1XBDA

Internal xylan binding domain from cellulomonas fimi xylanase d, nmr, 5 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
87
structure length
87
Chain Sequence
TGCSVTATRAEEWSDRFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLANASE D
publication title A family IIb xylan-binding domain has a similar secondary structure to a homologous family IIa cellulose-binding domain but different ligand specificity.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 6
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xbdA00
1E5BA 2CWRA 3NDYE 1QBBA 1EXGA 1C7SA 3NDZE 5DHDA 1E5CA 1HEJC 1QBAA 1XBDA 2CZNA 5DHEA 1C7TA 1HEHC 2RTTA 1EXHA 2XBDA
chains in the Genus database with same CATH superfamily
2VDKH 1V7MH 1RU9H 4ZFGH 4XPBL 5GJSH 5J6HB 4OD2A 5HD8D 1RCYA 3LV3A 3TJEH 3BVDB 4DN4H 1KNOB 1MCPH 4OQTH 5ITFA 1MCIA 2R69L 4JEGB 1MCHA 5IVZA 2G5UA 1DVFD 2EEFA 1E6JL 1JGVH 3HC0B 2FRGP 1HHHA 3LXUX 4WKZA 3WU1A 1QI5A 4PJ9C 4JFQB 4E9LA 2C7UA 5D1ZC 1KPVA 2H4EA 5J12B 4G1MA 1HXMA 1ZEAL 5HYJA 3ZW3A 4NRZA 1ECYA 3PJLA 1P53A 1BQHB 3K8KA 3P11L 2BSED 2Q3AA 3MROB 5CCKH 3CDGB 2IPUG 4XP1L 2X9ZA 5E8NA 4LLUA 2MTAA 3HPJA 3I9PA 4F7MA 2EUZA 1P7BA 3KPRE 3RAJL 3BUDA 4RFEA 4NWTL 3GRWA 3UOAB 2EH8H 2WBKA 4MBRA 1MY5A 4G1EB 3F62A 4KO7A 3TN0B 3WHXB 4R2GD 5DCCA 2XN9D 1AHMA 4PG2C 5LO7A 4GUQA 4WF7A 3QDHA 1J18A 1UXLA 4MJ4A 4Y88A 4AM0Q 1IC7L 3PL6B 2JQAA 4GQ9H 2WLKA 3FT2B 1U8MA 4RZCA 3HG1B 4MS8D 3DUUB 4W9IC 1EDHA 3GSOA 2H26A 2PW2B 3MYJA 4XGZB 5GQBA 3DGDA 1JRHL 1ERNA 3E1ZA 4P23C 3ARZA 5DWUH 4F33A 3UFIA 5BUPA 5I6NA 3LEXA 5FGBA 3NCBB 1G6VK 4JGMA 1MFDL 3AMKA 2C5DC 4WU5B 3WV0A 5I76A 1U36A 2GFBB 2PPFA 4PBDA 4CVWA 5CIPA 3VGGA 1G7LA 2WXRA 2NSXA 4H26A 1DJXA 3PUCA 4YHPB 3UZVB 1HL4A 1IX2A 3PE9A 4JFEB 3W1ZA 4L0ZA 2E86A 4XN7A 5GRJL 1XH2A 1ITCA 5FDWB 5EU5A 5HGDB 4LIQE 3VG9B 1F1DA 4ERSH 3EOYG 2HRPH 2AANA 5IVOA 3ARDD 4PS3A 1NBYA 3JYCA 2QPUA 4BQ6A 4OIIH 1CVRA 5CZXC 1UWYA 4FI8A 4Y4HD 4XP4L 2WNKA 4R4FH 4QLRA 4HPHA 4X5WA 1IM9B 1SZNA 4XBPA 2GJ6D 4I77L 1MCOH 3OSKA 3VD3A 2TAAA 4JZOB 4JFFA 3QR0A 2G75A 5DC0A 1JAEA 5AL0A 4BCZA 3CDCA 1YY8A 3CZUB 3EXLA 1A7OH 1NC4B 1JWSB 2CBOA 1UH4A 5EO9A 3VFPB 1SEQH 4RDBA 1NAKL 4DKFL 1ED3B 1HXYA 4JPVH 1E4XI 2BIPA 4EI6A 1FP5A 2FBOJ 2IJ0C 3N1QC 3U9UA 4HBCH 1MCBA 3FTVA 2R7EB 5C97A 1NFDE 1NBVH 1TJHH 2KLTA 3FCTA 5HI5C 4RISL 3VYNA 5E1AA 4FG6C 3T2PA 1KLFB 3B4NA 4GRWB 3X3GH 4IU2A 3ZMRA 3WJMA 3VXTA 4IRZH 1S9VB 2JWYA 2ZUTA 4TNWF 4V1DE 4HUWB 3OJDA 4ZUTB 4EI5B 4G7SB 5JHBA 2YA1A 4M4RA 3ZT7A 3VI3F 1XFPA 5IHLB 2GVYA 3ZYJA 5EOCJ 2CHNA 2M2DA 5JPNB 2BZCA 1ACCA 4OZHB 5HHME 1DBBH 1J0ZA 1T0NA 3UGUA 3QORA 1LWJA 4H0IA 5D4IA 1NBZA 1A6WH 4GFTB 4JL2A 1ZGLP 5ISZE 3LHPL 1M9WA 2OYLA 2OFQA 1KEGL 2VDOH 4AY0A 3JWOH 5F7KC 5E5RB 4Y16C 3BKCH 2EXYC 1IEHA 1H8NA 5L88L 4IW4C 1QFWH 3Q9PA 4YDNA 3U6RA 2NY4C 1M1XB 1KGCD 4MAUH 2G2NA 2ZXAA 2H1PL 4N20A 2VXSH 1S3RA 3RTQC 1BECA 4W4OA 3MBWA 5DS1A 3ETBJ 1GSKA 1EWHA 5MEOB 2IAAC 1XSOA 5GJTH 3MRMA 1MUJB 1NA8A 2P5WE 4FXGA 5CEYA 3T4AC 3U0WL 3EFOA 2LFGA 3B2XA 4N5UA 1EXUB 3P30H 4NLHA 1XH3B 2CNYA 1R0AH 5B7EA 1B9KA 4KMTH 4G5AA 1F11B 4IIQC 1LO3H 2P44B 1MIEH 5E2VH 1AZUA 4UT9A 3AS3A 4L3FA 3ZHNA 4I88A 4ELKB 4XT1C 1JNLH 3H53A 1WEJH 1U8PA 1E50A 2BVPA 1NGYA 2Z8WC 3VTAA 1XGZA 4E9YA 2VLRD 1CFQA 2L7JA 3ZRCC 1OE3A 3RVXD 1G6RB 3V0DA 4NZRH 3KPPA 5T33L 2C9QA 4EOWL 5DRNA 3D3VD 1CWVA 3G6JF 4OUUA 1JL8A 2VO8A 1I1AA 3LEVL 2OSLA 4FZEL 2WZ5A 4M62L 1PL3A 3UTPD 4M5YL 1KELL 3FN0L 1YJDC 2WBJD 4JO5A 4HAFA 4UMGA 3MV11 4X4ME 5E8DL 4YPGB 3A47A 4M56A 5L4FA 4OJAA 3DBXB 2QVTA 3SZKC 2J43A 2NNFA 2OW7A 2OI9C 3B34A 4L4TD 1JVOA 2PWDA 1C5BL 2PYEA 4I2XB 4N3UA 1XF2A 1AQKH 4L5FE 5BV7L 5F1IB 4B0MM 2XZAH 1D6EA 4MKTA 4PD4K 1VADA 1ZDQA 1KJ3H 1IB5A 3LNIA 3DMMB 4Y2DA 1H15B 3DRTB 1WG3A 5HYIA 2FNWA 1FI8C 4KK8D 5FDYA 1NPNA 3DETD 4YBLB 4MLSA 3TV8A 1KDIA 2CO1A 3P4NB 2ENQA 1X5ZA 1JK8B 4JE0A 4KFMA 3WE1A 4HKJA 4P2RE 1D5BA 1MZZA 2AQSA 1SN2A 3QDME 1MRCH 2NTFB 1J8HD 1E8XA 4UV4H 1QSFE 1SHXA 43CAA 5KTEH 2IADA 2A77L 3W81A 4K7FA 3UZEC 4C83B 4HIIB 2PP8A 4MQXD 1OSZB 1T03L 1LWRA 3U36B 4XN4A 1MELA 2PTVA 3NRPA 4E0RB 2WAHA 1YN6A 4HWNA 1CTMA 2NT1A 2H41A 5FYLL 1T7VA 3U6XA 3UPCA 2VISB 3N91A 2X4PA 3CZLA 5E70A 4GRLC 3OJ2C 4AENA 3V8OA 2VITB 3KJ6H 4IRSD 1QSEB 4R5TA 2EADA 2VUKA 4X6DE 2Q6WA 1FYTD 1R5IA 3MR9B 4KK5C 4FFVC 4EN3D 2W9EH 4IEFB 2NQ3A 5JW3L 3SGEH 4XWGL 3QNZA 2HG0A 3HUJB 4PJBF 5D7HA 4QAMB 1MI5B 1XXFC 1FHGA 2XZCL 3C6SB 1LYQA 4LPYA 5FGCE 2ID5A 1Q38A 1ID5I 2GABA 2NNXA 2WBXA 2WIIA 3GT6A 3HZYA 4LF3B 4QOKD 2PCYA 4WTWA 4Z7NE 4ELME 1S2EA 3UG4A 5AW9B 4NQVB 1KJMB 4PJCF 4F8LA 3Q9QA 4QHKJ 1KFAL 3LS5H 3CH1B 4YDKL 1E4KC 5CGYC 1F4HA 4F1ZA 1E43A 2IMNA 5E9DB 3MCG1 3RWGA 1JZ6A 4JR9L 1ZV2A 2A9ML 3LTVA 4XO4A 4OF0A 3NCJL 2BERA 1LK2A 1DQDH 1CIDA 1MQKH 1BQHG 3CVIL 4WSKA 4AW4A 1OCZB 1X7QB 4ZMYA 5IFHH 4X9HA 1PMYA 1ZV5A 2HWZL 5A2AA 4UIMA 4MJID 2BSRB 2CU9A 3L1GA 4YEEA 2ZUQC 4W4NA 1KMGA 4L18A 1ZIAA 1T89C 2AK4E 5DJ0A 1ZK5A 3KLQA 2MPAH 1XTLA 1FAIL 1Q9KB 1MG2C 5DFVD 3PY9A 1CLYH 2XXCB 3FTWA 4MZIA 4JM2B 4G8EB 4XVUC 1XL4A 5F7AA 4U6XB 2DQGL 3C09B 4KHTL 4M7ZC 3BWUC 4MB3A 1E5YA 3UEZA 1MZYA 