1XBDA

Internal xylan binding domain from cellulomonas fimi xylanase d, nmr, 5 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
87
structure length
87
Chain Sequence
TGCSVTATRAEEWSDRFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLANASE D
publication title A family IIb xylan-binding domain has a similar secondary structure to a homologous family IIa cellulose-binding domain but different ligand specificity.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 6
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xbdA00
2CZNA 3NDYE 1E5CA 1C7TA 5DHEA 1XBDA 2CWRA 1QBAA 1HEHC 1QBBA 3NDZE 1E5BA 2XBDA 5DHDA 1HEJC 1C7SA 2RTTA 1EXHA 1EXGA
chains in the Genus database with same CATH superfamily
1KSRA 5GSRB 5KW9H 3B8SA 3FONB 4XNYH 3CZUB 3BZ4B 2VCOA 2VLJD 3H56A 1VA9A 2HVKA 1SZNA 3KXFE 2BJMH 4N5UA 3M7OA 4KH2A 1TMQA 3MLZL 4O2FA 4NJ9L 4X80H 1QEWA 2Y36H 1NEUA 1G1OA 1GOHA 5IMMB 1A2YA 1M42A 1LO0H 4OLXH 4ONHA 3HRZC 3IWVA 4RSVA 5TH2B 2XRAL 4B9GA 4G8EA 3TEXA 2RHEA 2V2XA 2VIRA 1KJVB 4S0TD 3AREC 3QUZD 2IG2L 1EBAA 1X5KA 1RVFH 2BNQA 5I19H 3TURA 4P23D 3BPLB 4GQQA 2O26U 3ASNB 4PCKA 3FYIB 4K9JA 2F54A 4POUB 5IK3B 1ZXKA 2VDLH 3I3DA 4JHUA 2BNRE 3CTTA 4U7SA 5F89A 3C8KB 4NN7B 1QR1A 4Z23A 1HCYA 1F1GA 1MH5B 3AY4A 4N9GA 3APDA 4TUOB 3N0PB 4U6VL 2OCJA 4NN6B 3TYGH 1I1FB 3KLKA 1HOCB 4Q9RL 4PH8A 1OTUC 4PCTA 1NCBH 4WO4A 2DI9A 5C0JA 1NSNH 4Y19B 5KWYC 2QQLL 3CCHB 2VDQL 3BGAA 3GBML 4FL4C 4GFTB 2H3NB 4Y88A 5KBKA 2JI3A 4XVOA 1MW1A 1XGRB 4G6ML 2NNFA 3TBVA 1NAMB 5GZOD 2XPGB 3RNQA 2AZUA 1HILB 3ULSA 1DVFB 3I6LE 4NWTL 3HRPA 4HYTB 4B0MB 4DO4A 1Z5YD 3DLQR 1UA3A 4NUQA 1LP9F 2HFGH 3QC5X 1ZIBA 1CGXA 1P6FA 3DUUB 2J8UE 1CDCA 3DIDA 3ZKSD 4A2EA 1H5BC 5EIIB 5EF0A 2HVJB 1ZVSB 2K0RA 3JWDC 3D25A 4MHHI 1QZNA 1VPOL 5GIRA 5KJ4A 1PKQB 4ELME 5DS2A 2C7UB 1P69B 2D03H 2OZ4H 2PWHA 4N8CH 5D6CA 3ZSSA 4W1TA 3IU3B 4JY5H 3NIGB 4G43A 3NEOA 3BW9A 1T1WA 1TLKA 4WWKB 2IANA 5INDB 3VO0A 4PPTA 5EEXA 3JSSA 4ODWB 4EBQH 2FL5B 4TSCH 4X98B 5FKPB 3ML8A 3BP4A 1L9PA 1F41A 1CR9H 1L9OA 1XEDA 2OTWA 3LHPL 2AF2A 4OY9A 2ZAIA 3KYNA 4IOIA 5DSCA 1VDGA 3V95A 3MX0B 2ADIA 4EKXA 4QHLA 1RZIA 1X5ZA 4QHNB 4KRPB 4FFZL 3MRJA 3QRLA 5E8PB 2F19H 1NBYA 5ACZB 4NQCE 4NN5B 5HJ3B 1XF1A 3CFCL 4PRID 4LXFA 1LHZA 3LKRB 4YHLL 2FQFA 5FFOA 4ZTPL 5HGBB 4BRJA 4NQDA 2AXGB 3SCMB 4M7LH 4JHWH 5GGUA 3H53A 3WIFA 5HVFB 1NCCH 2A9BA 4IBZA 3FFCA 