1XBDA

Internal xylan binding domain from cellulomonas fimi xylanase d, nmr, 5 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
87
structure length
87
Chain Sequence
TGCSVTATRAEEWSDRFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A family IIb xylan-binding domain has a similar secondary structure to a homologous family IIa cellulose-binding domain but different ligand specificity.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords XYLANASE D
total genus 6
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xbdA00
1XBDA 2CWRA 2XBDA 3NDYE 2CZNA 1HEJC 1HEHC 1EXGA 3NDZE 1E5CA 1C7SA 1QBBA 5DHEA 2RTTA 1E5BA 5DHDA 1QBAA 1C7TA 1EXHA
chains in the Genus database with same CATH superfamily
2NY0D 4A2GA 2GG1A 4ZD3L 1X9RA 2A1WL 4XN2A 3U9UA 3RWIB 3U46B 5ISZA 1NCCL 4PJ9D 1CI3M 1HL5A 4KMLB 4X4ZA 1A5FL 3MLTB 1LEKB 5J12C 4IRZA 4JFSA 3BAXA 5EZLB 4DP9X 2VXVL 1JERA 4HH9B 4MRBA 5TDPB 1KT2A 3BAEH 4FQJH 3SZKC 2R4RL 4FQHB 1PGRB 3WTUA 4JPWL 4MSWB 1DBJL 2NXYC 1MWAB 3ROLB 3ZDYE 3BH8B 1TTRA 3IDJB 1GY2A 3L7FB 3QJFA 3MRRB 4FFYA 2ZOKA 4PJGA 4XNUL 5MEQA 3FT3B 3KYOA 3VH8G 4F8OA 4XMTA 5KTEH 4FXGC 5CEZE 1E9PB 1S7TB 2X4QA 3OB8A 2UZXA 4W9KC 4RZCA 2G3NA 4LPTA 2CO7B 3FFOA 2C9RA 1U21A 3MACL 3FO2A 4IKKA 2HRLA 2NMSA 3DV4B 1FO0L 4LEXH 4CADA 3F01A 3QIWB 1IQDB 4OJDH 3KLQA 2VR8A 3F05A 1MW3A 2F68X 2FNBA 3HZYB 3QNYB 5J8OA 3GRWA 3O81A 5B3NA 2P49B 1MPAH 2IADA 2Q7YB 3ZSSA 4LCIL 1DQIA 3BAIA 3LKNB 2QQNH 4FGMA 1QACA 2ORBL 3FJTA 2H1PH 5F3BA 1NANH 2AW2A 3CFEB 2H0EA 4NP9A 1AXSA 1DO5A 3QJVB 4KUZL 3GQFA 1TEFA 3KPPB 4PWFA 4Y19B 3OMIB 1SM3H 2W0KA 4KH9A 4IBWA 4APQB 5I1IL 1NM9A 2NZ9C 3V0HA 4NN7C 1GZQA 3MREB 4KAQL 1Q0YH 2P5PA 4N0UE 2NSMA 3OQRA 1MHEB 4N2BA 2VLLA 3SDXB 1MCCA 1QWUA 5E2UL 3Q3GA 1GYWA 4QHMB 5D8JH 3AUVA 1T7YA 5J13C 3GMNB 5BV7C 4F37K 4HCRH 3LQZB 5HDOA 4ADGA 3JWDL 4PUBH 3EGDB 5CZKA 4PJ6A 3DTXB 1BOGA 4IBZA 4EI5A 1JHLH 2G4GA 1H5BB 3ZDYB 1CJYA 3V6OA 4KU1A 3CSPA 5B7MA 1CIDA 4UQEA 4JZNB 1XEDA 5D1ZB 2EE3A 3OZLA 5M94B 1RURL 4L9DA 3MNZB 4OUUA 3K46A 4Z7IA 4JFDA 2HVJA 1MDTA 1EGJH 4NAMA 3S97C 3V9FA 3H7LA 1N2RB 3NJXA 5EH1A 4EI6A 2V2TA 2IG2H 2J8OA 4Y4HD 3AQXA 4WU7A 4ZMWA 1PYWA 2WXKA 3N5AA 4HKXA 1NDMB 4ODBD 4XPHL 1XAKA 4YSTA 3BPOC 1ZPLA 3EDDA 1NGPL 2HVBA 3SGEI 1B4RA 1E9QA 1AKJD 4L1BA 3BN9D 4HUVA 1OB1A 4RMQA 3OGOE 3L5WB 2DMHA 1RK1B 4BDVA 1CDGA 1OGAB 5CFHA 2R7EA 2N56A 3BZFB 4Y19A 4QLRA 1KTCA 1W0VB 3UYPB 3V4VB 2XQYA 4Z0XB 2ZWNA 4CJ1A 1KLUA 1RZJH 2X05A 4BEIA 1U8QA 1AIFA 2CKBB 4OD1L 3MJ8A 3CH8A 1DLFH 4QDGA 2WBKA 2B08A 4RNRB 3V5DA 4ZSOE 3UIZA 3W9DA 5SWSE 1AP2B 2DQFB 3WJMA 3PWUA 1SYSA 5IKCB 2ENSA 1S7SB 3UFIA 4NRXB 3GHEL 5I16A 4NKIH 5ICZB 3ABLB 3HUJE 1HKFA 4PWEA 2H2PC 1CICB 4YL9A 3JVGA 5DFAA 4NQED 3CFJB 1IL1A 3MRMA 4BYHA 1U8JA 1G7LA 1CGVA 1WIUA 3L3OA 4Z8FL 1RERA 3B2DC 1F90H 2H0FA 4C58B 1BIIB 1UM4H 3T2OA 4KJWC 1VZHA 2FX9L 4XN4A 3R0MA 5C07D 1KG0B 3T04D 4UUJB 4B53A 5BRZE 3ILPB 1MLCA 3BCDA 4OTXL 4WCYH 1RVFH 1BVNT 2ZP8A 4QO1A 2R1YA 5DUML 2W65B 1MCBA 2ZOKB 1GGBH 3AITA 3UC0H 4HOXA 1E2WA 3MJ9L 2BX5A 4WU5A 1JRHH 2B3RA 2P8LA 2Y7QB 4ZFFA 3P30H 1K4DB 2BCKB 2OJEA 4J28A 5EZIL 5B7FA 3MRPA 4JPIB 2ZOLA 3L95A 3WS6A 4WJG3 1IKOP 1SJHB 3S5LA 5AOMA 3FH8A 4KMTH 4O2FB 2NY4C 1J9SA 4XP6L 2ZICA 2VM3A 3KLAA 3AT9A 5IVZA 4W4OC 3SKJL 2CR3A 5IW1A 2Q9OA 5AZEH 2ZYSA 3MRMB 2ZTBA 3K5SA 4X6DE 2FR4A 3TIDB 3V8CA 3SIKA 5KBKA 2D03L 2I60H 3BUQA 2H32H 4XCCH 5I16B 2X9YA 3SGKC 4BXVA 2PPFA 4BCYA 5GGRA 3E1ZA 2VL5A 3CHXA 3OWEA 4POZC 4PLOB 5IVNA 3S4SA 5JIIA 3VI4F 1F3DH 2ICWA 1DQQB 1IQWH 4CKQA 1VLXA 3D05A 3EYVA 2VUOA 4LBEA 2X40A 1ASQA 1MHPL 1NEZA 2OMUB 5HJ3B 3CD4A 4I48B 5GZNA 2H3NB 2ITDB 4M6ML 3NSJA 2P5WA 4WHTB 4XH2A 4KGLA 1NIFA 3MOAH 3QNZB 4XGZA 3TWCH 1VPOH 1KDJA 2QTEA 1SYVA 1NSNL 3MNZA 2DRUA 4OUUB 1JK9A 4M8UA 2AEPH 3QIBA 1OSZB 3KHOA 2F0CA 1FL3A 1N2RA 3P4OB 4HJGA 5CBAA 3OQ3B 4ZFOB 2XJLA 3QDGE 1MEXH 3MDJA 5TE7L 2FWOB 2VO8A 4N90E 2VISA 1E67A 2VITB 5GRYA 1ZPUA 2E74C 1Y0LA 3VRIB 2XY2A 1A6WL 4F7EB 1MI5D 1MVYA 2E9IA 2XQ0A 4LE8A 1NEUA 1KEML 5EEWA 2AXWA 2VERA 2YWYA 3ZDZF 4J7RA 5HD8C 1REIA 3MLXH 5EO0B 2OMXA 3DRTA 3HG4A 3RL2B 4DN4L 3MUJA 3M1CA 1WZKA 3G6DH 3NIGB 3BDXA 1N5AA 4NSKA 3O0LA 3AXLB 1OTSD 2CGRH 1W0VA 1MCWW 3IDGB 3PJNA 4Y1SA 1BWWA 4YBHA 1OTTD 1E27B 2QQKL 4EMZA 2H7WA 1FNHA 2ZKXA 4XR8C 1MCWM 3SBWA 1DL7L 2WTRB 3MV9B 3GBLA 1JS4A 4YGVA 4YSDA 2AEWA 3QCUL 4MCNA 3QIUB 2BVOB 1AD0A 1EZLA 5J6HB 4XNZC 1BXVA 4QRUA 4MJIE 4MQXC 5EPMA 3ZDWA 2NR6A 1E3FA 2APVA 1U92A 1OGTB 1HXYB 5BVPL 3LKQA 1QSFD 1FNAA 4K5PA 2Q10A 2AK1L 3GSXA 3QFGA 2APSA 5CMAB 4N1EA 1SHXA 3G5ZB 2BZDA 4IRSB 5ICYB 3BSZL 3FNKA 3P0VH 2E7DA 2KDYA 1C5CH 1UUSA 2BPBA 1RIUL 4NPYA 3IDYB 5HYJD 1KJ2L 3VXRD 3JTSB 4NQDA 3TVMB 4P49A 3J7HA 4M7ZC 1S5IL 4GO8A 4BH7B 2DQTL 3F7VA 4XVOA 1N4XH 1OGTA 1Q9WA 1YAZA 2XY1A 3BH8A 1P4BL 3NZHH 4AOFA 2ZWZA 4PSPA 1G4RA 1NGPH 1WBYB 5CU9A 4BFNA 1XH0A 4ANWA 1X5IA 4M00A 3CXFA 2EDWA 1L9MA 3DI3B 4LESA 1F58L 3ZPDA 1XH3B 4KRLB 2YKKA 4UV7H 3VGGA 3QI9C 2JKJA 1CBVH 3NZHL 5AAWC 2WQAA 1A6TA 2VW4A 2CUMA 1KJMA 3ARDA 1RXLA 1FE8H 2ZPKH 5I1AA 4MAUL 5J9PB 1L3NA 2NNCA 1L7TH 2QZQA 4LIQE 1XBDA 3X1FA 2DOCA 