1MW2A 5HY9A 5GRUL 1S7VA 4JPQA 4L4VE 3VFGH 1Y7VA 1JZ8A 3EOTH 4MJ6A 3IXTB 3R4RA 5DI8A 2R0LH 3HW7A 4RIRA 1NGXA 3L3HA 4P5SA 1Z9OA 2CO6A 3QIWB 4HV8B 2AKRB 4YSUA 4WEMB 2ARWA 5EZOL 4QXGH 3U7WH 2R0ZH 3MLRH 4RFNB 5D7EA 5G4MA 2VDLL 1UJ3B 2HT2C 2OMXA 4TLUA 4ZW3A 4B9IA 4CJ0A 3VD4A 1HHKA 1WA2X 3C9NB 2BHZA 4I0PA 2OMYA 3QS3A 3U7AA 2Y5TA 1CICC 1BEYL 2C9AA 2CDEB 5JXAH 4RMBA 4NAQA 3RBGA 4N9GA 5E6RB 2AXJA 3ARGC 3U4KA 3GMPB 2OQJA 4LSVL 4ZO7A 5ANMA 2G60H 4PW4A 3FCSB 2DTMH 4BFKA 3ERXA 1I8KB 4NNYB 1L5GA 2XETA 4G8GA 2FQGA 4PQXA 2B1HL 4HVBA 4YSEA 2NMSA 3ULUL 1S7RA 2E46A 3EYOA 3TYGL 3A0OA 3PP4H 2NRDA 1P4IH 1I82A 2VH5H 1U3YA 4ZJ9A 4HOMA 4GW4B 3NJMA 2DQEH 5F6HI 1ADQA 1HSBA 1IGML 2J25A 4WUUD 3UGEA 4DAGH 1UQSA 4AGLA 5C6TH 2ZYSA 2NYZA 1HSAB 3PGDA 4CADA 1Z1WA 4QYAA 1U58B 2OMUB 1F02I 2N0MA 3QJQB 1RVFL 4E41A 3ZIYA 4XO3A 1U92A 4NFDA 2ZX9A 2O26U 4BIKA 2XY1A 3FUJA 5L2KE 2ZIDA 2B9BA 4GG8A 5DD5L 5JO5B 1MH5B 1LXMA 1D5IL 1NPJA 1U2HA 1A1MB 4FQ1L 4MXVE 2QDWA 4MMXC 4G6FB 3QS2A 5ACLA 3BVUA 2G4GA 5DJYA 1KIPB 2WQSA 3WN5B 1AOZA 3CDZB 1SVCP 5CM1A 1X9RA 2WLJA 3PNWA 5TQ2H 4KV5E 5C0FB 4WDIA 3ZZLA 4CUCA 2ZUUA 3BWUF 2F53B 5GZNA 1TDQA 3LDBC 3RKPA 5I66A 4U1NB 3EJQA 5BS0E 1AJ7L 4H8WC 2VN4A 5I2IA 5FYKH 1FO0A 4ZX6A 4BH8A 5GGSA 4LLQA 5J3HC 1YNKH 3AWFA 4MDIB 3HN8A 1A7QL 4HCRH 3MRDA 4G9FD 1D9KB 1SBBA 3FUHA 5DJCB 4OLWL 3QUZD 1JE6A 4AL8C 4UNVA 1QRKA 5AALA 1GCYA 5DZNA 4N8VA 4AUYA 1JPGB 5F96L 1ET7A 4PJFE 5IM7B 3SO5A 1U8LA 4S0HA 1GS6X 4N1EA 3V0VB 4FQQA 1SXZA 1F00I 4WW2B 5JW4M 3DSFH 3AVEA 5FAAA 3L3GA 2WXQA 1AR1B 2AJSH 2AQ2A 3QEQA 5LXGL 3FSWA 5IVNA 1MCCA 4P3WA 1Q72L 4MMZA 4K5NA 1W15A 1XCTA 5KS9E 1LE9A 1S5IH 4WI9A 3S96B 2IANB 1F86A 1IQWH 5CILH 3TZVD 4Q9CA 2YPKB 4H5SA 2BWDA 4C57C 4Z7IA 4UCFA 5M7QA 3EUUA 4O58H 2CRMA 3H0TB 4Q2ZA 2HJKA 3MUZ1 1K8IA 1B4JL 4XVTL 4DO6A 4DP5X 2K7PA 2V5RA 1YNLH 3CVDA 1FG2A 4EF3A 5I8CB 1EJOH 5AW4B 2CCWA 1HNYA 4FQXC 5ID1A 1IE5A 3W9EA 3KYOA 4KU1A 1WFIA 2D0FA 4R3SA 1E3XA 3P69A 1U6AL 4PP2B 3KYKH 4OLXL 2BXZA 2XBTA 2IO5A 2JH2A 4IKLA 4NP9A 4K9EL 4ONFL 5DD6B 3RDTA 1AIFA 4HUUB 1IL1A 3SE8L 2IDFA 5DUML 3ARVA 4PGDB 3ARRA 4CN4A 2V3DA 5KG9B 3Q8AA 2OPCA 2PCPA 2WLMA 2VE6B 1I3GL 4TQPA 2BZDA 2QQNH 1N7ML 1S9WA 2IC2A 3D2TA 4AV5A 3RKDD 2D0GA 3QRBA 2BHUA 3CMOL 2XBZA 3RL2A 5ALCH 2UZIH 1IMHC 4KWUA 2DICA 5D7LE 3S35X 4M1CD 3C60B 5IMOB 5KANG 2XJKA 2EYSA 4KUCF 4YL4A 3MLYL 4NQCA 5DRXA 3ZTJH 3PS6A 3LRMA 3X14B 1BMWA 2RQ8A 3GFUA 2BP8A 3ZQXA 4S1DD 2NY5H 1KYAA 2ZXGA 1J48A 1HKFA 3LB6D 3NDZE 1WYJA 4HCIA 4U1JB 1XF3B 4U4IA 1UKTA 2DMGA 4DKTA 2YD0A 4Q6KA 3ZO0A 3WUZA 4DVRH 1E27A 5LGKA 1WCBB 2FGWL 3DROA 2X9XA 2VXQH 3APNA 4HLZH 4YAQB 4I1RA 1T3FA 2J3SA 4HFUH 3ZKXB 4MNQB 5JNYB 2BDNL 1LEGB 2EKSA 4NJ9L 1HJCA 3NDYE 1A4KA 2AAAA 2ESVD 2QTVA 4GT7A 5IB3B 4LARH 2VXVL 3X12B 4XBGA 2ITCA 3N1PC 3Q8CA 3VQMA 4HUXA 1JNHA 4OCXH 2A6KB 2RGSA 4Y19B 3EFDL 5AQ0A 1KT2A 1EHNA 4UB0H 1NCGA 3GM0A 1PAMA 3T4AA 2KZ1B 3VXUD 2F1BA 2K6WA 2V9UA 2NOYA 3BX7C 2W92A 4P5KA 1A21A 4KO9A 2B4CC 3IJSB 1GY2A 1YA5A 3QYNA 2NSQA 2CRIA 3RVWC 3C8KA 2FQFA 3H9SB 2IOIA 4IIQA 4E2OA 1N64H 1TCMA 2F58L 2FD6H 2OTWA 3PUUA 5GISL 5KSVB 4HUVA 5F21B 1BLIA 2QDVA 3FTZA 5C08B 4S1RL 3ECBA 1BLNA 5EH1A 4UT7H 5C0EA 1Q9WA 3VGAB 2CKBA 4JFOA 1SDYA 5LAPA 3JV6A 4TVPL 4KI5C 1O5PA 1ZT4B 4NO0D 2Q7YA 2MOQA 1TFPA 3D4YA 4Z0XB 3LKRB 1QZ1A 1U8NA 1YY9D 2D3VA 4LAJH 1CK0H 1ZVNA 2BP0B 3MRRB 3QIBD 5I0ZA 3A24A 1P5UC 4OGAC 5KSBB 4KZDH 2Q7NA 1I7UA 4F9PA 3UBXI 4POYA 2EDKA 3HG1E 4FF9A 3RY5A 4XVSL 1UWEL 3RWHB 5IUSA 3QH3B 4H88L 3E2HB 4DK5A 5LN8A 2X4UA 1FAKT 1Y0LB 4KJYA 4GI6A 5E8EA 2HN7B 1TMQA 3EBGA 1PY0A 2KHAA 3U79A 3DO7B 1A7NH 1DO6A 3NFSL 5DMGD 3WAJA 3C6LB 3OAYH 1X5IA 1UUNA 5CBAA 2IXQB 4WW1B 4XPTL 4PG9B 5D55A 1SMOA 1UA6H 1MWAA 1HQ4B 2DIEA 5E4OA 4ANKA 6PCYA 5EDSA 4JFEE 3V6BR 5HJBA 1D5RA 3FQNA 4CU8A 1L9TA 2H32A 1MFEH 2OCFD 4LFHG 4J8RB 4H13C 2VN5A 3MAWA 3MRCB 5D7JB 1RZGB 1CL7L 4BRJA 1RUAL 4GKZA 3HHSB 2H3NA 1NEZB 1A14L 1EEQA 3EH4B 4UAHA 5FOBA 1ZK9A 1M9SA 1HESA 4LP5A 5DO2C 4HU8A 1QRNB 5TGBB 1CBVH 4AEIL 3OWRA 5ESVA 1QHOA 1WTGT 2G2RA 1E28B 3UTOA 4AEHH 1DQMH 3RIFK 2H8PA 2AQPA 3RI5F 3TT1L 3C75A 3IN0A 3PDOB 4GRLA 1VPOH 1OTUD 1DBAH 1R5WB 2MNUA 1ZHKA 3IU4H 3FQRB 4JNXA 2N1KA 3V0HA 1XGYH 3D50A 4JVPA 1QTPA 4XNZC 1VFAB 3MUGA 2BRQA 2EUXA 2ZX7A 2CRZA 2GG1A 4GQPH 4JM4L 5F7DB 2Z91A 3QGVA 4BEIA 2WB7A 4PLNC 5H4ZA 5LXVA 4DO4A 4DPAX 5EU3B 2X89D 2Z7ZA 4B0MB 4OR1A 3QWNA 4LB8A 4EN2A 3E1F1 4ZMPA 1X5GA 4K07A 4YHOH 1QBML 4HUNB 4NKDA 5DVKA 4KI5F 2VL5B 2ORBH 4I9WE 1CFSA 4HSAC 5CLZA 1I85C 2DS4A 4H1LA 4I1PA 1M7UA 4UAOB 1JZIA 4XXCA 5FK9A 4OIBA 5B39B 4D9LH 2H0JA 3OF6A 4DFIA 5CJXA 3NIDE 3PABB 3G6AB 5I18H 3BZEB 3BVXA 5BZDB 1X9UA 4ZYKA 4ALAL 1INQA 3B9KC 3II1A 3T3PE 4BQCA 4RNRA 1CD0A 4MA8L 5DVOA 1X5XA 2IQAA 2OZ4A 4AYFB 3TS8A 3GDBA 3L5WB 4OZHE 1UZ8B 3SDXB 2JJVA 2IFFL 3QPXH 1W0YT 2B16A 5F1KC 5FA3A 2DAVA 2Y4SA 3GSUB 2PCXA 1AGFA 1CYWA 5IMKA 1T89A 5FPIA 1ZTXL 5D2NB 1R19A 4CVXB 4MZ3A 3M86A 1FIGL 3TA3C 1UWXH 5KVDL 3F5WB 4WHDA 4NKOA 1UVQA 1L9QA 3AQYA 3HS0A 3ARBB 3P2DA 2E75C 5HJDA 3I75B 3KL3A 4CC4C 3NJHA 5IROC 1G9HA 4FLRA 3G5ZB 4MD5A 1AY1H 2W60B 4AZ8B 4HOZA 3L4CA 4YSAA 3L5XL 