1Q0YL 1KCRL 4FFYA 4M48L 3IKCA 1MRDH 2DD8H 4HIJA 1PZAA 5D5ME 5DHVA 3WFBH 2HJKB 3QEUA 4IQHA 4JM2B 3X13B 5JDJA 4BSWB 2ZOLA 2JKNA 2HUEA 4OM0L 4ERSL 4R4NC 3QIWA 1S7XA 2CJ3A 4FTVA 4FQHB 1UB5A 3D52A 3FTXA 1XF5B 3GJFA 5JHMA 4JREB 4PJ9B 4JK0D 3GI8H 2ARJQ 2ICEA 3IEAA 4QNPE 5BS0E 2DIAA 1JD9A 1E8YA 4MXQD 4X6FA 5KVGE 3V7AE 3SD2A 3QSKB 2V2TB 2VL5B 1ZGLP 2GSIA 2R2EA 1A6ZA 4LMQI 4NO3B 4TM9A 5CJQH 3TM6A 2CIKA 4QXVA 2A9NL 4N2BA 1BDYA 1DLFL 3HJEA 2KC0A 2H6PA 2NDGA 5FYKL 2KS0A 4K9EL 4RNRA 3AMLA 5D1XD 3HZMB 3L3GB 1OVZA 3VMOA 3HRZA 2C1PB 2P80A 4P5TB 2W94A 3GXMA 3FHQA 4NNPH 3S3PA 2LU7A 3AZUA 3AREA 2Z31C 1GPOH 3DX8A 5DK0B 4W9ZA 4LVNB 4P2YA 1BYNA 1ED3A 2E9WA 3K2MC 4XBGA 3S96B 3I75A 1EFXB 3II3A 1MRCL 1OOWA 3PWNB 3SYPA 1X5JA 3CC5A 3GFUA 3V7MA 2KPNA 5I1HH 2VXVH 2PXYB 1QO3A 4WW2C 1IC7H 3APNA 2WB7A 4LCVA 1N0LA 2KDYA 2VLKB 2WP3T 1IGIH 1UA6L 3FUDA 5AOIA 1VGKB 4LLUB 3F04A 3U7WL 4QRPD 5DTFA 4UYPA 3GZOA 1RHHA 2ATKA 2PR4L 1L0YA 2CAKA 3CSYB 3BWUF 5KUMA 3QS3A 1Q4NX 2GJ6E 4ZT1A 1N59B 3BP5B 2YQ2A 3FHAA 3QZBA 4HFUH 3ZKQD 5AALA 4IKLA 1KJ3H 4E0RA 1F4YH 5ID0A 4WEMB 3DRTA 4GINA 3PS6A 4FNSA 5D7LD 4Z8FL 1KGCD 2NY6C 4WVRA 1LK3L 5FV1L 1RIVL 5AD0B 4JN1L 5EIQA 3V0WL 1ZV5A 3VGDA 5IW6A 4G9FD 3WY2A 4Y4KD 3G5YA 1FRGL 1TJMA 1KTJA 2F8IA 3QULB 3JV4A 2DH3A 4K8RC 1DUYA 5IOKA 1ERNA 3L2LA 1CLOL 1ILSA 1GW6A 2Q3XA 4LE8A 5BV7L 1QLEB 3TPUB 3ZJAA 1E5AA 4TSBH 1ILUA 4LSSH 2FO4B 3ZE0E 1FNSL 2XX0A 3I50L 1J87A 2OBGA 1EHAA 4G7YH 4JQIH 4NSKB 4X9GA 2VW4A 5E8NA 3WKNA 4XE0A 4WUKH 4K73A 5C0IA 5IVZB 4W9JC 3P69A 4G8GD 2BP0B 5E24E 2GG1A 4TSAL 1K3IA 5JW4R 1K2DB 5CSGA 4ZXBA 3GGWA 5AKRA 1KJ2A 3STBA 4CC1A 1U33A 2YKKA 2BVQB 2ZSWA 12E8L 3GMMB 5EZPA 3DX9A 4FJ6A 4QHUA 3QG7H 1HJBC 1K85A 4I1RA 1PG7X 4P2QE 3TNNA 5KTEH 4NQED 5EBMA 3QUZB 2HJFB 3TCXA 1W6WA 2X4NA 5F7KC 2AEPL 3KYOA 3OKYA 5JHDA 2YGPA 2OMUA 1MFAL 5DRXB 3T3PE 1JOIA 3MNMA 2VXTH 3VI4B 3ZT6A 5FEBA 3F6JA 1M7DA 5J1TC 1J9SA 3KWWB 1DQTA 1B2WH 4ZFFA 5CBEA 2L7EA 3TZVD 1PSKH 1PNCA 1JGEB 3W11D 1XCWA 3EHBC 3OAUL 3GBNH 1QSFB 1HDMB 4U1IB 4LOEA 3ARDA 2ERJB 2VR9A 2WWKT 4OFYD 1NICA 5SX4I 3TBSB 3KCPB 1NCWH 4ZAKD 3H9SB 1UD8A 1NGQH 4WNJA 4Q2ZA 1KIUB 4XVSH 2J8HA 2LFGA 2DM7A 4KJYA 4KMLB 5F7EH 4DP7X 1KBKA 3PAVA 1I7TB 4NJAL 2YUXA 1H9DA 3WUWB 3WFCL 5BXFA 2J6WA 1H19A 1KXVC 4M5TA 1JRHI 5AVQB 5MEQA 1OAZL 2JB6B 5I1KL 1IAIH 2GVYA 1AXSB 5DZPA 4HPYH 3TT1H 1HSBB 4C56D 3RWHA 2FWOA 