4N4YB 3ATDA 1GOHA 2G2RB 3TIDA 3FFDB 1HXMA 4Z7WE 3HG1E 1WE5A 3WFHB 5DFVD 2OW7A 4IHOA 4Y5XB 1LO3H 5T1LA 1EJFA 4WI9A 3QUGA 3DDGA 4DJMA 5BV7H 1OAUL 1QATA 4MB3A 4OZHA 4FNRA 4QCIB 5KSVA 2CM5A 4UOJA 2UVEA 1DUYB 1SJMA 1DQDH 2UZYA 3DURA 4FI7A 3F12A 3F7PC 4GH7B 4HJTA 5HGHA 2OR9L 1S7RB 1YYCA 2OMNA 4NHUB 3UBXI 2Q7NA 4BZ1L 1A4KB 2Q8BL 1T80A 3QIBB 3ZVVA 5HYJA 4JR9H 3OAUH 3C6LA 2ZXQA 1YJDL 3HLAA 3SYAA 4X5PA 4R4NC 1HU8A 1A5FH 5CGBA 2R1YB 3FO1B 5FO8A 3EYQC 1G1OA 1MLCB 4YQXH 3PJLA 4DO6A 1VZGA 2ADGA 2ORBH 1BXXA 4OQTA 3GM0A 1DN0A 2LQRA 1U95A 4PRHB 4EAEA 2F19L 2LU4A 2IMMA 4WU5B 2NY6C 1KT2B 2WCGA 2C3VA 4OD2B 3ROOB 4PJFF 4U6YB 4AIOA 1NBYA 5B3SB 3L9RB 1NFIA 1D7BA 3RGVD 4HLZG 2A6JA 3OSVA 3WE6B 1FO0H 5CZVH 2A77L 4F15C 1P5UA 3JZ7A 2B9AA 3NFNA 3HZVB 3O4OC 2YPKA 3JT2A 4J3OC 4M03A 3T9WA 4YGAB 4LQ1A 1PEZA 4HIQA 1Q1JH 3RX7A 1P6AB 2XVKA 1KYAA 2BSRB 4FG6D 4HBQA 3MOAL 3TWCL 1AOZA 3RFRA 5ANHA 2CSPA 5A3IC 4TUOB 4YDMA 4Z6AT 1ES0A 5TQ0L 1A1OA 2R0KL 2GJ6B 3BGMA 3WNMA 1UA6L 4PTUA 3V9EA 3BLPX 3S8GB 4G83A 1DO6A 3NIFB 3EJPA 2EUWA 4Q2ZB 2BY2A 3T2QA 4FQJL 1J12A 3ZTEA 4N1HB 3SGDH 1HZLA 3NQIA 3OPUA 5A16B 1AKJB 3N2JA 5KSUA 3QXAA 1T6WA 4AW4A 5HYSG 1UWEL 1MCIA 5AD0A 1DVFC 4PS4L 3O6FD 3QDMB 1Z9SA 2AANA 3BZFA 3U1QA 3IAGC 4F8LA 3BQUD 5CN2A 3FU6A 1GW6A 1WCBB 4RQQB 4XXWA 1XB6A 4DVRL 4ZMQA 2WQRA 5FCUH 5D5MB 1WFIA 1JZFA 1QFWL 1CFBA 3VI3E 1QR1A 2C3HA 5TF1H 3ZR6A 4X0NA 4U1HA 1KBPA 3FN9A 3FL7A 4YPJA 5IHWA 4JJ5A 2G5UA 1ZT1B 4LF3B 5IP4A 3PQYD 5HGBA 4MCZA 5HYJE 1CQYA 3IETB 3LEYH 4PRHE 2PTVA 1OWWA 4PJ8C 1ET8A 1ZEAL 3V6ZA 4FJZA 1EZUA 3KYAA 5DHXB 1KWKA 4HWBA 1CT8A 1GCYA 1FNSL 1QRKA 2BSTB 3RNKA 2C9QA 1FFOA 2VLRB 4BZYA 2EEDA 2R51A 2CXKA 2CWRA 4JO8A 1RZIB 2YD2A 4PGCB 2XQYG 4PLKD 2YQ2A 1I9IL 3H9HA 2BH0A 4DAGL 4MJID 4G8GA 2G75B 3IB4A 4WNSA 3GK8H 1FQ9C 3UTQA 1DBML 2CDFB 3MLYH 4AVKA 4CC1A 4S2SA 3ZE1F 3D08A 1OSPH 1T5WA 5AAPA 5FLVA 1R0AH 2IWFA 4N28A 2J6EA 1N0XL 3ZTNH 5F9OL 1DJYA 2P8PB 3HE6B 5FV2A 1QWHA 4I0KA 4MWFB 4KKNA 4JG0H 2ZNXA 5KYYA 2B1HL 1AGCA 15C8H 3HG1D 2WLMA 1PIGA 1TZHB 4H0LC 1EUUA 5D7IA 3X13A 3NIFE 4MKTA 4EUPH 2X1XR 3CN1A 3MV8B 1NWOA 4TOYL 3UO1L 2EDXA 2DQHH 2AAVA 2YAFA 3VDAA 2OS7A 1EFQA 4TVPE 4XHJD 2WM0A 2AQ1A 1Z9PA 1GYUA 3VM7A 2CBQA 2IADB 3T0DA 4ZTOH 5ITBL 2UZXB 4JAMB 1KY6A 5A7BA 2XPYA 4LPYA 1D5BA 2Z31B 4LRIA 1OAKL 1J0HA 4K5OA 3FAXA 4YXLH 5MEQB 3ZIMA 3RPIB 2H3NA 3B2MA 2GFBB 2COQA 1KXVA 4KKRA 4HC1A 3AWEA 3SQBA 4G59C 1IJ9A 1IGJB 4APXB 3S96A 3EUUA 2X7LA 1N8OE 3ECQA 5D1QE 3VJ6B 1G6RA 4FAAB 5GSVA 4KJYB 3NSYA 1J1XH 5TF1L 2O5ZH 3LIUA 3W2DH 4FQQA 2DIJA 2KZ1B 1WPCA 1CR9L 4IMLA 1I9RH 2ED8A 3N55A 2XACC 2R2BB 2PTTB 2E9GA 2OSXA 4F7TA 1AGFA 4PB0H 4H0HB 15C8L 1ZA3A 1WF5A 4XMVA 4A7GF 3VCLA 4XMLH 1H3TA 4OGXL 3FO0L 3WTXA 3NACH 1ZGLA 4NO0D 1A2YB 5DHVH 1L9RA 2YZ8A 2KUTA 4LAJH 2BHZA 3GD1C 1XGPB 1NUNB 2VLJA 3EO0A 4XWOD 4FQXC 1NGXA 3VB8A 1EEYA 4X98A 4JPIA 3FZUD 2IAMD 3ARBD 2CLRA 3CN4A 2IBBA 4QF1A 2V17L 1A6UH 4GAGL 1UM5L 4IIQA 5FW6A 1MOEA 2PW1A 2L4OA 1V3JA 4AQOA 4LLQA 3L4YA 5GZND 2O26U 5B39B 4WSKA 4HK0B 5KBLA 3GSOA 4R90L 4LRIC 1FIGL 2CJUL 4TKWA 1MCPH 1KB9J 4N8VG 3TIEA 4L3AA 1LHZA 2E7HA 1V05A 1HYSC 2HRGA 1ZSDA 1SF5A 4QY8A 4AY0A 3GM8A 5IFHH 4KKCC 2LU5A 1GA2A 4OSUL 1NCAL 5KAQF 3N43B 3NVQA 2FYYA 5DEJA 3KLHC 2ZSWA 3NRPA 4DGYL 1DJSA 3LPPA 3WE6A 3MRBA 4XPTH 1SY6H 3DOIA 4LLMB 2D4DA 2WXOA 1FH5H 2YAHA 1R75A 4Q9QH 4TQEH 1G7PA 1HAWA 3WFDH 4XNYH 3GXDA 1VFAA 1HKLH 2NY7H 3KPRD 4X99B 2WLLA 2R56H 5DXWA 3BXNB 1OF2B 3LTVA 2V5MA 1Q94B 2D2CC 2G9HA 3TNNB 3LHPL 3VXNB 3NG5A 3CDZA 2QGCA 3ZDZB 5I8EA 1X7SA 2FRGP 4MHHG 4NQVB 5HHOB 3QUYC 1W91A 1WT5C 2UY6A 3N9GL 1LMIA 1OM9A 3ZO9A 2NTFA 3RURA 1J5DA 2CRYA 3TZVC 3GXTA 2VZUA 2FLRT 2CNZA 2A2QT 4KNQA 3EYFA 3PHOA 4RGNB 4PEEA 1DYZA 1UWGH 4HD5A 4MXVF 1KEGH 2APWA 1S7XA 3EIFA 4GW4B 5CXPA 1WBXA 1BYPA 5K69A 4YDKH 1SJVA 2EYRB 1A3RL 1OKEA 5EZPA 1KCBA 1NC2B 3GHPA 1BBJA 3M1OA 4Z77A 1U30A 2W07A 5D4QA 3KH4A 3HE7D 1N8ZA 4U7MA 2DD8L 1HHHB 3L9EA 2X4PB 5FC9A 4F8NA 1YYML 1Z5LB 1AZCA 3MBWB 4NC1E 2OMWA 2NZIA 3ARFA 5HJBA 4P2OB 4M9OA 4WWPA 2DTSA 1PL3A 1UWXK 3BAJA 2XTJE 3VMNA 3F8UB 2QGDA 2VABB 3PGDA 4K94L 4OY9A 3WL9B 3S9DB 1U8OB 4E9WA 3T1FB 3MJ7B 2AABH 3FSAA 4NWTL 5DVPA 1I7ZB 4ZT1A 1G7JA 3KS0J 4X9HA 1MAJA 1AHWA 3ZYJA 5EZOL 1B3IA 1B90A 2IFGA 3NCEB 3HI6H 3Q8EA 4XCYA 5JMRA 5ISZD 4NT6B 5GSRB 3UTTB 5JHLL 3QR2A 1EMTL 1D5IH 5EU6E 1T1ZB 1S7WA 3MAWA 3MRLA 1T7VA 1U8HA 3N44F 1SPDA 2DLFH 1U3JA 1CU4H 4G70B 4X80L 5DC0A 5EEZA 5LBSL 4BSJA 5JIPA 4C83B 4I0PB 4Q6YA 4GINA 3VXRA 3LVTA 2KPWA 4YDVB 1JV2A 1S3KL 3QUXC 4J2XA 3OKEB 3MV9E 3VMOA 4QUOA 2PW2B 4RFNB 1YA5A 2CJ3A 4U3SA 4PVNA 3RGVB 1NC2A 4KX8A 3IPFA 3LZOA 5IW3A 3K6FA 3KPSD 1FPTL 1N70A 2XDHA 1MRFH 1NFDE 3RA7L 3D09A 5E95B 2JTDA 3G5XB 3D3VB 2ZX8A 3BVUA 2F54B 3QR0A 4DN4H 2YS4A 3DDFA 4R7NB 4AZUA 1J0KA 3X13B 2DYPA 1N4XL 4AT6B 2OX5A 4FOMA 3N40F 4AYBA 4GKZB 3MBEC 3D12B 1NFAA 4C4KO 4YEEA 1XGTA 1DSFH 1FZJB 4L2LA 5HHOD 4N2NA 2VZ1A 5T1LD 4O58H 3MSPA 1M57B 1T03L 2OK0H 1BX2A 1DJHA 3OXSA 1KEGL 5HTSA 5EBLB 1HWWA 4OFPA 5D7LE 1ERNA 1RJYB 3HPLA 3PPEA 1D5BB 2Z31A 4BKSC 4JJ5B 1EVUA 3D85A 4HJSA 3QUYD 3JXAA 3N41F 4HIHA 4HMCA 1XZ0A 