1XBDA

Internal xylan binding domain from cellulomonas fimi xylanase d, nmr, 5 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
87
structure length
87
Chain Sequence
b'TGCSVTATRAEEWSDRFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLANASE D
publication title A family IIb xylan-binding domain has a similar secondary structure to a homologous family IIa cellulose-binding domain but different ligand specificity.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 6
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xbdA00
2XBDA 1QBBA 5DHDA 2RTTA 2CWRA 1EXHA 3NDYE 1QBAA 1XBDA 1E5BA 1C7SA 1EXGA 1HEHC 2CZNA 5DHEA 1HEJC 1C7TA 1E5CA 3NDZE
chains in the Genus database with same CATH superfamily
1HILB 2AABH 1W80A 4HJ0D 3RUGE 5B8CA 2X4TA 4U33A 2MHAB 4JHVA 5CUSH 5F3BA 1BOYA 2K45A 5SWSA 1BPLB 4O51B 1U8QB 1M2OA 3RIFK 3DHMA 5FA3B 5DZ9A 2ILLA 3BIKA 5IP4A 5EU7E 4LLMB 3LKRB 3RE0A 3WHE1 3WHE0 2AMGA 2CZNA 3DVNB 2BS8A 4JVUA 4K5MA 5HY9A 2AERT 4XGZB 2WTRA 2XACC 4TQIA 3UTSD 4KKBC 2DEWX 2P5WB 2C3HA 3DX1A 3CUPB 2V9RA 4UBDC 4NZFA 5DGRA 2YRLA 4BRJA 4URTB 4AZUA 1FH5H 4I2XA 3EH5B 3ARBC 2XPGA 5FV2A 4N2GA 1KBPA 2D7PA 4JQIA 5FM4A 1WAPA 3IFLL 2ZWLT 3JV5A 4ZFFB 1R3HB 1HL8A 2CA4A 5DGQA 4JCMA 3RWDA 2EVIA 4W9ZA 3LEVL 3EF4A 1UEMA 1Q0XH 5IBLC 2OMYA 3ESUF 3S3PA 4YQXH 1UJ3B 2I7SA 3K74B 2EDFA 3UTSA 4PREA 4KK8C 4PLJC 4NC2B 4X8JB 4B7IA 1RK7A 4NZ8A 1EHLL 1NGPL 3IJYB 3RVXC 2BRQA 1R34A 4GKZA 4ESKA 3QNYB 3VFMB 2QQQA 4BM7A 2PTTB 1E67A 4H2AA 4MB4A 5SWZD 4XWGL 3TBCA 4HS3A 4HC1A 4OQ1A 5KSAD 1DHKA 3IXAB 5C0CD 5KS9A 4YR6B 4NYLA 3MLSL 3DV6B 2YUXA 1ZAGA 5ANMA 1AI1H 1ILSA 1MHCA 3O0LA 3REVB 1T4WA 1ZSDB 2EIBA 3QDAA 2R0ZL 1OARH 3UP6A 3T1FB 5FA4B 1EPFA 2F8VA 2UX6A 2R0KH 2K4WA 5GSVB 1JV2A 4PRPB 4WWKB 3DUUA 5ICZB 4HXAL 3FFOA 3PXLA 5DZOA 1XAUA 2BIQA 3CDFA 1Z1WA 4FQXC 4P23A 5SWZA 1UEYA 4PS4H 4ZQTA 3GD1C 3N2JA 3ZRFC 5KSAA 4K7PH 4OW6A 1G1OA 2ICWJ 3PGCB 2E8YA 3BMVA 4HKZA 3G5XA 1F8TH 4IOFC 2QSTA 4FNLH 5ITBL 1K5NA 5AW9B 4R4BA 3SDDC 1J1XL 1HEHC 2ZSWA 4NN7B 3MV8E 3DECA 1TCMA 4EI5C 1Z66A 1F11A 1GRWA 1SN5A 2OW7A 1MWAL 3NJLA 4AL8L 3WIIL 5HHOB 4G6ML 4LGSB 5GRXG 4CC0A 1WBXB 5C86A 3DOIA 4AKQA 4MNQE 1TZOA 5H35B 5DFVD 3IWVA 1T1WB 3V10A 2JCCF 2CGRH 3QAZB 4FMFA 4IRZA 2QPSA 5TE4H 4IKIA 3QZLA 4KK6D 1X7TA 4IGBB 3OMAB 1F00I 3L3GB 5HHMD 3DSNB 5B3NA 2HMIC 1IFRA 1JSYA 4GSXA 1U4FA 3NDZE 3NSCA 2MHAA 3GSNH 3U30C 4K3HA 3T77A 3L1FA 3VE0B 4LLQA 5LAXA 1PG7X 4DOHB 2DQHL 2WKOA 4JFPB 3RX8A 1TG8A 2Y69B 4Z7NB 2VISB 4IKJA 3DVNA 5AVUB 5SWSB 2HN7A 5HGHB 5HDBE 3IBOA 1T2JA 4LF3B 4YGAB 2MRYA 2Q76B 5AW6B 3B8SA 2P5WA 5CWSA 1ZS8B 2XNAB 5BXFA 1HE8A 1U8LA 2PXYD 3SBRA 4DHLA 4JB9H 1QQDB 2QHLA 2QL1A 2RB8A 3GLAA 4OFVA 2YD2A 2NQDA 3Q8CA 1L3NA 4FQJH 4JZJB 2FBJL 2R23B 1HOEA 3DJTA 2LLLA 3SDCD 4BJLA 2Z31B 1XBRA 2VTFA 5FO2A 3OKLA 1FIEA 2C9QA 5I24A 5C1MB 3HS0B 1FV1B 2HKHH 4ZW5A 4Z0BH 4LSPL 4WU5B 2EO7A 4KX8A 3SGDI 1W72L 1FZOA 2VN3A 1W9XA 5HPOA 3VD4A 4X8JA 4FYRA 1OM3H 4X4XB 4KZEH 1PMYA 2PXYA 4HGKC 4BZ1L 1IGTA 5JOEA 3BZDA 3E7JA 1PX8A 1FDLH 3WKNA 1FL5A 3C09C 3SDCA 3U0PB 4YIQB 4X98A 4TLTA 3LH2H 2F8IA 5HDWA 3MJ7B 4U1IA 4ELKA 5F7WC 3DV6A 1MCWM 5HBBA 4E9VA 1AXSA 4QXUL 3REVA 1LQBC 2XV2A 5B4MC 5DLLA 1G7HB 4P2YA 3QC5X 5JO5B 3T1FA 1DSFL 3WFDL 1Y6KR 3QC6X 4P5MA 5GSVA 3MXWH 1YVLA 4PRPA 1Z2KA 2IBBA 5ICZA 4RMWA 4L37B 4L8SA 5GGSB 3LSOB 1KGYE 4YNYB 3BKYL 5JIPA 1CIDA 4JRLA 1V10A 4ONFH 4QO1B 2NT1A 1TTRA 1WVZA 3PGCA 1R5VB 5DHDA 1FNGB 5B39G 3JZYA 3VXOA 4NM8H 1SBSH 3UG3A 2OTPA 4XNXH 5CP3A 4YDMA 4WCYL 3F5WB 5DO2C 3WAKA 5CD3B 1ACCA 1WFNA 4XPBL 2AQ3A 5IB1B 5K69A 5LXVA 3PWUB 1LO0H 5HHOA 5H94B 1DTUA 3VWKB 1MWAB 3KM2A 4DW2L 5E9AA 2VLMD 5DYOB 4NP4H 3QYCA 3GFUA 1LEKA 5H35A 3P9WB 3DX8B 5C08A 4RSVA 2R69L 1T1WA 4O02H 4NKDB 4DEPB 3RWJB 1M56B 1NLBL 5D7SL 1KPUA 3GBNL 1JZHA 2R1WA 3QJQB 1MI5E 4MNHA 2GSIB 3L3GA 2RALA 1RSYA 3PL6C 1A9VA 4KRNA 4A67A 1FJ1B 1A1MA 3S5ZA 1FGNH 1UM5H 3KG5A 4LSVL 2XG4B 3BE1H 1IZKA 4XRCB 5DJZB 1DSWA 3DIDA 2IADB 3AB0C 4QRAA 2XC8A 3X11B 3GPSA 4FLRA 4NXSA 5B3JE 4AYDC 5D1XC 4R0LA 5LVEA 4JFPA 3QUYC 1UB6B 4KKNA 3MODL 1HNYA 2XA8H 4ZMPA 2DV6A 3UAFA 2EDYA 4TTDD 5AB1A 3RFRA 2XNAA 3N55A 1BQUA 1NGXB 5D1ZC 3OR7A 1UD6A 2A5UA 4OGZA 4R7VA 1J0JA 4GBXC 2CCVA 35C8L 3GKZA 2F08A 2COQA 4HX1B 4HXAH 4JZJA 4ALAL 4KQ0A 2R23A 5DC0A 4Q9QH 1GHFH 2OMZA 4MQXD 3OWEA 2GY7B 4Y5VB 3LAFA 4ODTL 1M7XA 1YQVL 3OKYA 2RAMA 4HCRA 1NCNA 1DP0A 3X17A 5DMIH 3VFSB 1SOQA 4WU5A 4KKAD 2YD3A 4MA1C 3VNZA 4OZGE 5AWNL 4IRJC 1FE8H 4Z77B 1L0QA 2W60A 4XXCC 5BS0D 1NMAL 1A5FL 3I9GL 4LEEA 1W72B 4IMKA 3GSQB 2YQ3A 1DE4B 2VLKB 1B2YA 4LSDA 1ES0B 4KVNL 2XBTA 3NCYP 3TA3C 4D9QD 2NCEA 1P5UB 2A73B 2KLTA 4G9FB 2XWZA 4QRFA 4GAGL 2X4UA 1TZHB 3UX9B 1MFAH 4C59B 3FH8A 4HDIB 1TTFA 2PPDA 1P6FA 1LDPH 3HG1D 1ZDQA 4FI7A 1RMFL 3BN9D 1FZKB 2XVBA 1NMBH 1WIUA 4MS8D 3UABA 3VWJC 4U7SA 5J11B 2I27N 2CRIA 3UBXG 1IQDB 2MQ0A 1CFQB 4I4WA 1KDIA 4QGYA 5DDHB 5FKAB 5KOMC 5BS0A 4MXQD 1G7HA 3M7FB 5JO5A 4X9YA 4BK5A 4ZJ9A 2CLRB 3QSKB 4I2XE 2G0KA 1BM3L 5GGSA 3ZYJA 3BW9B 4YNYA 4KHXL 4DPAX 4PJFB 4ODUB 1MCKA 4OLXL 4TNWF 3LB6D 2E76C 2NY7H 1CFSB 1R5VA 3HG1A 1J5IA 1V7NH 