5DU7A 5E8DL 2PMZA 3FTUA 4PJ7B 3PDDA 3H8NA 3Q3GA 2ZAHA 1H8LA 4JJ5A 4HT1L 1JYNA 2BMKB 3P9LA 2GBAA 4MRBA 3ZTNL 4LNRA 5DURD 4LSDA 5D8JL 5IVXF 5FUCE 3KW8A 4Z7WB 5GGTA 1S9YB 3KJ6H 4XGZB 2G60L 5CP7A 4HCFA 2VAJA 5FC9A 4Z3TA 4JN2A 1GXEA 1WD9A 1AQ8A 4XOBA 3R18A 1R17A 2WXOA 3GK8L 4JKPL 5C6TH 2FJHB 3C5SA 5DJZB 1O5DT 4G6KH 1K72A 1DQQA 3NOIA 1FYTD 2QSCH 2WXRA 4HETA 5F6HI 4BFIB 4U3CA 1FFTB 3CJJA 3V6OE 1TNNA 3JWNE 2FR4B 2WLIA 4NKDA 4TQHA 1I7RA 2O72A 3U0TB 5FHBH 3T2LA 4FNQA 4CGTA 3GM8A 5D7IA 5CN1A 1E6OL 1NCAL 2OMXB 3ES6B 1BFTA 2V7HA 4UT9L 4F2MB 2EABA 2KBGA 2Y0SA 1PL3A 1HKLL 2ZCHH 3VGBA 4LQFL 4BFOA 1C8PA 1G43A 1HXYB 5LBSH 2NYZA 5HDQL 2VABA 4JFDA 3BP6B 4OUUB 2IQAA 4AKPA 2R1YA 1D6VL 1E9OA 3ARQA 3GJFK 2W81C 3HNVL 3ZVVA 2Q7AA 3DNKA 4K94L 3Q05A 4D0DB 5IROD 1YUHB 1F42A 4JFXA 2ISDA 5IR1A 1M9WA 4PWFA 5CEXB 1FAIH 2Z92A 3TBWB 1J9RA 1FAKT 1TTAA 1QI5A 4WI5A 2XZAH 1P84J 3P4OA 5I6XB 4UYQA 1M57B 5EO0A 2NZ9D 2VLME 4DCQA 5E08L 2YXWA 4XRCB 1JV5A 2HLFD 2APVA 1UYWH 3FO2B 2VITB 5I1EL 4P49A 4TTGA 3HFMH 5IMLB 1KY6A 4MDJB 1U91B 3WNJA 1SJHB 1SYVA 1AFVH 3RVXC 1XSJA 3X3FL 4F9PA 5D1XB 5EEZA 3E9TA 4I18B 5I17A 1NBZA 4R8WL 3RNKA 3K7UA 2YEZB 2VUKA 3QUYD 4QRQA 4B9ZA 1FC1A 1EHNA 1OAUH 2NY1D 1AP2B 4JY4B 5JLZB 1CQKA 1VCBC 3K8KA 5B1AB 2N01B 4Z5RB 2JJTC 3FN3A 3OPZL 4L8BA 3ZOAA 4NKOB 3T3MB 1UZGA 2D3NA 1MCKA 2J3SA 2J1KA 4FFVC 4AK2A 5LWYH 3DYOA 4MAYD 3EYQC 2EDMA 3FRUB 3A0OA 4GAGL 4U6YA 5D1ZA 1KIPA 4HCGA 3HR6A 3ZDXE 1MCOH 1RU9L 3SHSA 2IH3A 3QNXB 2J56A 3U6XA 4EUPG 3HC4L 4K4KA 2BSRB 3Q1EA 2ZXQA 4OKVA 4QRPB 3U25A 5ADPH 2VSMB 3V5DA 3RX7A 5D7JD 5AB9A 5C2BL 1L6ZA 2K70A 4GG6A 2J6EL 1H6FA 4X0KA 3GSOA 2VQUA 1NLDL 3ZKMD 3MV8A 4G42B 4UOZA 1E27A 1E90A 1J1XH 4HU2A 3IDGA 2YMOA 3LRKA 3G6JA 3WYRA 3OKDA 1CFMA 3LN4B 4RMBA 4LEXH 2FBJH 1EHXA 1X7TA 1TMCB 3X11B 3ZE1E 5ESAB 4DAGL 3SGDH 3LKNB 2C5DC 4G9FB 1JWUB 3A4EA 1YEKH 2LAAA 5HHOD 4GXVL 5EUOF 4OIAA 3TJHD 4OIIL 3KPPB 5B3NA 5FGCE 3K5RA 2OCCB 3OD3A 4EN3D 2ZCLH 2C3WA 1ZSDB 2OX5A 3JT2A 1UUSA 2JXMB 3HUJE 5CJOL 3RUGE 3N04A 4CMMB 1X4XA 2NQ3A 2X4UB 3MBXL 1U92A 2H6UA 4O2EA 3OF6D 2K9FB 2CUHA 3DSNA 4K7FA 2BS9A 5ESVB 4G8GB 4K23H 1OY3B 3LZNA 3OTTA 4A6YL 4MD4A 2XVGA 4YPGA 4YBQC 1O9VA 1DVQA 1FNHA 1AO7A 4H0LC 1G5AA 1UVQB 3O3DA 2DWDA 2VLLB 3CK0H 5GRJL 4P5MA 3P54A 1G7QA 5EOCH 1U8NA 4DP2X 2W5PA 1A7NL 5T1DH 2PYEA 2YC1A 3UO8B 4WUUE 4EPSA 4AX3A 3BISA 1GYWA 1MCLA 5EF3A 1YUKB 