3ZU8A 1AQKL 4MHHI 2QPEB 2XWEA 1UM4L 2E6PA 5ABAA 3FKUS 4OCNC 1XF4A 5E6RB 1WUZA 4JZJA 2LLLA 4X9FA 4LSDA 3SEPA 4KROD 1WICA 3QEUA 4YSCA 4HGMA 4FJYA 4WZ9A 3HS0B 3MRIB 4PJ5D 1JDDA 4BQCA 1TU2B 4KITB 4F91B 4AQ1B 4F3FB 4J2QA 1K5NA 2VL4A 3KPSA 5JW4M 1ZJBA 4D7BA 2R4SH 3ARRA 3T8VA 2UY6B 4J6RL 5IMOA 1TTFA 3MLXL 4WTWA 4JO4L 3MC0A 5JYMA 4MMXB 4PGBA 1S7QB 5E5MA 4DGVH 4LOUC 4K0OA 4TLTA 1P4UA 5HDWA 5GGRY 1W8NA 2G75A 2XTLA 4ZTPL 3RUGA 4AK1A 3RVVC 3SKJH 3ECUA 2BY1A 3QRGL 4AWJC 1F8TL 4C55A 1TQBC 1INEL 3MXWH 2HMID 2P3YA 2WQVA 3UAJA 1FL6A 3AT0A 1MFEH 1DJIA 3VFNB 4PJ9B 1B4TA 1NIDA 4CRPA 2XZZA 1SXBA 5DJAB 2CQVA 1XF2A 3WEXA 4OGYL 2NY5L 2YK1H 2JB5H 3VG9B 2AGJH 1T0MA 3ZGHA 1MUJA 2QLYA 2XN9B 3VAEA 5ADPL 1WO2A 3WS6C 2Q3XA 4OVVA 4OB5L 4M56A 4JHUA 1N64L 1HINL 3KDMA 5FYLH 4OLVH 4E68A 1KELL 4IYKA 4Q9BA 3AY4C 3B2PA 4TS6A 1IC5L 5EHFA 1JZGA 2WTPA 3T4YA 4NQEA 4OI7A 4BHUI 1LNUB 2JK5B 1WGOA 2V5TA 5D7SH 5FDWA 1YRKA 1OK0A 2A99A 4PJHB 5B1JA 1U9KA 5D7JD 4P9HH 3BAWA 3I6SA 3RIFK 5CEYB 3U7YL 5CILL 1IFGA 4QRFA 2CDEB 2LLGA 5D2LE 4EN3C 3FFCB 3IWUA 4HAGA 2CA4A 4RIRA 4WKXA 3MLRL 4AKPA 2LVCA 4BD4A 1OPGL 3RGVC 3B7TA 4R7NA 1ZGLB 3BHBA 3EGSA 1BOYA 2WZPA 2WO3B 4ZNEA 3ECBB 1DR9A 2XSKA 3GSQA 1MWAH 2WZ0A 1RZ7L 1QFUL 1F8TH 1FI8C 3GEWB 4FTVB 1EANA 1VFMA 2CKNA 1Z3GH 5CLTA 1JWMB 2XN1A 1XGPA 3MCLL 2BS9A 2K6WA 4RLDA 2OYPA 4CAGA 3BP6B 4YVUA 2PF6A 2ENPA 1MFAH 3UAJD 4GUQA 3ENEA 3M45A 5HJDA 4QI3A 3OKDB 4AEIH 1YEGH 5FA3A 5SWSB 3WN5C 2L7QA 4AV4A 3RY6C 4U6YA 2H4EA 2H8PB 5B38G 4JPVL 4AQ8C 3V0VA 3QJRB 1DVXA 4ZW6A 3ARZA 4TL4A 1OARL 1KLUB 4PJDF 1IKNA 3ZJAA 2VDPH 4MNQA 3S36L 3CU1A 5ESVA 3VFTA 4KK6D 1EEZA 1EFXA 4XCNB 5GRWA 3H54A 2XT1B 1CD9B 3H9HB 1HIML 5EBLA 4Y1TA 1F1GA 4TUUA 2HTKD 2YAQA 2XX0A 4ODTL 1IJNA 2YUWA 3ZTNL 3KGTA 1IT9H 3MA7A 3HVDA 3L3GA 4YLQT 3VGHA 3ECWA 1I75A 3Q5TA 1AJ7H 1S5HB 3JV0A 4OZIA 3HS9A 1LXMA 4KXDA 4QYOB 3U30B 3MLWL 4N6QA 5C6WH 4L3FA 1CBJA 4FZ8L 2ZQKA 4IRZH 3UCRA 3VM5A 2FQFA 5BZZA 5K5YA 2BNUB 1QTSA 5FYKU 2OMVA 2G3MA 1ZIBA 1RMFL 3HG5A 5GGVL 3WO4B 1H9VA 1XDTT 1E5ZA 4EKXA 3RGVA 3EGXB 5B3JE 2CO6A 3SYOA 2GT9A 4UNTA 1DDTA 5LWYL 4UTAL 1F58H 5J56B 3NZSA 4GPVA 2IF7A 3O6LL 1BFTA 4UQ2B 2VDMB 4HWUA 4G8FB 2AMGA 5ICXA 3X3FH 1TENA 5JW3H 5IQ7H 3LN5A 5EF1A 2IDTA 4GP8B 1HEZB 1XF5B 5D7KE 3T0BA 3PL6B 4WW2A 4N2KA 4U3CA 2Y5QA 2X4RB 1U4EA 4GAGH 4TSBH 4EPSA 1KPUB 2XN2A 3ZRFC 1QMUA 5BCAA 2BC4B 2P5WD 4K3JH 3UTPE 2BRRL 4MCZB 2BY0A 1ACZA 4HS6A 4LHUG 4XP5H 5D7JC 1MY7A 2WCSA 2XWZA 1Z7JA 5DS8A 3OHXB 2EAEA 5DMIH 2R23B 4OGQC 4W70A 3WY4A 3U48A 5C0DB 3TONA 3QO0B 4ZZKA 1BXUA 5A7EA 3NACL 4OLVL 3E2HC 5I6LA 5FYJE 4BFGA 4JY5H 4NQSA 3M7FB 3D85D 3GS4A 3QEQA 2QHLA 4LL1A 4RBPK 5E8EA 1Z32X 2HWZH 2YQGA 3KXFB 4IU3B 1EAPA 4PJBB 4IS6A 5CSGA 2NXZC 1BVNP 4AM0B 3B9AA 3VXUD 4FDWA 3WV0A 8PAZA 2MH4A 4LKCB 2BSCA 4I88A 4KUZH 4ZMVA 4KGJA 4M7KH 3QQXA 3Q43A 4Y4FD 3QNZA 1GGYA 4GG6B 5AW1B 1I8KA 1H6UA 3KYMA 4U6XA 5FECA 2NY2B 5I9QB 5K59F 3KJ4B 5DJXB 2JJSA 2OMYB 5JUEL 1W8EA 1UWFA 3SPVB 4QF1B 4MFHA 2GUOB 3FTUA 3LQAH 1GW0A 1GJUA 5BQDA 4X99A 1TPXC 2A9MH 2VIRB 3D1MC 3IJEB 3H7BA 4WEMB 4Y2OB 4Y7MA 3WHE0 3A22A 4G11A 1SXNA 2OAAA 1T5XB 3EZJB 4GQQA 4MD5B 2UZYB 3DURB 1QRNA 4A7SA 3ATAA 5IFAL 3NZUA 3P9WB 1SVCP 2BHYA 3QW9A 4X50A 4Y16B 3BSZH 4L3CA 1TQWA 1XIWB 3JWNC 2ED9A 4YMPA 5D1XA 2BNRB 2X1PA 1JG9A 2DEXX 5T1LB 5CEZL 5EDSA 4O2CA 2YBGA 4QY8B 4UNVA 5IEKA 2GQHA 4XCFL 4YSEA 1N7MH 3QP3A 1KB5H 4JJHA 3ZY7A 5DUPH 1A4BA 4KQ3L 2PYEA 1EZSA 1AGEA 3QZMA 4LSUH 4XOCA 5DVLA 4AL8C 2GAZB 2IDUA 3NCJL 1VDGA 4RMUA 3RU8L 1PVHA 3QZNA 5DJ2A 4G1EB 4KROC 4DETA 2BP0B 3SJVE 4QRRA 4Z7QF 4HJ1A 5E6ID 4NUJA 3BAEL 4XB8A 4RMRA 1G6RB 4XMZA 4HETA 5DFVC 5I74C 4WQOA 1ZLWK 1IAKA 4ANVA 2J2ZA 1WAEA 4H7VA 3GKWH 4HXBL 3SOTA 3NH7L 4ESKA 4NM4L 3TTYA 1T22A 1BQHB 2DTMH 1CLOL 5B39A 2QVIA 2Q7AA 4GAYA 3ULVE 4JANA 4GYBA 4DGUA 2FNWA 1XSKA 1OIOA 3NK3A 3QNXB 2ZOOA 3CLEL 5HHOE 2FJHA 3BQUB 4JRWA 3BW9A 2LW3A 3OAYH 4G80A 5J1SC 4QRRD 3TO4A 2ITCB 2JIXB 4MGXA 2XQBL 3W9DB 4Y16C 5JIDA 3L4UA 3QUMA 2NW2B 4K5LA 4NJAH 3QWOB 4JRYA 2VLJB 2X38A 3GLAA 4H5SB 4L4VA 5ALCH 4XPAH 1OF0A 2WLJA 1S5IH 3VFOA 3T0AA 3BH4A 4UILL 3KWVA 1KPUA 3G5YB 4QOKD 4M7LT 1L0YA 4DP2X 1MIEL 4FLQA 2I7SA 1OHZA 4LPWA 4NERA 3MYJA 3HRZA 3PQYE 5DRXB 4Y5XA 2WWMC 2QHRH 4H4NA 1RJLB 2ADJA 3HAEA 3TM6A 2APTA 1HTYA 2C7UB 1L9OA 1AKPA 4ZPVA 4E0RB 1T1WB 3RUGF 4FKHA 1GZPB 4AE1A 4BE6A 4F9PA 4N8PA 2H3XC 1QKZH 4YHYB 2NOYA 1CXHA 3B7YA 3DRTB 3IS0X 4YO0A 4PD4K 3IVKB 5CO1A 3QHZL 5KSAC 3JVGC 4B9GA 3ILPA 3QQDA 3U1SH 4S0SD 5IY5B 2YARA 5LBSA 3GSVB 3MZGB 4PY8I 3BMWA 4NN6B 4AM0A 5F1NB 1BMWA 3TN0C 2AJZB 1MY5A 5L4FA 3AY2A 1QSFB 1EHAA 2EDMA 4CL7A 4F9LA 4GW1B 4IDLA 2VE6A 4MNGA 4XCEA 5E4OA 4RX4A 3I6LD 3ESVF 2ED6A 2FX7H 2ZXDA 3T5WA 5FV1L 4H25B 5F88A 5A6MA 1P84K 5ANME 5AZUA 1ILSA 3HEIB 3N42B 4YWGH 2HFEA 3ZE2F 1A6WH 4JRYD 3CDCA 2L7JA 3ZOAA 4F7CA 1WK0A 2HX9A 4MJ5B 3D9AL 4HHAB 2P8PA 3CSGA 5LVEA 3WKML 1KFAH 4K9EH 1NKGA 3HB3B 3UPCA 3TO4C 1YECL 4QHUB 2F53E 4XMUA 5E08H 4Y4HC 4ZW8A 1TZHA 3FMGH 4WDIA 1INQA 4HQQH 1AXTL 1OGAA 2JI3A 4D9QD 3BDBA 2O6DA 4JGUA 1ZHKB 2FJSA 3Q6FA 3UJJL 3ETTA 3L4CA 5F1IB 1ES0B 4Q89A 4UOZA 1H0DA 