5CM1A 1AHWC 1LK2A 4Q56A 3AC0A 3KBFA 3OAWA 1UWEH 4QPEA 4W9GC 1HC1A 2GIXA 3SE8H 5I66A 5IFHL 1GR7A 4P4RA 5L88H 1U8CA 4HIXH 4GP8B 5LBSH 2F7OA 2O6PA 3F5WA 3UTSE 3WTVA 4FHKA 1RZ7H 1GL4B 3PWUA 2XX0A 2WMPA 3ZTJH 1JDAA 5DFAA 1BBDL 2DZEA 3SPHA 4K3EL 5JXAH 2ZF9A 4M7ZC 5H94A 3VWKA 1MWAA 3D34A 2JKIS 4L1TA 3QFDB 5TQ0L 2VKXA 5CN3A 5TK2A 4BKSC 3F85A 3P0VH 1K3ZA 4NKDA 5KS9E 3QUMA 3O6ML 5B1KA 2LW3A 4OFPA 3ENEA 1QMUA 4Y5XA 2B7DT 1QPPA 4ZODA 2NQCA 5ANME 5MI0C 2V5SA 1I9JH 4AEFA 4CSTA 2XG4A 4J6IA 3FRPB 2KUTA 3DO3A 4XRCA 1YNLL 4JFDB 2A4CA 3ZE0B 4LCCA 2V7NB 2CJSA 4BSJA 3QIUC 1N8OE 3GB7B 3U7AA 1UB6A 4V2BA 3L54A 2B9BA 4GKSB 1XF1A 2CR0A 4WNQA 5E4AA 5SWZE 2X40A 4D0DB 5A40E 5LQBH 3O8XC 2ICWI 1QHQA 3IF1B 3SYAA 2AKRA 1HNGA 2GK0A 5E2WL 2J71A 2XKNA 5HYFA 1NGXA 1JERA 5E6IC 3ZZLA 1BZQK 2HT3D 2FJFB 4OCXL 1BZ7B 4JFEB 4JY6B 5DD5L 1DL7L 2RTTA 3GIZL 1TLKA 3PS6A 1W2KT 4FXKB 3C9NB 4I48A 4ZDHA 4BSVA 3CLEL 4DGVL 4EMZA 3EYVB 5TFSH 4BQ8A 5JPNB 1NCBL 4KHTL 2E7DA 4Y5YC 3S34L 4QHNB 1GKOA 3N42F 3WKML 5I18H 1RZFL 1HL4A 1I82A 2JJUA 2J6EA 1SDAB 4XTRC 1WZ1H 4ZXBB 2HRLA 4NJ9L 1W72A 3OLGA 3DX0A 1RHHB 1DE4A 2VLKA 4RRPA 4LOEA 1LJMA 4LHUD 4ZMWA 2VXQL 4MBOA 1BJ1H 3LN9A 3QFGA 5IOPA 1YEGL 2A73A 3VGAC 4G9FA 3D52A 4WI4A 4BZ1A 4M1GL 1FI8C 2UYLB 3ERXA 5JUEL 2J88H 4R7XA 5M94B 3GRWH 1TUPA 3FTYA 4PUBL 3KL3A 1U2CA 4HDIA 3SKNB 4TNGA 1UM4L 1E50A 2HYMA 3SE6A 4I3SL 5AAPA 1FZKA 2OCJA 3H42L 4JO3H 4PJFF 1AGBB 4PW3A 4HFWA 1MH5B 3GXFA 2A9AA 5FKAA 1S3KL 5KJRH 5F6IB 1QSFD 2HCZX 2IMMA 5F3HA 5I17B 4OUOA 3CN0A 2Y7OA 4NQCD 2XA3A 1COBA 1IC4H 2CLRA 5HHME 3RDTD 1FG2B 2WCSA 1MAJA 2Y1YA 5D8JL 1VKXB 4XCCL 2DQIL 4S10A 2D3NA 2VR3A 2EIZA 2YKLH 3BW9A 2JKSA 2YPLB 1QZNA 1BHGA 1OP4A 2H0PA 1NPUA 1SPDA 4JKWA 1NZRA 3P4LA 3Q3GB 1CFSA 2W92A 3ZGIA 3BVDB 3QP3A 3IJHB 2WGXA 1RLBA 4PW9A 2NDGA 4JO1L 1H5BB 5ICYB 4NQDB 2YJQA 3UIZA 1XD1A 4U1KA 3TJHD 1F1AA 4NQCA 1A47A 4KGLA 1F41A 3RDTA 4JN2B 3CH1A 2N0MA 4WJG3 4JZNA 4M62L 3QRGL 1IC1A 3IYLW 5GZNC 4NCC1 2OFQA 3QFDA 3AMKA 4XN1A 3ZE0F 2DDQL 3O2DA 4AY0A 1ZANH 4TSBH 2B3IA 2DQCL 3PWPB 4OFYA 4S1SL 2YD8A 2XWTA 4YN3A 2R69A 2G2RB 4R2GB 4RISL 2B20A 1E65A 1FBIL 5EWIL 5I28A 3VXRA 1MLCB 5JA9A 1OTUC 3BT2L 4WRLA 1U8HA 1HSBA 4MNGA 4N5UA 4X5RA 4AH2B 4D9LH 3PGDA 2HT4D 4JFDA 5GRJL 2EKSB 1N70A 1HNFA 2APSA 4XVJH 5FFGA 2H47C 2VUKA 2VH5L 3GB7A 1AYRA 1F3RB 1O6VA 1AXIB 4N6RA 1MCEA 1AD9A 1P84J 3FN3A 4D0DA 5GGRA 3NJGA 1JYWA 3FSVA 1GC1H 2VXVL 4F33B 3FYIB 4KRMB 5DRXB 3A24A 1BJ1J 3IAPA 3MYJB 1UTDA 1AKJB 3S88H 4IIZA 4V1DD 4ZFOL 2D3JA 3ILDA 1THCA 5FYLL 3ZIMA 4YDZA 3LKSA 4GNKB 4KJPD 2BNUA 5I82A 2UZPA 3SO3C 4FXKA 2QEJA 2WXOA 1OAYL 2EDOA 2VL5A 3B2PA 4TUOB 2NUPA 4KHXH 4PJ9C 1S7VB 2RH0A 2YXMA 2X0VA 4YFLF 3TESA 1INEL 3APFA 2FIKB 1ZKAA 4TNVK 1AS7A 1JGUH 1S9WB 2CPUA 1SEQL 2FR4A 1E7UA 5C08E 4B0MM 5FGCB 4JHWH 1EVTC 3HE6D 4OM1H 5DMKA 3OLDA 4U1LB 3LNEA 4K94C 2WC7A 3FF8A 2M8XA 4V1DA 1RHHA 1NAKH 2EE9A 2VN4A 5D96C 4PGCA 1V54B 4FQIH 3MRKB 2WY3B 5FLUA 4X9IA 4TPRL 4BK4A 3QA3B 4NP9A 3CSBA 3E9TA 1QNZH 3PQYB 3Q8FA 4WJ5A 1UD2A 4YMPA 4FN0A 4MB1A 5E2VH 1T0MB 4NQXA 4QRRD 2YLKA 5DXWA 3SKNA 3WE1A 4JLRB 3V7AG 4TUKL 1E6OL 2VLME 4XO3A 1EEQA 4Z7NE 4RGNC 1KIQB 1MH5A 4YO0A 5JIQA 2IIJA 2W8CA 3JVFC 2VXTL 5I1GL 3SGKA 4P46B 5E8EB 1XCWA 4WI0B 3D05A 4U0RC 2JMRA 4N2BA 5LGHH 1JL8A 5SX4I 5IMMB 4LLVA 1NAML 1DQIA 1G5AA 2ZXAA 5F2FA 1BF5A 1VKXA 4DKFH 9CGTA 2YXFA 4OCRL 3DHPA 3CLFH 3K4ZA 1RZKL 1HZKA 4QRRA 1S9XB 2CBPA 3CCHA 5K39B 3IJHA 2GPZA 2R8SH 2BX5A 1H5BA 3HC4L 4NQDA 3NSXA 5GS1B 1QLEL 2D7NA 1ZTXL 1ZMYA 2X4PB 5IK3B 1O7VA 2BY0A 3CSYB 4FFYA 4KQ4L 4PWEA 5JLZB 5ELIA 4JN2A 5AYQA 4K5NA 1EJ8A 2NY0D 4FJYA 2VR7A 2Q6WA 3ORJA 2FYYB 1B0RB 4QXWA 4KHTH 3PWPA 4AUYA 3HS8A 3KR3H 4PRHB 4Y19D 5JHBA 4KK8D 3BQUC 3S36L 5IHZB 1T21A 5BRQA 1J0HA 3FO1A 3HBGA 3RVXD 2GFBB 4XCYA 5TPWH 2QQKH 4X6BB 2VXQH 1LO5B 3ARBA 4ABUA 5BS0E 1IGMH 4N0YH 4J28A 3RVUC 1IE5A 5FHAH 1NCDL 5IQ9B 3U7YH 1MHEA 1N4XH 3KGRA 4PRDB 2QVMA 3CX2A 1EVUA 3PABB 5F1SA 4D9QE 3P02A 4K5PA 3WHXB 2GSGB 3L4TA 4PG9B 3RY6C 5KTEL 3M1BB 3KYMB 1HOCB 3LNHA 4UQDA 4ISVB 5DRXA 4Y19A 1T6BX 2DF3A 1F86A 3MYJA 4HIPA 3HG1E 1EHKB 1LO2H 1WGVA 4MA8H 4M03A 3GC3A 1PKQB 2RJMA 5D70H 2Q3AA 2C9UA 4ZFOB 4FQXD 5KUKA 2BVUA 4TUOA 2WLLB 3BAEH 1JNNH 2MKWA 2QGEA 1KBGL 1UOVA 2XLLA 5HDRA 4ZFGH 1EAQA 4IOFD 5FW6A 3QEQB 5KANI 1KB5L 5GSRA 1EHAA 3DMMB 1H8NA 3JYCA 4OUUB 1KGCD 3MTXA 4FGMA 2EXWC 4NUJA 2DQUL 2MQ3A 4JN1H 4MJIB 4EI5D 4PJBA 1HIML 3MQIA 5I1DA 4QTIL 1KF9B 1XCQB 4E0RB 1YSOA 1M6UA 4AGOA 5CHNB 3BRDA 3U6RA 1X5KA 4FQXA 4HJIA 3PQYA 4HJGB 5E4EC 1T0MA 3O81A 4DN3H 1NKOA 4JLRA 4P04A 4S1SH 2XBDA 3SDDA 5PAZA 1KIQA 1R5WB 4C83B 3IDIB 4JFSA 3NESA 2VQ1B 4O5LL 4TYUA 4X7TB 2HMID 1X6NA 3K6SA 1YRKA 4L1SA 5HYJB 4TSCH 3UL4A 4LK4A 1Q0YH 1PZCA 4JM4H 4M5ZH 2BFGA 2K8QA 4U1MA 4JG5A 3CMOH 1XEUA 5HDQH 3P9MB 1UASA 1UZ6E 5HI5C 5I1JH 1U91B 1NAMB 3NPSC 3FCTB 2QZQA 4YHIB 4DZBA 4KZDH 1IKFL 1P6WA 3C8KB 4HALA 1KXHA 5AZEH 2VWEC 3FUIA 4QYOB 4I9WE 5FYLH 5I0VA 1NFKA 4E9WA 2W9DL 4XOCA 2EUZA 2X4NA 2WNKA 4KITB 2OQJA 2XWDA 2FB4H 2KPWA 4NAMA 1A1OB 1TO5A 4YXHH 1QLEB 5FYJU 3AT0A 4JX0A 3K8MA 4E5XG 4ZAKB 4FHBD 5D1XB 3AG3B 4FG4A 4HP5A 