3QWOA 5I66B 3T0AA 2H47C 3VRJA 4Q9QH 3IDJA 1A3LL 5E2TH 3TZVB 2R0ZL 5I1GL 5FWRA 1AKPA 2HKHH 4BA8A 4Q6IC 3FKUS 1DBML 4UNVA 3HJ0A 2VSDA 2XV3A 3MUGA 4MNQE 4PS4L 1IVLA 4CKQA 1WZKA 1IBDA 4YX2H 2AK1L 3A6BL 5INCA 4UT7L 1A4KA 3A5VA 4NC0B 1D2PA 4Y5VA 3VE0B 3SJVD 5F44A 4L05A 5KSVB 1W0YT 4KO7A 5CLZA 3D3VA 1VFAB 1UZ8A 5EZOH 4DO5A 1HK6A 4IKKA 4OZHA 3EYSL 1Z9NA 2UXFA 2WXKA 4OBSA 4PLKC 1M9SA 1Z32X 4N0CC 2ZF8A 2HT3D 5FO7B 3O81A 5IG7B 15C8L 2G3NA 3X3GL 1YY9C 2UUDK 2MQGA 3MMEB 1BFVH 1HNGA 2EDOA 4FYSA 1YMHA 2BZ7A 2MIZA 3GKZA 1A4BA 5T1LA 5CBAA 2JJTA 1S7QB 4BZ1H 3NK4A 4EZLA 1WG3A 3MRQA 1IIKA 4JFZL 1IU1A 1QQDA 4PG9A 3OB0K 3QE5A 5DURB 1W72H 2I9TA 1YEGL 1TJGL 5IQ7L 2ZJSL 4WW1A 4NP4L 4R4BA 3SO3C 2GFBA 3PWPB 5I8KL 5F93C 2NLJB 1QBLH 1BJ8A 3EFFA 4QRFA 5ISZA 1UOKA 4KI5D 4PB0H 3VFNB 2EEDA 3B2VH 1FYTB 1FHGA 2E74C 5AYUL 2DW5A 2YR3A 5EUKA 1JGIA 2AQSA 4JG0H 1UZ6E 3N3EA 3D39D 4GRMA 5AZUA 3SDAC 3GINA 3QARA 3UBXB 4JQXA 1HZHH 1SPDA 2IDTA 3O2WH 4HKXA 2XN0A 3HR5A 2AHIA 2BY2A 3H7BB 4PV9A 2D7QA 3Q2WA 3S4SA 3ARGA 2F53B 4P9HH 3BAEL 1E5BA 4LRIC 1T3FA 2XBDA 4N0FA 1MWAH 1XF3A 4M8QA 3SKMB 5F7NC 1NDMA 5HDRA 3CDGB 2PKDA 5JDSB 1WF5A 3VFPA 2X4PA 2IQ9H 2A5UA 4JO1H 1ITCA 3G04A 3TH2T 4GQPH 4LLYB 5DMGD 2SEBA 2F61A 3ORJA 1TVBA 1QKZH 2VDQB 1AXTH 2CO2A 3C09B 4ONGL 5CINL 3VFOB 5I1LA 3TO4A 4DVBB 4M3HA 1J86A 1MXGA 4QRTB 5I1JH 5FHAL 4NHUA 4WHYG 3RIAK 3C60C 4F1ZA 1I8IA 4WFFE 3T71A 1CGYA 25C8H 2R27A 4L9LC 3MXVL 3POHA 3WFZA 1LILA 4LDLB 2AMUA 2A6JA 4FXLA 4FGMA 1I1CA 3T0ED 4PJGF 5KVDL 1NGWB 4UB0L 1SVCP 4DTGL 4AXWA 1MJ7H 3PL6D 4PJFB 1F58L 5KVFH 5L2KD 3OKMA 1T7YA 5DFWH 2ZOTA 1F86A 5DEGA 1UOWA 3QYCA 3QUYB 2Z64C 4HXAL 4KY2A 5FB8B 1IT9H 5SX5H 2BFGA 2FEJA 1TTFA 2VYRE 1IM3D 3MGTB 2NY5L 3CFBB 3MYJA 2FJFA 4I89A 4M7LT 2PCFB 1T6VN 1EIBA 3C12A 4R90L 2MCAA 1BBJA 4OCWL 3FZUD 5HHQA 4QOKE 4MAYB 2WQVA 1S7SB 2CLVB 2MPAH 2DWTA 2ZG1A 3BEWA 3EFDL 4S1DC 3F2LA 3O6LL 2QVMA 1A5FL 1U8CB 3CVHH 3RWCA 5E6SB 2AAAA 5D2NB 2IPTL 1R3KB 3C9NA 2QEJA 2XTJE 3GEFA 3C6LC 1JRHL 2X2HA 4U05A 1LDPL 2GAZA 2YK1L 1QUNB 3MQIA 4IS6B 4M9PA 2ZWSA 2HFFA 4RX4D 5CILH 3TBTB 5D1ZI 1JNNH 3AT8A 4GEIA 2YGNA 3S6CA 3SZKC 2NZIA 2I5YH 1T6BX 1S3KH 4Z7VE 4N22A 1F97A 1E4KA 4Y5XA 1KELL 5KN5A 3ZKXC 4Y1AE 2LE9A 3W5MA 1TTCA 1A1NA 2AI0H 1ZHNA 2OMYA 5LGHH 1RUMH 3HMWH 1ND0A 1URZA 5IBTL 2X4RA 2FEEI 4EQ3A 1RD6A 3I6GB 3IM1A 5C0NC 5J11C 2D0GA 4YIQB 5DI8A 4UU9B 