2AK4E 3OKNB 3GXMA 1L4IA 3APCA 3QHZH 2OMXB 1L7IH 3NTCH 4GUCA 4JQXA 2OQJB 2B3IA 3INUH 1CXLA 2AJZA 3CFCH 3PGFL 3BKJH 3O3AA 4CBPA 2OTWB 5AFAA 3HPJA 5F6IB 3DO7A 3LZNA 4IBUA 1NUDA 4PU2A 2DWEB 2V2WA 4WRLA 3S6CA 3DO4A 3A6BL 3P9MB 2WWMD 4Z7UB 5IR1B 3K71B 3FN0L 3PL6D 5AZ2H 4EI5B 2G60H 1T89C 2F8IA 4M4RB 4FXKC 3DSFH 2VN5A 4JLRB 4YHPB 3CGTA 1MVFA 3FT4B 3GMPB 2WWNA 1YEIH 1MWAA 2BXYA 2WUBH 3QG7H 3HG0A 3ARVA 5DJ6B 5CCKL 4NDMB 4HWNA 4MB5A 3MI6A 2VCOA 3VXSD 3VYPA 3BZ5A 1RK0A 5D2NA 4POUB 1GOGA 1OB0A 1N0LB 2ESVB 4HMEA 4KKPA 3IXTB 3BRFA 2A9CA 1MCFA 3DYOA 3QH3A 2EE0A 4I87A 4O2EB 4RAVA 3TV8A 1QSVA 4BSWB 2HKFH 1KTDA 5CLZA 7PCYA 1CS6A 3C8HA 2JMRA 2QSCH 2ATAA 1KBBA 2FGWL 2YAPA 4GT0A 3QIUD 4JREB 4YBLC 3ZSTA 5BOJA 3QWOA 3F12B 1M7DA 2Q2EB 1I1YB 3KLLA 4TNFA 4Y5XC 4P5SA 3RG1C 1TO5A 4HPOH 1FFTB 5F7NC 2HWZL 1ZXKA 5IHUL 3WSQL 3AS0A 4MCYA 4IBTA 3FB6A 4KJWD 4R5VA 3GYRA 2FZ3A 3L08A 1TETH 4PJEB 3P0VL 5E23A 3GLZA 3UAAA 3DX8B 4H13C 3RWJB 4LCUB 1N68A 3V2AR 1LDPL 3HUJF 4XWOC 3ME0B 3QG6A 3QJHB 3ZKXC 2GK0A 2GI7A 1A25A 1HQ4A 5FUZL 3KR3H 3RB7A 5CSZA 3SZ6A 4EN3B 4AEEA 2YKLH 5E70A 1O7VA 3CTTA 4KI5D 3CLFH 2H2PD 4NQCA 1KC5L 5HI4D 3V4VA 3FHQA 5J9PA 1TMQA 2QV4A 1A65A 1QZ1A 5A40E 2Z93B 4KKBC 1LILA 5I1KH 1LO4L 3ZQXA 1EMTH 1C8PA 1UOKA 3EXJA 3AT8A 3N42F 4FCAA 4LK4A 5GZOA 1Q9KA 3ROOA 4MMZC 4M4PA 2GITA 1JYVA 1X9QA 2R2CA 2CUIA 4DEUA 1M53A 4DGYH 4NYLB 5TDOA 1UZ6E 4ECNA 4PMEA 4X5WB 2VQTA 3CFJA 1OAXH 4MNQE 2B5IB 2CALA 2W65A 4YUEL 4CC0A 5HGHB 4NQSB 1QPPA 2BLFA 1KJ3H 2RA1A 2BP0A 2YPVA 3RWFA 2WLIB 1PLGH 4WLCA 1JHTA 5EOQL 3RI5F 1XMEB 2BOLA 3WKMH 1TQBB 5D1ZA 3UACA 4WWOA 2EEXA 4DZBA 1DUZA 1OAXL 2BIMA 3S5ZA 1OTUD 3TEXA 1HQ4B 4BIKA 1T20A 2XPGB 5EN3A 1F11B 2B4CL 5ILTL 4IRJB 5I6NA 3ALWA 2FYVA 3KPLB 5HHQB 4LHUA 4XNQB 4KQ0A 4JZOB 1HHIB 4HK3J 1OAZL 2E7LA 2VLRD 5AG8A 2Q8BH 4YS4A 3HJ0A 2BVOA 2GI0A 1ETZB 5DYFA 4ZAKD 3X17A 1M42A 5EEVA 3R19A 3VSUA 4MB1A 4CNIB 1PFCA 3C5XA 1DVYA 4RFOH 1JNHA 3LHPH 2IDSA 3ZE0F 1HAUA 1G0XA 2X4SA 3ARGB 1KYOK 3PP3H 4WO4B 4PRNB 2AXJA 3FF7A 4LCYA 1SEQH 2F54E 5L9DL 1OB1B 4HJ0C 3B9DA 5BXFB 4MZIA 5IGXH 3LKNA 4QKXB 4N0YH 1FZOA 3CVCA 1O7DC 4ABWA 4NPYB 2OA9A 1KLFA 3PIQB 3KBEA 1CL7L 1AHWC 1YJDC 5DJ6A 2YD6A 3RVTC 3SE9L 5BO1L 2EKSA 1BJMA 1THAA 1FNLA 1TQCC 1Y7VA 4MMYA 5DZVA 5BZWA 3VWKD 2A1WH 2LU3A 4N3TA 1YEGL 2RB8A 3V6FB 4OZGF 2FB4L 1ED3B 4A7GA 1VEMA 4U1MA 3ULVH 3DV4A 2EDKA 3B9EA 5GGUB 3SE3C 3T0EE 2A6DA 1S7WB 1QFUH 1HVXA 4XZUA 3GSNH 5D70H 4QJ5B 4MJ6B 4YNYB 1FSKC 2W1NA 2X6CA 3HTLX 4ZS7H 3T3PF 4JDEA 5CHNB 2C1PA 2K7QA 3LH9A 2V0AA 3QUXA 5D71L 4DZ8A 3OJDA 5E2TH 4H26B 4H20H 2WGNB 5IJKA 1I1AA 1JRHL 3BJ91 2R0LH 3V4PL 5B1BB 4NOFA 5A43C 4DPAX 3PWPE 1MNUL 3O6ML 5CKGA 5E9NA 3QPQD 2QELA 3MRKA 4OF0A 1H19A 1QEWB 2NW3B 1SXAA 2GJZA 2VSDA 5KBDA 3EBHA 2ZAGA 1P7QD 5KN5B 3OR6B 4MASA 3OKDA 4ZJ9A 3RPKA 5F2FA 3REVB 1SUJA 3G5VA 2ALWA 1SDAB 2HX8A 2DQMA 5I0ZA 3QDHA 4CADB 2AQSA 4XT1C 1P9MA 5E1HB 1CFSB 4GUOA 1NMCC 3GSWA 3CZGA 4JHZA 2VDRB 3DVFA 2GVYA 3QDGD 1LO0H 2HLEB 1UKTA 1KYUA 4OCYL 3VE0B 2P1YA 2QQLL 4CILA 3E7JA 5D7JA 4MAYD 4G6KH 1IFHL 4PJXB 2Y6SC 1S5HA 4PB9H 4U6HA 4TTDD 2K3TA 3IMRA 3QA3B 4NFBA 4UB0L 3D30A 5GGSB 2H6OA 3KGUA 3UP1A 1AXIB 1IGML 4WO0A 4L0ZA 3RFZB 4Z5RA 1IO4C 4J8RB 3ULVD 2R2HA 3DGGA 5D1ZC 4YXLL 1OOWA 3UJIH 1CF8L 3EO1B 4XGZB 4B7LA 3QDJA 2PCFB 1EV2E 1X5ZA 1ZEAH 4ODUA 3RRQA 2ITDA 2VOTA 4XCYB 3QYCA 5IJVB 5IV2A 2VZVA 1TTCA 4JHWL 1JF1A 1MELA 4NNXB 4HBCH 4M9PA 1N26A 2YLKA 5H94A 1URLA 2E7LC 4NKMB 1U8OA 2Z8RA 1CD8A 3KPMB 4MAYC 3NCBB 5DD0H 2A0LC 4TNEA 4XN1A 3CCHA 4AQAA 5I1LA 4DVRH 1TSHA 5JPMC 1NFDA 1YUHA 4APQD 5KJRH 4Q56A 3K6SA 1JGLH 3ZTJH 2XIIA 3LPGA 2FATL 3U1SL 1FRGH 2XETA 1ID2A 2E7BA 3NBNA 3AG3B 1T2JA 2CHWA 2BSED 2DWDB 4ICWA 1N6QL 5DJZA 2YQ3A 4E9RA 5C71A 3S3CB 3BSGA 3U4EB 4DF9A 5BUAA 1AZVA 1O6VA 4JB9H 2DLFL 2B8OT 2AI0L 2WQWA 2YEZB 3BMVA 2IH3B 2WGXA 1FJ1A 4YSUA 2P47B 4OF5A 5LXGL 2P8LB 4ZOAA 3NJJA 2LTQB 1V7MH 4YBLB 3G6JA 3M1BA 3DSNA 3ZBMA 4JUTA 4GXVH 1W9XA 2DQGL 1FNSH 3PV6A 4OJYA 4AYFA 3O4LD 4X7CC 4KVCL 1SFDA 2EXSA 3FU7A 2BSEA 1UCBL 2Y2TA 3FYEB 4QHNB 1IEAB 2R1WA 4HULB 2VDNB 1MVUA 4FRWA 3PREA 3RVVD 2W60B 5F9WB 3VXPA 5L0QC 3ZGIA 3EFFA 4DKFL 1PF3A 2DS4A 1B9ZA 4JM2C 3RJQB 4LAQH 1C8QA 1GHFL 1W8OA 4H8HA 4HOZA 5IQMA 1HHJB 4CGUB 4GRLD 1NCIA 4Y9GA 1AP2A 4OQTL 5CP3A 2WINA 2NUPB 1YY9D 3HPLB 4L0PB 2QMKA 3V5KA 2VDRL 4PGDB 4UQ9A 1CICA 4NQCE 1SHMA 2F7OA 2WVSA 3L4WA 4YX2L 5BS0D 3MACH 4PREB 1WD9A 3GSOB 2HJFB 4Y7OC 1X5JA 4L3ED 4L8SB 3ULVF 1E5BA 2Y24A 3U9PH 4KVNL 2VLKE 3PWLB 3WFBL 2HJLA 2QPUA 5EBGA 1HZKA 3EFDL 1LO4H 3DUSA 3E6FB 3QXWA 4IJTA 5HHMD 4MA1C 4B9YA 4ODTH 1KTDB 4ZSOA 1AQKH 3G6JF 4Z7OE 2GIMA 5IVXB 4QRPB 2CM6A 4MDIA 5IB2A 1BAWA 1GRWA 4XBPB 4M61A 3CWGA 1PLAA 5I1HL 3X1NA 5DUBB 3SODB 5I66A 3WHE1 2AV7A 1U8IA 1UXLA 2GBAA 3E0GA 1W80A 1DVSA 1BLNB 3GEFA 3HZKA 1HK6A 1BD2A 2RCSL 5LCVH 2V7NA 3MRDA 3VVVA 4UIMB 2ZUSA 4X9IA 5CSBA 1KTRL 3T2LA 3CJJA 2HJKB 3ZKSD 2DPKA 3BPNB 2VNCA 5EULV 3L81A 3Q3GB 2R23A 4FXKB 4UZSA 3QHFL 1NBZA 2OQJA 4U2ZA 4EUPA 1FPTH 1XSJA 4LL9A 1YO4A 3DTXA 2ZSVB 3ARED 4GW5A 4JM2A 4XCNA 1KXHA 1ZLWH 2X0UA 1EJ6A 3VFTB 2VLRA 2WZ5A 2XHNA 2J6EH 