4L4JA 5EZJB 2FBOJ 2H41A 2NW2A 5D7IF 1XZ0B 2VERN 4FG6C 2AEQL 3V4LA 5DEGB 1FPTH 4PRHA 1VGKB 4M5TA 3OV6A 1QFWM 3KPQB 3QWOB 4NX0A 5D1ZB 4OZHF 4FKKA 3FQWB 5JQ6H 5EOCJ 4X6BA 4GBXB 4L23A 1WIOA 4WO4B 1LK3H 5IQ9A 4YDNA 3NQIA 4FS0A 1AQHA 3HBPA 1QD0A 4MFHA 3BQVA 1BIHA 2OLDA 3AU1B 5HYSA 2UXVA 5MHSD 1UWGL 2WWOA 3DPDA 3PABA 2L7EA 5EZOH 1K4DB 5DWUH 2JQMA 2C9XA 3KYMA 1HOCA 4MA1B 1TJHH 2Z0UA 3S4SG 4UYQA 4O4YH 5DVLA 3MROB 1JVLA 2F15A 1JVOA 4LSTL 4Z3TA 4OZIA 3L4YA 3L7FB 3ZHFA 1OCCB 4P0DA 4UT6A 1NPJA 1PKQA 3KYKH 1QSFE 1I3RA 1I7UB 2I60L 2AEPH 4ORGA 1A7QL 5E4OA 4XPAH 1LD9B 1VB9A 4NQCE 1B0WA 2ZICA 3EO1B 4KK5D 3V0WL 3MLWH 5LWYH 1O7DE 1RY7B 3V4VA 2BVTA 3OAYH 3OSVA 4J2QA 5AZUA 4ZZKA 3H2PA 3QEQA 4MDJB 3H2QA 3OAUL 3DMMA 4HD5A 3M1CA 2K6ZA 3QULA 3NUKA 4Q0XL 5I5JA 1QNIA 1TTBA 1CURA 1KB5B 5DO2D 2NZ9C 3WKQA 1Z7JA 3GQFA 4MJ2A 3CD4A 3DO7B 3VXRE 1OWWA 3E38A 2FO8A 4N2MA 4YPGB 3BKMH 4MNGE 4QF1B 4J4PD 4RZCB 1MFVA 3GXMA 3HIZA 5CHNA 2PPAA 2IAAC 3G5VA 3O9WC 1RZGB 3ARDB 1KCLA 4NHCL 5AOZA 4ES9A 1TJIL 5T3ZL 3VJ6B 1XGQB 4AQEB 2P5PA 4Q6IB 4RAVB 3ZYIA 4NO2B 2X4OB 1R5WA 3PL6D 5AL8A 3EFFB 3IDIA 1X5LA 1LILA 4X7TA 1M1XA 2YZ1A 3CV5A 1BVNT 3BPLC 3I6KB 1G0DA 2EUVA 3CFCH 2X1PA 5CEZD 5HYJA 3AADB 2JJTC 2QADD 2OSWA 4LBEA 2VRAA 3GSOB 4UTBH 3P11H 1D2PA 4M7ZB 4YHZH 3QUYD 4KX9A 1CLZL 5E1AA 5EN2A 3A21A 3VXQA 3P9MA 3TH4T 2GTZB 3E6FB 2OI9B 2PYED 2A74C 1U91A 1M7UA 2MPAL 1NAMA 4UM9D 5JHMA 3D7PA 3FCTA 1OO2A 3MVSA 4YHIA 1RJYA 3MJ9L 3QEUB 2BINA 1XF2B 1G9NC 3FYEB 4HSCX 3V5HA 4BKLB 5EEUA 1OAKL 4DETA 1CICC 2E27L 2EVHA 4JZOB 1KJ3H 4OZFG 2KYIA 3ETBJ 3V4PB 1HL9A 4V1DE 1A1OA 4HWBH 5DUBA 3D3VD 5EZPA 1GOHA 2G60L 1BSIA 5D1XA 3QUYA 5F9AC 5J12B 3PPSA 2PYEA 1IILE 3LQMA 4LAQH 4Z7VA 4HUWA 3O8XB 1ML0A 4OAWB 4IRJD 4BFIB 1H6FA 3G5WA 4K3JH 1CDBA 1D6EB 2R4SH 1RKRA 4M29A 4NT6A 5D1ZA 3LIZA 3WY2A 2QSCL 1WA2X 4GBXA 3TA3D 4A38A 3HNTL 4WO4A 2AV1A 2G30A 5EU4B 1YN6B 5CCHE 1PSKL 2Y36L 3KS0H 4QNPE 2HPTA 3AU1A 3DV4A 3VXSD 5LJYH 4ELMF 3OZKA 1N6UA 1BQSA 3BT0A 2C9SA 3FU6A 3L9RB 1CE1L 3AS3A 5D93B 3CFJB 5EU3B 1HI6A 2Y5TB 3MBWB 4L0ZA 2XZQL 4BFBD 2QV2A 3QDMD 5AUMA 4YFLI 4XP6H 3VWJD 3KLHC 4KJQD 4EBQH 2BSED 4UILL 4QRRE 4XXCA 1X9RA 5DD6B 2ITFA 3MROA 4AW7A 3MV11 3ZX1A 3I9AA 3WXVL 1XGTB 3HB3C 1RZIA 4N0UE 4QXGL 4NQDE 3TA3A 1X44A 1QSEA 1CF8H 1S3RA 1OKEA 1LD9A 2DN7A 4O58L 3WNKA 2LU7A 1NCWH 3VXSA 3KJ4C 2ORBL 1B0GA 1BFOB 3ABKB 5F1KC 2C7UB 1U3YA 1ZVNA 4R7DA 3CG8A 5EF0A 2GJPA 1QABA 2YXWA 1SEBB 2FJHA 4F1ZA 3V4PH 1FL6B 4XP4H 1P7KA 2WQWA 3B2MA 4G8IA 3PWPE 3VX0A 2B5IC 1X4ZA 4OQTH 2DQTL 2X42A 4I3GA 3DO7A 4Q74A 2ZOKA 4G5ZL 3QQNA 1S5HB 4RFEA 4YPGA 4RZCA 4Z18A 4AQ8C 1FVEA 3ARDA 3U1QA 3KLQA 4DGIL 2XTLA 3DJRA 3G9VA 3K6NA 3MFGB 4LSUH 4OV5B 1DFBH 4UV4H 3IU3B 2QVIA 2EH7L 1EWHA 1PG7H 4RAVA 2X4OA 4N2LA 4Y4HD 2FLBT 4IDJL 1YC7A 5HVHC 4HLZG 4Y19E 5AG8A 4JFUA 3SPVB 3I6KA 2XBZA 5IW3A 4YWGH 1UG9A 5EF1A 4BUHA 4X7CC 3INUH 1TSRA 4GMSL 1VADA 5F1IB 3CK0H 2BPBA 3QIUD 3AJ7A 2GTZA 1IM9B 3E6FA 4OKVB 3VI3F 1H9VA 4Y2DB 4CBZA 5CBAB 3VQ1C 5D7JD 5HGDB 5DK3A 2WUBL 1RURH 5I73C 1F4WL 2J72A 1BXUA 4MD0A 4UQIM 5E6ID 2CK2A 2FX7H 2XTJB 4YL4A 1D9KB 4JZOA 3MRBA 2BSRB 2CHZA 4IBQA 1J88A 1E6JH 1IEAB 2B1AH 2FD6L 2XQYK 4KO7A 1JWUA 3NRPA 4YSTA 5E2UL 5FPIA 4KMLB 4YBLC 2B0SH 4XNMA 1A7QH 1D5RA 3LNIA 4PJBE 4WDIA 1CO1A 4CN4A 2G75A 3QIUA 1LE5A 1NGQL 4DKAA 1OGAD 2A6KB 5JW5A 2BRRH 1EMTL 2E9JA 1USZA 3KYNB 3TV3H 5IVXB 3OAUH 2PCXA 4XBPA 5DC2A 3SD5A 2J55A 3O8XA 3ZIYA 4M43L 4YJZL 4BFIA 4XTRD 3VMPA 3ATBA 2APVA 4XE0A 3VQLA 1FNEA 2O72A 3MCLL 4ETYA 2CO4A 1XL4A 5E6IA 4UIKH 3NACL 2KS0A 4P49A 1CMOA 2OXGA 4GQRA 1KGCE 1SN0A 4QHMB 4ZX3A 5E56A 4UNTA 3IN0A 1WFMA 1YN6A 2G2PA 3S96A 1A7RL 4XHQA 2C4XA 3MREB 1TSHA 4PJ9B 4UT9H 1WF5A 3FBQA 1JFHA 4QRTA 3A6BH 1OGAA 3ARQA 3CFJA 4JFFD 5G4OA 4Y5YA 3MBWA 3WN5C 4EIBA 3JWOL 4JR9L 3ZQWA 1QBAA 1WE5A 2FL5A 4Z78B 2VYRE 1WBZA 2JI2A 2GW5A 5GIRB 5GGVL 5IMKA 3PGFH 5I76B 3WEXB 1RVFL 4N3UA 3TP4A 5J06A 1WFTA 4J6RL 3ULSB 4Q97A 1EJ6A 1PCXA 5CGYC 3Q8AA 4OBRA 3V52L 4PWHA 3BYYA 3SKJH 3QRFM 4P2QD 4F2MA 4KWUA 1HN1A 1FNSH 3TEZA 1BZOA 3MRIA 1UM6H 3HI5L 3BKCL 3P4OB 5E5RB 1KLUB 3U4BH 4GRWH 5HJ3A 3CFEB 4S1QH 1ZT7B 3CMGA 1U8NB 2G5UA 4PRHE 3NCJL 2Y2YA 4HIEA 1TETH 5DHYA 3GT6A 4X99B 1BZ9A 2NPLX 2F19L 1MRCL 1IFHL 3O4LD 4PJAB 3ZHLA 3OB8A 4FA7B 4JPKH 2Z4QB 4MA7L 1KB9K 2TSBA 4HPOL 5GZND 1D5BB 4ABQA 4YSAA 1RFDH 1KB9J 2P8LA 4BFKA 4OV5A 1MZZA 2H5UA 4HQQL 3U36B 4PV1C 4CADB 1C5CL 4KH9A 2DLGA 3HAEB 2IAND 4KXDA 1OTUD 2WPGA 4RDBA 4OJAA 5D5MA 4OZIE 1YEEL 3D51A 3V6ZB 1OPOA 3HPLA 4XB3A 5EUKA 1FNAA 4GRWF 1E90A 4J3XA 1PKQE 2WKGA 2ESVB 2GBAA 1XIWB 2F7RA 2L4OA 5GZNA 4Y2DA 1E3FA 2E4FA 2ZKHL 4PRNB 3VFPB 1VZIA 3CFIC 2DWDA 5MHSE 2P7TB 2X6UA 3WKPA 1HQ4B 1HK6A 4QOKD 2FGWL 2IANA 1NEPA 1PTZA 2EINB 2DJ4A 2Y25A 2QPFA 5DJ0B 4M1DL 3D08A 3QISA 3A22A 3G6AB 5HHNA 2B9AA 3EDJA 3GWJA 3ULUH 4F5CA 5EIIA 5CILL 1DCEA 5GGQL 3P3RA 2ENPA 2A6KA 2M2DA 5E51A 2CMRH 2AANA 5I6KA 4QRUB 4ERSL 4IQHA 5IVXA 5I1IL 4LKCB 3DURA 1SLWA 1ZHLA 3IU4H 3MAWA 4UV7L 1RIVH 1D7BA 4M4RB 1QLRB 4G6FD 2Y6SC 4PV8A 3OAZH 1EAJA 1EFXB 4AKOA 2DQTH 2CO1A 4MCYA 5DI8B 5TDNB 4ZO7A 1MFBH 1YMMB 3SQOL 1PNDA 