE 1;  2WIN B;  4FAG A;  5BNN A;  3RYR A;  4ISQ A;  1WCD J;  4LKF A;  1WWY A;  2RHP A;  3OGS A;  3ETQ A;  3NKT A;  4UAP A;  4R9A A;  5LA0 A;  1XYO A;  3LZZ A;  4Z07 A;  3UKN A;  4XJZ A;  1CAU B;  4S2F A;  1DGW A;  3RI9 A;  4FOV A;  3NJV A;  1QJU 1;  2WNV B;  3ACH A;  4GAZ A;  2J1A A;  4PLM A;  4BIF A;  4DPN A;  2E7Q A;  4WVV A;  3VBR C;  2VO5 A;  2MPF A;  3K3O A;  1VBA 3;  3GZU C;  1Q8Q A;  4XFH A;  4Y1Z A;  1LED A;  1VBD 1;  2EXK A;  4XQ4 A;  1YNA A;  1UX7 A;  2JD9 A;  3T2Q A;  3N3H A;  3I4I A;  1D2Q A;  4FP2 A;  4BH9 A;  1NX9 A;  3AKS A;  5JPN B;  4PF5 A;  5LA1 A;  3O1M A;  3DXT A;  4TN7 A;  4NWW A;  3U4S A;  2BRT A;  1BEV 1;  3T09 A;  4MO3 M;  5ABJ B;  2XL7 A;  3B9C A;  3W5M A;  2W1U A;  5FZG A;  3MDP A;  4XAE A;  3O1T A;  3C7H A;  4ZZ5 A;  1PGW 1;  2D3S A;  5IFP A;  5CG9 A;  1Y4W A;  3FLP A;  1V6O A;  3ACL A;  3ZXL A;  4V2V A;  4UW4 A;  3ACG A;  3IAP A;  1JBC A;  4WM8 C;  1LEC A;  4AGG A;  1ZBE 2;  3IZO A;  5LA2 A;  2Y34 A;  1VBB 1;  3VBF B;  5SV5 A;  4XIO A;  4QDR A;  3PDQ A;  2GNM A;  4D94 A;  4J25 A;  4Y20 A;  4ZXE A;  4IET A;  4BWO A;  4JRL A;  1NA1 A;  3NNJ A;  5DAX A;  5IK5 A;  1SLC A;  1VBA 2;  3WOG A;  1E57 A;  2AEN A;  4OI4 A;  3VBH A;  5J36 A;  4QB6 A;  2VUJ A;  3FL7 A;  3HOB A;  2PHX A;  5GLW A;  1ND3 C;  3I3M A;  1GQP A;  3KVB A;  2GN3 A;  4JGZ B;  4PDW B;  3V56 A;  3BOP A;  3H42 B;  1TME 3;  4QDS A;  2AR6 A;  2D6N A;  1ZRI A;  1ZRD A;  2XJQ A;  4NHX A;  5A3U A;  2A6Z A;  3HEI A;  4LLF A;  4W65 A;  3SKJ E;  1RUD 2;  1VLN A;  2BGO A;  1G86 A;  4I02 A;  4A6O A;  1PM4 A;  4UF0 A;  4IL7 A;  1BJQ A;  3VDC A;  2EID A;  5BNN C;  5BY5 A;  4Y1U A;  2OYZ A;  3SEE A;  2VXR A;  5CIS A;  4Q4X 1;  4AL9 A;  4I0B A;  2WS9 1;  4MXW B;  4FPY A;  2RDQ A;  1Q8O A;  5IWF A;  2XML A;  4U2A A;  1U12 A;  2A6X A;  5DAB A;  3NAP A;  4K1Z A;  3WF4 A;  4EZH A;  5LEJ A;  4AED B;  1ZBA 1;  1A8M A;  1T2X A;  4D0Q A;  1TME 1;  1D4M 1;  1WCS A;  1HW5 A;  2JDK A;  3HT2 A;  1GNH A;  4FP3 A;  4YW7 A;  5CFC C;  2JEN A;  1P8J A;  2VMC A;  1IG3 A;  4WM7 C;  3N7J A;  1A3K A;  1LES A;  2WFF 1;  1QMJ A;  3I2D A;  1N1T A;  4HN1 A;  4XIK A;  3URF A;  2Q8O A;  4CCJ A;  3EB7 A;  2VZP A;  5A7N A;  1H1A A;  5FZB A;  1C28 A;  5DAW A;  1HKD A;  1QJX 2;  2J1S A;  3TRS B;  4CXX A;  1NZI A;  1MZ6 A;  5JDB A;  5I0S A;  4P5Y A;  5HI0 A;  4JGZ C;  4PDW C;  4ET7 A;  1GQH A;  4BQW A;  3F95 A;  4XDQ A;  3VKO A;  2BPA 2;  4Q4V 3;  1BZW A;  3MV1 1;  1OA3 A;  4QU1 A;  4JTN A;  1XYP A;  2V4V A;  5K9Y A;  4YLZ A;  1KD7 A;  1AYM 2;  1MPX A;  1I5P A;  2J1E A;  3OPW A;  1OC1 A;  1CZS A;  1J83 A;  2A6Y A;  1XNB A;  4QPG C;  4OHY A;  4RHV 3;  1GOG A;  4FOW A;  3BU0 A;  2SLI A;  5LBC A;  4QQL A;  4A44 A;  1D2S A;  1PVX A;  1NLQ A;  3T1M A;  1T6B X;  1ULF A;  1EUT A;  5FZ1 A;  1COV 1;  3K77 A;  1POV 3;  3BGA A;  4W6W A;  4ZON A;  1EY2 A;  3VN4 A;  2ZMN A;  1LOE A;  1S0D A;  2Y6H A;  1GR3 A;  5CKQ A;  4K3U A;  2QQK A;  1S0I A;  4U36 A;  2ADE A;  1RJ8 A;  1V9U 3;  3ZSJ A;  1UCX A;  1GSL A;  1Y9M A;  2VZ1 A;  3ZIX A;  4C8D A;  2WL1 A;  2P34 A;  2BJS A;  4XFF A;  2GC1 A;  3W58 A;  3HBK A;  1WBL A;  4QX1 A;  4IE0 A;  4LKS A;  3CNA A;  5F32 A;  3P3N A;  1YJK A;  5LEK A;  3IM0 A;  1QQP 2;  3SH4 A;  2HWD 2;  3M4F A;  3MFA A;  5FWE A;  2ZCW A;  4F8A A;  1NLS A;  2G9Z A;  3WHT A;  2R06 1;  5F9T A;  4CEW C;  1C1L A;  1ZRF A;  4JTO A;  1GZW B;  3NNM A;  3CHX A;  1IKQ A;  5A3W A;  3FFQ A;  4UFH A;  5A33 A;  5T55 A;  1F4H A;  3TEX A;  3AL6 A;  5EV7 A;  3J8F 3;  2VQU A;  5F5Q A;  5LBF A;  3ZXE A;  3WW2 A;  4OMC A;  1O4Y A;  3MW3 A;  2WNO A;  5J1X A;  3KZ4 C;  1TNF A;  1XQN A;  4GB3 3;  4XEZ A;  1HJG A;  4OI0 A;  1FOD 1;  2VZO A;  3JBG 2;  2A1X A;  4LKE A;  3KT7 A;  1AR7 2;  2AEY A;  5C8C B;  4WVW A;  5CEH A;  2B9U A;  4AFC A;  2EXJ A;  2R1B A;  1PIV 3;  5FIX A;  4CCD A;  5CA6 A;  2ET7 A;  2XUM A;  3IAQ A;  4XUO A;  3AMQ A;  2RS3 1;  5T5O A;  4BB3 A;  1J59 A;  4AI0 A;  2XJT A;  3TN9 3;  2W08 A;  3CJI A;  4KWU A;  2WS9 3;  2DCT A;  1XSQ A;  4BHP A;  2QUO A;  5DUW A;  1DZR A;  4CP9 B;  2RJL A;  3PIG A;  4DQA A;  2BYV E;  4NHY A;  4DMI A;  1R1A 3;  4XBL A;  4BOW A;  3H3L A;  4M0H A;  1RUF 3;  1AJK A;  3T0D A;  3M3E A;  4Y26 A;  3T2O A;  4PLN A;  5T5P A;  3SNM A;  4HON A;  4JVA A;  4CTE A;  4IEX A;  5BNP B;  5FO7 B;  3WNN A;  4PHZ A;  1CON A;  4JGY B;  4N43 B;  5I0T A;  3RZJ A;  4CCC A;  1C8N A;  2VCA A;  4HKW A;  3PJQ A;  4LBQ A;  4R9C A;  3U11 A;  3FN9 A;  3WG2 A;  4EYU A;  2VUD A;  