3HBPA 3TBSB 3HC3H 4NFDA 2R0ZH 4NZRL 3V6ZB 4B41A 3AU0A 5IUSA 1HEJC 2KLSA 2XV2A 2OCFD 3C12A 2X9XA 5DJCB 4YHNA 3UTSE 3BD3A 4EZMA 3FUMA 4LQFL 2WVVA 3MTRA 1F4YL 1VFOA 4HCRL 4CW1B 4P3DB 1NLBH 2OMZB 3C5ZA 3PWVA 3D3VA 2GT9B 1HINH 4U1GB 4Z77B 4W81A 2ALAA 2Z7YA 1KDIA 3MUHL 3BYYA 4APQC 2O5YH 4AKOA 2FT7A 5IHUH 4B97A 5DU7A 2VAJA 1GY1A 3QAQA 3B1TA 1WH0A 5DURB 2WZ6A 4GEIA 2NY2C 3DXAE 4G6AC 1KJVB 1AGCB 3RBGA 5T3XE 1SNRA 1WP6A 2YJQA 1YEHL 3DUHA 4H2CA 4A6YB 1NGQL 5GGQH 1I3RA 3O2WH 1BM3L 3IJYB 4TNWF 3OF6D 4YL4A 1A7PL 1C12A 3F64A 5C09D 3GXFA 1T7XA 5AVRB 3RY5A 1TF4A 3VXTA 3HE7C 1AHMA 2GHWB 3MGOA 5AAMC 3FTXA 1PPIA 3BEWB 4KNTA 5IMLB 2IXQB 5E4IA 2P5EE 3ZE1B 7TAAA 2X1QA 3RQ3A 3LAFA 2C3GA 1UM5H 3MJWA 4GT7A 2Y6SD 2DBLH 5BNXD 3CLEH 3TN0B 3P4MA 4BWTA 1FC1A 2RMNA 3RBSA 3VD7A 2VKWA 3BWUC 4UT7L 1HHJA 3D4GA 1A22B 4JRLA 1IB5A 1IGFH 1NTDA 3R4RA 2D0FA 4M7JH 4AJ0A 2AK1H 2ZWSA 4N9GA 1YPZB 5DUMH 2GY5A 3S88L 4GOSA 5MERA 3PL6C 2FT8A 3B1UA 4HDIA 5KSAB 1U2YA 4IBLT 4JKWA 5IG7A 2Y4SA 4ENED 2NCEA 1X5KA 2XWJB 4JMNA 1MQKL 4WI7A 5HHPB 4LGPB 3WFBH 4D3CL 2ZAHA 4N8VA 2ZXCA 5KZCB 3W9EB 4QXGL 4C4BA 2DM3A 1AI1H 2I07B 1J0IA 5EF3A 3EJZC 4RGMC 3RNQB 3QUMB 2RIKA 5J0BA 1MAMH 3WNJA 2CMRL 4JDVA 4MDIB 4L4VE 3QR1A 4K4KA 4N8CH 5D2NE 4N2IA 4FA7B 5IVXA 4M3HA 3MKKA 3N85H 4MAYB 5JYLA 5LAXB 4ABUA 4OQTH 3CHPA 3QUKB 3GJFH 1HSBA 1ZJAA 5I30L 5JPNB 4FLOA 5GISL 4XMPH 4GUPA 2DBLL 2DMKA 3VFUA 3I6GB 4UWQB 2BS71 3SGKA 1INDL 1SFHA 1Q9OB 3F65A 2PR4H 5I76B 2X9WA 1D5ZA 1KTLA 1HL8A 2YA2A 4HDIB 2KDGA 4TQ8A 1MRCL 1H3PH 3DIDA 2Q2LA 5JQIB 2BNQE 2ZCHH 4QRRB 2ATPB 5AVQB 1QYGL 3GXPA 4O02A 5JHLA 3T0VA 3QUHA 1HILA 4ZDHA 1CN4A 4UF7C 2OI9C 3LNGA 4HJ0D 1MCRA 3THML 3ZN6A 5EOTA 5E51A 1MVUB 3HI5H 3DX6A 3NN8A 4J8RA 1MCDA 4FXLA 1RURH 2EIDA 2FJGB 4MQ7A 1UA3A 4N0UA 5KVGE 2BHFA 2CO1A 3P3SA 4NUMA 1VKXB 1IC4H 2EDRA 5EOCJ 3LEVH 2YGQA 3HMXL 2HH0L 3PFUA 4L5FE 1MJ7H 4LQFH 2F53A 3T2NH 2WXHA 3RUGB 3N44B 2Y72A 1HQRA 2CKBL 4J4PD 4ODWA 5T1DH 4LDCA 5KG9A 3UMNA 3IBOA 5C0RL 4XBGA 3VXSA 4AGPA 3D39A 2AJUL 4Z7VB 1KCVL 2HFGH 4BK5C 4NB7A 5CD5D 2Z34A 2PYFB 4N87A 5TFSH 1AS6A 4HPYH 1U8PA 3SKMA 3U6RB 3D2UB 4HCFA 5KSVB 3EYOA 4LKCA 5ILTH 4H8VA 3PWPA 4ZW7A 4NJAL 2VXSH 4FNTA 3SBWC 3ZTDC 3K6SB 4HU8A 2Q6WB 1YMHB 3ISWA 3NA9L 3I75B 3ARXA 4PSRA 4R4BA 3VFSA 3ULVL 3LNIA 1ICTA 3O3BA 1D7FA 5EU7E 1PSKL 4XNXL 3W81A 2WKLA 1ROCA 1NBVL 1CE6A 4O00A 5BQ7A 3Q48A 2R83A 1CCZA 1CE1H 4DKTA 2CIKA 2Z4QB 3MJ9H 1JD7A 4FG4A 4PJBF 3G5WA 5I82A 4I18A 3NCXA 5EWIL 3D85B 3FSOA 1DBBL 1NKOA 5JHDB 1MJ8L 2C1PB 1MCKA 1GYAA 2AQ3A 1BAFH 1AD9A 4EUPB 5MP6L 1BG1A 5L9DH 1GOFA 1AHWB 3CZJA 5H35B 1G6RL 3AM8C 4PR5B 4HW6A 4M6NH 3VQMA 5IHZA 2R27A 4TNWK 1Z3RA 4EUPG 5T3ZD 1MQKH 1JGDA 3FTVA 1EDQA 4ZMPA 3WL9A 4BFFA 1KYDA 1FVDB 4KQ3H 3TVMA 2AITA 1IGCH 1ZV9A 4NJ9L 2E0PA 3TCLA 3GHBL 1KCLA 3DHMA 3H85A 4G9DB 3VXUB 4JRFA 4OD1H 3KYNA 1YN6A 3K6OA 3BZDA 1NMBL 3QIUC 1YEDA 3ZHKA 1FIEA 3QFJB 4NNYA 4X6EA 1R33A 2YD7A 1KIRB 4ONOA 3QDMA 4TUKL 3PAYA 4YHLL 1JUFA 1S7VB 4K3DH 2PWFA 3STLB 4GAAA 2WBJA 4X6FB 4PJ8D 5DJ8B 3MUZ1 4Q8BA 5GS3A 1R24A 3FPYA 2EIBA 4L8CA 3HS0C 4ZK8A 3HA0A 4OD3L 4L3EB 2GJ6E 3ZKND 4KDTA 2UWEE 4WJKB 4QJ4B 2PXYA 5GS0H 5GJTL 3SDAA 5IIEB 1I1AB 1U8CB 4GG8A 4OJFL 5AW3B 5TE4H 4WF7A 1Q94A 3EH2A 1WZ1H 3J07A 3H8NA 1ZDSA 3O8XA 2HRHA 4MVBC 5IROC 4XBEL 5T1MA 4LSPL 4GBXD 1XGYH 5HJGA 4AXWB 1WV7T 5D7HA 1OGAD 5C9JA 3SPIA 4NX0A 1OWRM 3DX7B 3K80A 1LE5A 5CD5C 1B3JA 4LEXL 2NXZD 3KH3A 2P52A 4ZMTA 3HR6A 1J5OH 3DPBB 1YEEH 3RWGB 2BIOA 4MAZA 4LSSL 5GHWL 3BEVB 2R59A 5EUKA 5T3XH 3VXMA 3CFCL 3PGFH 5BV7L 4BFOA 2KBGA 5IT2H 3US1A 1CYWA 4OZGB 4ODSL 4LIQH 4HJIA 1DCLA 3HVNA 4PV9A 3MBEB 1F56A 2BINA 3ESUF 2L7UA 1NINA 5KVEL 5FM5M 1JFHA 4YLBA 5EZOH 3L7EB 1W15A 2IBGA 5JA9A 3D5OF 2ZOTA 4OV6F 4UUJA 3ECBA 1OPOA 1OK8A 3V9CA 1T6VN 4LSTH 3D2TA 4N68A 4XBGB 4ZI8A 2QBWA 2EDBA 4ODWB 2X4SB 5I5RA 2DLGA 1PZDA 5IMOB 3MRGA 5IW6B 2VM9A 3D51A 4K3EH 4KHXL 1ZGLP 3QDME 2DD8H 2XG4B 1UZ8A 5AWNH 4F3FA 4PJEA 1MG3C 5SWQB 2Q20A 4UZGA 3ZZQA 1SOKA 3E38A 3BT0A 3UBXG 2UWEB 1VCAA 2B1AH 1Z3GL 1NCUA 3IKKA 3HS8A 1SXCA 5ENWA 4WEBH 5H2BB 1FZMA 5IBUG 1T2XA 4QWWC 5TQ2H 2DL2A 35C8L 2I9LB 4KK8D 5ESQA 4R3SB 1IVLA 2DAVA 3DPBA 3HNSL 5DZ9A 3KLSA 3O8XC 3FCTA 1BXAA 4KQ4L 2L0DA 4CN6A 3PXHA 2ZONA 2IH8A 3FSZA 5E5UB 2NDFA 5FM4A 1QFWM 2DZEA 1J9RA 4PG2C 3LRKA 4ODUB 4MMZB 1BP3B 2Y0SA 4UM9A 1GS6X 4JN2A 4WTXA 3VQLA 5IMKB 4BQ8A 4Z95H 1YEKH 3VFNA 4RDQF 3ZYIA 2OCCB 3ZZLA 4AC2A 1B4JH 1H5BC 1QVOB 3EF4A 4HVBA 4QIRA 3UAEA 5D7LD 3IFLL 2IVFC 1DE4A 1CURA 1I8UA 3LOWA 3FB8B 4FLRA 4ZUUA 4LOVA 5FO8B 3AXHA 4AT6A 4C56D 3SCMA 4HZ1A 4KK6C 3WI9A 1F0LA 1ASOA 3DO7B 2IH1A 3STLA 5GS2D 5HI5D 1FN4B 2QSCL 3CE1A 3NIDB 3FRPG 4IRSA 3PNWB 4FLSA 3LEXB 4X7EC 1NGXB 3UABA 2Z1KA 4O02L 4QRPE 5E9DA 1HJBC 1SN5A 1XH1A 1MFEL 3ARGC 4LP5A 3NEXA 4MMXC 1TU2A 4FFTA 2BJMH 5I1GL 1Z6JT 4DERA 5AW9B 1R17A 1QOKA 3ARDB 4KTYA 3KPSE 2XA3A 3NT0A 5DT1H 2IQ9H 3AQDA 1HXMB 3HE6A 4AQ1C 4ZNCD 2F8VA 4C83A 4E9YA 5C3IA 4TULH 1O9VA 4P5TC 3GUFA 4WGVB 3CC5A 1E2ZA 4P99A 5LGHH 2JKLA 4WENB 1BZQK 4NQXB 3KS0H 5EFIA 5T1DL 3CSYB 2AJXL 4D9RE 3GJFB 3HC4L 4I0PC 3CFKB 3DA0A 5IWLC 4WI5A 4NM4H 3RJOA 