4M7LT 2MQCA 3QXDB 1K4CB 4PJEF 5CD3B 1XAKA 2BVOB 2IAMB 4LESA 4GAJH 3OC8A 2FTAA 4YQXL 4XOAA 3WE6B 5DD0L 3JTSB 3EJCA 5H94A 1G7JB 1WK0A 4MD0A 5EOQH 4B9YA 4JW3A 1U93B 3G5XA 3QUGA 4K3JL 3U7YL 4Y5XB 3S98A 1H9DA 4N6QA 3QNYB 1IGFH 2DY2A 3CK0L 1MF2H 1PZCA 4KVCL 4OSUH 4QTFA 4XPFL 1QLRA 2D7TL 5CBEA 4DPRA 5IVXA 1CICA 1U8JB 5BO1H 4UQ2B 4FFZA 1RJZB 2VMEA 3SYOA 3OL2A 5EBGA 2C3VB 3REVA 2FL5B 2Y36H 3ARGA 3EADA 1E7UA 4FZ8L 5DGQA 5IBLD 3DXAB 4M6OH 1YYML 4BFIB 3DV4A 1MCSA 4LP4A 3SDDC 1WFNA 4IMLB 1TYRA 1MCQA 2X38A 4WUKH 5EB9A 3V9CA 1SJMA 3RWDB 1UHVA 4XMVA 2I07A 3BKYH 2N7AA 1AQ8A 2Q3ZA 2XPGB 3ZHLA 1YZZA 3VFVB 3DX8B 5I17B 4YFLI 3B2VH 3DX3A 3CN4A 2XN2A 4QY8B 1GTNA 3IDMB 4JG5A 5A2KH 3BGMA 1CD1B 3ULVH 1T1WB 4JVUA 4JO2H 2YPLE 1NM4A 3ESOA 4UMSA 1ZLSL 2HLEB 5LCVH 4I2XE 2UUDH 5E6IB 4EBQH 2BSTB 3ECVA 1MCEA 1VEMA 5I6XC 1WP6A 3CBRA 1E6OL 2F54B 3M1BB 2DYRB 3CHSA 3ILPA 3I02B 4NO2A 3WNLA 1MJ8H 4OZGF 1EHAA 4FAAB 2QMJA 4G7VL 4QHKI 3S36H 2GEEA 1KEMH 2A2QT 4MMXA 4PRPA 4LNRA 3HMXL 1UC6A 3Q6GL 2UWEB 1MAMH 2AITA 3F8UB 3HG2A 4X6CF 4LLVB 4YGVB 3SE4C 3AAZA 1DQLH 4YZWA 2X44D 3P3SA 4YSPA 3IPBA 5AUMB 3SKJL 4ZFZA 1GOFA 1FFOA 1UWGL 3NTCH 4OV5A 5KVFL 1OAQH 4J4PD 5D96B 3HB3B 1ZJAA 5J1AB 1S46A 1CXIA 1RZIA 2DWTA 2R2EB 4BSVB 1I53A 3DJTA 1OCOB 1QSEE 1W8NA 4DF9A 3PQYA 2D3JA 3FT0A 3GTNA 3OJVC 4NKIL 5DMIH 2WVTA 3VXQB 3CZFA 5EOTA 1R3IL 2P5WD 5EEUA 4FGMA 2BFVL 1TJIH 3HUJE 3HNSH 2VUYA 1MI5E 4UM9A 4XPHL 2VDNH 3PF2A 5KVGL 4NUJB 1YYCA 4E9SA 1JFQH 1WBYA 1PCSA 2A73B 4HJ0C 5CWSA 2JELL 3VSTA 3GSVA 5FOJA 3V4UL 1FZKA 3B1TA 4NDMB 1D5XA 2CO7A 3UCQA 3JSSA 3CVHA 5EC2A 3VRIA 1WWBX 2YD1A 1FN4B 3MOBL 4NUGL 3DIVA 3G04A 4J3OC 2A4ZA 5K9JL 1VGEH 4NKQB 2A5UA 4TKWA 5IVXF 2ICWJ 4MJ5A 3MNVA 3H4HA 2VDNB 4QKTA 1G0YR 2F1AA 4R97C 5MEQA 2CK0H 2LHAA 5L7XL 5DJXA 3TA4D 1V3KA 2G5BB 1AGDA 1X44A 1BQRA 3MVSA 3A6CL 1I7TB 1BDYA 2A9DA 2Q8AH 1E9PA 1JHKL 1F6FB 3IJEA 4Y7MA 5A3IC 4OLVH 3DV6A 4G6KH 4FQXA 1I3RB 1VERA 2YXWA 4P99A 3RIFF 4GI9A 5TPWL 2CJSA 3O9WD 4R4BB 4PLJD 5IJVB 1ZS8B 2QHRL 2I9TB 1C7TA 1GAFH 1KCKA 2HZHA 2MOVA 1A9EB 2ZX5A 2CHXA 1NWOA 3BQUC 1P7QB 2B59A 3LPFA 4X7TB 3L3IA 4A04A 1DQVA 5EN2A 2WQWA 4G8FB 4OFQA 4XNMA 4XNQA 1BA9A 3SDCD 1MHHB 1IC4L 3N43F 3RPIA 3GTTA 4TUOB 3BAXA 3GZKA 3O81A 1SMDA 3V55A 3KLKA 1IQDA 5IUCA 2FHCA 2ZSVA 1Z9MA 7CGTA 5F6IB 5I28A 3TPKA 3G6DL 3ZTEA 4EVNB 1QX1A 2VMCA 4Y7OC 3IMWA 3L3DB 4NQXB 5DXWA 2IBZY 1DUYB 2YXMA 4XN1A 3AXLA 2R2BA 3UIYA 4FTVA 1ZTMA 4BH7B 1T66C 2WV3A 2FZ3B 4JFDE 4GO8A 1FIEA 3V9EA 2WXNA 4LEXH 4HXAL 3OQ3B 1HAUA 3QULB 2B0SH 2FATH 4QXVA 4K7PY 1SBSL 3ZT5A 1P9MC 3D85A 1NEZG 2M83A 4Z7OB 3QWOB 2GC4C 1AKJD 3VXPA 2P3YA 3PAUA 5BZWB 1JDAA 1AR2A 2CJ3A 2IGTA 3MV9B 2WZPD 2R29H 1IAOB 3CN0A 3E80A 3IFLH 4X99B 1T0MA 5DHVA 4IS6A 1FH2A 2EDLA 4NN6B 3O2VH 1NINA 2AEIT 3L3KA 4XMPL 3GMRB 2GSIB 3SDYH 1XZ0B 2DQCH 4X6EB 1ASOA 1A02N 4W9EC 4PCTA 2PCFB 1J0IA 4OCSH 3QUXA 4ZUSA 4HISA 3MRFB 4GOSA 3BAEH 4D9QE 4XCNB 5TE6L 4YDZA 4L2YA 5DTFA 1ANUA 3VXSB 3MV7A 4X80H 5E2UH 3RVTC 4POZC 4F15C 3KDPB 5K1JA 2IBBA 3IGAA 1KXVC 3FUFA 2E7HA 2J5LB 1NGPL 2QSCL 2XPZA 4OD2B 1T2XA 2K8MA 3LKQA 1WSST 4BK5C 3ZQWA 2YFOA 2EE3A 3FFCD 3PHAA 2TRHA 4IGBD 4H8QA 5B39G 1IBGH 3GSNA 1U8QA 4FE9A 5ITFB 2VQTA 1O6TA 3L7FA 1V10A 3QG7L 5GGTH 5AG9A 5F44A 2AK4D 5IVZB 4ZTOH 5J1TC 1EEYA 1OW0A 2F53E 2JJWA 3SQRA 1HHHB 2KUTA 4WKZB 4ANWA 5E1QA 3FT9A 1OVZA 1F58H 2C7UB 3Q13A 2VUOA 1BREA 1KPVB 2O6EA 1PSKL 4RX4A 3VDBA 5DUJA 4O2EA 4G1MB 2CHZA 1HXMB 2EACA 4YIQA 4D94A 2OXHA 1Q0XH 4OLYH 5I19L 5HYJB 2I60H 1I4FA 4NRZB 5FEBA 4L4VD 4JHUA 4OJFL 3ZN6A 4D8OA 1KC5L 5E8NB 2H0PA 3HPJB 1MNUL 4LLUB 2PXYD 4AQ1A 1OAKL 1YQ2A 4F7MB 1UKQA 4RFEB 2YIHA 3CHRA 3T0DA 2GITA 2GKIA 5F7NC 3R7RA 3CFTA 1MCWW 3FOLA 1P6AB 4FL4B 3S3BB 2Z31D 3FCGA 3CHQA 1HE7A 2ZG2A 2CM5A 3MLSL 5KSAD 5CIPH 4WNSA 4GO6B 3P3RA 2BJMH 2R51A 3CZKA 3GSQB 1QPXA 3IDGA 4MZRA 3IN2A 1QNIA 4RZCB 1HEZA 1U8MB 4AMKL 5CEZL 2NZ9C 4Y4KD 3D87B 3GSOB 4B41A 2H26B 4TNVK 3MYJB 1KCRL 2EO7A 1IC5H 4QHUA 4NP4H 5JQHC 1OV8A 3HE6C 3N9GH 4PJ7F 4F33B 2HKFH 2EEBA 1LTXA 4KKAC 3LEXB 1GPOL 4HF5H 3GBMH 1OP4A 4PRIA 1T20A 2K8QA 1KGJA 4P48A 3G08A 5CIPB 2X05A 1G7LB 3B8YA 3LVTA 4CSZA 4H26B 1KB3A 2DJMA 4DH2A 4ZUUA 4LSPH 4MAYD 1NMAL 3GI8H 1U8HA 3WKQA 2CGZA 4ZMXA 1B4RA 3IJ8A 3NZUA 4LRIA 2KYIA 4QNPE 1BX2A 1HCVA 2CO2A 3GLAA 5EU5B 3TC9A 1E4HA 4Z3JA 2R2HA 2B8OT 3C5ZA 4BFEA 4L8CA 1KCSL 1X6NA 4R9HA 4RFOL 1NBYB 2X4RA 1OSPH 5L2KD 3UDWA 3M6DA 2E27L 4V2BA 1F56A 5AAMC 2J1YA 4IK7A 2IPUK 3D2UD 5BNXD 3EYQC 5I1DA 2K0RA 1EPFA 4X5WB 4JHWH 2GEQA 4FNSA 4XBPB 1C5CH 3NRFA 4MFHA 2HH0H 1AO7A 1TTCA 1H5BA 4JFFB 2G75B 4KNSA 4G3YH 4NUMA 4A7GA 3SY0A 1YY8B 5JYMA 1E8WA 3V7MA 1JRHI 3BSZH 3SE9L 3ZDYE 4OF3A 5EO9B 4H44C 4GAFB 5ICZA 3KM2A 2ADJA 3WY1A 1HXYB 4GBXC 2OMZA 4EI6B 1WWAX 2ZX6A 3B9KA 2DIBA 3U9UB 5I0YA 2YUVA 3PDDA 4NQDD 1IBZA 2DKUA 4Z5RA 1KJ2A 4QIRA 5ILTL 4NIYE 2VQUA 4DCQA 5E1AB 1OP9A 4C4KT 2G2PA 1TVBA 1V3MA 1GHFL 2A9NL 3FUDA 4IU2B 3WGUB 4MA7H 5DU7A 3WJMB 1W9XA 3VXTB 1G87A 3LS4L 3W56A 4MNQE 2NX5D 2A74C 3UZQA 5E1HB 3TA3A 3WMPA 3OJDB 1P4BL 4M4RB 3CSYA 4X6CA 1DFBH 2DPKA 4HK3N 1N2RA 3GXMA 3EYSL 1DSFH 5IROA 1EBPA 2FCBA 