5A7Q A;  2YFZ A;  2FDF A;  1GYK A;  3GDB A;  1OLM E;  4IDZ A;  3K48 A;  5FYH A;  2XDV A;  1WMF A;  4QX7 A;  2VVE A;  1XNA A;  3H9A A;  1VBC 3;  3GHN A;  2XUE A;  2PFW A;  3EBR A;  2WSV A;  4FPG A;  3WDX A;  1DQ4 A;  1ZA4 A;  1JYT A;  4KWL A;  3ZKU A;  2WC2 A;  2XLG A;  2XGX A;  4GB3 2;  1QJY 2;  1CJP A;  4HOO A;  3DPR B;  3ATG A;  1DIW A;  1GQG A;  3QH6 A;  3TNQ A;  4CE8 A;  3ZFE A;  3WT3 A;  1OD3 A;  1RUF 1;  2VVD A;  4GWM A;  4MSV A;  4CEW A;  4KQ7 A;  1XOY A;  2OII A;  1NCQ B;  5LAT A;  5IW0 A;  2J1U A;  4YGC A;  2R06 2;  1ENQ A;  3TN9 1;  3VBS A;  3TEW A;  5J37 A;  5JZG A;  4WZF A;  4YW3 A;  2JDM A;  2ZEW A;  4MVT A;  2DBI A;  4KU8 A;  2IXH A;  2ZGT A;  2RS3 2;  3ILF A;  5HCB A;  3MIC A;  3NJZ A;  5M0T A;  4MOA A;  1B35 B;  3WUC A;  3AZX A;  5IAT A;  2J7M A;  1K5M C;  2XBO 2;  2Y6J A;  1VBE 3;  4CYD A;  2XJP A;  4GWN A;  1SG3 A;  4N53 B;  3V0B B;  5CIR A;  3P3P A;  5DZF A;  1ENS A;  4DEQ A;  2VZR A;  4XFA A;  4E8C A;  1AYN 1;  1GNZ A;  2VNG A;  2JG9 C;  4AGR A;  1O7F A;  3FBM A;  4IV1 B;  1IPK A;  4EWA A;  1UYY A;  3AM2 A;  3LQC A;  2DUR A;  2VCM A;  1CN1 A;  1CVN A;  3LFI A;  3GZT B;  3RYK A;  3SHR A;  5CFD A;  5L7O B;  4FPJ A;  1RUD 1;  5H9P A;  3BU7 A;  3FJS A;  3N4M A;  1JUH A;  4GD4 A;  3Q9O A;  1BHG A;  3C8X A;  4N9I A;  5BNO A;  3IDE A;  4M3C B;  4RL7 A;  4A7Z A;  2W5F A;  4YAR A;  1H0B A;  1UY3 A;  3ZDS A;  2KM2 A;  1V9U 2;  2E32 A;  3I59 B;  2EVX A;  3N9P A;  3R4D B;  4OHX A;  1IS4 A;  1DLC A;  1QDC A;  5E89 A;  3U10 A;  1LOF C;  2JDP A;  2HWB 1;  1W8U A;  3AYE A;  2QQI A;  4AEM A;  4R4Z A;  1RUI 3;  1IS5 A;  2I74 A;  4IE5 A;  4GQ7 A;  2D43 A;  5DMY A;  5JXJ A;  1AVB A;  3AL5 A;  4FI9 A;  3GBF A;  1CIY A;  3BOD A;  5FBJ A;  2B9V A;  1QGL A;  3EQE A;  4LA2 A;  4Q27 A;  5C3O A;  3IBM A;  1XU2 A;  2YV8 A;  1QJY 1;  1LOA A;  3INA A;  3OSD A;  1C8M 3;  1BBT 2;  2IXI A;  3KV9 A;  2OQ7 A;  2EIG A;  1BK0 A;  3AP7 A;  1RVF 1;  4K20 A;  4IV1 C;  5EYX A;  1DZT A;  1O3Q A;  1ZBE 3;  1WCQ A;  2QJV A;  1S4C A;  3BTA A;  4D8M A;  1SPP A;  5J7M A;  3GCW A;  5LK7 B;  2JIG A;  2BFU L;  1ULE A;  1AXY A;  5FY7 A;  3I2F A;  2A71 A;  2ZAC A;  2R04 3;  2KR2 A;  3O12 A;  4RSU A;  1ONA A;  4WM8 A;  4W50 A;  2NLR A;  2OT7 A;  3EO6 A;  2J1T A;  3KF3 A;  4D7T A;  3KQR A;  1VRB A;  3BTX A;  2D40 A;  4HFS A;  1TMF 1;  4IQP A;  3AP5 A;  5A1A A;  2RS5 1;  4QX8 A;  2YC4 A;  4CDX B;  4S2D A;  4TTG A;  2WFF 3;  1R1Z A;  1HRI 1;  5EIY B;  2WNV A;  1QIQ A;  5FOB B;  2IXK A;  3D0J A;  1L7Q A;  1H1M A;  2A7A A;  2XVL A;  4NII A;  5A32 B;  4ARY A;  3MEP A;  5A3T A;  3RZG A;  1ZRR A;  2CYF A;  1FV3 A;  2HEV F;  4C91 A;  1MS8 A;  3N7M A;  4CPB D;  4NHL A;  4B29 A;  3WLU A;  2VH9 A;  4FXK B;  5JOY A;  3DXU A;  5FBZ A;  4CEY A;  1GP5 A;  4PQ9 A;  5FMO L;  4NRP A;  1YC6 1;  1NY7 2;  1CAX A;  5JR2 A;  5ANQ A;  3DCQ A;  3MI8 A;  2A70 A;  4HG6 B;  2MHF A;  1Z7S 2;  1GZC A;  1AF9 A;  3NV2 A;  1H2K A;  1ZNP A;  3C7E A;  2ZZQ A;  4P9I A;  1SLA A;  2HBT A;  1O5U A;  1S0B A;  1QJF A;  4YW4 A;  4MGS A;  4BYY A;  2WII B;  1FMD 1;  2WR9 A;  3HT1 A;  3TNP B;  1LHW A;  1AYM 1;  1YFX A;  1JHJ A;  4XFB A;  1PMH X;  5IAX A;  3E1F 1;  4GH4 A;  3SCF A;  1LGB A;  4YFZ A;  1Q3E A;  1JUI A;  3VZM A;  4Q4Y 2;  3L2Y A;  1UXX X;  2CSG A;  4QPI B;  2P4E A;  2ZEZ A;  1QJE A;  1O4T A;  2WN3 A;  4MET A;  2F6B A;  4R9D A;  3H1M A;  2W68 A;  4P00 B;  5FZ6 A;  1ULO A;  4XCB A;  1IZ3 A;  5H9R A;  5C9A B;  4K8F A;  2L9L A;  4AR2 A;  2ES3 A;  5GJ6 A;  4TSV A;  3CBN A;  1WCK A;  4RYD A;  3HMY A;  3WCS A;  4QKF A;  3ZYI B;  3ZYJ B;  3SQO A;  2RMU 3;  3AP9 A;  2XWB B;  5KC5 A;  1RUH 3;  1TQ5 A;  1HQN A;  2CAV A;  2OS2 A;  1UN1 A;  4CUA A;  1SDD B;  3KWV A;  1REE A;  1MZ5 A;  3M70 A;  3R4U A;  1VBD 3;  2WLQ A;  4FQZ A;  1QOO A;  5LB6 A;  1JOD A;  1CR7 A;  1DLL A;  2CWM A;  5GLZ A;  1JZ4 A;  4LTA A;  1CD3 G;  5AC9 3;  2P1B A;  1C5I A;  1W03 A;  2ZOE B;  2BBV A;  4CZS A;  1LNS A;  1QXR A;  4CCM A;  2JX9 A;  4NVP A;  5KHJ A;  1W9W A;  4HN0 A;  3POF A;  3RDI A;  4B4Q A;  5K0U C;  5DZE A;  1WMD A;  1KQR A;  3AYA A;  2BWA A;  5CYY A;  2PHL A;  4LBK A;  1A6C A;  3AVR A;  2DU0 A;  2GZW A;  4GMP 3;  2BNM A;  3VL8 A;  3BTZ A;  1TMF 2;  4IND A;  4N90 A;  1EPW A;  1F35 A;  4NPM A;  4QX5 A;  5EJ3 A;  2YDE A;  5FQ0 A;  3VHN A;  1UIJ A;  2GC2 A;  1EAH 1;  3KQ4 B;  2VC9 A;  1MS3 A;  1QY4 A;  3QH7 A;  3P6B A;  1JHN A;  4YPJ A;  5FYY A;  4KBZ A;  4Y33 A;  1OKO A;  2A3X A;  1CQ9 A;  4FFI A;  1FAY