4Y19D 3EO1A 3SDYH 4IK7A 5KS9B 4BKLA 4OU3A 1MFDH 1BGXH 3RPBA 3LRGA 4KY2A 1UQSA 4NN6C 5DVKA 3C5SA 3TBSA 2CIKB 1IUZA 3W5MA 2QFRA 2ADYA 3QQ9C 5EBMB 3VFVA 5C7XL 3IN0A 4FEMA 2BXZA 4PWJA 4ZFOA 2JCCE 3WTYA 1FCGA 3IETA 1OW0A 4ES8A 1HCZA 5MHSE 3ILQC 5IHHA 2PO6B 5K1VA 1V7NL 4U1IA 2WYIA 1IAMA 2O5ZL 1R3LB 3EDEA 4LLWB 3UROR 1QR1B 1OVZA 1AD0B 4HSCX 4U1NA 1G0YR 1PCXA 1YN6B 4HALA 2AABL 4MNHA 3IGKA 3AREC 1HH9B 2EH7L 1T03H 4U3SB 3EYVB 4JFQB 1XSIA 1EA9C 1DSWA 3HFMH 5F1IA 1EHKB 1Z0MA 1DQKA 3NIGE 4ZMZA 1OAKH 5AKVA 5LAPA 3MRKB 1ETA1 1YNTB 4NRYB 4MWFA 2R1XA 2VXQL 2FE0A 3HRZB 5JUEH 3S8WA 1ZHLA 5FOBA 1T5WB 1WFTA 4JRYE 4FS0A 1F4HA 2EVJA 3KW7A 3VVWA 3BAYA 4NBXB 1S9WB 4OZ4B 3ULSB 1UWGL 2IEPA 3LRMA 4M8QA 1J1PL 4UANA 4FNLL 3QIWC 1TLKA 2YPKB 2GCYA 1LE9B 2J3SA 1GKOA 4JFFA 1P5VB 1AFVL 1JK9B 1DLHA 4JY5L 2O6FA 2PPEA 1EAJA 5E8DL 3EFOB 2HN7A 1M9WA 4BRVA 5MENE 1E5UI 1N7ML 3IDIA 4FXGA 4KRNA 2A5UA 2VUYA 2NXYB 3K2IA 2VR3A 1KB9K 3WIIL 1G84A 1KTLB 2VB5A 3VFWB 1DVUA 2EDDA 1RHHB 1DQTA 2WXGA 2Y7QA 3OMAB 1RV6X 3WFCL 3M17A 5LGHL 1IAKB 1GAFL 5BRQA 3CH1A 2NRDA 3LXUX 5DQ9A 3INOA 4BBWA 1MCOL 4OKVB 2X87A 2E9WA 1NCAH 4HG4J 3QJFB 4PJ7E 5A2FA 1Q9LB 5F7WC 3HZ3A 1A9EB 1SJEA 4P2OC 2WOBA 1CLZL 5F89A 2IBZX 3IDNA 4J4PA 4XP9H 5TE4L 5TDPA 1I7RA 2ZCLH 3RKDD 3DXAA 5DZJA 1G5AA 5J3HC 3BD4A 3PWLA 2B77A 4L4TB 4FFYL 4S1SL 5FB8B 4PJ5B 4WW1B 2FB4H 3R4DA 4PBDA 2VLKB 2Y7SA 3BWAB 1FZKB 2GC7C 3QUYA 4NGHH 4P59H 2K7PA 4U33A 4A2HA 3TURA 5I1LB 4MD5A 4H5SA 5CD3B 4R4FH 1UH3A 5TF0A 4ZXBA 5KVEH 3BGAA 4RGMB 2HFTA 3MO1B 4G7VH 4IKJA 4Y4HB 4FZ8H 4IRZL 4HAFA 4JGNA 1S9XA 4GFTB 4YC2C 1PEWA 3M7OA 1PMYA 3LS4H 3S3BB 1CGUA 3GBNH 3EO9H 2I26N 4B9IA 4RA3A 5EG6C 2HTKC 3OR7B 1A6TB 4GSDL 4HT1L 1UA6H 2L04A 3TT1L 3O3UN 1NCHA 2VC2B 4X6CF 3BPNC 5JIKA 1E40A 2R56L 5BS0A 5C1MB 2R4RH 1LJMA 2HT2D 3EF7A 1SLVA 4TSBL 4P9MH 1MF2H 2IH9A 1G7LB 2KKQA 2FDBP 1JXFA 4J3UA 5MP6H 1NL0H 3GO1H 3C6LD 4OGZA 1TR7A 1XO8A 1RZJL 3T0XA 4AMKH 3UX9B 1JMXA 5AOIA 5DJ2B 1KG0A 2BOBB 2MCMA 3RFZA 2B1AL 1X7QA 5DJ0B 4Q97A 2F61A 4LLAA 4HQQL 3VWJD 3PPSA 3LSOB 1XIWC 4PJ7B 1MHCB 4DIXA 2EXWC 4UYQA 3D34A 3MO1A 4ENZA 1RJZA 5ISZE 3GMOA 3FO9B 3TBVA 1NUGA 1KTBA 3RWJA 4QR7A 4QRBA 5DMKB 2X2IA 3PP4L 5K9QI 1C9SA 1K8IA 4X0KB 4ZO9A 1OEZW 3TZVA 4K2UL 2VLJE 1YNLH 3HBZA 4OIIL 1UVQB 4JKPH 4FQ1L 1NFDB 1TFHA 1YUHB 1L6PA 1ZHKA 3N0PB 4PRID 4M1GH 4P5RA 2R1XB 2SODB 5CJ8A 4EN3D 3DRQA 2OMTB 1ZA3B 4NRYA 2WCPA 4J3OH 5CZXC 4YZFF 1INQB 1M05A 1BBDL 1DHKA 2DQJL 1VB9A 2VW7A 4YXHH 1YC8A 3SPVA 3AXLA 3CU7A 5AUMA 4DUXA 3WS3B 5F7EH 3A4EA 2V2TB 4R0LB 2E4FA 1MREH 1G9NL 3ARFC 3MZTA 5DSCA 3LJ3A 2X6UA 2CLZA 2VR7A 4I5BB 3TPUA 4A6YH 5CF3A 3CBJB 1R34A 5FWRA 2VR6A 3W0WD 2JF1A 1YSOA 5D7LB 3VH8B 3T1WA 3GMLA 1J9TA 4G7YH 3VFRA 1KUMA 4JLRA 4N24A 4YHPA 1FRGL 4NCC2 4NAQA 5GIRB 5ICUA 3BUTA 2VLKD 4FXGB 4AZ8B 4B3VA 1KPRA 4AIZB 5IESH 3GSUB 2FO4B 4NQDB 5I74B 5EIVA 4D9LH 3CN2A 2DWEA 2V2WB 4GMTL 4MVBD 2XPZA 2IANB 4LLWA 2HKFL 1KWGA 5IQ7L 1QBBA 3Q2WA 3AVEA 1OD7A 3K6NA 4FL4C 1R3JB 1A0QH 3WHXA 2Z31C 1RIVH 2XWRA 3HLKA 3V4VL 3A0OA 2ZCLL 2JV6A 5C0AE 3FH5A 4ZS7L 4AZ8A 1QUNA 3T3PB 4LBEB 3JVFC 4WTQA 3NFSH 4FA6A 2EIMB 4Z23A 4BH8A 2AZAA 3ESOA 3D4CA 3NPSC 2ZXBA 5A2IH 2OMBA 4KO7A 1ITBB 3I02B 2RACA 3HW7A 1IX2A 4YHNB 1GZQB 3MREA 2Z31D 4Q2ZA 3FONA 3QCVH 3V0GA 4J23A 1SY6A 3GLDA 3OKLB 2NLJA 3WXWL 3WO4C 5LJYH 3O4LB 4J6RH 4V1DB 4FLHA 4X4YB 1THCA 1B9KA 1GGCL 2DTML 1AXSB 4PI2A 2FBJH 1A4CA 3DOHA 2DJMA 2EC8A 4M8RA 1J18A 4HJEA 4L4VB 2LABA 5I9QC 3IFPB 1BFOA 5I2IA 3ET9F 3HC2A 5KVGH 4E5XA 4L9LB 3V79C 1PD0A 2EQDA 1XL4A 3QI9B 3IU3A 3LRSA 3R8BB 3K2UL 1FV1B 3CFBB 3GJFK 4JL1A 2I27N 1S8DB 3OLEA 3GIVB 3NCJH 3RU8H 1W72A 2WC7A 4O2FA 4I2XE 4UI2A 2XN9E 5DD0L 2WANA 2ZXAA 1WC7B 3CFQA 4QD2E 4KO5A 2DKMA 1FUNA 4YXHL 3OC8A 4NYLA 5TDOB 1XD0A 1BD2B 5BS0B 4U1HB 2YHGA 3FTGA 3RL1A 2NX5E 3EDKA 4ZX5A 4FQHA 5D4HA 5B39G 1NEZG 3QXVA 4G8IA 1I9IH 3E9TA 2I9TA 2HRPL 2Z8WC 2B4CH 2CLVA 4JM4H 1PSKH 4XNXH 4K9EL 4L29A 5HHMB 2HB0A 1NEZB 3GMQA 3EH4B 1CFTA 1FL5B 1N3NB 5AOLA 5CGMA 1A6AB 3IJ9A 3MHZA 4JFHD 1CZ8L 3BP4B 4BZ2H 3NP4A 4JM4L 4OZFH 5G5DA 3T3PE 2K45A 3OJ2C 2OMTA 5JHMA 3FQTB 3WNPA 3FBQA 3L16A 4PH8A 4WO4C 2B20A 4YIQB 1XIWD 1KN2H 5TFSL 4UOW0 3L9BA 3VTTA 1EHLL 4U1KB 2J72A 3F7RA 4OCRL 4X0KA 3O6KL 3UTSB 4WJ5B 2VLKA 4XE0A 1G7HA 2W9EH 3B7SA 3QUXD 5AB1A 2P44B 3V7AE 1WIOA 1T6BX 2ROYA 4H2AA 4L9LA 5F9DC 3E8UH 5BO1H 1MF2L 1IEHA 4XHJC 4ZXBB 2G2RA 3ARPA 4GLRI 5SWZB 1J87A 4GXFA 1ZHNB 3QWQB 2WSPA 4MCYB 2C9VA 5HBBA 1SMOA 2ODHA 1PZ5B 1IFRA 3I84A 5F3HB 4KZCA 4L29B 1SJHA 3S5LB 4F92B 4WFHE 3H9SA 4HX1B 3GK8L 2NPLX 2W80C 2B0SH 3VXPB 4LPCA 5FGBC 1U3HB 1TZGL 1EXUB 4GLRH 3EOYG 1RUQL 3WXWH 5FPIA 5AKSA 2AEQL 3PS6A 2PPDA 1UZGA 4HKBB 2WYHA 5AVUB 1QA9B 4OBRA 4F1SA 4GIPD 4NZUL 3D0LB 4PLKC 5CWSB 3X12A 1NAMA 1BFVH 2PXYD 4NZTL 4H1LB 4XBEH 3DUUB 3GSRA 4DTGL 4F1ZA 2EUVA 5ITFA 3EFOA 2E7CA 5JHDE 2G5BA 3OLIA 1MI5A 1IE4A 2EXYC 2R39A 5KVFE 2FEDC 4W6XB 2LV4A 1F4XH 1QFOA 2CBOA 1NC4A 1OQOA 3IDYC 3NAAL 2QGEA 5F7LB 5F8RC 5AB9A 3BH9A 4ZPTB 1S3RA 1K3IA 5JW4Q 2YQBA 4NQQA 4TUKH 5IEHA 4M62L 1PQZA 3WGUB 2XWCA 1ACXA 3NZ8A 4GQ9L 3WN5B 5DK2A 2XJKA 1J48A 1UH4A 