4P5MA 5AOJA 1F3JA 3DTDA 4APXA 1NFDF 1T0NB 3CNKA 4GKNA 3RWJA 3QORB 5BUGA 3ROOA 1NBZB 3CQFA 4Y19E 5FR3A 3T8XA 1EMTL 3EJZD 2BNUA 3VD1A 3CBJB 3DX4A 2RCSH 5DHMC 3HE7A 3NYKA 4IBWA 1JZ3A 1DJSA 2V6HA 3U6RB 4BXSV 2KDYA 1B0IA 4S11A 4YDLC 3TV3L 3H9SE 1UUSA 4R4NC 4ZMWA 3MBWB 1W72L 5C08E 4KK6D 5HVGB 4LEEA 2HFGL 3PGFL 1AXSA 2UZPA 3DTUB 3MRMB 4FXGB 1RL1A 5IQOA 3AQDA 5CEYB 3EFOB 2F74A 3ZSSA 4URKA 1GTFA 3IPFA 4HQQH 4L3EA 1LO2L 3SDDA 1S7QA 2QKSA 2WVVA 3SBPA 4DHLA 3Q1SH 1ZEAH 3LIZH 1YEFL 3EHBC 5KSBE 4BZ2H 3LQZA 4K8RD 5I75C 4ZZKA 3CLWA 4X5PA 1U8PB 2V3FA 3MODH 1L9NA 2BVPB 1NGYB 1JBJA 3TTYA 1EAPA 3B7UX 4KRPC 2DQDL 4XNUL 3FUEA 2IWGA 1CFQB 2ADFH 2BNRE 1K8DA 3KPPB 2QGEA 2PPCA 5DRNB 1RH8A 4OUUB 5C3LD 1S7TA 1I1AB 2OULB 3V4VA 3SBRA 2OSLB 2J72A 2QQLL 1SUHA 1CXKA 5AVQB 4L48A 4HOWA 3W2DL 2CO3A 2KERA 4WFFD 4DEPC 4ZAKD 3LH2H 3RP1A 3RX9A 1ZANL 2PYEB 4ACPA 2K3TA 1N70A 4RMWA 2ZUVA 1XF2B 5ESVB 5J8OA 3SE4A 1FVEA 1MFDH 1MW0A 4JN1L 3CPUA 1D6EB 3GTVA 1VADB 5EUOA 5DK2A 5I0XA 4Y2DB 4FG2A 2OYKA 3H2WA 5B38A 3LMJH 2EVJA 1Z9NA 2IPKA 3OZLA 7PAZA 3RGVD 4I3SL 2ENYA 4FYSA 3L4VA 2Z0UA 5TF1L 3FQ4A 5KANI 2Y24A 4FD0A 4HKJB 3CAFA 2GY7B 1D5BB 1YSOA 4YN3A 4ZW8A 4X9IA 43CAB 2NY2B 1K5WA 4CMMA 5EU6A 2IADB 1ZOXA 4K7FB 2JIXD 4GXVL 2EH7L 2JB6A 2WWOA 5I30L 1VCAA 1AXTL 4HWBA 1WDAA 4V2CB 1YN6B 3QEUA 4PH8A 3O6FA 3TBTA 4XH2B 2V17H 3GYRA 1RK0A 1UYWL 2X4PB 3IBOA 1FCGA 4AENB 5JIPA 4NXKA 3UO1L 3UIZA 1AACA 2Q6WB 3SE3C 1R5IB 1BSIA 1R47A 4LQFL 4J5VA 3ARSA 4JRXD 2J1XA 3AU0A 3QNZB 4Y4FD 3H42H 3FU6A 3W0WD 4XHJD 2JKTM 5A6MA 4KHXH 4TNVF 4X0NA 3ZX1A 4LRNH 1KXQE 2WIIB 3HZYB 3CFIC 5LBGA 2FWLB 3PWNA 4AVJA 3CV5A 3ETBF 4XCYA 2I26N 1QUPA 1RZPA 3QXUA 4QTIH 3VWKC 5CEXA 2P42B 2H2SD 4ZXBD 1VEOA 3HG1D 1OGTA 4OZFH 2K45A 1RUMH 4X6DF 5JDSA 2Q2LA 4Q6IC 4RISH 2DV6A 2WCGA 4XBEL 3RWGB 3MOAL 1O6SA 5EEWA 4JDZA 2JK5A 5EF3A 4PS4L 5D7IA 5D2NE 2BPBA 3GMLA 3LPWA 8CGTA 5IREA 5A6IA 1LK2B 1FNSH 3BQUA 4AC4A 3PIQA 2XWJA 3EO9H 4B3EA 5IOPA 1OE2A 4Z7NF 2JB5H 4OD3H 5JHLH 4R7DA 2DDQH 4UIMB 4B5EA 5ITBL 1UATA 4QHPA 1Q9OA 3F3HA 1IE4A 3QWQB 2BX5A 4MWFA 5EORH 5CGBA 3JTTA 5EWIL 4HD9A 5DJ0B 3LHPH 4F7PA 1KEGH 3GI9L 4OBRA 2F5BH 4U6HA 4DETA 2XKNA 3FB8A 5L88H 3BE1L 1JGDA 2VDRL 3VAEA 3EG9A 5HY9B 1L0XA 2ITEA 1S7VB 3MCKA 3UEQA 4Y9EA 3SGDI 4MJ6B 5E1IA 4ZOCA 1IM9D 5DI8B 5ABAA 5FHAL 3ZDWA 1RULL 4RIRB 1EO7A 1NGXB 3L3HB 5G55A 2PR9A 1IGTA 3CZNA 4NM8H 4WTZG 2CO6B 1P9MA 2DMCA 1T5WA 1XB6A 3CGTA 1DUZA 3V10A 1R3HA 3T0ED 3AG4B 4ZK8A 1UCTA 3MXVH 2NY3C 5E4AA 4FOMA 5MP6L 1P4LA 3VD2A 1JZFA 2NQCA 2A3TA 5KVDE 1E0OB 2OMXB 3JBG7 5JHDD 2APWA 3V6OE 1HHKB 3KPRA 3ZXAC 4A2LA 4I0PB 3AZUA 1EH9A 2OMYB 3F7PC 2Y5TB 4I3GA 1ZPLA 4PJ7A 5K59E 4N9GB 4I9WD 1ADQH 4PV8A 2AGJH 2UXTA 4G6MH 3S5YA 2OQJB 5ANMB 1F45A 1G84A 5KBMA 3O8XC 3B7TA 5K1NA 1Q9LA 4OI7A 4M8UA 2C3HA 3FSOA 4U1GC 5FHBH 1L5GB 1UD6A 1V7NL 3DECA 3MXWL 4G8GB 4JCMA 5IHBA 2DYSB 1S7RB 4EI5D 3EYOB 4LT7A 2F54E 4FZEH 2E56A 4U0RB 1LJMA 2VDRB 4M62H 4YFLF 2DEWX 4M5YH 1PX3A 5CZKA 2BIHA 3IJHA 3SO3C 4DIXA 1JJUA 2X3BA 3BESR 2JSFA 3OD3A 4LCWD 1HSBB 5F9WC 1UQSB 3ULVE 4F8NA 3TEYA 2N4IA 3PGDB 4CADB 3JXAA 1C5BH 1JD9A 2Z92A 4KJWD 9PCYA 3VSVA 1IEAA 2R4RL 2Y1YA 3L2MA 4L2LA 1DQIA 4YBQD 1SYSA 1P4UA 2Q9OA 3OBAA 4E41B 1WD9A 1UCBH 1U92B 1ET5A 2CDGA 1CDJA 1YQVL 1FE8L 4PWHA 2ZCLL 4E9RA 4GQRA 4GG8B 1T80A 4P5TC 4M02A 3QUYD 3TIDA 3WSQL 3FB5A 2P49B 1OCWH 1EVUA 4U7SA 5DJYB 1OOWA 2WGXA 1T21A 3LRLA 3WY2A 1EHXA 4XAWL 3PNWB 4MQSB 3NEXA 3H1ZA 4WDIB 3RX8A 4PV9A 2C4FU 2YAFA 5L4JA 5I66B 4NBYB 3F6LA 1T04A 2EC9U 3K2UL 4WGVB 2LV4A 4UF7C 5I2IB 1FO0B 4BH8B 5GGSB 4LLQB 5IQNA 5FYLH 2BLFA 2VWEE 3ESVF 1T5XA 3NCCB 1FPTL 1VESA 4FMFA 4QRPB 3MRDB 1FF5A 3D05A 4RWYL 4MXVF 5K9QG 3MNMA 4YSOA 3UADA 2OJ1A 1EFXA 1QLEL 3KZ8A 2IDQA 2FJUB 5D70H 4N8VB 5CJOL 2WOYA 1CDUA 4KV5F 4B5ZA 3KLHD 5ENWA 2R9HC 4FNUA 1U8LB 3GLEA 5KJRL 1AZBA 1RIHL 4FQQB 2GJZA 2JJTC 2CWRA 1RLWA 3MUUA 4LLWA 5ELIA 1NOLA 2UX6A 4UQCA 1RIUL 2HFTA 3L5IA 4WV1A 3L3GB 3ARFD 4NGHL 3B43A 2E3VA 3QEQB 4YX2H 4M6NL 5JIHA 2VDMH 5HVHB 4DERA 1KFAH 3CFNA 1MJUL 3FO0L 2K1MA 1XCTB 4MMZB 4TF4A 1LE9B 3BPLC 3QYMA 3D09A 1FC1A 2CBTA 2IVFC 5IW3A 4PJFF 3NCJH 1H6FA 1H3VA 2YD6A 2AQ1A 2XWCA 4H5SB 4GEIA 1GJIA 4RGND 4A7VA 4Q2ZB 3DMMD 2HJKB 3B9DA 3BEWA 1K8IB 3UL4A 1AMXA 1LP9A 1FG2B 2WC7A 4KQ4L 2HWZH 4R7NA 1OHQA 5ID1B 3HG0A 3W9EB 2NT0A 3KYOB 1NLDL 3ECWA 4PWFA 3G9AB 5J13C 4R3SB 1SHWA 2YUWA 4FC3E 3D8MA 4OB5H 3WIFA 3ZIMA 5KS9F 4K3DL 4F91B 5FB8A 1QLEB 3E3QE 5D1QA 2X4OA 2EUWA 3NABL 1VENA 3L4TA 1PLGH 2ZUXA 1MAJA 3RDTB 3KH4A 3KJ4C 2FSDA 3RWFA 1AIFB 3GS4A 2QSTA 3WKNA 1IL1B 1ZD6A 5F9OL 5H35A 4KHTH 2X87A 1JV5A 2DL9A 4X7SL 4B7LA 5GRUH 4NHUA 2O4EA 2YD2A 1QSED 3UC0L 4DGVH 1GA2A 1OQXA 3FTGA 3GUFA 5J12C 1SHSA 1BFTA 1S9WB 4RSVA 4Z7OE 1CZ8H 5E4EB 2ITFA 1YNTF 3H3PH 1MRDL 3HI1A 4ODSL 1WWWX 1KSRA 1QI3A 3S8WA 2C3XA 1MI5D 3MV9E 1EQWA 2VZUA 3FQYA 4NQSA 1ORSA 2KMWA 3IWVA 2CLRA 1DYZA 2EYSB 2O61A 4NQCB 5DRXB 4LP8A 1WHPA 1CI3M 2A74A 3ISWA 1OLZA 1RLBA 3BAWA 4OCLC 4IBUA 2BP8B 1BEYH 3RJDA 4GINA 4LASH 3TN0C 3T9WA 3ZVVA 4N8CH 1PCXA 3IEAA 4ZTPH 1E27B 1MJ7L 2NY1B 5E9DD 2CKBL 3DROB 3PL6C 1VIWA 5ES4B 1VSCA 1RZJH 