A;  4FPC A;  4A3Z A;  4AAP A;  4EN8 B;  3I97 A;  3AKQ A;  3O0W A;  4QQP A;  3VBF C;  4YVW A;  5FZA A;  4AAX A;  1YQC A;  2WT2 A;  1OF3 A;  2ZS6 B;  4AGV A;  1N3P A;  3GBG A;  3OB8 A;  3NRU A;  3S6P A;  2BP6 A;  3C7F A;  5GZE A;  3GM8 A;  3O1V A;  3H8R A;  4XF9 A;  4CDQ A;  2GMP A;  1QOS A;  4FO9 A;  1PK6 C;  5KHH A;  5FMC A;  1ACC A;  2WWU A;  2YY1 A;  2G19 A;  3B02 A;  2PEL A;  3PUQ A;  4XW3 A;  3B69 A;  4BQ4 A;  1PM7 A;  1LJ7 A;  1AUY A;  4COZ A;  2A6W A;  2QDR A;  3H7J A;  4C1W A;  4CU7 A;  1V6M A;  4DNY A;  4NHK A;  3ZFF A;  1ZZC A;  4EJR A;  2WYF A;  1PX3 A;  5I8Y A;  2WO3 A;  2YRO A;  1V6K A;  1X33 A;  1YIP A;  4Z2W A;  3VB9 A;  1ZRC A;  3A7Q A;  4YGD A;  1W6M A;  2BZD A;  1LEN A;  1LU1 A;  2GC3 A;  1W3V A;  4LIT A;  4ASL A;  3VDD A;  2VNO A;  4FPL A;  2RG4 A;  1S0E A;  4H7L A;  5EWS A;  4YG3 A;  2VY0 A;  5FZE A;  2W91 A;  4AFM A;  1YQ5 A;  2B7Y A;  5CBL A;  3M3I A;  3ES1 A;  1MEC 2;  5JVV A;  3V0A A;  1HV1 A;  3WCR A;  5A33 B;  2FZ1 A;  1YQ8 A;  4OLL A;  1XYN A;  2HWC 2;  3J7L A;  3KB5 A;  4XJ8 A;  4Z8B A;  4CXW A;  1KDM A;  1A34 A;  2R49 A;  3LKJ A;  1XRU A;  4DXT A;  3CLP A;  2VR4 A;  3HNM A;  2EAL A;  2AC1 A;  4KI5 M;  3VBH C;  5KXE A;  3JXS A;  1FXZ A;  2I45 A;  5DAQ A;  2BDR A;  1D7P M;  3I3B A;  3ZN4 A;  2BOI A;  3R4S A;  1OD5 A;  3VD9 A;  4LUL A;  1W6Q B;  4CDU A;  1OOP A;  1UMZ A;  1Z7S 3;  3AFG A;  1W9T A;  5C5T A;  1IG0 A;  5FKB A;  4EN9 B;  2UYB A;  3WF1 A;  4HXC A;  1AHS A;  2J42 A;  3I3Q A;  4W4Z A;  5F5A A;  5F2W A;  3ZIW A;  5E88 A;  4Q8K A;  1JZ3 A;  1C3H A;  1F31 A;  4MLO A;  1XE0 A;  1KDK A;  1OFS A;  4CDQ C;  3DEM A;  1R08 3;  5KXD A;  4O61 A;  4NPL A;  2XON A;  3ZSM A;  4P9Y A;  4ZKT B;  1QJU 2;  5BNP A;  1YFY A;  3KF5 A;  2VQA A;  5T3N A;  3NWK A;  4XUP A;  2VTX A;  3UKV A;  5JLV A;  5AC9 1;  1DQ2 A;  4LXL A;  5CFC A;  2V5Y A;  3CEW A;  2ZHL A;  1N1V A;  4QQ2 A;  4ZXK A;  1LTE A;  1UU5 A;  1ZZ9 A;  4KGQ A;  2Q1M A;  3LGR A;  5G04 L;  1QDO A;  1ZBE 1;  2DVD A;  1EV1 1;  3IWZ A;  3PUR A;  4UW5 A;  5FWJ A;  3RZK A;  1RUG 2;  2YBS A;  2R32 A;  2ZGM A;  1GP6 A;  3C7O A;  3CO2 A;  3UJO A;  5L9V A;  1EYB A;  4ERO A;  3WY6 A;  4FTB A;  2JG8 A;  1PNG A;  3N9O A;  2YFU A;  5FZ7 A;  1O8P A;  1WUV A;  5IUQ A;  1VRH 3;  4NN0 A;  1W0N A;  2HWE 2;  3DPR A;  4MGI E;  1ND3 A;  2RDN A;  1BBT 3;  2XKP A;  2ZGS A;  2Y33 A;  4Y1V A;  3GYD A;  4R4X A;  4B7E A;  1UO9 A;  4WM7 B;  2VOX A;  4CEW B;  5HXV A;  5D8A B;  3KS7 A;  1GZT A;  1OBN A;  2I07 B;  1OPO A;  1O59 A;  3PU3 A;  1W8W A;  4HKL A;  4OFG A;  3ZXG A;  4V2W A;  2I2S A;  2OZJ A;  4Y22 B;  5FCC A;  3SH3 A;  1LEM A;  2WQ4 A;  3OYW A;  4LR4 A;  4MYE A;  4DIQ A;  1RTV A;  2KXL A;  3VD5 A;  1YHF A;  3ZSK A;  1CPN A;  3L9J T;  1RUH 1;  5L73 A;  3ZN6 A;  4Z2A A;  2UU8 A;  2X5I B;  5CU1 A;  1DBN A;  1AYM 3;  1OLM A;  2CHH A;  2X53 S;  4NOT A;  4XHB A;  2PYT A;  2OKX A;  1TE1 B;  5EPA A;  1W8F A;  5JOW A;  1M4W A;  5FUP A;  5TSW A;  4QX3 A;  1FPN 2;  3AZZ A;  1VBB 2;  3HNB M;  2RJK A;  5IHR A;  3WNL A;  2PLV 3;  4YVW C;  5LWB A;  3FHA A;  5J09 A;  5JAX A;  1LAJ A;  4N53 A;  3POJ A;  3V0B A;  1QJX 3;  4TXW A;  1K5M B;  4M3C E;  1FNY A;  4QB1 A;  3K2O A;  4I3G A;  4E4D X;  2AH2 A;  4FTE A;  2DDU A;  3O1O A;  5IVY A;  5BNP C;  3MIB A;  3UES A;  2HWD 3;  3ZYG A;  3IKW A;  3R05 A;  4AQT A;  4DY5 A;  4CP0 A;  1VE0 A;  5FPL A;  1BK1 A;  2VW2 A;  4H7M A;  3ENR A;  4A2U A;  3M7A A;  2ZGN A;  1J84 A;  4LOT A;  1OQ1 A;  1FMD 3;  3THP A;  3WX5 A;  3PVN A;  4O7X A;  2WWJ A;  2HWF 1;  5CFD B;  5L7O A;  3AYC A;  5FZ3 A;  2XBO 3;  3PLQ A;  4PI2 A;  2OVU A;  2WWS A;  1W9F A;  3E97 A;  1W6O A;  3K3N A;  2GMM A;  3SCG A;  1YIF A;  4RS5 C;  4Q8L A;  2HWC 1;  1C5H A;  1UD1 A;  1Q8V A;  3NNG A;  5FOJ B;  1QOT A;  4I01 A;  4XQD A;  4DXR A;  3AKR A;  3WEZ A;  3ZM8 A;  4LKD A;  3ZXK A;  2DVB A;  4LHL A;  4LNV A;  4XTM A;  4Y4Y A;  3H1W A;  4UFI A;  4MHU A;  1FMD 2;  3FBY A;  5T50 A;  3POY A;  4QGL A;  4AQS A;  1U5Z A;  3B3Q E;  3VZN A;  2QQJ A;  5C71 A;  2TEP A;  4OQ9 A;  5FPU A;  2ZX0 A;  1NCQ C;  1R64 A;  2OUH A;  1CWP A;  3TEY A;  1R08 2;  3VLB B;  4JDN A;  1HV0 A;  1YCI A;  1PGS A;  3BIE A;  5CZK A;  1YXW A;  1ASJ 1;  1NQD A;  2BBA A;  3VL9 A;  4ZZ8 A;  2BNO A;  3IMM A;  1YI9 A;  1WA4 A;  5FP7 A;  2DCJ A;  4PF1 A;  1OUS A;  4XE9 A;  4L9B A;  1VBB 3;  1SPP B;  4YZ4 A;  5ABJ A;  4LO8 A;  1Q56 A;  2YBK A;  1I3H A;  2R04 1;  3OEA A;  1DGL A;  3K4D A;  4IGP A;  1RGS A;  4HK8 A;  4A42 