3BI9X 3E3QC 3X2QB 3O41A 4L8CB 4MBRA 1I4FA 1ACYH 3WFZA 4QAMB 2IPKB 3QH3B 4AL8H 5F7YC 2V33A 4RGOH 1G9NH 2AFNA 5IUCA 3PDGA 5DC9B 5IOKA 5L8JB 3DRQB 5D2NB 4J3TA 4KXCA 3T3ME 4F7CB 5M95B 1K5NB 5CNHA 2J6EL 3CXDL 3ESMA 4A2EA 1SEBB 3L5HA 3MV7B 1F02I 3Q8BA 1A4JA 3BUYB 4FG6C 1Q0XL 1QSEB 4A2DA 5K9JL 2B5IC 2EDOA 1ZT4A 1J05B 5CZVL 3ZL2A 2WXJA 5SV3A 4AIZA 1IVTA 4ILDA 2Q86B 5B1KA 5GIRA 1CD1A 3TCTA 3VE0A 1LMKA 4UT6H 3B5HA 5BZWB 1UCTA 5CBEB 4FG0A 1KBGL 1SMDA 2EO1A 5DHVA 2ZUVA 4ZUWB 1G43A 2GCYB 3TVMC 1AD9B 2DWTA 3ZL1A 5KZCD 3JT0A 3LMJL 5TD4A 3ESPA 3GSUA 3QZWB 4JFYB 4KDVA 3KWTA 4F57H 4AIXA 1EFXB 1IGTB 3EGDA 4OCMC 2IV8A 5D2LF 4KRMB 3CSYA 3RVWD 2OL3L 3UTTE 2QADB 5FUCE 4DEWA 3B7RL 2WIMA 1EH9A 4LSTL 3VWJC 2QJDA 3U0TB 1BFVL 5E9AA 3TEWA 2OXHA 2PTUA 2XN0A 5KS9A 3CZEA 2ZKYA 4K8RC 2B2XH 1P4IL 1AYRA 1IBGH 3SDDD 1U33A 1UADC 1FHGA 2JJVA 3EOTH 4RWYH 3PV7A 1FFQA 4PTTB 4UCFA 5BVJA 3QQ3A 3A6BH 3TZVB 3TN0D 5KOMC 3EH1A 4QKTA 2VN7A 5HYFA 3EADA 1MZZA 4H26A 3U7WH 5F7DA 3QUXB 2VDQL 3F6IA 4PWKA 5KSAD 2BVQB 4TQEL 4CU6A 4I8DA 1G94A 3HR5A 2C5DC 4Y4KD 1ZVYA 4MXQD 5DO2D 3T6QC 1A7QL 2DYRB 2FATH 3N6YA 4WW1A 3M46A 3U82B 3H3PH 4FFVD 1U8PB 3AU1B 4FL4B 3KPOB 1MDAA 4XCCL 1Q8MA 4FQCL 1HCYA 3BIAX 5E6YA 1GTFA 4JRXD 4AW7A 4C59B 1AZZC 5ACLA 3W3BA 1JWSB 2FL5B 1SYVB 1WAAF 2IQ9L 3H6JA 3LKPB 3WN6A 1MFUA 3QQDB 3V0IA 2GJPA 3DJTA 1OALA 4JY4A 4OKVA 4XO5A 3VYOA 4KZDH 3FQ1A 4AUUA 3QC6X 4G8GE 4P4KC 4PI0A 3KJ6H 5EC2A 3K72B 4JCWA 4EBQL 2L3BA 1I7ZA 1OZTG 3II3A 3VSTA 2XTSA 5LN4A 5J13B 5LQBL 4CGTA 3O3BB 6PCYA 1U8JB 3GTNA 4HS3A 3NDZE 5H8DA 1YPZF 2HG5B 1IFHH 1RSFA 5JW5A 4PJ9A 2B0SL 3RDTA 3U0PA 5KYWB 4KRPB 3MRFB 4P46A 5M7QA 1CGTA 4OIFA 2G3ZA 3CC1A 3ULUE 3CVHL 3VI4B 4FMFA 3EBGA 2F2HA 4OGXH 5KYNA 4KTEH 4M8QB 4MZ3A 3K8MA 4KTDH 4LCWD 4X4MA 3WLWC 5IW6A 2VDLL 5DMJB 4AL8L 3Q06A 5DVOA 4OQ1A 3C8DA 2I24N 1YMMA 2VRKA 3BW9B 3S5YA 3PHQA 3GXNA 5C6TH 3FU3A 1S9VA 2NY1D 2R7EB 3S36H 2CJSA 1QBLL 1M6OA 1ZVSA 3CQQA 2F53B 1D2PA 1RK1A 2C9SA 2CHXA 4N1CA 5K9QG 1R0AL 3OMZA 4RFNC 1AANA 4HKZA 4P2RA 4Q14A 1DBAH 3SQOL 1KGCE 1UWXH 4W9HC 1EDYA 2KERA 35C8H 5EZJA 5SX5H 4N0CD 2OMYA 5CR8A 2GITB 5CGTA 3T08A 4TTGA 2AC0A 1CFVH 2JIXD 4AE0A 4CVXA 3DHJA 4R7DB 1E7UA 3ETBF 5H37A 3V5HA 4CU7A 4FNSA 3VGEA 2GAZA 2E9JA 1QLFB 5B38B 3IU3B 3DX7A 3LRSB 4LB8A 4LVEA 3L3OB 2XWBA 3A3YB 3HE7B 5AAWA 2CPUA 3GGWB 4PRPD 1IL1B 5T3XD 2NZ1A 1QHPA 4ABQA 2FUTA 4ZMOA 3MCKB 4UTBL 4DKEH 4O2CB 1YPZA 2A9AA 3VFVB 2AQQA 3FOMB 4PJFA 1AO7A 1PDKA 2XYCA 3LQZA 4FQCH 3KVDD 3C09C 3FSWA 3P02A 3QXTA 2DQHL 4YC2B 2Z91A 4GMTH 4X6CE 3VW3L 3SE9H 2HT3C 1DEDA 1T4WA 3NH7H 1G7IA 5KW9L 5ELIA 1FBIL 2DEYX 5HHVH 2HH0H 2PP8A 1WBZB 1RZ8B 1WAAA 2ESVE 3B6SB 1HNFA 1PX8A 3R8QA 5KW9H 2ZUYA 3MLYL 1TCRB 1QUNB 3HE6C 2JJWA 1RZGB 2A38A 3ZDXE 1YEEL 3CZLA 3KPOA 3WIAA 2BWDA 3D0VB 3H9ZA 4LDEB 4X7DC 1GXEA 4DVBB 1Y6MR 2R29H 2MKWA 3N41B 3BGFB 1U6AL 2P9RA 32C2B 5DDHB 2P8MA 3FQ2A 1EAPB 4R26H 3ZL4H 5FYLE 1I8LC 3AAZB 3WDHA 1NCBH 3TS8A 3L1EA 4CBZA 3L3JA 2DM7A 3QFJD 1QFWI 5FKAA 4BKTC 5LHDA 1QABA 2ZYIA 5I1GH 1A7BA 1N5YH 2NXZB 3ULVC 2NYZA 2PR4L 5EU3A 3KYKH 1FFPB 4ANKA 1A0QL 1RPKA 3O2VH 1CTMA 3TBTB 1HJCA 2J88L 4BKLB 2P24A 4D0DB 3W11D 2PCPA 2YRZA 3NCCB 1HEHC 3B8YA 4KROB 2GABA 5LGKA 3EOAB 3CFKA 4K3EL 4PYHA 3T77B 1P7KB 3IDJA 3L7FA 4K3DL 2QFPA 4PLNC 4UBDD 5LNDA 4ONFL 4ZX4A 3X1BA 1XR8A 3Q9QA 1CT8B 2JCCA 2CMRH 3KWWA 5HI5C 1XGTB 1UOWA 5I28A 2X10A 4DP6X 5CJXA 1AI1L 3QZWA 1U4FA 4JFYA 1T21A 2H32B 3I85A 4OM1H 4PW9A 3ARFB 5FA3B 5K33A 1JZ2A 2VDLH 2VZTA 4JAMA 2FK9A 3GNML 4A2LA 4OV5A 2YFOA 4P07A 3TLRA 1XGUB 3SGEH 4AV0A 3SHSA 1WUNT 1RUAL 1CQKA 5FKAB 3BLBA 1R9FA 1BZEA 1JXJA 2FSEB 25C8H 2YC1A 3JWDH 3TF4A 4MA1B 1OAUH 4Z9KB 5F93C 1LO5B 1YMHA 4I13B 3EO9L 5H37G 1BF2A 1I8IA 4QHKJ 5EEXA 1FN4A 1J5OL 4P3DA 4JG1L 2OR8A 4O5LL 3C75A 3OKEA 3L4XA 3G08B 3WSQH 4I3SH 2EACA 3IDMB 5MEND 3D18B 2ZUTA 4MAUH 1KBVA 4W6YB 1GGTA 1XBRA 1MXGA 4NENB 1KIUA 2JELL 5FEBA 1BZ9A 1QWNA 3CFUA 1QFPA 2O6EA 3LQAL 4GSQA 4PV8A 4QRPA 5E9DE 4QNPE 4EIBA 4LLYB 1I4FB 3LH8A 3QCTL 4XB3A 5C08A 2RAMA 4NHCH 1IAOA 1KXQA 3KCPB 3KBFA 4WWKB 2BO0A 3DPDA 3N40P 4DKAA 1OOAA 3BN9C 2YXFA 1K72A 3QWNA 1KTKE 1GZHA 3ABKB 2PYED 2W92A 3ES6B 5B38A 3QPXH 2Z91B 3T2PA 4MNQB 3D07A 5CN3A 5MENA 4NZUH 3FU9A 2QKSA 4B9CA 3HUJA 1JXGA 2B39A 3MUGB 4I18C 4BZ1H 5H2BA 2AJUH 1IILE 4Z7UF 5DWPA 5EIIB 4P2OA 1CDUA 1DQLH 2ROXA 2XNAA 2F54D 4TNVK 3FCTB 4P5TB 5E1GA 5E8PA 4X5XA 1CGSH 2WXRA 3P0YH 3RVXD 3SE8L 1QRNB 4MQTB 1P7QB 1II4E 2LT9A 1IBZA 4HWZB 3BUIA 4XPGL 4RRPA 1I7RB 1MCHA 3WUWA 2IJ0C 4Z7VA 4UINL 2IFFL 2GUOA 1WHPA 2VQUA 4AEFA 1IBFA 1GC1L 5SWQA 2AJ3B 2C9PA 2FEEI 1BM7A 1EGJA 2H9GA 3H9SB 3PUCA 5CS7A 1EWHA 1Z2KA 3VI4A 4HIXL 2VZSA 4UTBH 2YGNA 3DMMA 3U0WH 1YMMB 5D93C 1KB5A 4NHCL 2BOCA 4R7XA 1V3LA 4N26A 5DZNA 1UWYA 2VERN 5EOCL 3FQUA 1E6OH 1JPTL 4A63A 2X3AA 3FC8A 4NKMA 4R9HA 3TCXA 3RWGA 4YUEH 3HFML 5B8CB 4JPKH 3RHWK 3F5WB 3C09B 3IRPX 3SPGA 3AABA 1JF5A 1JZIA 4OI8A 4LKXA 3TEUA 1RZJC 2UXVA 3O3DB 1F4WL 3AG4B 3D39D 2H32A 4H44C 2R8SL 4PJ8B 2ADIA 2QQLH 1PY0A 4G6ML 2V9UA 3WEXB 2E86A 3VD0A 1MKFA 4LL4A 4Z5RB 3SJVB 7FABL 1JCKA 1Q9OA 2H5UA 2AJYL 5FKPA 5DJYB 3K72A 