3OL2A 3QJFB 2CG9X 4NQQA 5LCVL 2EYSB 5HYJE 3MREA 4OD2A 5IV2A 4PJ9A 4X8GA 2NX5B 4H1LB 1DQKA 1U8OB 3P54A 2APXA 3WI9A 1GS6X 4HK0B 3GXPA 3OM3B 4PJ7A 3GHEH 4RGND 1NIEA 1VEOA 4Z78A 2YGOA 3NIGB 3ULUF 5DSCA 2AXFB 2E4TA 1GJWA 3HZ3A 4PY7B 3UBGA 3UTTD 1ORQB 1R3KB 4GMSH 3MGOB 5AYTA 1W0YT 2H1XA 4LLYB 4LT7A 3BP7B 1TJMA 2BVOB 4XPHH 3VVWA 5CEZE 4GMTL 4NWUH 3OG6B 3RWIA 1FF5A 1X6LA 3ZDXB 3GXTA 3KPPA 2D7TL 4P5SA 4G1EB 5D1XE 3P4OA 2FE0A 3LRHA 4R83A 2WXMA 2PYEE 3CFEA 3ZZSA 4Z7VE 3VD9A 3ULVH 1MN4A 1WC7A 5FFOA 2UWEB 4NUQA 2ICWA 3LXUX 4EDXA 5B38A 3BUDA 2HLFD 3UTTA 4PJAA 1LYQA 1MQKL 1K9TA 2VMFA 2Z4QA 1R24B 3HFFA 1KPVB 4HVBA 2VLJB 4B9CA 2IBZY 3L4UA 3CZJA 1IEHA 4ODXB 3FO0L 4NJAH 4QLRA 1GGCH 3V4UL 4XNZB 5DS8B 3BEVB 4W6YB 5HJBA 1BBJB 4KXAA 1R19A 1ZT4A 5DC9B 4TOYH 3U36A 4CADA 3NJJA 1X5ZA 4Q9CA 1IT9H 4OF6A 1ZIAA 4XNBA 3T2PA 2ICEC 1N59B 3V6ZA 3F83A 4EUPB 2XCMC 1XGRB 2ESVA 1WDAA 1XIWA 4FE9A 3SDYL 1QSEE 3ESOA 4IIQB 2K3HA 4PRNA 4OLUH 3JWOH 4F3FB 3VXSE 1PCSA 5MP6L 4TULL 5IB3B 3BQUA 1OE1A 5I1AB 4JVPA 4KUCF 1OAQH 1A7OH 4MB5A 4MD5B 4MAZA 3DUHA 2E9WA 4I77L 2GTWB 2HG0A 3HNSL 3I75A 5DJ0A 3O2VH 3FTUA 4NQEA 5FYKU 3SPIA 5ITFB 5B1BB 2LT9A 4OLYH 1F5WA 2AF2A 2FEDD 1F4XH 3IM1A 4Z5RB 2GCYB 3GI8L 5C0FB 4UT7L 1Q94B 2WP3O 3QIBD 3RY6A 5FOBB 4HJEA 1TENA 1A2YA 3MKKA 1MFCH 3HC3H 1BQKA 1CC3A 1R3LA 1N9PA 4LKCA 3THML 4M4RA 1QEWA 4JQVC 3W11C 4BH8A 2VZ1A 5GRVK 1EFXA 4OIFA 5T33H 5AB2A 4ECNA 3LNGA 2E9IA 4BH7B 3NN8B 3NIGF 2EYSA 2SEBB 4R97C 2X41A 3CFTA 4NNYB 1W6WA 1CK0L 2NX5A 2IH9A 4H1LA 3ASWA 4MQTB 3N0PB 4N5ED 4LP8A 4YHLH 3W2DL 3UC0H 4HK0A 4B0MB 3MRGB 4ZTOL 1YEWA 1OCWH 4LFHD 2FGZA 2ZXEB 1EV2E 2XYBA 3WIHL 3MSPA 1ZHKB 4PJDB 3GSVB 3ZDXF 4ZMYA 3ZT6A 4UMSA 1ZE3H 5FM5M 4MD4A 4I5BA 1EA9C 3MLZH 1URLA 4MMZB 4RDQF 3SEPA 1GY1A 3L3DB 4HU2A 5EBGA 4HWEH 3D0VB 1R3KA 2Y22A 4QJ5B 4LLYA 2MCMA 4C47A 4FFTA 3BP7A 2BVOA 1OT1A 2D3VA 5KYUB 2R2EB 5HI5D 5GGRY 4DFIA 1JGLL 4JFHE 3TEUA 5CF3A 3D4ZA 5F0MB 1UB5B 3IJEA 2PPEA 4D94A 3GMPB 4K07A 4X6DF 4WWKD 4R5XA 5DK0A 4XBGB 4FL4B 4FKHA 2IC2A 5B7EA 4OIAA 2UWEA 3BPLB 1GH7A 5FK9B 3L2MA 3OHMB 5AOKA 5EC2A 3RGVB 2GJJA 2VM9A 4HFUL 3GSNA 4MCMA 1CXIA 1KPVA 4MZIA 3QUZB 3V0HA 3H6AA 4BA8A 2F5BL 3G6JB 2HFGH 4U1GB 1RIHL 5F7KC 1NUDA 4FG6D 1ANUA 3RILA 3GSRB 2X7LB 3TCLB 1MIEL 5DS8A 4UV7H 4L0YA 3BEVA 3PFUA 1BBJA 1NBZA 3QI9B 1SXNA 1OGAE 2CQVA 3BC9A 4PJHB 4ATWA 2CDFB 2DM4A 4B50A 5AOMA 1A4KB 1ZVHA 2WO3B 3OJ2C 5EUOE 3V0EA 3VACA 2IPKA 4B3EA 4G8AC 2HWZL 1OK8A 1T22B 2WLIB 5TDOA 2C3XA 1I3UA 1SXCA 4W6XB 3EJJX 4EUPA 4PJEB 4B9KC 3COOA 1QFWL 3QR0A 3GM0A 4UOW1 4FFZH 1LEIA 2EDLA 1AMXA 2YBRB 3S8WA 2JSFA 2RCSL 3HC0B 3JZ7A 4JJHA 4OTXL 4QHKJ 3MLXH 1IBGL 3CVHL 4F2ME 5EO9B 4F15C 4U05A 1I1AB 3EJPA 4H8WH 5IB3A 4LGPB 4TL4A 5I1AA 2D03L 3QVAA 4JFFE 5D7KE 1FNLA 4P3CH 1NDMB 4H20L 5CJBA 3NCXA 4AGLA 2W80C 1PQZA 1KYFA 3W0WA 3Q13A 5FO7B 3BWSA 5ITFA 3OVUB 3QZOA 5L7XH 3GTTA 1JFQH 2AJYH 5K33A 4IS6B 2AJUH 2X5PA 3EH2A 5BO1H 1X5HA 3GXDA 4MXWL 1Q94A 4HYTB 4N2EA 3CFKB 1NM9A 4DP8X 1CLYL 5IZ7A 1XX9C 1CTNA 3CFMA 1C5BL 4G8GD 1CYXA 5IOKA 4UM8A 1NC4D 2B2XH 2BOBB 2QGDA 3GTVA 3CIAA 1NCCL 4YXLH 5EO0B 5AW8B 4YEFA 1U21A 2QLYA 1E5ZA 2A3TA 2G2NA 3GS4A 4BH7A 1FIGH 4DESA 5C0DA 3LQAH 2OR7A 1E5YA 1HWHB 5DEFB 1BFSA 2PYFB 5D5ME 5KVFH 5KSBB 1KDJA 2AGJH 1DQLH 5KEZA 1GAFH 2NCMA 2K9FB 3KYAA 3DGDA 3GMLB 1JCKA 1P69B 3B83A 1ZHKA 4EKXA 4HF5H 1KEMH 3GSVA 3MUZ1 4PJDA 4UNIA 5CNHA 1J1PH 3SDAC 3AQZA 2B5IB 1IKNC 5AW3B 5I8KL 4MMZA 2X2UA 3VXUD 8PAZA 1DZBA 4PD4K 2CGZA 2H6OA 4R84A 3QUGA 2ZG1A 3UTZA 2IANE 3FKUS 1L7IL 4PD4J 3O9WA 2R2EA 4X80L 5KYUA 3NFPB 4AIXA 2AQ1A 3CFNA 3OKDB 2WO4A 3G5YB 4F5CE 4X8CA 4QWWC 4L2YA 4I3RL 3MCG1 1KJ2L 4MGXA 5AAWC 1YPZB 3POCA 5MP6H 1UB5A 1JGDB 4O02A 1I9EA 4B97A 2ZX7A 1JHTB 3HMXL 3P30L 2WK2A 2VAAA 3C5ZB 5D71H 3VSUA 1CICD 4I77H 4B9ZA 4MS6A 3UTQB 3UFIA 1BVKA 3L4XA 3VXUA 3BHBA 2JJTA 3RGVA 4QOKE 3N44F 5IBUB 3S37X 2YKKA 1FRGL 1X7SA 2WSDA 4ICXA 2Q7YB 2DB8A 3BLPX 3GI8H 3QUZA 5KSVB 3LQZB 1CTMA 3G6JA 1BAFL 2A74A 4ATTA 2ICCA 4HJJL 3HCVA 4Q52A 4N2FA 3T0BA 3GZPA 2X7LA 1JK8B 3TCLA 3TZVB 1F3JB 3OKMA 4BFOA 4PJHA 1TOXA 2CDFA 4PJ7E 3TS8A 1PVHA 4X5XA 1CICA 1AR1C 5E7FA 3GF8A 4Z7IA 3H9SD 2WLIA 3KXFD 1K8IA 4M8QA 5DQ9A 1N7ML 1NIDA 2IAMC 1I8IA 5L4MA 4PJEA 4ZD3L 2C9PA 1AE6L 1ROWA 1QTYT 1E8ZA 2HH0L 2V5YA 4KROD 2WYIA 4U1JB 5E9NA 1QAWA 3QO1B 1GGBH 1JUFB 3APCA 3PG2A 1SUJA 3BCDA 3STZA 3KLHD 1I7TB 4JMNA 2G5BB 1BJMA 4PBDA 2GYSA 2ED8A 3CVHB 4ZTPH 3Q2VA 1U2YA 3JWDC 4N68A 3HB3D 4RGNE 3T3MF 4U3SA 4YGVB 1MVYA 1DQQA 3MR9A 1P1ZB 4FDWA 4HUCA 1Q72H 4NKOB 5FO7A 4POZD 2QMJA 3BWUF 1E28A 3UADA 3QIWB 3UTTE 2TRHA 4IS6A 5IJVB 3NH7L 5IM7A 3BPOB 5AW5B 2AAVA 1HCFX 2VCOA 5B1JC 5JHDB 6PAZA 1S8DA 1DUYA 3GJFH 3HI6L 5EOTA 2QVKA 1EEYB 2ZJSL 4Q4EA 3TVMC 2F53D 1SOKA 4O9HH 3WS6C 2F18A 5LAPA 1JGEB 2EDJA 4PCTA 3FK3A 1HAWA 4ZO6A 4IBYA 1VPOL 1KTBA 4L8DA 4DKTA 4BKTC 5LO7A 4DPRA 2A2QT 3QORB 4F7CA 3HPJA 2HUEA 2B3RA 1YYMH 1K2DB 3QAQA 5KSBA 1E9QA 1PFOA 4WK4B 1U9KA 1EFQA 3QCUL 1AYOA 3GMLA 3DX7B 1CFNB 1GIGL 3T6VA 2G9HB 4EDWH 4LDCA 1I8KA 1AOZA 4GG8A 1YPZF 1TZGL 3QPQC 5C0EA 4JCLA 4NC0B 1IGIL 4BINA 3VG9B 4K71B 1BWMA 3QO0B 4UDTB 