4AK1A 4QCIA 1T3FB 3NIGB 5JQ6H 3ULUH 3PPSA 3JWNG 2C7FA 1ETJA 2EKSB 1FH5H 5FKAA 2CJUH 2ZG1A 3BLBA 1AP2A 3FQ1A 4MTMA 4N2GA 3TYGH 5AYUH 1A4KB 5FYLD 4NC2B 4Z7QE 1LWHA 4S2SA 1EHLH 1YJDL 5BJTA 4XBGB 2ITCB 2MCPH 3AMLA 5C0RH 4WLCA 1CFBA 3OZKA 1H8LA 4PJGA 4HUXB 1JNHB 3DARA 1B6DA 4JDTL 2XY2A 1GVIA 5AVYB 1OT1A 2EYTA 3ATDA 1ZAGA 3NSXA 3GK8L 4PYHA 3T4AB 1AD0A 3IDNA 2F6AA 4P5KB 2DMKA 2IWKA 4P2RA 2CHWA 1BOYA 1Y1UA 3C8KB 5HYJE 2DTSA 3QDMA 2AQQA 2CPCA 2L7EA 4IIQB 2OTWB 5LGHH 5EZPA 5FW6A 4ILDA 4HUVB 3AT8A 4ENED 1WVZA 4TQEH 4KROD 3ECBB 1BLNB 4PJDA 1MAKA 4LL1A 3QIWD 2AZUA 3QWRD 5C0EB 1Q9WB 2VMFA 2WPGA 5DJDA 2CKBB 4HG4J 4JFOB 2L7UA 3JV6B 3TFBA 2CKNA 1S9XA 5F7HA 3CLEL 4HK0A 1RAMA 2Q7YB 1AJ7H 1WITA 4X6DA 5JW4Q 4XNYH 5AVTB 2RAMA 2XWRA 3IMUA 1AQHA 4EJ1C 1U8NB 3IDYB 4PGBA 1PY9A 1QUNA 2XV2A 1XB8A 3HRZA 3SGJA 1BG1A 1XQ4A 4NZTL 2BS71 1FZMA 5DZOA 1ETB1 4HEPA 1OTSC 2QR0A 2GTZA 3RVUD 4AGMA 3EDFA 1I7UB 2V5MA 4NC0B 2JQZA 5LWYL 3HBGA 4Y8DC 1T6WA 3P4MA 4ZW7A 4WI5A 3A21A 5E99L 1VRSA 4JDVA 2OI9B 2PMZA 2X4UB 4JS7A 4U1KA 5F0LB 5HVFB 4KJYB 5E8EB 1ZPUA 5HJGA 4FCAA 4NPYA 5DLML 1IBHA 3GIVA 1LO0L 3T2LA 1K6QH 4ZFFA 1CGSL 2Y0SA 5CBAB 4OGQC 4PVLA 2E74C 2PP7A 3UBFA 1DLFL 1UKSA 5GIRB 5I71B 4LEOA 3IGLA 3JZYA 3GLZA 3MNWA 1MWAB 3QG6A 1Q72H 1QBLH 4OCYH 1XF1A 2LFEA 3FQNB 1M7XA 2H32B 2D03H 3IFPA 4D9QD 3H55A 4GKZB 2H3NB 5FOBB 2J88H 8PAZA 3GHPA 1H3WM 1T1YA 2YMOA 3QJFA 4H0LC 4QXTA 3DA0A 1Z7JA 4R90H 2ICES 2G2RB 2FEEL 4XVTH 5AKTA 3Q2CA 2CJTA 4MNHA 4R5VA 2OXGA 3TFKD 1UGKA 1KB5A 2EIZA 2OZ4L 3ZL4H 2H8PB 3UCRA 1KZQA 1P84J 3ABKB 4G6FD 3SODB 4Z95L 1E4JA 4GRLB 4DESA 1N8ZA 5CEZE 1ZHKB 1CLZH 2HPTA 5IK3A 3VA6A 5CZRA 4JFFE 3MUGB 2F53D 3EF4A 4UDUA 3L1EA 5T5NG 3H9YA 3DOHA 1EO8H 5DF0A 3MACL 2Z91B 2BM3A 1SOKA 4X42A 3ZYOA 3ULUD 5C0AA 3OZ9L 4AQ8C 1U2CA 3EJUA 3D33A 3FPYA 1N26A 2O5NA 1UOWA 5INDA 1UACL 3FYIB 3JWOC 4H8HA 1OEZW 3VWKA 3K80A 2EIKB 4G43A 4NKDB 5ICYA 1CFSB 1N7MH 5HYSA 4WWKD 2EZ0C 4H1LB 2ZZUT 3KBHE 3MRQA 3CMOH 3PHOA 1Y1DA 5FK9B 1HDMA 2HT4D 3KR3H 2OMTA 5FX3A 3D07A 1I9RH 2OL3A 3QEGL 4AYBA 4IMKC 4OLZL 2CBQA 1OP3K 4ZYKB 1INQB 5MHSE 4HJGA 1HILA 3T09A 3CTTA 4RNRB 4FFZL 3JT0A 2IQAB 2X1QA 3MJ8A 5F7WC 3SKUD 2CQVA 3NJKA 3VVWA 2VLKD 1UFUA 1IT9H 1E90A 2IAND 3CX2A 4NHCL 2YWYA 2FGWH 5FA3B 1AGFB 4U31A 3EGSA 3N55A 5IMKB 5JW4R 4UANA 1FQ9C 1NSNH 1FNHA 3BYTA 3NIDF 2HYMA 2EINB 3QFGA 1IBFA 3JV4A 4IOSD 2PO6D 4NKOB 2NYYD 1UVQB 4KXBA 3HS0B 5BCAA 4M7ZB 2CGRL 1QO3B 1C7SA 4L0YA 2HSIA 1ZWIA 3T3PF 4MD5B 3RILA 4N8VG 3VXMA 3VXOA 5GS1C 3OG4B 3UP1A 4OZHF 1N6UA 1LM8V 2WINA 1PD6A 2PTTA 5H94B 1MREH 2H1XA 4MD0B 1TQTA 3RFRA 3VTMA 3BRFA 1BQ5A 4JREC 5DA4A 3VM5A 1IV8A 2R39A 3G5XB 2XNAA 2WNXA 3IE4A 3OG6B 3FU9A 2XTSA 1MFVA 5CBEB 3ZTCC 1QLRB 1BJ1H 2F58H 4QTHA 5GISH 1CICB 1T83C 7PCYA 3REVB 4WEEA 4Z23A 1PBYA 3ARGB 3GSWA 4KKZA 3QPKA 3S3CB 1JNNL 2YSTA 3DV4B 5F88A 4TVPH 3O8XA 2EVFA 1EZLA 1LEIA 1KYOJ 4H8WL 4X6FA 3LSOA 2XSKA 2VLMD 2I07B 4RDQG 1TNMA 4ZPVA 5B3SB 2JCWA 2ENSA 5AOMA 3FO2A 3RWEA 3HPLA 2MOGA 3ZOAA 3PAZA 4XVSH 5ESQA 2ZCZA 3BJLA 4LU5H 4AL8L 3BGMB 3NSFA 5DD3H 5K9OA 3WY4A 2HX9A 1M7DA 2H9GA 2J1WA 4OFYD 1OP5K 5KVEL 3WXVL 3TOPA 5DZAA 1B3JA 4JUSA 1RURH 4PLKC 12E8L 3INUL 3NFSH 4MNQD 5BO0D 4UNUA 1GYCA 1ACYH 2O5ZL 2FUTA 3H3BC 2XT1B 2ZCHH 1XTMA 3ECUA 1DVFA 3ILPB 4NO2B 3TO4C 1GZQA 3FOMA 3MRNA 2PF6A 4XPTH 2AF2A 3CVHL 2AABL 3BCFA 4MMXB 4ATWA 4PRPB 4P57A 4AH2A 2IG2H 4LNRB 3SCMD 1H3PL 3SKNA 4NUQA 1CL7H 4OCNC 1RUAH 3AAZB 3VXRE 2UX7A 4JJHA 1I1FA 2RBLA 4B9GA 3AITA 2D4FA 3AQXA 4NS0A 4QJ3B 4RMQA 2EVIA 1SJXA 1F4WL 4GAGL 4ZFZB 4OV5B 1FFOB 5AD0A 4L23A 2JQMA 4MMYA 4HJSA 2BY0A 3CVCA 3HNVH 4C54A 1RZIB 5HBBA 1GR7A 4KX8A 2VW4A 4JM2C 4DGYL 1L9MA 5C08D 3B83A 3PQYB 4PJAA 3QJZA 3WFCL 3C09C 3FH7A 4M00A 5DMJB 3CZFB 5EOTB 5FUZL 2FLRT 1SM3L 2G9HA 3OLGA 4F2FA 4BFNA 5FCSH 4ZNCD 3UACA 1E8ZA 3JT2A 3SJVD 4UM9B 4Z0BH 5TD4A 3FTXA 1HHIA 5MERA 3GHBH 4P5RA 1J1OH 1IIIA 1WBYB 5CWSB 1D2PA 2GAZA 3GSVB 1MPAH 3BVVA 3OSVA 3NH7H 1ZA3A 4IOFD 1FZKB 4TUKH 2XZZA 4Y1SA 3L1OL 3FN9A 4RFNC 1D5XB 1QBMH 2CO7B 3ARED 4LEBA 4PJ5A 1BYPA 1JS4A 1XZWA 3CVHB 4QR7A 5EC2B 1QYGL 1UJ3C 3HOGA 3VRIB 1XT5A 5EC1A 4M43H 4L3CA 4M7KL 3DIFA 4N90E 3G04B 4LCIH 4PW3A 3IVKA 2YRLA 5JUEL 2OKMA 4N0FA 2WXPA 3MNVB 4MJ5B 3HUJF 3C6LD 3KGUA 1VFOA 1BZEA 2Q87A 3NA9L 4I48A 5MEQB 2WJ5A 3F7KA 5DJXB 2H6OA 1AGDB 3J7HA 4NBZB 2VQ1A 3QARA 1X3DA 1E9PB 3IJEB 4BZ1A 5T1MA 2CK2A 1AGCA 2VKWA 2YQGA 3DV6B 3WY3A 4FQXB 2IFFH 4ZS7H 3JUYA 2QADB 4WI4A 4BA8A 1K3IA 4R83A 3AQZA 1ZTXH 4WFGD 4Y4HA 2J44A 3DI2B 4TVPD 1TO4A 1FIGH 1G7HA 1QI4A 1QRND 3GXFA 2B59B 4UOZA 3L3IB 1AZVA 4CGUB 2XKSA 5EN2B 5GZOC 1A3LH 4XNQB 4XNMB 2ISDA 5IEHB 3NAAH 1CDGA 1ODAA 3O3UN 4MVBD 5EIVA 5I5RA 3RPIB 3CFJA 2IPTL 1CDHA 5LQBH 1IQDB 5B1CA 4KTGA 3WELA 2ZSVB 1KGWA 3MGTA 3VE0A 1NIBA 2MPVA 4GIAA 2CCVA 4HWZA 5I8OL 4JKPL 3IS1X 2EDQA 3AXLB 2R2BB 1I7RA 1I8LC 4FTVB 5DFWH 5DVPA 2WWMC 4JM2F 3C8HA 5BW7A 4OZ4A 4URTB 5DHVH 2B4CL 2EO9A 3MZGB 5T1DL 3UXFA 3CK0H 3OM3B 3GEFA 4NQQA 1HNFA 5AFAA 3PREA 4MGXA 3WLWD 3QDGD 1Q1JH 1Y07A 1EDYA 1J88A 3M07A 2YGNA 3L08A 1SJHA 3D85B 4Z8FL 4J6IA 1YYMH 4WWNA 2FDBP 1THAA 5ANME 5DR5L 3VXPB 1VA9A 