A;  4IV3 C;  3LFM A;  1UZ0 A;  1LHN A;  4W6Y A;  3RI8 A;  4Q0Q A;  5C3P A;  3QOP A;  1GU3 A;  2D3P A;  1YJL A;  2CY6 A;  1C8M 1;  5EJ1 B;  2GAU A;  4YM0 A;  4R9B A;  2D44 A;  3D82 A;  2XPJ A;  2Q4S A;  5DDJ 1;  4CDX A;  3OPT A;  4EN7 B;  2VMD A;  4OUE A;  4MAD A;  4EN0 A;  1US3 A;  5FR3 A;  4QU2 A;  3W20 A;  4Q4Y 3;  5FV3 A;  3ZYR A;  1JYC A;  2XB6 C;  2Y6L A;  3B01 A;  5FPV A;  3UYJ A;  2QQM A;  4ATF A;  1YUD A;  3THD A;  4Q29 A;  1VRH 1;  1V00 A;  5CKM A;  4WVM A;  3RVH A;  1I9R A;  5FO8 B;  2YC0 A;  4QM8 A;  5FYB A;  3S57 A;  1PO2 3;  4XZU G;  4KG0 A;  1M06 G;  1LOG A;  2VBB A;  3ST7 A;  1UNB A;  4C90 A;  4GWI A;  2HWF 2;  1J1L A;  5KC6 A;  3KT1 A;  4MGZ E;  4UF0 B;  3HPN A;  3FFZ A;  2FDH A;  2DUO A;  4DRR A;  3BKZ A;  3USU A;  4LBO A;  1SQ4 A;  4K40 A;  1RUG 3;  1V6N A;  1C57 A;  3USS A;  3H0O A;  2BU9 A;  1JZ5 A;  4OVE A;  4YZ2 A;  4AVV A;  3PVO A;  1LU2 A;  2IC1 A;  4AED A;  2ILM A;  4AK3 A;  1J3Q A;  4D7S A;  5BPX A;  4IEU A;  1AYN 3;  3RZM A;  1CAW A;  2VGD A;  1DQ0 A;  1N1S A;  5HV4 A;  1HX6 A;  3AX4 A;  3P1I A;  2IVJ A;  1R09 1;  1RMU 2;  1IQD C;  2YBP A;  3D3A A;  4FFH A;  4QPI A;  2E26 A;  3VBO C;  4DRV A;  2QZ3 A;  4HK9 A;  2XG3 A;  3SIT A;  5C9A A;  2IFW A;  2VQ0 A;  3I3D A;  1AR7 1;  4BLJ A;  1OFN A;  4AWD A;  2WZR 3;  4PLO A;  1J1T A;  2BNN A;  4LBN A;  5JSR A;  2RJ2 A;  1OF4 A;  2VCB A;  2WSU A;  5FZK A;  4EE2 A;  2VZT A;  2UWB A;  1COV 3;  1UX6 A;  3MW4 A;  2A3W A;  4UFK A;  3ZXD A;  1CJD A;  4LIV A;  5FLI A;  4BJ0 A;  2ZGU A;  5B4X A;  2LUW A;  4CUC A;  1TMF 3;  4HT1 T;  1RIN A;  3D5O A;  4FPE A;  1E5H A;  2SBA A;  2G9F A;  3DL3 A;  4L92 A;  4S2G A;  3CKH A;  2DVF A;  4DXS A;  2WZ8 A;  4DUX A;  1MVQ A;  4COV A;  1DYP A;  2W0X A;  2Q5T A;  3LF7 A;  4MX3 A;  4XAC A;  5JXH A;  5FDB A;  3E6B A;  4ONU A;  2LAL A;  1JYX A;  2FDG A;  1G7Y A;  3WNP A;  4QQH A;  2VOW A;  3QBQ A;  1QU0 A;  3VD7 A;  3TOJ A;  1DGR A;  2QQL A;  3CQO A;  2NPI A;  1HRV 3;  2DFB A;  2YUE A;  4NO4 A;  5JXI A;  5FPX A;  5K0U B;  3GGL A;  3T1L A;  3NV3 A;  4HLT A;  1K5J A;  1UMI A;  2VL4 A;  3H3Z A;  4JHT A;  1KS4 A;  4BQ3 A;  5D2A A;  5KR7 A;  2IZW A;  2FZ2 A;  3FLT A;  2JE7 A;  4QHO A;  5FQ0 B;  1COV 2;  1ZZ7 A;  2GND A;  5FZ8 A;  3DKW A;  4AHX A;  1OUR A;  1HJF A;  1ENX A;  1NE6 A;  1NCR B;  1O91 A;  1JTZ X;  4E2G A;  5K8S A;  1X9T A;  5E8A A;  4UW6 A;  2V4A A;  4AVC A;  2A75 A;  4ES8 A;  4TZD A;  3C7G A;  1SFN A;  2HBU A;  1LOC A;  2PHT A;  3PME A;  4IEZ A;  2Y6G A;  1W2U A;  4LK6 A;  5FY0 A;  2WAO A;  3LDK A;  4J1W A;  3J8F 1;  4BMB A;  4HKO A;  1VIW B;  2D3R A;  4NAO A;  4E4Z A;  2H0B A;  2ARA A;  5FXW A;  2DV9 A;  2G4I A;  2RVA A;  3VKF C;  4JV4 A;  2P5B A;  3U14 A;  1H6Y A;  2CU5 A;  3I2K A;  5FZC A;  1DF0 A;  4F83 A;  2KD7 A;  2VUA A;  4IE7 A;  2BVB A;  2JDY A;  4IEQ A;  3ZKY A;  4P14 A;  5I93 A;  1BVV A;  2Z4F A;  1DGR N;  5C8C A;  4CDU C;  3M3O A;  4IV3 A;  5F6L B;  1UL9 A;  1W8Z A;  1OPM A;  4OQ8 A;  5A6X A;  4FT8 A;  5SV8 A;  3AMP A;  3O0X A;  1Y43 B;  1Y9Q A;  4XJA A;  2W94 A;  4AI2 A;  3OTF A;  1ND2 B;  2OZ6 A;  2UYA A;  3O0V A;  4FOY A;  1YWK A;  4G9S B;  4LT5 A;  3I7D A;  2R06 3;  3ZLI A;  2QTW B;  2GN7 A;  1UAI A;  1NCR C;  2V09 A;  3QLQ A;  2RDS A;  5F3I A;  4H2A A;  5C5U A;  4BE3 A;  3O1S A;  2RR1 1;  2EXH A;  1ULC A;  1AR9 1;  4ZU4 A;  4O65 A;  4DFS A;  1FOD 2;  1W6N B;  3V0A B;  3MBW A;  4QDQ A;  3OGJ A;  1OLR A;  5JMO A;  5G05 L;  3W21 A;  1QQP 1;  1ENR A;  4LBQ B;  4BXS V;  3IPV A;  4K8R B;  1S0F A;  4E2Q A;  3HQR A;  4RHV 1;  3AZY A;  1JU3 A;  2RMU 1;  1NG0 A;  4H14 A;  2JG8 C;  2GP5 A;  4X8N A;  1MS5 A;  4A6S A;  1VBC 2;  4KWJ A;  1XB9 A;  1BKZ A;  1SFY A;  3KCX A;  4NWV A;  2E33 A;  4HVQ A;  5IVF A;  3WDY A;  1H4G A;  1L7L A;  1AL2 1;  2CTV A;  2Y6K A;  4XC9 A;  4QMA A;  4XMI A;  3RPQ A;  3DUI A;  4Z82 A;  2FCU A;  1OVP A;  4OYU A;  2VTX J;  4CCO A;  5L19 A;  2WZE A;  3M8L A;  2DU1 A;  2PHD A;  2Q1Z B;  2E51 A;  4QKN A;  4OUS A;  3T2P A;  3ZFE B;  1BMV 1;  4YG0 A;  2IFR A;  4NPR A;  4G4F A;  1NLR A;  1QNW A;  1RUF 2;  2JDH A;  3MLL A;  4BZ4 A;  4RGA A;  2QBX A;  1R1A 2;  3ZFG C;  4YRD A;  1W39 A;  4I09 A;  4UW3 A;  1V6I A;  4FSJ A;  1GWK A;  1H30 A;  5LBE A;  2ZMK A;  5H9Q A;  2PXJ A;  3POB A;  5A7O A;  3AXD A;  2ZGR A;  4UXA A;  3UT0 A;  2C1F A;  4BXF A;  1PZ7 A;  3RQ0 A;  4Y5Z 0;  4Q1R A;  4COY A;  1LB2 A;  1PIV 2;  1ZBA 3;  3WG1 A;  4GJY A;  5C70 A;  4YSF A;  1QXP A;  5FZF A;  2DCK A;  4Q4X 3;  