4AQ8A 2HUHA 2OTUB 3L3IB 1IUZA 1E4KC 2GIYA 4KJWC 4NQEE 4C55A 2J1ZA 1A6UH 2VC2L 3OKDA 2EABA 2P46B 5E6ZA 3OD3A 1U8MB 5J3HD 3DK0A 5GRUL 2CM6A 1JGDA 4I0PD 2V8MA 3KM1A 4LCVA 1JHTA 4F9LC 5CLYA 5GISH 4OY9A 1KJ2B 1XGUB 2BJML 3P4NB 3PNWB 3UP1A 4JL1A 1N6QH 3APMA 3OSKA 3QXAB 5DLML 1E30A 2AJVH 3UTQA 3ZZQA 2W94A 3BZFA 1SYVB 4NQSB 4AE0A 3N40P 3TOPA 2G9KA 4A7QA 5F8RC 1A02N 4OBSA 1MJUL 3CHXA 4JRXD 4JANB 4M9PA 5KSVA 2JCCE 4BDVB 1AC0A 5DJYA 5C2BH 5H4YA 1F58L 4QY8A 3ROOB 4X6CA 4JG0L 1CLYH 4AYGA 3DVIA 3TZVA 2YN5A 5IHUL 5TH2B 4LPXA 1G84A 3PHSA 5I6OA 1WGOA 2IPTH 4YHNB 1ONQB 1Y18A 4H0IA 5ADPL 2XICA 3DROB 2UY7B 1ZWIA 3I02B 3AT9A 4GSDL 3GJFK 2CDEB 3RPIB 1RZ8B 1MJ7H 1YEHH 5EOCL 3RVVC 1CQYA 3SKOB 1HHKB 3FOLB 1EJFA 1D2OA 4JNXA 3GPEA 4X0NA 3F7RA 2X2HA 4U1JA 1O7SA 1BWWA 1RK0A 4HKJB 2BHUA 4PV9A 2O26U 4C8XA 1JUFA 4KNSA 1I7TA 2DQFB 4QMEA 2DLFH 4F91B 3CBKB 1JYXA 1W8OA 2F1BA 1KBVA 3WFCH 3JV0A 2XETA 2NSXA 4JRWA 1CBVH 1KELH 3FU5A 4PN6A 4PSPA 1DJZA 4OIIH 2D31B 2DMHA 3MUHL 1P1ZA 2UVFA 2UWEE 2W9EH 1XT5A 4FLQA 3T2NH 4XOEA 3D0LB 4PH8A 4YXKH 3EJTA 4BCXA 3KCPB 1NLDL 5IJVA 1ZK9A 1JHLH 2AK4B 3KPNB 3UIYA 5BUGA 4LCIL 4KVCL 2E56A 2YQGA 1MREH 1KJ2H 1TVBA 2FHBA 3WN5A 5JHDA 3NA9H 1YJDH 4R96A 1PDKB 2OXHA 1EEYA 5JW3H 1Q9LB 3FN9A 4UB0L 4CC1A 1EO8L 1JGEA 5BW7C 2VABB 2ENJA 1R17A 2ZG2A 3IKCA 2IOIA 4PJCA 2VWEE 3KBHE 1MG3C 3QORA 4AJYV 3W3BA 1VFBB 2EECA 3I50H 4LCWB 2ENYA 4LOFA 4IBLT 1K2DA 1S9VB 1TT6A 3ALXA 1VACB 4AGQA 2K1MA 1P9MC 3HS9A 4ZXBD 1YY8A 4QHKI 2CPCA 3DX7A 1XVSA 2KMWA 2AQSA 3E3QC 3J07A 2PABA 2MOGA 3TM6A 1XCXA 3OKKB 5AW7B 1G87A 4R8WL 3P73B 2ZOLA 1SHWA 5E9DB 3MRMB 4G42B 4DUWA 3UPCA 2XV6B 2YMXH 3HE7C 1YEDB 4I0KA 5JIHA 1BVNP 4UDTA 4CMMA 2COVD 2OTUA 2OKMA 3PV6B 3L3IA 2Y2TA 3A23A 5H37H 3W0WE 1WYJA 2JKNA 3L5XL 2BY1A 1ZA6B 1EDQA 1KENL 1M3IA 3VFVB 4S2SB 1FLRL 1WK0A 2FX9L 1IGCL 3RL2B 4A1RA 3WIFA 1BEYL 2PUQT 2VC2B 5CFAA 1P4IH 3LZNA 2BSSB 2J73A 2R2HA 4MAYB 2CO6A 4PVLA 1XGUA 3TJEH 2YBGA 5D1QB 2XG5B 1E8XA 4ODBD 1E27B 2NSMA 1H15A 3HMXA 3Q6GH 2WQUA 2PPCA 2ICEB 1RJLB 2FECL 4NQSA 5T5NF 4M6OH 3W38A 4GXVL 3B7UX 5D7HA 2VE6B 3OMIB 5CEYB 3T9WA 3RY4A 4JANA 5FWRA 4JPWL 5EA0L 5DZLA 2IPUG 3D9AL 3UYOD 1AO7D 1RL1A 1WQVT 2I69A 3V6FB 1ZCRA 3LH8A 1UFGA 4ZMZA 2ZYIA 1MW2A 3LYRA 3G3LA 1BFVH 5AAMA 2NY6C 2BFVH 1TMCB 3HTLX 5JDJA 2I85A 2ZJSH 2EIEA 2SODB 2Y6SD 2G3ZA 1JZ2A 6CGTA 5HD8C 1C1EH 1LMIA 1ONQA 1T0NB 3T0XA 3TF7C 4PJDE 4I1NB 4N2NA 4F58L 4AEIL 3WLBB 5K59F 5KWYC 2EP6A 3T8XA 2HT2D 3RPIA 1RZ8A 2JIXD 2A0LC 2XZZA 3EOYG 5HYEA 3DX9A 4APQB 3B6SB 5EEYA 4P5RA 2OR8A 1HHKA 2QDVA 3FOLA 4L3EB 3UJIL 3X12A 3WY4A 4ELDA 2XPZA 1IGFL 4KTDH 2Z7UA 2A77L 2NSQA 1Q90A 1AO7A 4HKJA 1X5JA 2DTML 5CGMA 4NGHH 2CALA 2JQAA 4WVRA 5ADOH 1WCBA 3FTZA 3LPFA 2ADGA 1AD0B 4HWUA 5HJGA 1Q1JL 2JJWA 4QIRA 1QA9B 2D31A 4XP1L 1IU1A 1YNKL 5TF1L 4CVXB 5I8CB 3VXUE 1MCLA 3D0LA 3FT3B 4R97B 1SM3H 3RKDD 1UKTA 2AITA 3RAJL 3DJZA 1UD5A 2AK4A 2FZ3B 2BO0A 3ZU8A 2NR6C 1H8OA 1RU9H 2BS71 3BPCA 4E9YA 5J1AB 4IKKA 4DAGH 4E42B 2GG1A 2RGSA 4JAMB 5GRUH 5M95B 4XBMA 3LKOA 3VXMB 1Q9LA 3TYGL 1D3CA 4YSSA 3FU9A 3P77B 4KTEH 5EDXA 2BS9A 4UZSA 3V8CA 2VABA 3ULVC 4DH2A 5FCUL 1JNLL 1AJ7L 2XOTA 2Y07H 3BUTA 3E2HB 3OMZA 1VFBA 3DLQR 4LCWA 1DBAH 2EE6A 4Y2NA 4J3UA 4KMTH 4PJEE 4X5PA 4QAWA 5D4HA 1PFCA 4RETB 4XBEH 1XTMA 3VDCA 4J3VA 2WQ8A 1KFAH 5KVDL 4DGWC 2X12A 1ZGLA 3E8UL 3OKKA 5T1KD 1BF8A 1UYWH 3L3OC 1LWHA 4NOFA 3O41B 4RAHA 3MRMA 4G42A 3LN5A 1N19A 1RLWA 4UQBA 3INOA 3PWLB 4K5OA 3L1OL 3NCWA 3JTTA 1MCPH 4HWNA 1FGVL 1YEDA 3JTBA 3OXRB 3TTYA 2VQTA 1EX0A 3PV6A 3KXFE 1Y1DA 1G1CA 2C8NA 2DYPB 3U7WL 4BZ2L 4S2SA 1MFNA 1N6VA 1TO4A 5B39B 3FT4A 3O3BB 2WBJB 3RURA 2BSSA 3D25A 2BNRB 2PW1A 4LASH 3OKEB 4MAYA 4MXVE 5D1QA 2X0WA 3SQBB 1E27A 4D0BB 3OGCA 3C08L 4P2RB 2ICEA 3L6FB 3QEGL 3TWYA 5ABDE 1H9DA 3IDJA 4B7LA 3LN4B 4R3SB 4NHUB 4M02A 1QPKA 1BMZA 1DFXA 2OYMA 1AGDB 4LEXH 2VITB 4KXZH 1SJXA 1AAJA 1IAIH 3RGBA 1L9PA 1MVUB 3B3BA 4C4KT 1WEJH 4ETQA 4OJFL 1SVCP 1JZ5A 5KSBE 4UUJB 3JWDL 3KEHA 1QBMH 3W11D 1CI5A 4UB0H 1SXSA 5FYJH 5L2KB 1BYNA 1PY0A 1TKWB 1F2XK 4Y89A 2OK0L 4ZTEA 2AV7B 4K8RH 4N9OB 4C56B 3N43B 3FQYA 4N22A 3VD7A 2ATPB 2F53E 2VLLA 1KBKA 1H3VA 1ZIBA 2B4CL 3L45A 3WMPA 4U2YA 5C0RH 5T3XL 2VB5A 5DCCA 4G8EB 3VFNB 1SF3A 1HDMB 3IDGB 4UF7C 1RHFA 4LOVA 3V0IA 3WNJA 2ED7A 2P5EB 2Z91B 1QW8A 3NTCH 1AIFB 1KB3A 1RULH 4A68A 5DRWA 3Q6FB 3FMGH 5ILTH 3KL5A 4Z3FA 3D06A 4FF9A 4JQVA 3VFOA 4B5EA 3SE3C 4A7GA 4HBCH 4E9SA 1R1CA 1ZE3C 4DEUA 2YGVA 5FUOH 2D7QA 3FAWA 1QA9A 3QWRA 4Q2ZA 3LPOA 2Y6TE 2CKBL 3ATDA 2JB5L 1B3IA 2EILB 3OKNB 4JO4L 4XO9A 5K9QG 1XZWA 2H32H 3HFML 2Q7NA 3I6LD 4GW1A 4TVPL 4XMWA 4LAJH 5DHVH 4BSWA 2FZ3A 1SHXA 5J1AA 5A6MA 2VERA 4JAMA 1J8KA 1F90L 4PWGA 1FFQA 3EZJB 4X6CE 4Z7UB 1J1OL 3VXMA 1U92B 3MXVL 5F96L 4XMKH 5M7QA 3P77A 4NBZB 3ISRA 1ED3A 5FYLD 4WGKA 1WTLA 4CVZB 5BMFH 4KI5F 5D7IA 5I71B 4IU2B 4PW4A 1DVFC 4WY7H 1H0DB 1L6XA 2R9HC 4HW6A 2KDGA 1NQBA 3U6XA 4C58B 1J48A 1A7PL 5I2IB 5HGBB 2ALAA 4OZHA 3BPNC 4AM0B 4JRXE 5TDPA 3L2NA 4NN5B 3FTXA 3UBXB 1JDCA 3AGWA 3K2MC 1JNHB 4ANWA 4F92B 1J8HD 1ND0A 1PLCA 4MCNA 1Q9WA 1VRSA 4RA0C 4U3XA 1T03H 3WTSA 1WD8A 2BZDA 3NAAL 3FCUB 