3ISRA 4TF4A 4N3TA 2AFNA 1ZWIA 3ZMNA 4F7MB 4CBPA 1KZYA 2V9TA 2H8PA 2K78A 4UDUB 1FL6B 5MEPB 5I16A 2GK0B 2R2BA 3LIZA 1A3ZA 7PAZA 1GHFH 4XMKL 2GEEA 4JRFA 3V0GA 4K5NA 4IMLA 4F20A 5IFJA 1ZS8B 1RUKH 1B4JH 3RWJA 4C58B 2JK5B 2IAMC 4LPVA 5DUPL 4W6XB 2D4FA 4AWJC 5EBWB 1AE6L 4AJVA 3FN9A 3INUL 5AW1B 2GIXA 1NMCB 2DDQL 4DN3L 3FOLA 5FA4B 4AJ0A 2H2PD 1M1XB 1KC5H 4AUYA 4NHCL 3MROB 3V6FA 3WIIH 5ITFA 3R8QA 3UMTA 4YXHH 1G6VK 4OJEH 1UWXH 1LP9A 1BQHA 1Y7VA 2XFXB 3FSZA 3QP3A 4A37A 4D3CH 1FCGA 5DDHB 1R5WB 2D0HA 2P47B 4Y2LA 5FO9A 2EYSB 2J88H 4WHDA 3BRGC 4FFYL 1FVEA 4FQPA 4BD4A 3S8GB 3DXAD 1X9QA 3M8OH 3GXDA 3CD4A 3GO1L 3LXBA 5CCKL 3L4TA 1A6WH 2NY7L 2OSYA 3VFTA 2ZXGA 4KX7A 5L2JA 4LEEA 1OSZA 1Z3RA 3EGDB 3LCYA 3N6YA 3OGCB 3MRLA 3QJRB 3LNFA 3S5LG 4FNUA 3UCRA 1CG9B 1SHSA 2C9UA 4XP9L 5JW5A 1R5VA 3EDDA 1A7RH 3S37L 3RTQD 3NCYP 2HAZA 3C60A 3IE4A 2QADB 1X5FA 4NKIL 1MHHA 4U1LA 2NYYC 4FG0A 4LKXB 2LTQB 5EC1A 5C08D 1JF5A 3TIDB 2W9DL 3SJVB 3DJRA 4GOSA 3O45B 1OKEA 5IJCC 4NKMB 3HS0A 2XQ0A 4KGJA 1R3JB 1J8HA 2EEXA 3VI3F 1QWNA 3KR3L 1IZKA 2GT9B 3O4LE 3IU4L 2JJSA 4B9CA 4MQ7B 1MW3A 2DJSA 4RWYL 4QXWA 1R4XA 3RWEB 2AQQA 4G7SB 2BFVH 5DC2A 4LOFA 3HZVB 1N64H 3QDME 1WSST 1YEEL 2VDOL 3MNZB 2P5WD 4PFEA 4F7TB 1XD1A 2HG5B 3VFSB 4TQPA 5DHDA 5K69A 1TQTA 2NYKA 2GJZA 4G7VL 4JFED 4EIBA 4JKMA 3HVDA 1MFCL 2KT6A 4K5MA 3FQWB 4O58L 5BV7B 1RZGB 1RAMA 1AZRA 4XXDA 1UXSA 4QTHA 1R3LA 3C2SA 3EDFA 2WVVA 2NNAA 4KVPA 1BLNB 3L2NA 3A6CH 4XNAA 2OMZA 1GKOA 1E7UA 2ALAA 3CLFL 3C6LA 5C0BA 2BS8A 4OFPA 3HG2A 3UTQB 2PNDA 2ODHA 4YNYA 2I07B 2H32B 1AH1A 3X1GA 4XX1G 1DEEA 1HIMH 2Y6TE 2ZUQB 4PLJC 4A7SA 4LF3B 1IEAA 3D39B 2AERT 4WHTA 2E7DA 3ZU8A 1JNLL 3BSHA 5JUEH 1RURH 4WEBH 1QW9A 4M62L 1VEOA 4AVJA 4QLWA 3KXFA 4JKLA 2QGCA 3N44B 2EKSB 2IDFA 5MI0B 1LO5B 3RTLA 5EWIH 2XXCB 3WO4B 1LE5B 3LQZB 3MCG1 4E41A 4KY1L 4POZD 4OSUH 2FBOJ 4UIKL 3EBAA 5LJYH 1QI3A 3SKJH 4HUVA 1TJIL 2P5EE 4U2YA 4X5WA 1KBGL 4NGHL 3FF8A 1NIEA 5A16A 2J73A 3QEHB 5AW7B 3ZTEA 2EDQA 2VN7A 5FF6B 3QRGL 5CF3A 1U3HD 2YWZA 3O9WD 3ZHDA 4LLMB 4WK4B 2WW8A 4M5SA 4FMFA 5H2BB 2DQJH 1I7ZB 4JDTH 2AEQH 2YAHA 5ADOL 1DDHA 2IAMA 2E5EA 3P4NA 3TONA 5FS5A 2Q3ZA 3GMRA 1IB5A 3RJDA 4KROD 1YEJL 3AU1A 3JWOH 3GHEH 5FWQA 2UWEE 4N2HA 4R0LC 3RX9A 3II1A 4WFHD 5DJXA 2BM3A 3L3KB 3VDAA 1G7MB 2JH2A 5K9JH 3VQ1C 4PR5A 4KQ3L 3BPCB 4QRUA 4FXGC 3GXNA 4F92B 1QBMH 2X53A 2VJ0A 3FT2A 4YSOA 2YUZA 