4QQO A;  1YEW A;  4I30 A;  2RV9 A;  4CUB A;  2WNU B;  4MHR A;  1IOA A;  2V72 A;  1VMJ A;  1HXS 1;  2N7G A;  4XXA A;  5ACA 1;  4E2S A;  5C3Q A;  3JD7 3;  3CL1 A;  3NAP C;  4OUM A;  1LHO A;  4EWE A;  4YZ5 A;  3I2G A;  1UOF A;  1JOJ A;  1ND3 B;  2VME A;  1PMJ X;  1EUU A;  4ES9 A;  5IT6 A;  1JS9 A;  3SLI A;  3AMH A;  1D4M 3;  2OA2 A;  2VZU A;  5IVC A;  2UWA A;  3VBR A;  3H7Y A;  4GB3 1;  5FYS A;  4OHZ A;  2RR1 2;  1EV1 2;  1YLL A;  2WQZ C;  4XDP A;  3RRD A;  4BPZ A;  1S2E A;  2Z79 A;  2RS1 3;  2WFF 2;  3VKN A;  4XXP A;  1SBE A;  1ZVF A;  4FQ4 A;  4Y22 A;  3OYW B;  1RUC 1;  3JCI A;  1MZE A;  2C24 A;  4QXK A;  4LBM A;  1RB8 G;  5A7P A;  2XVK A;  1MAC A;  3OGV A;  3WDT A;  4ORF A;  1PVC 1;  2VBP A;  3BVC A;  5IVB A;  5IFT A;  5JSO A;  4M3C A;  5K7P A;  3T08 A;  4YVS A;  4XFG A;  1UZY A;  2PLV 1;  2XJR A;  4A7K A;  2ZAH A;  1Z0H A;  3DN7 A;  1RIT A;  3FWE A;  3I59 A;  1OH4 A;  5I8S A;  3MID A;  4QPW A;  3RNS A;  2GH2 A;  2H6C A;  5FXX A;  1CIW A;  1W2A X;  2EAK A;  1C8M 2;  1MS9 A;  3ZSL A;  1XPW A;  4QPG A;  2NN8 A;  3J7H A;  2VAU A;  4IE6 A;  3M3C A;  1BEV 3;  1UZW A;  2VUL A;  1K5M A;  1GIC A;  2ZML A;  2RM2 2;  2C6S A;  4RQP C;  1YI7 A;  3VZK A;  4HET A;  2DVG A;  3KHB A;  1RUI 2;  1OH3 A;  1VMF A;  5BNQ A;  1OLQ A;  4UFL A;  2DUP A;  1GOF A;  1OMI A;  3NST A;  2Z42 A;  4UWD A;  2QFE A;  3HN1 A;  2WT0 A;  3Q8C A;  4PQQ A;  4UT5 A;  1BMV 2;  1IPS A;  1VR3 A;  1X8M A;  1X36 A;  1W8T A;  2WFP A;  1LUL A;  3MHZ A;  1RUE 2;  1DFQ A;  3E5Q A;  4MXV A;  2UUR A;  1XND A;  1A8D A;  3VZJ A;  1VB4 A;  3RMX A;  5D21 A;  3A23 A;  1TEI A;  5FMD A;  1F4A A;  3HBZ A;  4LUM A;  4KL1 A;  4MUV A;  3FE5 A;  1REF A;  4OZX A;  4Q5O A;  1OUX A;  3I2I A;  1NE4 A;  1AL2 2;  1AR9 3;  2VUC A;  3SXW A;  5C8W A;  2RR1 3;  1OOP C;  3FUO A;  4JAA A;  4A41 A;  4E4S A;  5E6H A;  2HYX A;  3HVD A;  1QJU 3;  2TUN A;  1MZF A;  2E63 A;  4CCN A;  4I0A A;  1VMH A;  3MGU A;  4XTP A;  4CEY B;  3W59 A;  2E6V A;  2GC0 A;  2Q8C A;  2D93 A;  2EA7 A;  1RHI 2;  3CU7 A;  1HXS 2;  1WGP A;  4N9H A;  5F39 A;  4NIA A;  1PO2 1;  3WVJ A;  1EP0 A;  1LOB A;  5IK4 A;  2XJU A;  2R1D A;  4B3N A;  4JGY C;  4M01 A;  4RFR B;  4FVV A;  1IGO A;  1Z7S 1;  2AAC A;  2RDR A;  2JD4 A;  1XSR A;  3AC0 A;  2QQO A;  3MIF A;  3NQH A;  4IGO A;  4K6B A;  2O8O A;  4L8Q A;  5F2S A;  4ATE A;  2ORX A;  4QKB A;  1TME 2;  2E7T A;  2JWP A;  4N7I A;  2MEV 2;  1S0C A;  2PA7 A;  4B4P A;  1AR8 1;  1E5R A;  4LO7 A;  3MIE A;  1I1E A;  3POW A;  4NRO A;  3AB0 A;  1H1I A;  3WIN E;  4GH4 B;  4LMF A;  3WUD A;  4IER A;  4XPV A;  5HXM A;  2QQP A;  1UOJ A;  3ZFG A;  5KBF A;  1JOP A;  4TLG A;  4UI9 L;  2X29 A;  1O8S A;  3DPR C;  3THC A;  5DN2 A;  3WF2 A;  2HWE 3;  3NV4 A;  1UZZ A;  4WVM B;  1W99 A;  2JEM A;  1MS1 A;  3JB8 A;  4QWN A;  4DUV A;  1H9W A;  1CZT A;  1QH6 A;  4Q4W 2;  4QAW A;  4XAB A;  2XJV A;  4HZF A;  4DIN B;  2HWD 1;  3RJ2 X;  4CEY C;  4NUB A;  3WG3 A;  1D0H A;  2X05 A;  4QHZ A;  2E9Q A;  3N36 A;  2LM3 A;  3MPP G;  1SCR A;  3MW2 A;  4BU2 A;  2NMO A;  1MS0 A;  2FCT A;  1RUE 1;  2GME A;  5J3U A;  2ZHN A;  1URX A;  1PO1 2;  4O9G A;  2Q1F A;  4COW A;  1D4V B;  4SBV A;  5A6Y A;  2D6L X;  3UK9 A;  3NNL A;  3WNX A;  3WNM A;  1HRV 2;  5GKA C;  3WQB A;  5I91 A;  5JI9 A;  4PBO A;  2A73 B;  4YFW A;  4M0N A;  5F5I A;  1HDK A;  4PI0 A;  2A5Z A;  1AXZ A;  4MGQ A;  1AZD A;  3FZ3 A;  2O1Q A;  4Q0P A;  2BFU S;  2JIJ A;  2Z5W A;  5LY1 A;  2RM2 3;  4Z1V A;  3AMN A;  5ANN A;  4D7Y A;  5FZH A;  5A80 A;  2PAK A;  2G9G A;  2WQ8 A;  1CPM A;  1KEX A;  4NJ4 A;  1Z78 A;  4RHV 2;  5CNA A;  5DDJ 2;  4AHW A;  4DOU A;  5JZG C;  2VQT A;  2ID4 A;  2YPJ A;  4YGE A;  3WSO A;  3QAC A;  3ZYH A;  1JZ2 A;  3AYD A;  5A3N A;  4Q0U A;  4XF4 A;  2CGO A;  3ECQ A;  3KHC A;  2D6O X;  3WG4 A;  3S0M A;  1DDL A;  3DYO A;  4A45 A;  2WZR 1;  2ET1 A;  1EAH 3;  2ZPX A;  2ZX4 A;  3SEP A;  2XQR A;  3LDR A;  3M3Q A;  3ZYF A;  3LSD A;  1QEX A;  5GZD A;  2JKB A;  4Y3O A;  4YWA A;  2JDN A;  3RG0 A;  4DEV A;  4LIU A;  4Y1X A;  3RJR A;  5C4W A;  1H2L A;  1R09 3;  2RS5 3;  4QM9 A;  5FAX A;  3OGG A;  4RQP A;  5E16 A;  4FCA A;  4M3C F;  3OF1 A;  1W2N A;  3IDA A;  4R52 A;  4CA9 A;  3T4V A;  2VE1 A;  1D4M 2;  4CP2 A;  4E8D A;  3NVC A;  2X09 A;  5AFB A;  1AYN 2;  1RUO A;  4Y5S A;  3ETP A;  4AFD A;  2P6H A;  5K0U A;  4COU A;  1RVF 3;  2UY8 A;  2ZAA A;  4Y4R A;  2OX0 A;  4YW5 A;  2FDK A;  2ZEX A;  3WF3 A;  3EMR A;  2P3I A;  1V9U 1;  4NHM A;  1RUH 2;  3VD3 A;  3MZH