5HYSG 1ADQH 3OKOA 2X10A 4IK7A 3F84A 4K23H 4FQ2H 4I18B 3V5DB 2O5ZH 1W6LA 5ENWB 1G7MB 2QV4A 3VU2A 1E9PB 1EBAA 2XXFA 5JDSB 3HZMB 2ODHA 4MWFB 4OJYA 3RBSA 2CIIB 3WJJC 1Y0LA 2Z93A 2X6BA 3W56A 2BHFA 3O3BA 3F62A 1V05A 4M93C 3SE4A 3DTDA 3BFOA 1NKGA 4PP1C 3WELA 2AEIT 4DP4X 5JHDE 4HUUB 1Q1JH 2UZYB 1U58A 4XP1H 4YHKH 1OAZL 1TTCA 2EKJA 2QJDA 1BYOA 3L6FA 1MRDL 1FAKT 3FQUB 1YEJH 2IAMB 2VDRH 3M17A 3QQDB 4PJCE 3N85L 4RMQA 3TONA 4NHUA 3VW3L 1KT2A 1NMCC 1AGDA 5HYIA 2V9QA 1BLIA 1VGEL 3PWJB 4WEBH 1ZV9A 3MBXL 1KTKE 3WGVB 2ZKXA 4UUJA 4GAFB 2AJXH 2XZCL 3OG4B 5FOJA 3TO2A 4L8BA 1A3LL 4OI8A 4KUZH 1KGWA 2K4AA 3GK8L 4JREC 4ONGH 1TKWA 4AQ1B 1LMKA 2C26A 1T0PB 4ZAKD 2ATPA 5CAYB 1QVOA 5F0PB 2ZAGA 4LCUA 2AJSL 2CHDA 2J8OA 3LQAC 3VFNA 1KG0A 3RWCB 2F54D 4JO2L 3IDGA 4OCMC 4P4KC 1KCKA 5HXMA 2Z91A 1NBVL 1JPGB 2F6AA 4HPYL 1AIFA 3EDFA 3RRQA 3NFNB 4I13B 4PHXA 3Q6FA 4FQ1L 3TH3T 3CE1A 5GJSH 3SDAD 1MHPH 4GI9A 4J27A 5FC9A 4YS4A 3E8UH 5C7XH 3TVMB 1P7HL 4PRIB 3U2JA 3WNLA 3VO0A 2BM3A 2OMTB 4RFOL 1ECZA 1GKEA 1ZD6A 5C09D 4NOBA 4IM8A 1UXWA 1SHSA 1CDGA 3V2AR 5BVJB 1GCYA 2LVCA 4YDIL 3BAJA 1CLOL 1PZ5B 2F54A 4KOBA 2CKBB 1P53A 4QWWD 4XC3H 3H56A 4Y4FD 5HHQB 3IXTB 4NO0D 4LBAA 1DYZA 4Z7UA 1NANH 3SDAA 2X9ZA 1OSEA 1HYSC 1IKNA 4UU9A 2V5MA 2H0JA 4NN6C 5KZCD 3K5SA 2AP2A 3D12B 1XDTT 3MOQA 5C09A 4LSRH 5EFIA 3VQMA 5EU6B 3TBSA 3BN3B 1XMEB 3GDBA 4G59C 4UTBA 4UQ3B 5FUZH 5KN5A 1UD4A 3HNVL 4TRPH 3T3PF 2FNWA 4EO5A 1LEGA 5BRPA 4CC4C 5AAWA 4MRBA 4O2FB 4OCSH 2BNQD 3QH3B 4LLAA 3UBXA 3EOAB 1AO7E 1OEZW 4NO0A 1CGUA 3BVTA 2C1PB 3EJZC 3NJKA 1WUNT 1AR1D 3LCYA 3U4EB 2AC0A 5K1NA 2EZ0C 3ML9A 2BLFA 4H7VA 4WFFD 5AW1B 5I75B 4LVHB 5LNGA 3D39B 4GS7C 1O9ZA 4FNTA 3T6XA 4R4FL 4X6EB 3MJGX 4K7PY 2DTSA 3CWGA 4TMPA 7CGTA 5ENWA 2AEOA 5JPMB 3BZEA 1CT8B 3QZNA 2CIIA 4WUKH 2B39A 1JWMB 2OJEB 3TU6A 2R29L 2WLJA 3BRFA 3Q43A 3S37L 1DBMH 2BNQA 2EEXA 4BZ2A 4HXBH 5E1QA 4RSYA 4OJDH 3RTQB 4LP4A 2F58H 4HUUA 2R2BB 2WINB 3CSGA 1FO0L 3OZLA 2CJUL 3IPEA 3DUSB 3D2UD 4PTUB 4G7VL 4YX2H 3PF2A 3L48A 1MVFA 3S7GA 1OGTB 4K3DL 4E9RA 4V2CB 4Y16B 2E9BA 3AITA 1ZEAL 2IAMA 2OL3L 4GO9A 4PB0L 1OPGH 4JFYA 4MJ4A 5GS0L 4W93A 3SSGA 1EEZB 1AQDA 1H6UA 4K5LA 5DK2A 1IE4A 2BVQA 1N64L 3DBXB 3D6GA 5HHXH 2XQYA 3BLKA 3LRMA 1NDTA 3ARPA 1NGWB 4U1NB 1NC2B 4WHYG 3O45B 5GQBA 2ADFL 2IH8A 5BQDA 5TTRA 4I87A 4J1UA 2NXZC 3RLSA 2N59A 4FTVA 1O5PA 4YSRA 3O6FB 1V3JA 4IHOB 3W39B 2DIBA 3IMTA 3RWCA 1B9ZA 1U36A 1E2ZA 5DMJB 1JPGA 5D7LD 2DIJA 2BHYA 2IWKA 2NY5H 5B1JA 5GZOD 1DBBH 3U82B 5HYQA 1RQ5A 1QSZA 2YFNA 1AGFA 3TVMA 1G9MH 3T0VA 1URIA 1SXZA 3H9YA 4PRIA 3SGJC 4YBQD 1A9EA 4NUGL 3WS6A 2XIIA 1CFVL 2H6PA 3QPQD 3SDXF 1B88A 2OMTA 2DWXA 1A25A 2CLZA 3F7YB 2YS4A 5D1QE 4OJEH 2IOMA 4D8PB 3RWHB 4MHHI 4PJ5B 4XVTH 3A5VA 1GZQA 4P2AA 3C5JA 4JS7A 5IQNA 5AQ0A 1XB3A 4J8QA 2CKBA 1A14L 5K1VA 4MKTA 4F9PA 3NZHL 5KG9A 4UQAA 4NM4L 4WW2F 5HHQA 3IXTA 3GBMH 2PR4L 4OB5L 1QX1A 3GSWA 3IRCA 1XEDA 3KNBB 4JL2A 2JTDA 4PJGB 2KLRA 1MAMH 4MDIA 1HFUA 3DO4A 2NY2C 1UJTA 2A1WH 3MU3A 5E0FA 1OF2B 3PDOA 3RVWC 4JDZB 3FUJA 1BREA 4OT1L 3UACA 4DVBA 4AGMA 5T1MB 1OOAA 3RWEB 2ISDA 1N0XH 3DC0A 1S7XB 5EU6A 1SJEA 5C0NC 1E4KA 1M53A 1O5DT 3TO4C 3ESMA 1A7NL 3ZKNC 5BOZG 3TGXA 4LVOB 4ICWA 4YDLB 2YFOA 5T1DH 3RA7H 3QH3A 4JM2C 2AJ3A 2BCKA 1H3PH 3EOAA 1CQKA 2Z4TA 4F9LA 1ACZA 1N68A 1BXAA 1NEUA 4E36A 3U4EA 3F01A 5FF6B 2JI1A 2EH8H 4NNXA 3ZE1E 3D39A 4I85A 4S1RL 4H8VA 3RVVD 1DJHA 4N25A 5AOJA 4KNUA 4X6EA 5KVGH 4OD3L 2H3XC 2HJFA 1U3HD 1GMEA 4B96A 2FX8L 2BSBA 5DD3L 4JHZA 3LY6A 3QARA 3KPRB 1CT8A 3K91A 3CZKA 3X1GA 4RESB 1YDPB 3TIEB 2JB6A 3LXBA 4LQFH 2NY1B 2D4FA 1JZGA 3K3QA 3K8KA 3AWGA 1KLFA 5HGGS 4XN7A 2R2BA 1S7WA 2WINA 2J8UF 1I7RB 2WZ5A 4Q14A 4G9DA 5JHLH 1NFDF 1J9CT 1OCRB 2WIMA 4PTUA 4W9JC 5E1HB 1ZV5A 1OAXH 3VXME 3OR6A 2K9UA 1FO0B 3I84A 4Y16A 3EJRA 3GMQB 4W9EC 5L6YL 4JGNA 5D7IE 2PW2B 4KAQL 3SKMB 3KGUA 4RAUB 2Z92A 2OL3B 5CJXC 3ZW3A 3F58H 3HBZA 3BGMB 1OSPL 3I6LE 4FC3E 3MHZA 2XTJD 3VRLE 3DBXA 4E41D 1Y7VA 4OZHE 3CPLB 3TF4A 4DEWA 4XNQA 1A6AB 4JG9A 3H8NA 5EEZA 2FTAA 4H44C 5CIPB 1FAIL 4JE4B 4CL7A 3EGDB 3SQRA 3O45A 2CO7A 1HINL 4CNIB 3AG4B 2X3CA 4KXZI 1IAII 2EE0A 3RX5A 5BV7H 3O6FA 2ITDA 5MEOB 2Q3XA 1OALA 4WHCA 3SJVB 2CO2A 5A16B 2KZKA 3MBED 1DO5A 1CFBA 3IETB 1T1XA 2L7JA 1RUAL 2RMNA 3R4DA 2R7EB 1XBDA 4S11A 3FB8A 3TT3H 5IJKA 4Q9RH 3B7YA 2AI0L 1CD1B 3MGTB 2P44B 2VLRB 5C0GA 3R7RA 2MOQA 3H3PL 2AQRA 2GT9B 4AQAB 1MFEH 1S78C 3F7YA 4LRNL 3HE7D 3ILPB 3M1OA 4MBRA 4PJGF 5ALCL 1LNUB 2PPFA 4N4YB 4UOJA 3C6LC 2B08A 3KWXA 3RWHA 4PJ5A 1DJXA 1P5VB 4WWID 5D2LB 4OVUA 4JE0A 4GG6F 3QFJB 1ZSHA 2VR9A 2NNFA 4NZUL 1KWGA 1A0QL 4Z7OB 1F42A 3S3SA 3S37H 1KNOB 3B2VH 2CHXA 2WLHA 5EBWB 2YEZA 1IJNA 4IOIB 1WZMA 2IG2H 4XC1L 5AKVA 1AXTL 2VDQL 4OCYL 1UOKA 1OF2A 3RQ3A 1A3RH 1MRFL 4HIHB 4JDZA 3SE9L 3QUHA 1HZHH 2H9GB 3KHQA 5T1MA 3HE7A 4OLEA 5FX3A 5EIIG 1GTFA 4WU7A 3LS5H 4Y9CA 3ULUD 2H4EA 3IDYC 1DEEA 4WEEA 3T2LA 4D0CB 1LVEA 4YHML 4WKZB 2NY6D 4YHOH 3EDKA 4YVUA 4ANXA 4OLZL 2PN5A 4ONHB 3R0NA 3E9UA 1WBYA 2Z35A 3B2UC 1JXJA 4LSQH 5HPMB 5FF6A 1EZVY 1G4RA 1JPFB 4UNVA 4YLCA 5IQ7H 3HHSB 1AG0A 4WUUD 2A0LD 3GGWB 2DM2A 4FXLA 3VFGL 2GEQA 3TCXA 