5GSVA 1FV1A 4HMDA 1D9KC 4G8GE 1WT5A 3AY2A 5JOPD 4N6RA 5E6ZA 5DHVB 1T0MB 3PLYA 5FGRA 2W65A 3T2NL 2WYTA 3ESPA 4TLKA 2AJVL 3N0PB 3U9WA 3L3KB 3Q2LA 1EJ6A 2CE6A 3QCUH 1E4XL 1OD9A 3S3DB 4EKJA 4WW2C 2EDMA 1TPXC 1AR1C 3OR7A 5E2WL 1ZT1B 1ZLSH 1JMXA 3QUXB 4X5QA 4ZUSB 3IAQA 3BKML 3ZKMD 4E41E 2G4EA 5DTFB 3VD7A 4NZDA 3MV7B 1A64A 3CD4A 4OT1L 3BAYA 5AZUA 3ARBD 2F7PA 4JB9H 2B20A 1WF5A 3IGAB 4IBZA 3VFMA 1JF5A 5K39A 3LKQB 4H1LG 2X1PA 5IWLA 3LYRA 2XIBA 4CW1A 1DN0A 4PN6A 2J4WL 1JF6A 1LNUA 2XPYA 1CR9L 1NCWL 1U8QB 3GSNB 2VAAA 4LSDA 3DURA 3L7FB 4OVVA 2IAMD 5FYJH 2VXTL 3S97C 3HMXH 1OKEA 3MDJA 4A38A 1Z66A 4YHKL 3SDAC 3UJIL 1QKZL 1EEYB 4QGTA 4P4RA 5CP3H 3NEEA 1UWGH 4GSUA 3MOQA 3L3OA 4O2EB 4YIQB 1CTNA 5GGRY 5JIKA 5KVFH 2OXHB 2VLRA 1I4FB 3BN9C 3BP5A 3CIAA 3QYCA 3BPOC 3CFKA 4P2OD 4BFGA 2EABA 3TESA 2FEDC 1Q0YL 2A9BA 3ET9F 2YPVH 4IHOB 3STLA 3TVMD 3DXAD 4GAYA 4AQ1B 4FULA 4DZ8A 5B3NA 1SY6L 2HMIC 2GITB 3MSPA 2FJFA 2WBJA 3FOLB 1RMFH 3GSRA 3CE1A 1IKNC 2GTQA 2XV6B 4JQIH 2JCCE 5G2NA 5CINH 3D7PA 4K94H 2BIIA 2HKHL 4L8SC 1ZS2A 3LQAC 2JELH 4L4TA 1B0GA 1UM5H 3A4AA 1JV2A 4WEBL 4KVNL 3QEQE 3IDGB 4NOFA 5EPMA 1IAII 3FS9A 3C60C 1HEZB 1RJYA 3VVVA 3VXNA 4NO3A 1C9SA 4J28A 2G30A 3ZE1B 6FABH 5K9JH 4QHUB 4ODVH 4XPGH 1Z9SA 5E6ID 2I27N 3CSGA 3F6IA 3IGUA 5I1HL 5DFAA 4W6XB 3B7SA 3OMAB 1B4LA 4PRIB 1T20B 2F54D 3DX6A 3A6CH 4FP8H 3G08B 4WW2F 3CFUA 1J8HA 4PREA 4QRAA 1UEMA 2C9SA 4BHUA 4Y1AD 4ZUUB 1KJ2L 2NUTA 3M1OA 5AAWA 4IRZA 3UJTL 1U8HB 5IB5A 3VFSA 2B14A 3STBA 4KAQL 2X6UA 2O72A 4GH7B 3WUWA 2WZ0A 1QP1A 2ZPKH 2CLVA 5TPWH 1BX2B 5CN2A 2NY5C 3HI5H 1UB6A 4JANA 2R2HB 3C5ZB 3F7VA 1RZQA 3ZE0B 1FYTA 4L8CB 1LD9A 3K3QA 4EN3A 2X4RB 4XXDA 5E6UB 1VACA 1QVOA 1YPZA 1PDKA 1IC4H 4NOBA 1N8OE 2FLMA 3ORJA 2JI2A 5IJCC 2NPLX 4NENA 4YHML 4G7YH 1BFOA 1A7PL 5I1DB 5F2FA 4BWWA 4QOKA 5DUPH 1AO7B 4HMCA 5A1AA 3DWTA 1H5BB 4QNPF 4YLCA 3BC9A 1NMCC 1U3HD 2GY5A 3QSKB 4KDWA 5DHEA 5FO8A 4GG6F 4UM8A 3SY0B 1NEUA 1H9VA 2XQYA 1W2KT 1MFCL 2O5XL 4XC3H 4NQCE 3F6JA 4PAZA 3WKML 3VGAC 4U1LA 2MTPA 5ICXA 1E42A 5ICZB 2ADJB 4YDIL 4P9HH 4PWKA 2EEDA 1DQKA 1Y6MR 2BXYA 2OMZB 4HXAH 3B9KB 4R6UA 2NR6C 1SBSH 1HIML 3MRHA 4Z5RB 2GQHA 1KJ2B 4PY7A 3BPNB 4QRFA 4DCQB 1GIGL 5DT1L 1J12A 2A83A 3MRBA 4XNBA 1UWXK 1WTLA 3BQVA 1TVBB 3HHMA 2Q10A 4QRUA 1KENL 3ROLA 2F7IA 4MJIA 3QFJE 3NIGE 5EDXA 2MH4A 4R7LA 3UZQB 1BGXL 4XO5A 3TA3B 4IBVA 3CSBA 3ZDYF 3E2HC 1QA9A 3CSYB 4X6CB 3F83A 2YPLA 1N2RB 3PRZA 5T1LD 4A7UA 4PJ8D 2A0LD 5I8KL 1J5HA 1I3UA 4P5MB 5DJAA 1F3JB 4APXB 3QP3A 5GS1A 4GKNB 4JFPA 3RWJB 1JF1A 3ROOB 4B9PA 1TQBB 1INEL 1FSKC 2WP3O 4JM0A 1JZJA 4R5XA 2Y3AA 3T8XB 1SPDA 3ZUCA 2HTKD 3Q5YA 4PRHD 2BNUB 3VM7A 1P7QD 1MG3C 1Y6KR 5K9QI 3U0PA 1T22A 4IDJH 1A6VL 3HE7B 1NUFA 3GHEH 5HDBB 5EBWA 3GMQA 2QSCH 5D7JC 4XTRC 1MHCA 5I1CH 3FFOA 4A2HA 4FCHA 4TUJA 3MCYA 3PV7A 3H2QA 1RQ5A 1JDCA 2A7BA 1F8TH 1AXSB 2I24N 2K4AA 4M48L 1I8IA 3OLEA 2OMBA 3VB8A 5MEPA 2I85A 4NJAL 5AZ2H 2F74B 4DZBA 5E0QA 3SDDB 1TR7A 4L3EB 1S7QB 3QJOA 4K4KA 4LL4A 4BGLA 3TT3H 2WVVB 2GB2A 4X50A 4IOIA 4K23L 4J27A 1JD7A 5IHWA 3FCUB 3RUGA 1ITBB 1KIRA 25C8L 3ZL2A 1L9SA 1DQQA 4A63A 3LQZB 3NPSB 1RZFL 2NY0C 1KC5H 3LXCA 3BP7A 1ROCA 1BIHA 1BF2A 1OAKH 2ZOUA 3GJFH 4L9LA 3HI6L 3U83A 1EAPB 1KTKE 3MRKA 3SGKC 3CFBA 5AW7B 3U4EA 4ZFOA 2B3RA 3LY6A 4RGMC 3FO1A 1F90H 1L7IH 3MV9D 2FJHA 1EZUA 3NSYA 4FS0A 2D9QB 3FPXA 1K8DB 4AGQA 1IFHH 35C8H 5I16A 3ZO9A 3A3YB 4UAOC 1S7TB 2BY3A 4DP9X 3V4VB 4EEEA 2W81C 4MSWA 2QGBA 3QUML 4LLDA 2VXUL 6CGTA 4MCYA 3TO4A 3ML8A 3IF1A 5KSBF 1YEKL 2BOBA 4H7VA 1HAWA 2VAJA 3SPVA 4JG0H 3S34L 1FL5A 2ATKA 2F19L 4YDMA 2F1EA 2MHAA 4YE4L 3BWZA 3BJ91 4ANVA 5B1AB 1W0WA 3N43B 2OMNA 3VXSD 4A1RA 3VH8G 1FVEB 2DN7A 2DH2A 2QQQA 5EUOB 1NDGA 4FEMA 5DK2B 1KJVA 3UABA 2COVD 5B38B 3N85L 2Q20A 1KYDA 2IPKB 4OI8A 3LN9A 1A47A 3O2DH 3EJYD 1YEHL 2H2PC 1A9BA 3GBLA 3V0WH 2AEQH 2EECA 2X9WA 4Z7UA 1EAOA 4LSRH 3POCA 4CMMB 5IFAL 4NB7A 5EU6B 1IEBA 2YQBA 1HKLL 1KV7A 1YCSA 5GGVY 4G9FA 3U1QA 2H7WA 2JB6B 3VGFA 1UASA 1SUJA 1YUHA 4RFOH 4GMSH 1KY7A 2VZ3A 1YEJL 1YAZA 2XLLA 5HYJD 3D12B 5CKGA 3DX2A 3O6FB 3TBTB 4RA0C 4JO1H 1RK0B 1M53A 1L3NA 4X5RA 1XV8A 3MFGB 5D5MA 6TAAA 1QWNA 1RUPH 1ZIBA 3BXNA 1BAFH 4MAZA 1BWWA 1YMMD 1C1EH 3GMOA 4Y5XC 1U42A 3DYPA 4JFDA 3L8QA 4GB9A 3BRGC 3O0RH 1FVDA 1EHKB 3ZBMA 1FRGH 3SE9H 4XN9A 4AV4A 1HINL 4NSKA 4B50A 4R97B 3QRGL 3GMNA 2OMWA 1MCKA 3PWNB 4XCYB 1TVDA 2YWZA 5CEXB 2NY6D 1S8DA 3NCMA 3OXRA 4TNGA 3TZVA 3DDFA 5HYQA 1OGTB 5CN3A 1NCNA 1DBJL 5JDSB 3QCTH 5FM5O 5H37A 3CC1A 3VNYA 1ZLUH 1O6SB 3RL1A 2A9NH 1WISA 4JDZB 1E5ZA 2JK5B 5D7IB 3R19A 5GRWA 3GMLB 1E2VA 3LS4H 5GS0C 3OAZH 5KVMC 3PWPA 4HETA 3IKCA 4HK3J 4QXUL 3BQUB 3LRKA 3PIQB 4HCGA 4YXKL 2XWJB 3BUTA 3W82A 3ESUF 2ICWA 2EXWC 2A1WH 4K5MA 5IOPB 1F4YH 2KZKA 2XG5A 4ICWA 4R0LA 2V2TA 3L2NA 3ZDXE 4R7DB 3Q7JA 3FNKA 4E42A 5DYFA 3F7RA 5DHYA 4YSQA 1M2VA 1Q9OB 4MXQC 2COQA 4MWFB 5F93C 4KKCC 3JTTB 2Q0ZX 2LU7A 2WD0A 2QPFA 5C0JB 2YC1A 5ESAA 4F7PB 1J1XL 3I2CL 4WY7L 2R1WA 1KBVA 1CDIA 4LCUA 4U6HB 1VKXA 3CQPA 5GHWH 1CD8A 4TSCL 1I8LA 2XKNB 3FB8B 1TU2A 5DC2A 5IQ9A 1TO5A 3FZUD 3ULVC 5E9AA 1JGDB 1L9PA 3OKDA 4N2CA 1MCDA 1O9WA 2QGDA 1FDLH 