5EEYA 1KJ2L 3UJTH 3VXNB 4P5KB 3QR1A 1MCWM 1G9ML 5CZKA 3ULAB 4BKSC 4R26L 2CSPA 5L2KB 3GSQA 5CJBA 5AAPA 4XC1H 1ZKAA 4KMTH 3FO0L 2OYKA 1E6JH 3OSKA 3UPRB 1PIGA 3WS6C 1MI5A 4U1JA 1KCSH 2DWEA 4V1DE 3T4YA 3Q2CA 4AIOA 3FTSA 3T2PA 1CE1L 5DD3L 5TGBA 3PNRB 3UJIL 2XWXA 4UBDC 3C5JB 3QA3B 4RISH 2I32A 2OLDA 1S8DB 1JGUH 3FUKA 4HJGB 1G94A 1YN7A 2IOOA 5IB1A 3UG5A 2OR9L 3IAPA 3WKPA 3ULVH 1SOXA 2BZCA 2XWDA 1C12A 2UY7B 3FB6A 3H9YA 4JDVB 5GS3A 3FB8B 2RQ8A 4KQ4L 2CXKA 3RGVD 5E2VL 4HMCA 3RRQA 4UILH 1I8LC 2YXVA 1X7QB 1ZE3C 1EDYA 4KVCL 5BO1H 3WDHA 2DQHL 4JNXA 3IETB 3MXWL 4OLVL 1U3YA 2B39A 1IGYA 1YO4A 2VRKA 5AW6B 2CWRA 3MLYH 3DVIA 3N91A 4GW5A 3BAYA 3PP4L 4M6OL 5AKVA 3TV8A 4X9HA 1XIWB 2YBRA 2DWSA 4RMUA 1T83C 2CHWA 3NZHL 4FOMA 4NQCA 3KPRD 4XCFH 3PHOA 2YXMA 5L6YL 5D72L 1GVIA 3OHMB 2HT4D 4TVUA 5EO9B 4JRYA 4PJBE 3S5YA 4NRYB 3TJEH 1TOXA 4ATTA 5KVFE 4XAKE 3H7LA 3B2XA 4B9IA 4AZUA 4WJG3 3T77B 4E5XA 5D5MA 5K9OA 4L8CA 3D06A 1EUTA 4PJCE 5SWSB 1YNLL 2ZCZA 3EUUA 5C0FB 1KTDA 1SXBA 1XBDA 3TV3H 2ZICA 3DX4A 1CDIA 2PF6A 2VDKL 2CR3A 2VE6A 4Y9FA 5JR1L 3CAFA 4Y2DC 3MCKB 4ZW5A 2R1XB 2XQBH 6PCYA 1UD5A 2ZWYA 4P4KA 1C5CH 2WXLA 1ZANH 4IRSD 2H9GB 5BS0A 3D4CA 4ODXB 3M1BA 1W8EA 1RUQL 2JKLA 3OKLA 3PY9A 2YOAA 3PFQA 5E1IA 1UEMA 1SMOA 3VWKC 4H44C 5DCCA 4Q6YA 3W2DH 4PD4K 5AKTA 1T1ZB 3SBWA 3SGEI 1FO0L 2F54D 4JFQB 2MCPH 3N40F 1TQCC 1WZLA 1YMME 1UJ3C 3MNDA 3EO1A 2FE0A 3P0YL 4JGNA 1RZJH 4TPRL 3WV0A 2WHVA 2XV0A 4IGBC 4X8XA 1NC2A 5HHVL 1E4WL 1WRFA 3EJQA 3KM1A 1D5RA 1UB6B 2OULB 4GG8B 2CUIA 4MMYA 3HC0B 2DBJA 1AGFB 1PZ5A 4Z7UB 3V55A 3UZVA 3NBNA 4HIXL 3ARWA 1YQVL 2E56A 1SNRA 5I9QC 1ES0A 3HE6D 2X4QA 3DIVA 5JMRA 3US9A 3IDMA 3ARSA 4XO8A 1XV8A 2WLKA 5F70A 5C0GA 3SDYH 4OZIB 3QCVL 4JM4L 5C08B 3G6AB 3SPCA 2CK2A 1S5IH 3FQUA 2WTOA 5DFTA 2VXSL 5EZIH 3P4MA 3PGFL 4FXGA 3RYMA 1CXKA 4WV1C 2ETWA 3IGLA 5LGYA 1NH6A 4IJ3C 2ROYA 4AGOA 4F7CA 4HF5L 4PTTB 1DCEA 2WUCL 4PJEA 5ETUA 3JWNC 5HHXL 1V7MH 5DMIH 1NJ9B 2AGJH 4XMXA 2GJ6A 3OKNA 4XN5A 3NFNB 4I3GA 2EYTB 2IAND 3QO1A 1EEUA 4NUGL 1N7MH 2P5WB 3WS6A 1YPZF 4XPFH 5I8CB 4HXBL 3X12A 4URTB 5LNGA 5IF0B 5D1QC 5LGJB 3UYPB 4NUMA 1GY1A 1JYXA 3OGOE 7PCYA 4PHZA 1KENL 1OGAA 43C9B 4AV5A 4LQ1A 4Z0BL 5IJBC 3WKML 5DJAA 1FG2A 5FYLL 2HPOA 4KNUA 4JMNA 4A6YB 1I4FB 5L88H 2BPBA 3I85A 1F90L 3T2QA 2FEEL 1CDBA 1E8XA 2HKFH 2IGFH 3JTTB 4UMGA 4NQDD 5DS8B 2ZUVA 4JB9H 4AEHH 4CU8A 5KYXA 3FFCD 4D7PA 