1WWCA 4JFWA 3Q0HA 4AEEA 4Y1AA 3KPRA 4MA3A 4M6NH 4IBUA 1F6AA 1E4WH 3HUJA 2D7MA 4Z8FH 2F54E 2ZCZA 1QUNA 2PTVA 3GO1L 4NKMB 1QACA 2J1WA 3QDJD 3SCMD 5MERB 4M56A 5IESH 4ZK8A 3KCWA 2YWZA 3T4AB 1QI3A 5TD4A 4DKEH 4Z7UE 3JWNH 2WVTA 1PIGA 1T7ZA 3VGBA 3TCTA 2EQDA 1OQXA 3CHPA 4G7YL 2QKIB 5INCA 1TEFA 4WUUA 1I3VA 3F3HA 4XE5B 2ZOUA 3GMQA 4E5XB 2X87A 2PW2A 3IFOB 3QUXB 1OTTD 3EH1A 2FATH 4X5WB 5C09E 3SKMA 2NR6D 4XCFH 2VXUL 2ZXDA 3KE0A 1IARB 2OL3A 2CKNA 3CZSA 3BWAB 5DZNA 1MNUH 3QXDB 5ISZB 1MCWW 4UOZA 1UQSB 2PR4H 3IFPA 4QYAA 3I3BA 2AXWA 3CPLA 5FYKH 4XCNA 3QDJA 5J13C 5E4IA 4GXUN 5CIPA 5AEAA 3K80A 4UTCA 5K9OB 3ULVD 3SY6A 3S9DB 3WJMA 1WHPA 5B38G 4RWYL 1F0LA 3H2WA 4XPGH 2UZXA 4X9HA 2MCPH 2OP4L 5E2TL 4P3WA 5F9WC 3HZKA 3SOBH 4YFEA 4KUCD 2HFTA 4WSKA 3SJVA 4GQQA 1NJ9A 3O6LH 5A16A 4JY4A 5DUMH 2LFEA 3L95A 2NR6A 4JJ5B 4L5FH 4QEGA 3IETA 4LLWA 4HH8A 3F6LA 5D2LF 3S4SB 2R7EA 4F7MB 3AQXA 4FYQA 3FSZA 4JRYB 3MV9B 3MLPA 4Z7OF 5EEWA 2J44A 2VLRA 5I1EL 3PNRB 2BNQE 1S9KC 2HP4A 2VIRA 2GT9A 2JLLA 1X9QA 4BXVA 3ZO9A 1LNUA 1F02I 1JWSB 1DVFB 4TVSa 3TYFB 2RD0A 4WFFE 1L7TL 1BV8A 2A9MH 2W0KA 3N50A 4NRZA 4ZOCA 4AJVA 3QFJA 1IGJA 2WXFA 3D85D 4BQCA 3EYSL 1EUTA 4AMKH 5JA8B 1D6VL 5CJOL 1OHZA 3RL1B 1DQDL 1HKLH 1BLNA 2WXGA 2GUOB 1OXYA 3MLTA 2DQJH 5ID0B 5DVKA 2FVNA 2EO1A 3VFUB 1CWVA 3WXWH 2X9WA 3L3OA 2NY3C 5E6YA 4AYBA 3X13A 4HIHA 3SN6N 3CFDB 4H8QA 5DR5L 2VDQB 1I31A 2G3XA 3DI3B 3NGBB 3CDCA 4PI2A 1F3DH 3L9BA 3BKJL 2Y1ZA 3MJ8A 4FTVE 4PR5B 5E24E 4EN3B 4GAYB 4D0CA 2EIMB 1NANI 2OULB 3MRCA 2DI8A 2DD8H 1DQVA 1QRND 4PJXB 3UBFA 1PD1A 4Z7WF 5F7MC 1BQLH 4ONHA 2Y7SA 5AENA 5MEQB 1SY6L 3OC5A 3OHXC 3T2OA 3G9AB 1VFOA 4ZYKB 5HPMA 2QTEA 5BRZB 1JPFA 4PRIE 1T0OA 2DQDH 3EGSB 3GGWA 5DYFA 3VI3E 4F8PA 4LIQH 3ZDZB 1HH9B 5D6CB 4ZSOB 1NMCB 4EPSA 4KV5F 4ANUA 5ACMA 4HAFA 3DKHA 2LU4A 1TZ8A 1A22B 1KY7A 4YDJA 3RUGB 3AQDA 4LMQI 1VHPA 3O0RH 3RNQA 3TN0B 3QCVH 1QRNA 2YQBA 4TNFA 3VFWA 4OZFB 1O75A 2FEEL 4DN4L 2VZUA 2DQEL 3B5HA 4KY1H 4WI2A 4JFVA 4HWZB 1BVLA 2FSEB 5I5IA 1S4IA 5CMAB 4F20A 4X5WA 3Q5TA 3TH2T 1C08B 2A6IB 1BQHA 1OAUH 3C5SB 32C2A 3V0VB 4ZUUB 1IVTA 5EU6E 5I30L 4LFHG 4WHDA 1GGUA 1UQSA 1TR7A 4RZKA 5H2BA 1X3DA 5ECGA 2NYKA 5CEXB 2V3EA 3SE3A 3GSUB 4U1SB 4XC1H 5FDWB 2XXGA 4GXFA 3UO8B 3FTVA 5F88B 1AZZC 4JG1H 2R9HD 4GI8A 3ZBMA 4H4NA 4G6JH 4L9DA 3D39E 2GJZA 15C8L 1IAMA 1MIMH 1RUMH 4AVIA 4JY5H 3LTVA 3EHBD 1IC7H 2YGNA 1QR1A 4JJ5A 4G5AA 4EVNB 2O5XH 3R1GH 4HS6B 4OSUL 3GINA 3RU8H 1QTSA 5HI3C 1RUPH 3FHEA 3FO2B 3MV9A 3CVBA 5ABAA 4NN6B 4JKLA 4BWWA 5F7NC 4JEGB 3DRQA 2OJ1A 2FHCA 3VFGH 1XB8A 1JWSA 1DVFA 2WXNA 1YAIA 2GEEA 2VSKB 2VDMH 1JK9B 4UYPA 3C2SA 4LDOB 4P48A 1ET8A 1KXQE 4ZS7H 1LO4L 1BOGB 2J8HA 3DGCR 2H7WA 1BQ5A 3NVQA 4HV8B 2WO2B 5DZPA 3UPRB 3LKQA 3S48A 3T0DA 4PP1D 2CBMA 4GRLB 5I1CH 4HSQA 4F7TB 5E8PA 3U9PH 2W38A 2UXTA 2ZPKL 1TCRB 5BZDB 4PJXF 3SYQA 2JK5A 3JV4B 3VX1A 3HRZC 1T3FB 2MFNA 3CFDA 5KVEH 1Z5LA 2DWEA 2J5LC 4WV1B 3F7LA 3LPGA 1U8PA 1RPKA 4NLHA 4PR5A 4XNUH 4K9JA 1GGIL 4QLWA 4G43B 1WAAA 4GAYA 3DSFL 1CD9B 3OC8A 3WJJA 1UZGA 2NNXA 3UJJH 5DJ2B 1DVUA 2ZXQA 4F7PB 3D4GA 3ECBB 1R0AL 43C9B 1I1YB 4EQ2A 4MJHA 5I8EA 1IC5H 2I24N 3L3JB 4XNYH 4NXKA 4MJJA 4LARL 3CU7A 1A1NB 1BM7A 3LXCA 1ZY9A 1G1KA 1MKFA 3EGSA 3LPWA 2CAKA 4DP0X 5I15L 1DLFL 4KFMA 1HH9A 1MPAH 2E75C 5D6CA 4ZSOA 2Y7NA 2AK1H 5A2FA 3ABGA 2NMSA 3SHSA 5SX5K 1HCVA 5BQ7A 3QDGD 3NFSL 4GO8A 4M48H 4PBWD 3ZDYE 2NT0A 1RPQA 4OCWL 5FO9B 1A66A 4HSAC 5I1EH 3E3QE 4DSYA 1D5MB 3X3FL 1MHHB 2WWKT 4MQXC 4RLDA 3CHOA 3Q2LA 2FSEA 4L9LC 3Q1SH 2GUYA 1C08A 2A6IA 5CZXD 3C5SA 1A6VL 4P4KA 4YSPA 1HWGB 4X0KA 2R0LH 2WYHA 1ID2A 4KKAC 4Z95H 3FONB 3S3DB 1UKSA 5F1NA 2C9AA 3HW7A 2DH2A 1HYSD 5JOFA 3WFBL 1B4TA 1G6RH 2ZCLH 3IDUA 5FDWA 5C3LD 1DN2A 1KPRB 3EYOB 4XMLL 1P4LB 1AGEB 1BGXH 4RMUA 1LGVA 2HJLA 1B4JH 4HS8L 5F88A 4MSWA 1ULVA 2XQ0A 1RP8A 3VAEA 3ZE2F 4IU3B 3SPJA 4DCQB 2CBOA 4Y2OA 3MLVH 3X3GH 5IJBC 3QHFL 5A2JH 3QHZL 4X5QA 3VVVA 4EVNA 3BN9C 4MS8C 4HS6A 1JTTA 1JN6B 2Z8VC 4Y1AE 4H25A 5CSBA 4HUVB 2H3NB 3HUJE 2DH3A 5KANG 1HXMB 2EZ0D 4FNRA 3P9LB 4KQ3L 5L0QB 3T4YB 3VRIB 3ZMEA 1A4JA 2YPVH 5EORH 4GXUM 1CN4A 4KDWA 4M61A 4OGYH 2BP3A 1AFVH 3IB4A 1FORH 3VXNA 1JK9A 3B5GA 4PFEA 3N9GL 1HH6A 4WUUE 5HHVH 3LZOA 5CSZA 2WAHA 1JRHL 4CC4A 1I3GL 3US9A 4JQIL 5ACZB 3UPRA 4P2OD 4AM0Q 4A6YH 5IW6B 4UMGA 5E08H 3NPZB 1DVZA 1E3ZA 3B1UA 1KJVA 4FP8L 2QPUA 2UY6B 4MASA 5BZDA 5IB2B 3BLBA 3QDJE 4NZRL 2IDSA 1L5GB 1RI8A 1UA3A 2ZXGA 5AZ2L 4HMCA 3LEYL 3ROLB 2X28A 5ESQB 4MLSA 2PCFA 4NPJA 3VYOA 4UTAH 1M7DB 1MOEA 2ZNXA 1JPTH 5F7LB 4GIAA 3FQNB 1BIIA 4N8UA 4G43A 2WUCL 4XMXA 5DJ2A 4F7PA 4JFZL 1L0PA 4FFVD 43C9A 4XNAA 3B7TA 2XWXA 1YNTB 3L3JA 4H0HB 3MRNB 4DP1X 4HC1L 3HZVB 3SGEH 5LN4A 3U0WH 5INDA 4GSRA 2EAEA 2NXZD 3D1MC 5LDSA 4XPTH 1WA1X 3OTTA 3P3YA 1SY6A 4WW2C 1S5IL 2RIKA 2VLRE 3IFNH 3ULVE 2Y06H 1EGJH 4U31A 1MI5B 1QBLL 3KHOA 4AZ8B 4HIIA 4F1SA 3MFFB 1CPUA 3N0AA 4UAHA 5HDBF 3VNYA 3W9EA 2Q10A 3L8QA 5B22A 1BW8A 1MNNA 1G7PB 1THAA 3MLYL 5I9QC 5DJ8A 3QFJE 4F93B 3P3TA 1G4MA 1YYLL 2NY5C 3GJFA 1LP9A 5FO9A 2DM3A 5C8JB 3ZR6A 2HTLD 1X5AA 1WRFA 2QHRH 2YOCA 1MHHA 3BD4A 4UQ2A 5C0AD 3ZTJG 5JIIA 1OM9A 1YG9A 