4FZEL 2CKBH 3EJZD 4TYUA 4KI5C 1FG2A 3OHXC 3DJRA 3FO1A 5F96H 1E6JL 2MFNA 3QULB 2EKJA 1QBMH 5B21A 3LKPA 2KLRA 1DL7H 1U8MB 3GKZA 3U6XA 4Z76A 3QARA 4TVSa 4Z0BL 4GXUN 5SV4A 1BVKB 5F9OH 3AACA 4BFRA 1IAIM 1U58B 1T83A 1F3JA 2M2DA 3D8MA 3NABL 4XAKE 3OLDA 4X6EB 3FCSA 4HEMA 3HN5A 5BRZA 4XNZB 3BVVA 5DZOA 4AGLA 3G6DL 3BPLC 3HRZC 2Y2WA 4LLVB 4ZFZA 1SLUA 3O2DH 2DQIL 4OCSL 2JB5L 4UTBA 2P8MB 4HUXB 5J4MA 4M5YL 3PWJA 3UZVA 1EXHA 4NIYE 3EBIA 4JG9A 3W11C 4JN1H 4TSCH 2N0KA 5MERB 5CU5A 3K4ZA 5TDNB 1GYCA 4KRPC 1MRDH 1UA7A 2DQTH 2X42A 4P4RA 5DK0A 1MN4A 5KN5A 2X6MA 4Z78B 1UQSB 3QC5X 1J8HD 5FLUA 1YVLA 2QTVA 5JHBA 4QTHB 4DPRA 3O41B 2Y23A 4H0IA 4F27A 3UXFA 3DSFL 3L1GA 3W5NA 3S3DB 3QJSB 3U7YH 3G6AA 1M4KA 4NQEE 3LHAA 2A9BA 5MEPA 1VIWA 3E2HB 5DVNA 5HDBE 3WDIA 3VRIA 1C16B 1KGXA 1RPUA 1PW3A 1UACL 6PAZA 3FTWA 5IGXL 2AXHA 2NX5A 3F58L 3DNKA 4C57C 5D7JB 4ZQTA 1KXVC 1FH2A 3GGWA 1ACCA 2P24B 4D0DA 1Y6KR 3L5XH 4KJPD 2V8MA 4H8UA 5AYTA 3SN6N 5KEZA 2P5WE 1WEJH 3QRFM 4YHOH 5TGBB 2OTUB 1N6UA 4EOWL 3E8UL 3B7UX 2PCXA 3VYNA 3V5HB 2H0PA 5ADPH 4CU8A 1OCZB 1J1PH 2VDKB 1RKRA 2RR3A 1KB5L 2EYRA 1SQMA 4IKIA 2XQYK 1PAMA 1YLBB 4PJAA 3PG2A 1NMCB 1IGIL 2BOCB 4AKQA 2X4PA 3MXVH 5TK4A 3R18A 1PKOA 1WJ3A 2MQ3A 4QOKA 3WEBA 2AV7B 4A1RA 4PJIA 3UG4A 2R15A 3TX4A 1UT1A 4JMXA 2YRBA 1NPUA 4XTRD 3FT2B 3JZYA 3VXMD 4MTMA 4Y8AA 2AQPA 4PAZA 3VXSB 5JPMB 4I77H 1ZHNA 2Y22A 3QIBD 1EIBA 3SKOB 2E46A 3JWDC 4X7TB 3AS2A 4CJ0A 3PRZA 5HGAA 3ARBA 5C8JA 1EAOA 2HLAB 4KY1H 2EVHA 1QHQA 3LKSB 4Y1AE 1MRFL 4PGEA 4G42B 2YFNA 1D6VH 1U41A 2B59B 2VT0A 1ZK9A 2PN5A 1E28B 1TQTA 3T1FA 1LO2L 1A7RL 3CNKA 4KZEL 4UMGA 3F6JA 3A6CH 3DYPA 3W39B 3QYMA 4MS6A 1GH7A 2Y7LA 3MUGA 3TIEB 3CN3A 3MRNA 1ODUA 2XWTB 1OCWL 4Q58C 2X4NB 5DJDA 4A7VA 4CSZA 12E8L 2XBDA 3MLZH 5T5FH 5TJWK 2FX8H 3WLWD 4RSVA 4HKZB 4R7DA 5D1ZI 1OAJA 3BP6A 1HKLL 4N85A 4BA0A 4EZKA 1K2DB 2HLFC 1RZFH 1XCQA 2H26B 2ZX7A 5E2UH 3LNFA 4P46C 4PBVC 1GMEA 1ET5A 4Y2LA 3OC5A 1JWSA 4N0RA 5AD0B 1KNOA 5D2LB 5K39B 5DUJA 1ZA6B 5DURD 5JLZB 4R84A 5D71H 3PHSA 2CIIB 3DUSB 2VMEA 1AZUA 3L7EA 4NCC1 5C0CA 1UYWH 2OL3A 2VDLB 1FVCB 3OKKB 4PY7B 1CBVL 4WJ5A 2ODIA 4R8WL 4FULA 4XODA 3FB6B 4FFYH 1IAIL 4PV9B 1T5KA 3P9LB 3DX2A 4NUQA 4PYGA 3WXVL 1RIVL 3OKYA 4N3UA 3VGAB 3POHA 2JI1A 3APMA 2GK0B 2VMCA 4YR6B 3D87B 4PBXA 2UX6A 1FAIH 1FLTX 2GC4C 1A2YA 1PZSA 2DV6A 4F20A 4HIHB 4IJ3C 2BFGA 1WFJA 2X3CA 3D25A 3NABH 3PUUA 3ARBC 2OI9B 3P4MB 5FYJD 4BELD 1ND0A 2W59A 4UAOB 3DXAB 4KHTL 4P05A 5DLML 1U91B 5CUSH 1A3LH 5DMYA 2ZKHH 5HDLA 2GJRA 4ZO7A 4WFHD 5CM1A 1A7OL 5E8OA 3EZ8A 4NCDA 4WW2F 3BDYL 1RAMA 4WTZA 2GTZB 4J12A 3QFDA 5BS0E 1DSYA 4U4BA 4NN5C 5T5NF 3KCPA 4WWKA 1IBGL 5ECJE 3X14A 4WY7L 3QO1A 1CICC 5AW7B 2M1KA 5HHME 1CFSA 4NN7B 4I0CC 4XVJH 5GGSA 2IOIA 4GBXA 1B6DA 2IMNA 4UAHA 1NOAA 2ZUXA 5D9SA 1J1XL 2FO4A 4TF4A 3D7PA 1TT6A 1BOGB 1DBBH 1TO4A 2UWEF 5FCSH 3TC9A 4ZUSA 2KYIA 1VSCA 3HC0A 2FD6H 4GI6A 1JVOA 4BA8A 4F57L 1K9TA 1ODAA 5J1AA 2NY3B 1E6OL 3FF8A 2EDLA 3PWVB 5I8OH 2J25A 3F7YA 4ZODA 3GPEA 3MRIA 4IMKC 2IALA 1FNFA 5GS0D 5D1XE 4Y9EA 4AQEA 2IAND 3QXDA 4G6JH 1ADQL 2V5YA 1MFCL 5LDSA 2F7PA 5LGJA 1KTJA 5DRNA 2HP4A 5JHDD 1DQVA 5HPMA 1YJDH 2XA8H 1NIEA 3BPOB 4B9KC 2IAMA 4CW1A 4AYEC 2AVGA 1ZHLB 4G6KL 4PMFA 1CDIA 3SE6A 3RL2A 2V17H 3ZHDA 1TZAA 3FONB 3E6FA 2JB6A 5GSVB 3Q1SH 1VPOL 5EO0A 4PP1D 3QB7C 4PGCA 4PIBA 2AKRB 1D9KD 3CVBA 4KWUA 1P2CA 3ZLQC 1TOXA 2D7TH 3BP7B 4EI5D 4LASH 4PJDA 1H3UA 4PJIE 1WA2X 4W6WB 2IANA 3V4LA 4OT1L 3HZYA 3QNYA 2VDML 2O61A 1RULH 5JW4R 4JDZB 2EVGA 1XGQB 3BWSA 4QYAA 4OI9A 3WMPA 5CLYA 4B0MM 1N64H 4D0CA 1I3GH 5BUGA 2JKXA 5AVZB 2OMWB 4ZUWA 2FH6A 2KQNA 1AOHA 1F1AA 2JKRM 3C60C 3NGBC 3O3AB 4YHYC 1X4XA 5CBEA 1MW1A 3EYOB 3CHRA 2D7QA 4NGHL 2QSTA 4XH2B 4JFFE 1I1FA 4I48A 5F6IC 2O61B 1UXWA 3G5VB 4MLIA 1WZ1L 5K9KB 1RUPL 5I6KA 4Q0XH 5E2VL 1BSIA 3LNDA 1CXEA 32C2A 1JZHA 1ZLDA 4GRLC 3IBEA 4AYFB 1M05B 2K4AA 4JW3A 3CG8A 4KUCD 4HAKA 5TH2B 3Q5OA 3QS2A 1P4BH 2Y07L 1NGZB 1UHVA 4CSTA 1M6OB 1ZVSB 3NIFF 1MCEA 4RGNC 4BJLA 3MLTA 5HHNA 1PLBA 3BGMB 2EXYD 5IEHB 4I85A 4Z7WB 1HHIA 2EH8H 5KVDE 5CIPH 3AC0A 2ZUUA 1S9XB 4JREC 5I0XA 3JWOH 1VFAB 3MMEA 2CBPA 3N85L 1T0PB 3SY0A 2NUPA 4W9ZA 4ZXBD 3EHBD 5IESL 1XMWA 4XZUB 3TO4B 3QUYB 3H2QA 2VXQA 4NBYB 1ADQA 2WLHA 1B88A 1W0WA 3VRLF 1YDPA 2W9DH 1C08B 3F00A 4NUPA 2BVEA 1QBAA 2EE9A 4YIQA 1F90L 1ZLSH 4GS7C 2BVTA 3T6WA 5FM5O 4Z95L 3KWUA 4BE5A 1HIMH 3DXAD 1RZKL 3ARUA 1D5ZB 3OKOA 2VN6A 1IC7H 4PRDA 2W9DL 3TA3C 2W9EL 3NP3A 2A83A 5I1DA 2APBA 4EI5C 1QLEB 4PP1C 4IGBC 5FFGA 4G3YH 2PLTA 4WKZB 2A7BA 2R0LL 4KDWA 4UT6A 1DZBA 3MXWL 4BQ9A 1JGVH 1KGWA 1DEEB 2J88H 5DR5H 3B9KA 5FUOL 1TYJA 2DLTA 5DF0A 1ORQB 1TIUA 3IDIB 4AH2B 1CGXA 4G9FD 4WNQA 4G6JL 2NCMA 3BPCB 5F7FA 2VL5B 4Y1AA 4E9XA 1J8SA 1DVFB 3TP4A 1FLRH 5GS0C 5DR5L 5A2AA 2E56A 1KENH 2F19H 5AALA 4UB0H 2XWJA 3UP6A 5C70A 4B96A 2ZCKL 4Z3HA 2FX7L 4P2QE 4ZTOL 1KXTA 4RFEB 1CD0A 4WVRA 4DEPB 3C6SA 5JXEA 5H4ZA 1DJZA 4HWBH 5GPRA 2DLIA 3D3VE 4U3XA 4L8SC 4S1DD 4DP4X 2HKHH 5KSBA 2UWEA 4HKJA 1P5UB 2J1KA 3TBCA 3H3PL 3FSVA 3E3QE 4TM9A 3NPZB 1A6ZA 2P80A 5EIIG 4LVHC 4PJ5A 2BHUA 3GJEA 3T65B 2HVKB 3T0WA 3WFHA 2YMXH 1G4MA 1SZNA 2VUKA