3EG9B 3ZR6A 3NJFA 4AT6A 3MCKB 5ECJE 2V3EA 3V0GA 2R8SH 3C5JA 5CEZD 1QBAA 2WWKT 3KLLA 4OCRH 1U30A 4ZG1A 1IGTB 2V9TA 1JCVA 3GXNA 3HB3C 4JGJA 4JFFD 4Z1PA 4PTTA 1T5WB 1DUZB 1R3HB 4KQ0A 4UQDA 1YEGH 2NTSP 2JKWA 1SLUA 4L1TA 2J7LA 2G3NA 2P8MA 1P4LB 4O02L 2DBLL 1AI1L 5A16A 3TBYB 3QHFL 1JVKA 1YEFH 3KPRB 4B27A 4PM1A 5AYQA 4TOYL 4PJ7B 4LIQL 3ARTA 2HRLA 5D1XD 2K9FB 4DN3L 4XWOD 3WEOA 3BT0A 4PV8B 5DHDA 5T3ZL 4LGRB 4JFZL 4XNUH 2E7CA 2VWEC 2OBGA 1XBRA 1F6LL 2ESVA 2PABA 1Q9LB 5DD1L 4YHLL 4Y5VA 2WQRA 3AACA 2Q3XA 5C6PB 2P52A 4K3EL 4UWQB 1A4CA 1T2QL 4HCRA 3BPCA 5FYKU 3GSXA 3NCXA 5J5EA 5IY5B 3U4BL 2LR4A 2NZ1A 3F2LA 1U8OA 5MHSD 2B39A 4CJ1A 1GYUA 4XN5A 4JHBA 2YAPA 4JKLA 1CLVA 1JGUH 2AEPH 4HLEA 3IJHB 4R26H 5K59F 2HJFA 3VXUA 1QPPA 1W8EA 2VTFA 4BD4A 4KK9D 5IOKA 4PRPE 3QORD 4JO8A 3F7QA 1J9SA 2QHLA 1ZANH 1TETL 2Z92B 2HAZA 4KKBC 1IEAB 1NANH 2WYHA 3BIAX 4PRAA 5JA9A 1SYSB 5LNEA 3SDAA 5I73C 1RZ7L 2DIJA 5I6LA 1AFVH 5JR1L 2HG5A 3BDYL 3BP4A 4Q52A 4S1SH 2EILB 5HDWA 1L6XA 3TIDB 4GG6A 3FB5B 4UTBL 1JZEA 3PQYE 4U1SA 3GJEA 1T21B 3QPQD 3S4SA 2C9VA 3ULVF 1TTGA 2B15A 1CD9B 4PV9B 1OT4A 1FA4A 4NQED 3E6HA 3TEZA 4LGPB 2EH7H 2XCMC 5AW6B 1T04B 1AXTH 1IKNA 4LNVA 4RLDA 4XVOA 4L8SA 1SF5A 1T5XB 2DQUL 4QHNA 3X1EA 5BOPA 1PZ5A 4IIZA 4KXZI 4XPAL 3D4CA 4ZW5A 3KHOA 5T3XL 1HU8A 2A6IA 5EA0L 3WFDL 1EFXB 3T6WA 1JHLL 3FTSA 3MGOA 1UOKA 4JPWH 5ENWB 3WD5H 1NCCH 1EV2E 3FT3A 3F12A 4S1QH 2GJZB 4M61A 4LLWB 4WV1B 3QAQA 3ZRSA 4CC0A 4DEUA 4CVZA 4RMSA 4XOEA 4IBTA 2JJSC 1LMIA 2J21A 3TU6A 4M1GH 2UXGA 3MOAH 4YZFE 1WZ1H 2PYED 4NN6C 3N3EA 3GZOA 3CHPA 2X3AA 1DANT 3K1KC 4JZNA 4ZO9A 5TFSL 3WKYA 5L9DL 2QVFB 3P0VL 4PGZA 2CZNA 3MLVL 4AUJA 3HZKA 4Y2DD 3BEWB 3RTLA 4HG4K 3MBXL 4IM8A 1LP9B 5DUBA 2H5UA 2VXQA 4R7NB 3SIKA 5ITBH 5DZVA 4ODXB 3HN5A 2QKIC 3MFFA 3IRZA 4U3XA 4N0YH 2X89A 3WIFB 4KKLC 3SOBL 2J5LC 5FB8B 3OR6A 2FJGA 5D1QB 3V4PL 2X4OB 1SOSA 2K70A 2UV3A 5E5MB 1BCIA 3GI9H 4FQ2L 1V27A 1CGTA 4FTVE 1UWFA 1PG7L 4OD1L 4U6TA 1WCQA 1NAMH 3RWFB 1OARL 3WLBA 5H35B 1ID2A 4P0DA 1JV5B 1NBCA 3QVAA 1NM9A 4NHUB 4L5FL 3MRJA 1NCIA 3FTGB 5FHAH 1KXTA 4KX9A 5EOCL 4WAFA 4ZSOA 4PBVC 4FNLH 3BOVA 2FB4H 4J3BA 3HI1B 3WTUA 2YQ3A 4NCC1 5D2LA 1CU4L 2RHEA 3CFDA 4NQSB 5B38G 1ORSB 3KWVA 2Y6SC 5LNGA 2CLRB 4AI7A 5K33A 2O61B 4N25A 4PWJA 1UB5A 2A74B 5DRZA 2FHFA 4AG4H 5AOLA 5BZXA 1LK3H 3B5GA 5I24A 1MFAL 3VQ2C 1SNRA 3EKCA 3LNEA 1SLVA 3BVWA 3MLZL 2YA2A 4YUEL 2V9RA 3LKNA 1PEZA 4N90D 4P9ML 3JV0A 4Z7OF 1QHQA 1AAJA 2W80C 1P84K 3CJJA 1HNGA 3OB0K 3B2UD 3MXWH 1YLBB 4QCIB 3MV7E 3MBEC 2HFEA 1KG0A 2UZXA 5ICUA 5FKAB 1NDMA 2Y7SA 3WO3B 1AP2B 3N1GC 3NEOA 3BLKA 1OAUL 3WS6C 3K8MA 3H6AA 5KOMC 5BXFA 1EUTA 2DEXX 4S2SB 4YDLB 5FGBC 2P26A 2P24A 5BJTB 5HHQA 4LSQL 5CF3A 4XVJH 4J3OG 4PJGB 4BXVA 1FLRH 1EGJH 5BVPH 2OR9H 2VERA 1U95A 2EYTB 2R4RH 1GZHA 2WANA 3QZMA 1QABA 5EIIG 3TLRA 1T0PB 1WFMA 1T5KA 3UROR 1QWUA 3IDNB 3BUIA 4KTDL 2VB5A 4UT6L 4OM1H 3VG0H 4P2RB 1TJXA 4I1NB 4EUPA 1F3DH 3QDMB 2R1XA 4TTDC 2UXFA 4P4KC 2HB0A 2ZYHA 3BAIA 3HC4H 4Z7QF 4GLRH 5FYJE 4PJDB 1S7WA 3HVDA 1VGKA 4OTXH 5DJDB 2WXJA 4KRPB 2X4QA 5F3BA 3HS9A 5GRXG 1WAEA 1S9XB 3DYOA 4HK0B 5D8JH 3C12A 2IOOA 3K2UH 1JGLH 1EEZA 4X6DB 5CD5C 3ZKND 3FBKA 3IFOA 4QXWA 3O6ML 4PGBB 1QUNB 4EAEA 1BAWA 3HRZB 1JZ4A 2VDQH 1FZMB 2H6UA 2Y69B 3FO9A 1JDDA 2QR0B 2GTZB 1AVAA 5J06A 4RWYH 3IS0X 3QEHA 1ULVA 2WKLA 1S6NA 3P4MB 1Z5LA 3ZE1E 3BW9A 3WEXA 1KXQA 4Z7NB 4JDVB 3T3MB 4HIHA 1CFVH 3GNML 4U1KB 4DEPB 3Q48A 4OGXL 3DSNB 4NPYB 4G6JH 4I85A 2DQFA 3GIVB 3D0AA 1CVSC 4L29A 4PRIE 4KZCA 4ZFFB 4OM0H 4YE0A 5LVEA 4UZGA 4LEOB 2VDQB 1KB5H 4MKMA 2DOCA 1NOFA 3SSGA 3MNWB 3UJJH 1HWGB 1QFWM 3QG6B 3B56A 5FKPA 3FO0H 3JVGC 4J4PA 2OTPA 2QQKH 3T08A 1TQSA 3IFPB 4N86A 5FV1L 2OL3L 2SEBA 1XIWC 3SZ6A 5DLLA 1DJIA 2NXZB 3LIUA 3X17A 5TTRA 2YRBA 4OCWL 4LSUH 2AJXL 2Y06H 4PJ9D 3ZE0E 4MA3A 4HGMA 1M2OA 1T1YB 5D1ZD 3U9PL 3QJFB 4QXTB 5TE7H 5KBNC 2CRYA 4KQ4H 1W16A 4MNHB 5AW2B 2OXGB 4YXLL 2OTUA 1KB5B 2EIZB 2O6PA 4GXUM 4E9QA 1D5MA 4QAWA 1ZGLA 4D9RE 1N8ZB 4UTAH 1NGWA 2AJYL 1VZIA 3P0YL 5IK3B 3LZPA 1AO7E 2OP4L 4UDUB 3K71A 1WFTA 1M3JA 4W81A 4W4OC 3RWIA 3QUHA 1SJVA 3LEYH 3L6FA 5SX4H 2ZP8A 2DQHL 5F9OH 3ZSTA 1AE6H 5C0AB 4CGTA 2XWEA 4FXGC 3BT2H 5L6YH 1SDDA 1Z9PA 3DX7A 5INDB 1QBBA 4QRPD 3UC0H 2XXMB 4Q0XL 3VWKB 5TDOA 4G43B 1KGUA 5E2TL 4EQ3A 3ABMB 5ICYB 4HULB 5HYSB 4IRJC 1DLHA 2K6YA 3MRQB 3PHOB 5F97E 1MRDH 1HDMB 2YUXA 1FNEA 5AKSA 1ND0A 2OMTB 2WKOA 3MV8D 1EAJA 4P23D 1GYWA 4KMLB 3FQTA 4LMQE 3FQUA 2VDPH 2OL3B 5E2JA 1GGYA 5EHFA 1U0QA 3RBSA 3GXUB 2X6CA 4XCCH 1EFQA 1Z6JT 5CU9A 4HJGB 1HILB 3RZCC 2XWBA 3V0IA 4FABL 3FB7A 3MJ8B 4Z7VA 1JSYA 5MENE 4LHUG 3G7TA 1SOXA 2AXFA 2VC2B 2N56A 4D0DA 5IW1A 4DOHB 1I1AC 3K2MC 2P5EA 4FYQA 1M6OA 3EGSB 4W9HC 1TZGH 2X5PA 5F71A 2NNRA 3DVGA 4JFHD 2VDPB 3THML 1WUZA 4F57H 3O4LA 1GYVA 1UURA 3WIIH 3VACA 3IDUA 2XA8L 3GINA 3JV4B 2ZOOA 3GXPA 4G5ZH 4PY8J 4YBHA 5HDBE 4PJHE 2R2CA 4KNUA 5HI3C 1G1CA 4G80A 4RAHA 4HPOH 1YECH 4HYTB 5CZXD 1TT6A 3KG5A 5LCVA 3I3BA 1ZWIB 1P2CA 3QDAA 2QSVA 2XRAL 3VXMB 2V33A 5D71H 3VXOB 3S2CA 2DH3A 1SJEA 5KJ7E 1KN4L 3GXTA 2CR6A 2WINB 3UYRH 5EBLA 3OGCA 3WEAA 5C70A 4HZ1A 5CZVL 2PTTB 4ICXA 