3TFKC 2HKAA 2OSLB 3CVIH 4IRSD 1H8SA 3MN8A 4JHUA 3T1WA 1C5DB 3ZKXC 2P48B 5EZIL 5F7DB 2FQDA 1VERA 4U3HA 1XSOA 2C3GA 1XGPB 4D3CH 3UCQA 2ADIB 4ZZFA 5IIEB 1PLGL 2EICA 2EVJA 1CF1A 2P3YA 4XMTA 3FONA 4AEHL 1CL7L 4JUTA 4NDMB 2L3BA 2JXMA 2NY2D 3SGJA 2XXCB 3RVWD 1AMYA 1KPRA 4EXPX 2CD0A 1P4LA 1AGEA 2EEBA 1P4BH 4XPFL 1BZDA 4WF7A 5C0AA 2H2SC 3RVTD 2P42B 4DCQA 5C0ND 2Y1VA 4HPHA 4OZGB 3TO4D 5IJCC 4TUJB 4M6AA 5JMRA 2ZP8A 3ZKND 3UH8A 4GYBA 2C4FU 2C9VA 4U1HB 3ZSSA 2WBWB 4JM2D 4KRPB 3BP4B 1TTGA 5IBTL 1T2QH 2HRPL 4RMBA 3RYMA 3U9WA 5B8CB 1HXMA 2X4TB 5F3BB 2DAVA 3LMJH 5EF3A 3V55A 3P9LA 3RTLA 1QRNE 2WVVB 1MJ8L 3T4YA 3BUYA 4UOQA 3VRIA 2Q8AL 1XQ4A 3BIKB 1HEJC 1CB4A 2VDNH 3BDYL 3KAAA 5JORA 4TTGA 3MACH 1F4YL 1B2WL 5JW4N 1T20B 3DBSA 3IDYB 3TO4A 2WTRB 3EADA 2B1HL 4X6DE 3RNKA 1NFAA 4W4OC 4HEPG 2XXMB 1XF4B 3LZFH 5ACZA 4JM2A 4I2XB 5IW6A 1LE9A 2OCFD 4QRSB 2OMVA 3IJ9A 1IQWL 4ODVL 3MRLB 2I5YH 2UY6A 1KCRH 3CIQA 3M7OA 2VSMB 4I1RA 4BHUA 3RWDB 1IGYB 4AYSA 1JZIA 1YECH 3I2CL 1RIUH 3QG7H 5DRZA 4K9EH 4MAUL 1G7QB 5I1KH 1UXSA 1J5HA 3M8OH 2OMYB 1KIUB 3CFQA 3Q1EA 1GPOH 3FQNA 2B14A 2ZUQC 2VDPL 2K78A 4PREB 5AYUL 3UTSB 3IDMA 3HG3A 3MYZA 3RG1C 2V2WA 2D0HA 4GKZB 1YNTA 1PAMA 4R26L 3MLRH 1MCIA 2VDKH 3MRNA 2E6JA 2HRGA 4XMLH 4TSAL 3FXIC 2F5AL 2N7BA 3MV9E 3BWZA 5IUCA 1Z9SA 4KJYB 4YHPA 5B3JF 3EFOA 2HG5A 3D48R 4AC2A 3BUPA 5B7FA 4NYLB 4JHAH 3M6DA 2A4ZA 2DQGH 3AS1A 2APWA 1E4XH 5CJXA 3HRPA 5ANMB 4Z7QE 4ZG1A 1MHCB 3BCFA 2CRYA 2VDOL 2XWCA 4L3CB 3CHQA 4XVSH 3GI9H 3K2UL 3QQ3A 1JV2B 3MNMA 2IFFL 1E3XA 4X7SH 5EEXA 1NCAH 4JKKA 4M6MH 1S78D 5SWZB 5IFAL 1J0IA 3WD5H 3CN1A 2OSLA 5KSAB 3N9GH 5GHWL 5C0CB 1C5DA 3MZGB 5F7DA 4MDRA 4QKXB 3NJXA 3SZKC 4GRMB 1K5NB 5L4IA 4R4BB 2ADIA 2EYRB 4LVEA 2ZSWB 3JXAA 4OZGF 4X50A 1UUNA 3ULAB 3HE6C 1WAAE 3QPXL 3G6DL 2DMKA 1DVTA 4P9HH 3LS4H 4NNPH 3DRTA 3TWCH 5L2JA 2P28B 1CDUA 3CZFA 1U4EA 4JPVL 2P26A 2ZCHL 2IWEA 3C6LA 1C7SA 1CGXA 1KN2L 3UG5A 5IHLB 5FO8A 2EDTA 3VI4A 2O5YH 3OPZH 4ZPTA 1NIAA 3GSXB 3JV6B 3SBWC 1NWOA 3FUMA 1T1YA 4ZSOE 4U1HA 1RUQH 1XR8B 4JFZH 3WUWA 3FQ1A 2WLNA 4Y8DC 3ZLQC 2JF1A 2BWQA 3BP4A 3B2UD 4ZOBA 4A7UA 5FUCC 2GABA 2WVVA 3GXIA 3G04A 5AKSA 1YEKL 4HKXB 3T77B 3K8LA 4LLQB 3S36X 5LAXB 4BELD 5I8OH 2J4WL 3K46A 3EGXA 1UWFA 4OLWL 3DJ9A 3QJHA 2ZNWA 3EJYC 1V7MH 5A2KH 1T20A 2HN7B 3NSJA 4PBXA 1T1ZA 1LHZA 2CUMA 4P5KB 1NH6A 1MZYA 5CWSB 5CCKL 3WEAA 5BXFB 1U8LB 4CU8A 1XF4A 2O30A 5ICXA 5HHMB 1SYSB 5BUPA 3TV8A 5DZJA 5CINH 4QRSA 1N26A 3I3EA 3MRLA 5C6TH 3SYCA 3WMQA 8FABA 4HCRL 3JWNC 1H8LA 3LHPH 1IGYA 2B16A 1TQVA 5CLTA 3OKLB 5IGXH 2NY0C 1K4CB 3RP1A 1I9IL 1G7QA 2YQ2A 1PZSA 4L18A 4JDEA 5JXED 1KIUA 3PUCA 3UTPD 1INDH 1FZOB 5IB5A 1NSNL 5KS9F 3ARVA 4WFHD 3NIDF 5DD1H 1WV7T 4JK0D 4FQCH 1TQCB 2VM3A 4X4MA 2PXYB 4J3TA 5TE7L 3BH9A 1IGTB 2VDPB 5BPPA 4F80A 3FC8A 5E6UB 1QFHA 5LB1A 1A6WH 2ZP9A 3N5AA 3R06B 3HI1B 3ARFC 1FL5B 2BDNL 3SDCB 4BUQA 2ZUVA 4KJYA 5D72H 4IRZH 1AZVA 4X98B 1KWKA 1RK1B 2H1PL 5F9OL 4UI2A 4U1IB 4ELKB 4RGMB 2BMKB 4WTQA 3ECWA 4JKPL 1AXSB 4FADA 1N18A 2A9NL 2IWFA 4L3CA 2JJSC 5ALBL 4DZ8B 2WZ0A 1DN0A 4PI0A 2GAZA 1M9WA 1U30A 3GBDA 1MFDH 4CKQA 2VDOB 4NQTA 4P5MB 1R3JB 3SY0A 4DGYL 2CXKA 2PO6D 1FFNA 2VQ4A 3MOAL 1QKZL 4L8SB 2XQBH 4DUVA 1IAKA 5A2LH 2OR9H 3F7VA 4UWQB 5C0IB 3T5WA 5I6LA 2ITCB 1ESOA 3QCTH 3QNFA 4PJ8D 4AYMC 5C0CA 3ARXA 4H8UA 2O61A 3IDXL 1JZJA 2FO1A 2EDHA 4GRMA 2B77A 4UINL 1XGZA 2EYRA 2QPEB 1J18A 2F74A 3NCEB 4MJ5A 3VXOB 1YEIH 3QB7C 5KYYA 4U6YB 4N0CD 3FN0H 4XXDA 2AQQA 3TT1H 2NY3D 4CJ1A 5LKNA 3GKWH 1E8YA 1KIRA 5DD0H 2YAFA 3SKUD 5AB0A 4YE4L 1ET7A 3B7RL 2C3WA 1LEKB 3UROR 3QUML 5C08B 2P80D 1I7ZB 4J2XA 4Q6YA 2XWEA 1AY1L 3ATAA 3GSXA 1I8AA 4Y2LA 2K7QA 3JV6A 2PCYA 1KPUB 3NQKA 2R1WB 2YRPA 4MNHB 1XR8A 1Q9KA 4BK8A 5LUMA 1A1MB 2K6YA 3US1A 1FA4A 2E6PA 2M26A 1DR9A 5FYJD 1JGVH 1N8ZA 1LP9E 4HKXA 3HRZB 4K8RD 2J5LB 2MH4A 1FL3A 1ZS2A 4GAAA 4R0LB 2NLJB 4G3YH 4OD1L 4PVMA 1HJBC 2IDUA 2DS4A 2CNYA 2FWUA 4A2FA 1DEDA 2Y1AA 1RZJH 3HMWH 1V3KA 4P5KA 4W9HC 3DGGB 3B9AA 2FWSA 3OR7B 1SYSA 1SQ2N 4M00A 4NB7A 1RSFA 2D9CA 3B9VA 2IFFH 3OHXA 1KXVC 4OU3A 1GYWA 3L5HA 4JDTL 2OMZB 1LO3H 1KC5L 3KGTA 1K4CA 4ANKA 4IK6A 2J6EL 4FA8A 5C0AE 5CP3H 4NZTH 4Z7AA 3CN3A 3DTXB 4ZMAT 1GZPA 2BNRD 2W60B 4OLVL 5JW4M 1F4HA 3W5MA 4U6VH 3MRQB 4UDUB 5C07D 5E99H 3B9KC 3MNVB 2YLHA 2FJGA 3O6KH 2X4RA 3R06A 4LESA 12E8H 3HI1A 2KL6A 2VSDA 2X4UB 1YHPA 2YZ8A 1RK1A 4L9LB 4FYSA 4Y4KC 3CXDH 2IF7A 2VNCA 1J12A 5CFHA 2CK0L 3H3KA 2H32A 2BMKA 1UCBH 5DHVA 3KPTA 5DQDL 2GQHA 3L4WA 1CZ8H 4GH7B 5L2KD 5HI3D 1YA5A 4I4WB 2AFNA 1M6OB 4DZ8A 5BS0B 3D30A 3NABL 1N0LA 2DMGA 1R3JA 5C07A 1HYRC 1ASQA 3AAZA 1GSMA 3QNZB 1FFPA 4FEIA 5A6IA 5C0IA 5IROD 2OTWA 1SZNA 2ITCA 4KK5C 2J21A 4YZFE 2V6HA 3HG1B 2YIHA 2ICES 3FFCD 3QPKA 1LK2B 4X7EC 3LEXB 1Z3GL 2UUDH 4NQVB 4OR1A 1U8JB 2NUTB 2XN9D 5I66B 5I0DA 4P4RB 4JO8A 4U6YA 1U8CB 1XV8A 5D2NC 1PJWA 2WZPD 3WFEL 1A4BA 1T7XA 2OZ4L 2WMPB 1Z0NA 3GXUB 3IFLH 1AHKA 5IKCA 2EJ1A 4Y9GA 3SO5A 2FYVA 3D4CA 3O2DL 4J4PC 3LEVH 1DBJL 3EOTL 5EIQA 1ADQA 1I7ZA 1JXKA 3RI5F 3FFCA 1DBKL 3QUMB 3EYFA 4TS6A 4Z7NF 4IEFA 1N2RA 1KY6A 4GAJL 4HIQA 1EHLH 1NGPH 4Y5XB 4GEIA 4U4IA 3WFHA 4YAQB 2EIKB 3CGTA