A;  1KJR A;  1CZV A;  3RZZ A;  1SMV A;  4YM2 A;  2G1M A;  1LOD A;  3QCW A;  3NNF A;  1ZX5 A;  4CU6 A;  5KHI A;  3VGI A;  1NCR A;  3MIG A;  2ZKL A;  1TVG A;  5JOZ A;  1RUI 1;  3KT4 A;  3S5Q A;  3VDD B;  4NRM A;  2FBE A;  2C9K A;  3I2H A;  4AYU A;  1G9A A;  1GFF 2;  5FZ4 A;  1B09 A;  1N47 A;  1XE7 A;  2W1S A;  4AEK A;  1XNC A;  1N1Y A;  2IXJ A;  3K46 A;  3AZW A;  3RYP A;  1ZZB A;  4GXL A;  5KXB A;  5FYI A;  1DYO A;  4JX0 A;  2WAA A;  4BIS A;  1QH7 A;  2EF6 A;  5I0R A;  4NMI A;  4IEY A;  3I2J A;  1QXJ A;  4KNC A;  3VBS C;  1KS5 A;  3KCY A;  5FTT C;  3VD4 A;  1FAT A;  5FZO A;  1RUJ 3;  1UQX A;  1WBF A;  3LEK A;  2Y0O A;  2JIC A;  1JZ6 A;  4EN6 B;  1JN2 P;  3BYW A;  1UPI A;  1JMU B;  3G7D A;  3PTR B;  3HD8 B;  2AYH A;  5JWP A;  1W6Q A;  4CDU B;  1WLD A;  1W8N A;  2ADD A;  2XJS A;  4D6R A;  3NMB A;  1X9P A;  3PHM A;  3RZL A;  4Q2F A;  1RUC 3;  3K4A A;  3UGH A;  2CWS A;  3WP4 A;  5A1F A;  3CZJ A;  3CDZ B;  4XIL A;  1H8T C;  1GOH A;  4FOQ A;  1PMI A;  1IPJ A;  1F5F A;  1W6N A;  3AJY A;  4WBB A;  3TWI A;  2JG9 A;  2VW1 A;  4AVT A;  4CCE A;  5I8T A;  1LRH A;  4NID A;  4OHV A;  5CFC B;  1VAK A;  2CV6 A;  4ITC A;  2Q30 A;  3DV8 A;  3IB3 A;  5LZ6 A;  1MQT C;  3IPV B;  4BA6 A;  4JHZ A;  2P2K A;  4QPI C;  3NKG A;  2YU2 A;  3OD0 A;  3VBO A;  1UW8 A;  1RXF A;  4JKM A;  4OI2 A;  5FXV A;  3VDB A;  2PHR A;  3U75 A;  4JZR A;  1UKR A;  2QKD A;  2JG8 B;  2EIC A;  2R0F A;  2HWF 3;  1O4Z A;  3NJX A;  1RVF 2;  2ARE A;  1DCS A;  3I54 A;  3M2M A;  3BPZ A;  4M00 A;  1RUJ 2;  2JE9 A;  2WJS A;  1RL3 A;  2F17 A;  4X6R B;  4DB5 A;  3BN6 A;  1HQL A;  5A3L A;  1C4R A;  3GJB A;  3PUH A;  1V6L A;  1PNF A;  4XUN A;  2IXC A;  3CMG A;  4WM7 A;  1ST8 A;  2DCZ A;  1SAC A;  4FXG B;  4UBG A;  5D8A A;  1WME A;  1WLT A;  1H8V A;  4BQ2 A;  3I8T A;  1BCX A;  1VBC 1;  3ABZ A;  4LOS A;  2CL2 A;  4ASK A;  3AKP A;  1L3J A;  5JIA A;  1G9D A;  5CB7 A;  4IGQ A;  2DBN A;  4H55 A;  4A7Y A;  2PHF A;  1XJA A;  1CES A;  3GF6 A;  1ZA7 A;  3LIG A;  1HQW A;  4URT A;  3RZH A;  1JH5 A;  1KIT A;  2BGP A;  5DAV A;  5J48 A;  4LJH A;  3VBU C;  1HB3 A;  3VKL A;  4UFM A;  5FMO S;  4CDW A;  4CU9 A;  4ZS3 A;  5A3O A;  3D6E A;  4XET A;  4IEO A;  4X6Q B;  3B94 A;  2V73 A;  3I49 A;  2ZA9 A;  4W6X A;  1ZZ6 A;  2B4K A;  2P3J A;  4QKD A;  4KGG A;  2XOM A;  4RGG A;  3NW4 A;  1YFW A;  2ZGK A;  3G6J B;  5DUU A;  3PIJ A;  5APA A;  5KWR A;  3WP5 A;  4PIZ A;  1AR8 3;  5T5J A;  4P9L A;  4J6G A;  1W8H A;  1PO1 1;  2GU9 A;  3OG2 A;  5EHD A;  5KHG A;  4BIO A;  5DQ0 A;  3MFC A;  4W8J A;  3RGB A;  5CAZ A;  1IS6 A;  1PGL 1;  5A70 A;  3TEZ A;  1XNT A;  4DUW A;  3B00 A;  3X29 B;  3OY8 B;  1OT5 A;  3WD5 A;  1MQT A;  2WUH A;  3PNA A;  3WDU A;  5A7W A;  4OI1 A;  4N7U A;  3NO8 A;  5F1R A;  3H1Y A;  5FRA A;  3POE A;  1W9Y A;  2ZHM A;  1MVE A;  4FFG A;  1X7N A;  1OVS A;  5HPO A;  5FP9 A;  4YZ1 A;  3MPB A;  1G6N A;  3RS6 A;  1NOV A;  2YPD A;  1GWM A;  2D97 A;  4LPL A;  5GZC A;  4NRQ A;  2LTN A;  1QKQ A;  1DQ6 A;  3H50 A;  3KGL A;  1NZC A;  3VUO A;  3KLS A;  4G3Y C;  1FT9 A;  1R08 1;  3R0R A;  2XHN A;  4FPK A;  3WP6 A;  4A4A A;  4LO5 B;  1QJZ A;  1JI6 A;  4BK5 A;  1LKN A;  4XFI A;  1TNR A;  2JEC A;  5D8A C;  4RN5 A;  1H9P A;  3UV9 A;  3APB A;  2J1V A;  1R09 2;  1RMU 1;  2BVV A;  1PK6 A;  4JKL A;  4UBH A;  1W90 A;  5IVE A;  1VBE 2;  2VW0 A;  3FLR A;  1WMX A;  1Y7B A;  2NQY A;  5GAL A;  3JBG 1;  2TBV A;  3VKM A;  1BXH A;  5FY9 A;  1N3Q A;  3J26 N;  3HIF A;  2VCC A;  2W87 A;  3VBU A;  3ALQ A;  5JOX A;  3IIA A;  3LEG A;  1LGC A;  2P3K A;  1UF2 C;  3E6C C;  4I2O A;  3IDB B;  3MUZ 1;  1U5I A;  4H3W A;  1TG7 A;  3P5B A;  4XHX A;  3N7L A;  2ZAB A;  3OUJ A;  3Q8B A;  1HXS 3;  2VU9 A;  2Y8K A;  4JQR A;  3SKV A;  1KJL A;  1YO8 A;  1OXC A;  2RM2 1;  1F9K A;  3B93 A;  4EQV A;  3TAY A;  2XHK A;  5CAD A;  5CVR A;  5LAS A;  2JE8 A;  1KFX L;  5HV0 A;  3BI3 A;  4NIH A;  2VG9 A;  1W28 A;  4XMA A;  1H8T A;  4XJW A;  4RFT 0;  5DG2 A;  3ILR A;  5IJR A;  3KSC A;  3GZE A;  1RUJ 1;  2BW8 A;  5FFO C;  4PBP A;  1APN A;  3WQ0 A;  1PZ8 A;  4ZY9 A;  1AX1 A;  1Q5O A;  4Q4V 1;  2GNB A;  1QJY 3;  5CFD C;  3GAL A;  1VRH 2;  4XUT A;  4ARX A;  2B8M A;  2ZHK A;  1V0A A;  3KV6 A;  3VHP A;  2CDP A;  3N9M A;  2ZKN A;  2MEV 3;  3BCW A;  4NR1 A;  4RS5 B;  5IVV A;  1I5Z A;  4R8H A;  3T0B A;  2RS3 3;  1S55 A;  3USU B;  3E5U A;  2WA4 A;  4AEJ A;  1HIX A;  1W6P B;  2NM1 A;  4SLI A;  1UY2 A;  2AGS A;  2BER A;  3WDV A;  3QD6 A;  1PGW 2;  1Q8P A;  2QQN A;  2W46 