4E9YA 3Q44A 2BY3A 1JPGA 2XZZA 4H20L 4EVNA 1T83A 2R1WA 2YD0A 3ZTJH 2R0LH 5EU5A 5EA0L 3WEMA 3QZPA 2JQZA 3L3DB 3IMBA 2DLFL 4G1EB 3KYKL 3MREB 4FQQA 4DVRH 1KIQA 4L4TA 3CLEH 3OKKB 1U8OA 2K1MA 4Q7DA 3UPRA 1OGSA 1Q9KB 1TUPA 1U3HB 3VXUA 3DHMA 3LPGA 4K2UH 1FL3B 3VD2A 4MKTA 5K93A 3WXWH 3BSZH 3FC8A 1SM3H 4FQIL 1Q9WA 1Y1DA 3NEXA 4M5ZL 1BREA 2Y06H 3CFNA 4ZMVA 4Y19E 2E9IA 3OAWA 1NFDB 4KROB 4TOYL 5F1SA 4YE4L 2CJUH 4M5YL 3OPUA 1RJZA 1T4KA 2WLJA 3E6HA 3F5WA 4FQLH 4H0GA 3BPOC 1AQDB 4RFNC 2P80D 4TLUA 1U58A 3ZMRA 4HMEA 1AVAA 3V0VA 1U3JA 5HSFA 3TEWA 5LBGA 3T5WA 1OM3L 5F9OL 3O6FC 1TU2B 1MIML 4NZFA 5E6IC 3O2VH 4XZ4A 4KXCA 4PAZA 4H88H 1HCZA 1PKQE 2B5IC 4OLYL 2BSCA 4K3JH 5IHZB 3QI9C 3D7PA 3MRCA 4LHUG 3NIGE 4GMTL 3D0VA 2B1HH 4IGBA 5DWPA 2HTKD 4OT1L 4ISVA 4JMXA 1CO1A 4JFHD 1TZ8A 4QXUH 4WGKA 3RZWA 3ZGIA 5ESQA 4Q0XH 5LCVH 4KOCA 3QJSB 4C55A 4F24A 4IU3A 3W0WB 4Y16A 1NAKH 1EEYB 3W81A 2ZUYA 1MNUH 1IKOP 3P0VL 4ZFGH 4UQAA 2FJSA 2D8KA 1MFVA 2WLNA 1ONQB 2BOCB 4OZFG 4WV1A 3DV4A 1LTXA 3ZHLA 5IV2A 1MW2A 4KKAD 2DWXA 2AQNA 1HCFX 3MRHA 3SGJC 4C54A 2LVEA 2VN3A 4FABL 2V5SA 4IIQA 4ES9A 5KUKA 1KPRB 2OMWB 1SY6H 3S2AA 4XZUA 1MPAH 3FQRB 3KPRB 1IFHH 3U1PA 5D1QA 3K81A 4FZEL 3WEBA 4Y4HA 5F1NA 1DUZB 1U2HA 1X9LA 2O6FA 1PZDA 3B3IA 5EOTA 2Q7NA 1ZLVK 4WWPA 4AE0A 2Z1PA 3TN0A 3MRNA 2HVKB 2H1LM 3U83A 2X6VA 4O2FB 4HKJA 1T7XA 1ZTXL 4Y9GA 2A9AA 3HNTH 1QEWB 1JZ5A 4MJ6A 1A2YB 4XCYA 4ZXBD 4DFHA 4XOCA 3QJUB 4YGVA 4LGRB 5H37G 3MLPA 1F3DJ 1KCVL 1QFUH 1RH8A 1XTMA 3NAAH 4ONHB 2OZ4A 1LGVA 5AVTB 3BVUA 4G8EB 2V2XB 1EHKB 2VIRB 3BN9D 3ULVE 2VUOA 2R4RH 1V3LA 2CK0L 5JHDD 4TLTA 2AXWA 3GMLA 2BNQB 2FX8L 5FYJE 4BDVA 5FPIA 4WTZA 4J3XA 4JVPA 2F54B 5L4IA 4JBSA 2NOYA 2UZYA 4I5BA 3WY3A 4A2FA 5F89B 5GRWA 5IHZA 2HFEA 1WISA 3DIFA 2Q6WA 4I87A 5J0BA 1JZ7A 1QR1B 1NBVL 3BUTA 2P24A 4N9GB 3ARDD 2HWZH 2KYIA 2QV2A 2WYHA 3L81A 2HT2C 4ZNEE 2C1OA 3DJZA 1A6VH 2OP4L 5AOMA 4WO4B 4MS6A 5C0JB 5CD5C 1LM8V 3ZQXA 3NJLA 4I9WE 5DJ2A 2VLKE 3STLA 1R47A 5E99H 2FT6A 3AABA 1ZLWH 4WY7H 2Y69B 3TIEA 2GC4C 2JKRM 3TBVB 5IHUL 2Z4TA 1AQKL 4HWEL 4PJIF 2X12A 3RNQB 1QSVA 4FD0A 3ULSB 5FM4A 1XDTT 1N0XL 3FH7A 4MQTB 2R15A 2CBPA 2CDEA 1U41A 4LO9A 2V17H 4HEPA 4A7GF 3WEAA 2YD2A 3DMMC 5GIRB 3D25B 1MZZA 4JPIA 3IXTA 3MOBH 4BM7A 4E9LA 5D6CB 3LSOA 3WD5L 3KPMA 2P3YA 2PO6D 4J3OD 3LNGA 3GBEA 5BRZA 1JTTA 4KTGA 4G43B 2IBBA 2Z9TA 3BW9B 1T1WB 2DI8A 1ZCRA 2IANB 