4F7EA 1CQKA 1I9JH 1XH0A 2AV7A 4L3EE 4M7LH 4Y0GA 3RURA 2BVQA 5E08L 2XQBL 5K1VA 1QFHA 3CLFL 2XNAB 4HH8A 2NY2C 1PLAA 3U2JA 1WGOA 1TTBA 4RETB 2AI0L 3FBQA 4QTHB 5ACZA 4XP9H 5HI5D 3GSWB 5F9JA 3EAKA 4FG6D 1HZLA 5J0BA 1G5GA 1QLFA 4OV6F 1M71A 4GNKB 4AQAA 4O51A 5F88B 3BYYA 4ADIA 3O8XB 1HH9A 2Y2TA 4AGOA 1CF8H 1FNFA 1LEIB 2ZJSL 5IBUB 1VJSA 3GB7A 4NQCD 4WHTA 4X6FB 3LSOB 3T6XA 4ZPVB 4CL7A 4LLMA 1CQYA 2XV0A 15C8L 4OIFA 3FO2B 5JXEC 3FT4A 1BFVL 3AXHA 3HPLB 4N2IA 2PKDA 4PBWD 3RWEB 3SO3B 2J2ZA 5ESQB 1KYFA 4MLIA 1GGCH 1N9PA 2C1OA 5K9OB 1FNLA 1Q4NX 1M7DB 2H9GB 4Z3FA 5I23A 1AQDA 2ADIA 1DDHA 1NCOA 3FFCA 1C8PA 1LO0H 1A2YA 4IGBA 3JZ7A 4Y16D 4TRPH 2EXYD 5T1KA 3QQ9C 5EUOE 3SPCA 1MVUA 1TJGH 2X2HA 2NY4D 1DVFB 1DLFH 1JZGA 4YWGL 1GZQB 3FOMB 2DW5A 3MRNB 3RTQD 1A3RL 5DZLA 3UBXG 2WZAA 2OK0H 1U8KB 3VDCA 4P57B 4AH2B 1I9IH 1X5LA 4YO0A 3U1SL 1WZKA 3IMRA 3SKNB 4PS7A 4FLQA 4M1DL 1N6QH 5I1GL 5EU6E 4XMKH 3SBWA 1ES0A 1YEDA 2P80D 1I1FB 4OJDH 4S0SD 1MIMH 4LKXA 4ZMVA 3KPSE 3DVFA 2XQ0A 3CIQA 1BQLL 2PXYA 5AD0B 4YGAB 3ML9A 4MMYB 1RZKC 4YXHH 2BNQD 3ATEA 1A0QH 3E7JA 5C0BA 3UTQA 4PJAB 4R2GB 5F3HA 2WN2A 3U48A 3B9EA 1GGTA 2APVA 2V0AA 5KSAA 1HZHL 2G9HB 1DVTA 4OFPA 3LD8C 1SLWA 2X7LA 2YKLH 5MERB 1HHIB 1PAZA 4YLQT 4BSWA 4BUGA 5AW1B 1B88A 5JOEA 4AXWA 2DBJA 3FU3A 3ZYZA 1XB3A 2Q7AA 3D9AH 1INDL 2GAZB 4JPSA 4P2QE 1ZA3B 2WM0A 4BZ1H 3M8OH 3D6GA 4HP5A 2JVUA 4PJ5B 3APFA 4IDLA 2YO3A 2VDKL 5EC1B 1V7ML 4NC1E 1RU9L 3N44F 4L3CB 2CBPA 3QI9C 4I0PC 3BPLB 3DIFB 2EDRA 3TJEL 5D7IE 3IVKB 4KVPA 4N0FB 4FI7A 4IBYA 3HBPA 1ZHBA 4XMLL 4OQTL 1GS8A 5I1EH 1NGQH 1YUKB 4I48B 5TK2A 1A4JA 2VW7A 5B1JA 1JGVL 2VQ1B 2ZYIA 1DEEA 1HT6A 4OFDA 5T1MB 4HSQA 1AGCB 3VMPA 2QKIA 4OFIA 1YEIH 4NHCH 3ES6A 3B9VA 2I7SA 2YD4A 3I9IA 4U0RC 4FNPA 1KWKA 2RH0A 3I9AA 1T4KA 2BRRH 3VFNA 4Y4HB 2GCYA 5CJBA 4YSDA 1XL6A 3H85A 1G7HB 5FF6A 3D2UA 4MDRA 4HEPG 3KJ4B 2WQAA 2EH8L 1GC1C 1R46A 1U91A 3CFJB 5EV7A 1FHNA 4GRLD 4YFEA 1XWVA 3LH9A 1VFBA 4KK5D 4X9FA 2VSCA 2V7NA 3MGTB 4FFVD 3VE0B 2VDKB 2W88A 5ETUA 2ZKHH 4HWZB 3HCVA 3EW3B 1I7RB 2X6AA 4F58H 1XH1A 1IO4C 4ETYA 1VAHA 4XMXA 4OZ4B 1PZBA 2EKJA 5IP4A 2Y22A 5GGTA 2I9LA 3T6VA 5MI0C 4PJ7E 3O2WH 5GZNC 1QHPA 3REWA 1X5JA 3EJTA 5DFTA 2V5SA 4DUXA 2NX5A 2DKSA 3IDXH 5CGYD 1SJHB 4IK6A 3OHXA 5GSVB 1CIUA 1FV1B 3QJHA 1O0VA 3BRDA 1U4FA 2IDSA 2VSMB 4N6RB 1LMKA 5C7ZA 5SWZE 3R8QA 3MBEA 3GO1H 4AEEA 2W65B 3MLUH 3WS6A 3D25A 4ERSL 2HRPL 5DO8A 3LAFA 4H25B 2EDYA 5F8QC 5AVWB 4YDVA 4MHHG 1TZOA 4X9GA 3RPBA 1ODUA 4QJ5B 1PY4A 3OR7B 2Y3NA 3RU8H 3WXVH 2VZVA 2IIJA 5EMYA 3FH5A 1R3JA 1TITA 2N7SA 5HVHC 12E8H 3E8UH 3INUH 5HGAA 4ANUA 3KL0A 4R4FL 4MMZC 4FQCH 2VN6A 3ZDZE 1MCOL 4XVUD 2J6EH 3VFMB 5T5NF 3GZQA 3NZSA 4UYQA 1AHKA 5K39B 4YFDB 5CMAA 1BMZA 5HYSG 3LNHA 4XOBA 2ZOWA 4CW1B 4P4KA 2XWDA 1DN0B 1LNUB 1M7IA 3S9DB 2VAAB 4FFYL 3DURB 5T3ZE 4AVIA 1H3PH 1C16A 4JPVL 3K91A 1CGXA 5FCUL 1OM3H 4N85A 5BMFH 1PLBA 4X8GA 4XBMA 2YD8A 3ZKSD 2OAAA 2YD3A 3L3OB 2HT2D 5GRZA 2FR4A 3ECQA 2FBRA 2VLRB 4M3JA 2CPUA 2QGCA 2Q5BA 1CICD 3BP5B 4UOW1 1JXDA 4IRZL 3CFKB 3RDTC 3JTBA 3AM8A 4N1CA 3ARGD 2ZG3A 4UIKL 3STLB 1GCFA 4GAYB 5TJWK 4DZ8B 3ZMEA 2FGZA 5DMKA 2APXA 1W0VA 2FWOA 3BO8A 3QFDA 2DF3A 2FJFB 2WBJB 4HGKC 5KYXA 3QJTB 1KTBA 1O7VA 2X4SA 3MN8A 3PWVA 1DBBL 5EZIL 4HWUA 5E4EC 1A6WL 4L4TB 4ZAKA 4JBSA 1B0GB 1JV2B 1G9MH 1U41A 3QQNA 2VDOL 5EPMB 3ARWA 1TSHA 2ADGA 3JWOL 3NIDB 5C0NC 4EIBA 1RJYB 3BSZA 4NO3B 1QFWL 3VXNB 1Z5YD 3JVGA 4M9PA 4MAUL 2VM9A 1M57B 2VXSL 5I5IA 3T3PB 3RGVA 4WFED 3UTTE 3U4AA 4G2AA 4KY1H 4DVBA 1XIWA 3IPEA 4LLAA 3HIZA 3QE5A 2WXFA 3LN5A 1DR9A 2NY1C 2WTPA 4Y1TA 3FN3A 3A6OA 2JCCF 3DX6B 4KX7A 4LAQL 4EQ2A 4BKLA 1LP9E 1KTCA 1RJLA 1J8HB 4PREB 3L95A 1CE1H 1G6RL 3P30L 4UBDC 2JIXA 2NUTB 1BD2D 5KW9L 1GMIA 2X6MA 5IB5B 2FO4A 3VFSB 3H3KA 3S35H 5T3XE 4KMTL 4ZD3H 3WUWB 1LO3L 2CLVB 5D1QE 1MIEL 1SRDA 3N5AA 4V11A 5E2VL 1UB6B 3CXDH 4JANB 2XWXA 2D31A 2CCLA 2C8NA 3HAEH 3F7VB 1DVQA 4WJ5A 1FYTB 3UBGA 1LD9B 2BMKA 3NFPA 4EN3B 2ODHA 2L7QA 4XXDB 2XYBA 1VACB 1QVOB 1YPZB 5J3HD 1PDKB 4JRXA 1GH7A 1RZJC 4Y4FA 4KGJA 3P54A 4B6ZA 3IGFA 2EIEA 3D06A 3PQYD 1ETZA 4NENB 2VDOB 1BFOB 4NZRL 3W0WA 1HX0A 4KUCD 4RDQF 5EU7C 4TSAH 3HG4A 4QEGA 4OUOA 1PLCA 2BFGA 4QOKB 4JRLA 5D9SA 5HI4C 5LGYA 4NO5A 1BFSA 2GUOA 4IRJA 4BWUA 1ZVSA 3VFRA 1MSPA 4HLJA 4N0CC 5FO8B 1WGVA 3D5OF 2Z8RA 1AGEA 4UM8B 4ZXBA 1LE5A 4PU2A 1YEEL 3HNTL 1YC7A 2FX8H 4U1LB 5ICXB 3EF7A 1DP0A 3TPUA 2Y7NA 3KXFA 5AZEL 2ZCKH 3QZBA 4ACTA 1F97A 1T1ZA 2WLYA 3MRHB 3I9GL 3RZCA 2F7QA 2WCPA 5DEJA 3ABZA 4PY7B 3GRGA 4JHZA 4Z8FH 3IDYC 5HJ3A 3MRBB 2A83B 5HHPA 5DR5H 1KUMA 4HX1A 1MNNA 3LIZA 3N6YA 4QRUB 4Z7AA 3ROLB 3L3JA 4EDXA 2ZKWA 4MJIB 3VO0A 4F9PC 4BZ2A 3TH4T 4N2OA 1NFKA 2VLJD 3LJ3A 1FYHB 2EVHA 4LMQI 4E9TA 2P4AB 2E6JA 1MRCL 1QA9B 3T2NH 5KTEL 3WIAA 2AJVH 2YPLB 2DQJL 3F85A 4NPKA 4P46C 2EAEA 5EEXA 5FC9A 2ZT9C 4FQXD 4N2KA 1CF1A 5C0CE 5DJAB 1GYAA 4PJGE 5GS1B 4PJXA 4JFPB 1JF1B 4I13B 4MXWH 3FC8A 5I74B 5I71C 3DGGA 3AXIA 3S8FB 3BKMH 3EZJB 1OM9A 4K0OA 1CYGA 5AW0B 3TBBA 2OCJA 2VN7A 2DIAA 1E7VA 4HUCA 7FABL 4KNQA 3U0PB 3NIGF 2FIKA 4JREB 5EBWB 1H3XA 3T6QC 3GMQB 4A2EA 4HWEL 2J6WA 1MHCB 1E65A 2NSMA 4XI5C 3T0EA