A;  2FQP A;  3H8O A;  1G8W A;  1UIK A;  3OGR A;  4AQ2 A;  1DQ1 A;  4C0B A;  1HRI 3;  3AZV A;  1UU4 A;  3VBF A;  4N43 C;  1F15 A;  4ZU7 A;  1GNY A;  5C33 A;  2AEZ A;  1CAW B;  5LRS A;  5LW9 A;  4AVB A;  1W05 A;  1U0A A;  4Y20 B;  3LOB A;  3FMG A;  2JKX A;  2QDN A;  4D3W A;  1NA1 B;  2NMN A;  1UPS A;  1TZO A;  4AHZ A;  1GBG A;  3WZ1 A;  4L0P A;  2IWG B;  1C1F A;  3VBH B;  2XR4 A;  3MYX A;  2QZ2 A;  4URA A;  1QQP 3;  1WW6 A;  1YYN A;  2R6Q A;  2XVG A;  3FC0 A;  3SMH A;  1SLL A;  4JGZ A;  1AR9 2;  4PDW A;  3T4H B;  3A0K A;  2YZ4 A;  4L2N A;  5JPM B;  4N8M A;  3LPF A;  1L7R A;  2XQX A;  1X50 A;  3FHQ A;  1QF3 A;  3H8U A;  1X8E A;  1WD4 A;  1WD3 A;  3ZFF C;  2XL9 A;  2CGP A;  3W9A A;  2ZGL A;  3POG A;  4XF3 A;  4XF1 A;  1HN1 A;  1OQD A;  2D7F A;  2ENR A;  1LR5 A;  1XNK A;  2X5I C;  1PO2 2;  3LOI A;  3O1U A;  2C0Z A;  2O14 A;  1YQ6 A;  2ERF A;  4KG8 A;  3ZSE A;  1O5L A;  1W06 A;  3TBD A;  4FBF A;  1XE8 A;  2HWB 3;  2DCY A;  2VBD A;  1MEC 3;  4DXZ A;  2YGM A;  3B5L B;  2WBK A;  2RS1 2;  2OPK A;  3ITQ A;  4OHW A;  4AFB A;  2WKK A;  1CAV A;  1LCL A;  3NL1 A;  1AL2 3;  4Y24 A;  1SCS A;  4Q4W 1;  4DS0 A;  3UGF A;  5JCT A;  2Z69 A;  2J1R A;  1AR6 1;  2P17 A;  5EP9 A;  4BQY A;  5FMB A;  4LO6 B;  3UKT A;  5GZF A;  4YG6 A;  1B35 C;  1ULD A;  2ARB A;  4AOC A;  2HYK A;  5FYC A;  1MS4 A;  1JW6 A;  2DVA A;  2KA3 A;  3ZXF A;  2C9A A;  3S5A A;  3LEM A;  5EYY A;  1IHM A;  1V70 A;  2NZ9 A;  4TWT A;  1VBA 1;  2YU1 A;  1UU6 A;  3WNK A;  1D0G A;  1LOF A;  2DYC A;  2FMD A;  2HJI A;  2PHW A;  4QB2 A;  5A3M A;  1G9B A;  5JSP A;  1PGL 2;  4WV8 A;  5T5L A;  2VD7 A;  3M1H A;  5C7G A;  3EHK A;  2NYY A;  4YNI A;  1JYV A;  2ZZJ A;  4QGN A;  5F8P A;  1NY7 1;  4FPO B;  5FY8 A;  5FY5 A;  3D8C A;  4YW6 A;  4RQP B;  3UL2 A;  2ZX3 A;  3ZX7 A;  5AFE A;  1JYI A;  2VZQ A;  3LB9 A;  5DAP A;  5FLJ A;  1HRV 1;  3III A;  1U5Y A;  2ATF A;  4Z92 B;  2F4P A;  2A3Y A;  2W47 A;  1W2O A;  4XVH A;  2HWE 1;  2HWB 2;  1UY0 A;  2EIE A;  2Y60 A;  2YMZ A;  4IE4 A;  5DUV A;  2ZGQ A;  5L7O C;  2VZS A;  3T30 A;  1RJ7 A;  4GAL A;  2C5D A;  3I3E A;  4IEW A;  1IS3 A;  1VAL A;  1EPZ A;  2OPW A;  3Q8A A;  1E5S A;  4IV3 B;  3HAG A;  3HQU A;  1PVC 3;  3AMM A;  5ACA 2;  5JMC A;  5IVJ A;  3WW3 A;  1VPH A;  2QNK A;  4UYB A;  5T52 A;  3AKT A;  1ND2 A;  2CDO A;  2VMH A;  3KV5 A;  2WA3 A;  4HVO A;  4XUR A;  3LSE A;  4GMP 0;  2RS1 1;  3N35 A;  3PTY A;  1QHD A;  1PIV 1;  4PT6 A;  1K3I A;  2DTY A;  2JB8 A;  1K42 A;  2VEC A;  3WQ7 A;  1A78 A;  2VPV A;  3OUI A;  4NIG A;  1FOD 3;  5LRR A;  1JXN A;  1S1A A;  1FNZ A;  2A6V A;  1OHF A;  1LHV A;  5DPN A;  2ZX2 A;  5FZI A;  1GZW A;  4P02 B;  5FZM A;  2Q8D A;  2YXS A;  3U37 A;  5DZG A;  5FK7 A;  3OBA A;  2E31 A;  5IK7 A;  1NYW A;  1HRI 2;  2VOV A;  5FLH A;  2D6K A;  3CZU A;  4KWK A;  4XF0 A;  1ODN A;  4QGM A;  3LCP A;  4F7Z A;  4YW2 A;  1AJO A;  4QXH A;  4EZ4 A;  5K4L A;  1X82 A;  3DKQ A;  5EXO A;  3UGG A;  2FDJ A;  3PUI A;  2WO2 A;  3FHI B;  3J4U H;  3C2U A;  4HPK B;  1UMH A;  1K12 A;  2R04 2;  1O3S A;  3K51 A;  4I0W B;  3NJY A;  2VMG A;  2QVS B;  1BYH A;  5F7U A;  5BXX A;  2YG0 A;  2YGL A;  4C1X A;  4FTS A;  4X8P A;  2VMF A;  3IN9 A;  2GNT A;  4CDX C;  4LBJ A;  4PIY A;  2UWC A;  1KRI A;  4KMQ A;  2JXA A;  3WR0 A;  3ZMO A;  5BUV A;  1VB2 A;  4PJY A;  1ZRE A;  2GP3 A;  2XXZ A;  3B7M A;  3GHM A;  2Y64 A;  4JRA A;  2PMW B;  1QWR A;  3BTY A;  4KBB A;  3H8X A;  4MV2 A;  1PX4 A;  2VOK A;  3MF6 A;  1KFU L;  2PQQ A;  4JGY A;  1GKB A;  1VJ2 A;  3PMS A;  4F3J A;  1POV 1;  2W92 A;  4GUL A;  5L9R A;  5J96 B;  5FUN A;  3NV1 A;  1MEC 1;  2ARX A;  2ARC A;  3ORJ A;  2GDF A;  4JDO A;  4YM1 A;  1N3O A;  1WZX A;  1W0O A;  4IEP A;  3PVB B;  1DZQ A;  4JCK A;  4CDW C;  5FJK A;  5GLU A;  4NE9 A;  5DUX A;  4KU7 A;  5CG8 A;  5FPA A;  5FZD A;  4UFJ A;  1S2K A;  5F5C A;  3RWN A;  4D69 A;  2WNU A;  1RUD 3;  1GMM A;  5ERL A;  2PHU A;  2W95 A;  2W2I A;  5FPZ A;  1UWW A;  1S2B A;  1HB4 A;  2PAE A;  2QQV A;  4OMD A;  1S0J A;  1SEF A;  5E1R A;  3VDD C;  2DF7 A;  4JKK A;  1XXN A;  4QX2 A;  4XCA A;  4AED C;  4BQ5 A;  3ZPY A;  4GKY A;  1NAE A;  2QQU A;  3ZMN A;  3KD4 A;  5HCF A;  3LAG A;  1T6G C;  4CU8 A;  3AFK A;  3VBR B;  1QNY A;  4Q1P A;  3C3V A;  1NCQ A;  1V6J A;  1ULG A;  4HMZ A;  2W3J A;  2HKX A;  4FAH A;  1O6U A;  2JDA A;  5KXC A;  4BQX A;  1HB2 A;  4ZHN A;  4EV0 A;  3VV1 A;  5JI7 A;  2Z2S B;  3MUY 1;  1UOG A;  3AP6 A;  5H9S A;  2YHJ A;  2BOJ A;  3LD8 A;  4HVR A;  2R16 A;  1I6X A;  2K46 A;  1VAM A;  4YVS B;  2WAB A;  2EXI A;  1EAH 2;  1CX1 A;  3ZXA C;  1GUI A;  5FYV A;  3UJQ A;  1IKP A;  4RR3 A;  4CSW A;  3JD7 1;  1VAV A;  2W1Q A;  3Q8F A;  3KGZ A;  4QXB A;  4WZC A;  5FY1 A;  4LA3 A;  4AFA A;  4B8E A;  2WYS A;  4QPG B;  3O1R A;  5FYZ A;  3HNY M;  2VOT A;  1HN0 A;  1RYY A;  2GSY A;  5DDJ 3;  1Y3T A;  4AW7 A;  4IXL A;  5CKN A;  4GA9 A;  5BV6 A;  1UOB A;  1LHU A;  5EQU A;  3J7M A;  3ME2 A;  3EJK A;  4CP1 A;  2QE3 A;  1AX2 A;  2WN2 A;  4B1L A;  1ZM1 A;  5GLT A;  4IV1 A;  3N9L A;  3HQX A;  4CRQ A;  4YYO A;  4LOR A;  2ZXQ A;  4FFF A;  4MH0 E;  1JYW A;  2BWC A;  1SZB A;  1VBD 2;  1UYZ A;  3DYP A;  3LE0 A;  2IXL A;  3GZA A;  2CGN A;  3K75 B;  4AI1 A;  3CIH A;  1DYK A;  2WNU C;  3PU8 A;  3LA7 A;  1IQA A;  3DYM A;  4YVS C;  5BNN B;  4XFC A;  4AZZ A;  1AX0 A;  1FV2 A;  3ZYP A;  2VM9 A;  2VTF A;  3V65 A;  3VDA A;  4E9K A;  2WNV C;  2E53 A;  3MV0 1;  2R30 A;  4LO4 B;  4WVZ A;  1G9C A;  4QT6 A;  1OQE A;  1PZ9 A;  2B5H A;  4OZO A;  1CAU A;  2CAU A;  1FX5 A;  4LHK A;  3AK0 A;  5GLV A;  3T2T A;  1YFU A;  4CCK A;  2W39 A;  3OBR A;  2VMI A;  1AXK A;  2DUQ A;  4MZU A;  3R6S A;  1PK6 B;  1PHM A;  1RMU 3;  2X8K A;  4D6S A;  1AR6 3;  3L2H A;  3W5N A;  3U07 A;  2FCV A;  3O5S A;  5FO9 B;  5C9A C;  5HBA A;  3JB4 C;  4IEV A;  4OCT A;  4P9J A;  3WF0 A;  5C8C C;  3K4Z A;  4WM8 B;  4BM8 A;  2HEW F;  3IDC B;  4FPF A;  4ASM B;  1Y9G A;  1AR7 3;  1BQP A;  2BGC A;  3GXU A;  5A7S A;  3JBG 3;  3BAL A;  5IYY A;  2F4L A;  3OCP A;  4BCU A;  4DZG A;  3H3U A;  4BQ1 A;  3A0N A;  4GIQ A;  3V64 A;  2H6B A;  1J3P A;  3D0S A;  3LDB A;  1QJX 1;  1OKQ A;  3KM5 A;  5EFU A;  2AUY A;  4C0H A;  2PTM A;  4IW3 A;  1W9S A;  5A6Q A;  2LS6 A;  3S7E A;  5FXZ A;  1H8T B;  1VP6 A;  2P37 A;  3ZFG B;  4B4R A;  3LPG A;  5A32 A;  5FZL A;  5AC9 2;  4CPB A;  5HCA A;  3HJR A;  2MNG A;  1RC6 A;  2O0O A;  1DP0 A;  2Q0A A;  1U5X A;  3ZDV A;  4DY3 A;  3ZFE C;  1JYN A;  1FPN 1;  2JB4 A;  1SFP A;  2C26 A;  1W04 A;  3ZOI A;  1NKG A;  1ALY A;  2XLF A;  3A4U A;  1SBD A;  2QCS B;  4JQT A;  5FYM A;  3SH5 A;  3DF0 A;  1W2T A;  1CAX B;  4L97 A;  4Q0S A;  1GP4 A;  3MO4 A;  4RS5 A;  2RMU 2;  3B9I A;  2W52 A;  4QHB A;  1FI2 A;  2Y38 A;  1POQ A;  3GJA A;  3ON7 A;  4AQ6 A;  5FUI A;  3SCH A;  2K0G A;  3U78 A;  1GAN A;  1W6P A;  4ISR A;  4PCR A;  4MXW A;  5FYT A;  2X10 A;  4XQW A;  2VJX A;  3PL0 A;  4XUQ A;  1RED A;  3NAP B;  3PUS A;  3JZV A;  4JDM A;  4V1P A;  5A6Z A;  1OA4 A;  3AP4 A;  1UXZ A;  1BBT 1;  4IUG A;  4MGY E;  5JUV A;  2TNF A;  1MR5 A;  1XC6 A;  3PUA A;  4Q4Y 1;  4AF9 A;  4QXC A;  4XBN A;  3OEB A;  4RA0 A;  5JR7 B;  3VZL A;  3ELN A;  4CXY A;  5EZW A;  4O9E A;  2PQS A;  2MEV 1;  4Q26 A;  3OOX A;  5FZ9 A;  4B1M A;  2D6P A;  2K2S A;  2Y6F A;  1NA1 C;  1H4H A;  2FD8 A;  4Y1Y A;  4HSL A;  1ZYB A;  2K9Z A;  2P6C A;  3Q8E A;  3KVA A;  2EIB A;  2BUK A;  4ZU5 A;  2PN5 A;  1UY4 A;  5IK8 A;  1DU3 D;  4LUK A;  3WQ1 A;  5I0D A;  4Y5T A;  2BV4 A;  3ES4 A;  4P9W A;  3ZO0 B;  5LBB A;  1FPN 3;  2D6M A;  3MF9 A;  5F3C A;  2XLA A;  2DTW A;  5J98 B;  2W9X A;  1NT0 A;  1UYX A;  3KCC A;  1POV 0;  2C4X A;  5FRE A;  3U1X A;  3UNP A;  3E5X A;  3PVE A;  1RHI 3;  3VHO A;  4TLF A;  1OA2 A;  4CCL A;  3SC7 X;  4ZPI A;  4FPH A;  4P5H A;  1ASJ 2;  1WCU A;  4B7K A;  5FP4 A;  5C4W B;  4MG2 A;  3J7N A;  3DEC A;  2YB7 A;  4YGB A;  1CAV B;  1KGY A;  1NUK A;  1RIR A;  5A1L A;  1JOB A;  3E6D A;  4RD7 A;  1YQ2 A;  2FMY A;  3LA3 A;  1Q43 A;  5HCH A;  4LHS A;  1YRZ A;  3ZPO A;  3ZR5 A;  4LBQ D;  4DO0 A;  3JD7 2;  3T0A A;  3OPZ A;  3RMY A;  3WNO A;  1WLW A;  2WO1 A;  1DG6 A;  5ISL A;  3ROU A;  1OSG A;  1PVC 2;  3MLK A;  4D6Q A;  5ACA 3;  3ACF A;  2WT1 A;  2VZ3 A;  3FX3 A;  4Q4X 2;  2B45 X;  1DGW X;  1XU1 A;  3JQX A;  4LE4 A;  2ZBJ A;  3ZXJ A;  3GCX A;  2DWR A;  1ZBA 2;  1J58 A;  4L11 A;  3CF6 E;  1O3R A;  2OUJ A;  2Y0I A;  4YVW B;  1NXD 1;  1WA6 X;  1GWL A;  1WW7 A;  1WKY A;  2W1W A;  4M4R A;  3N7K A;  5BYN A;  1E5I A;  4CDQ B;  2BQP A;  5JXG A;  3U4X A;  2ETE A;  2LRO A;  5C4W C;  5JIU A;  2OQ6 A;  2VNV A;  4JC1 A;  4I3P A;  5D1I A;  5B4N A;  3ASI A;  2QQW A;  3ACI A;  1SHW B;  2PLV 2;  2H0V A;  3LEI A;  4XDO A;  5FZO B;  4LEJ A;  3J9S A;  4P9X A;  4J1X A;  1WW4 A;  3O7O A;  3MIH A;  4LE3 A; 
#chains in the Genus database with same CATH homology
 1XE0 A;  4N8M A;  1K5J A;  3T30 A;  1XB9 A;  2VTX A;  2VTX J;  4CA9 A;  1NLQ A;  2P1B A;  5EHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...