1TJHL 4IYKA 4JJOA 4D9QD 3PHSA 4ZPVA 1XQ4A 2QLVB 1WBXA 1KGXA 3BP4B 1NTDA 1QYGL 1Z5LA 2YAOA 3VXMA 2X3AA 3VB8A 2IV9A 2OTWB 1DFXA 3KYNB 4IOIB 4GSDH 4JKKA 5DSCB 5ES4B 4HCRH 5E1GA 1FGVH 4FG6C 2ADIB 2HXAA 4QHLB 1RZIB 4AYFA 4DEPB 1TCMA 2XY2A 2GABA 1QNIA 3PDOA 1V10A 5I0WA 1MEXH 4IDLA 3VXRA 3MRJB 4KV5E 1J0KA 1YSOA 2C8NA 1NBYB 3CFDA 1VFBA 3BUBA 5DXWA 1I8MA 3RHWF 1P1ZA 5GHWH 2VXUH 5M94B 5IESL 2AXFA 3CHOA 4NQDB 5GGUB 5CU9A 3FAXA 2OJZL 4WI7A 3WIFB 1SXCA 4IBVA 3FFCB 3NCMA 4AG4H 3QDAA 1MCRA 3ETBF 3IKCB 1IQWH 4GXUN 4OF6A 3SGJA 4HIJB 4CMHC 4N5ED 5DHVB 1NDGA 3QEUB 4XMUA 5CGMA 2ZOLB 1XGUA 4MB1A 5ELIA 3QIBA 5EH1A 5B8CC 2Y5QA 1JAEA 3QIWB 1S7XB 4PBVC 3J07A 4FTVB 4S1QL 4IBYA 1UB5B 3FCBA 3MLZH 3GJFB 3QHZH 4OUOA 3IAGC 2DQEL 4RQQA 3VI4E 3JXAA 1VEPA 5DF0A 4IBSA 5AVYB 3MUJA 2Q76A 2ICEB 1V3JA 1IILE 3LIZL 2BWDA 3OQRA 1CQYA 4X6FB 3N9GL 1QSFE 2GSIB 3RURA 1VF5C 2R2EB 4WUUA 1A6ZB 3SDCD 2JV6A 2CBQA 2CIKB 2IG2H 5KJ7E 5KYYA 2H6PB 1R3HA 3LD8C 4RNRB 1KGWA 4UINH 1IBZA 4XNMA 4PP1D 3HRZB 1EJOL 4GJTB 3K2IA 2C9VA 3MLTA 5BOPA 1BA9A 1DL7L 3BWZA 4KUCD 3AREB 2HTLC 3DX8B 4QJ4B 2VZ3A 2VDOB 3BLPX 3K3QA 4GO6B 4DK6A 1ED3B 5HDWA 4LK4A 1ETA1 2W8CA 4XBGB 2JJUA 3CXFA 3I75B 1JPST 1PD0A 4PB9L 5KBNC 1HHHA 3CC5B 1S9WA 4NPYA 3M88A 1PAMA 4G6MH 4PJ7E 1QO3B 5ERWA 2L8AA 5D1ZD 4JQIA 5F7FA 4N90D 5HVHC 3BD4A 1N0LB 4NWTH 4YUEL 4WI4A 2F5AL 3IS0X 4ANWA 2EVIA 3DYPA 3HB3C 2VN4A 4Z7WE 3S36L 5FYLD 4YEEA 1KCWA 2XWRA 5DTFB 2K8QA 1RHHB 1OP5H 2ATKB 4BXSV 4ODUA 1KACB 3APFA 3N06B 5C0CD 2NY4C 3SIKA 2H2SC 2XY1A 4R96A 3TGXA 4G7RB 3MV8D 4E0RB 2QVKA 5ID0B 2R59A 3DRTB 4Z7IA 5IM7A 3K6DA 1B0GA 4F2ME 5D96C 1AHMA 2DIJA 1DBAL 2WQ8A 2A9ML 4YAQA 1QSEA 1CLZL 1R6VA 5IW6B 4JG5A 4RRPG 4F8TA 3G5YB 3GHBL 2NTSP 5E1QA 4EDWL 3JV4B 1DUYB 4JFUA 4S11A 4H25A 3NIFE 4KPHH 4LNVA 1E4XH 4H1LG 4KI1A 4ZTPH 1HZKA 4KO6A 5E8NB 1RZ8A 1X5IA 3QAZC 4G3YH 5CEZL 1BD2A 2GCYA 2QVFB 3BE1L 3QUKA 1Q0YH 4XMZA 3NFSH 4NWUH 5C0IB 4M48H 5BUAA 4UNUA 2KZBA 4B5ZA 3CE1A 3LTVA 3MV9A 2WKOF 4JO2H 5I1IL 2BSBA 1CC3A 1EO8H 1HHIA 4M03A 3NJVA 3GGWB 4ZXBB 3ZDZB 1KJ2B 3ZL2A 1RZKC 2ZSWB 3DX9B 2YEQA 4QHUB 4WKZA 5DJ0A 3AXIA 1BEXA 1YYLH 3NSDA 3HHSA 3ESVF 3TNNB 3UBFA 5D1XE 5EBMB 3KZ8A 1GTNA 2X4NB 3ARBC 3KYOB 5SWZA 3V0JA 3R7RA 5JHDB 1RK7A 1FE8H 2OMUB 4LIQH 2FO1A 1G9HA 3EDJA 4KUZL 4UM8A 4XH2A 5B8CA 5JOFA 3BH9A 2ICWA 3FSAA 3LRLA 1M7DB 1QD0A 1QG3A 2LLGA 2WXIA 2XN2A 4LCIL 4ZFFB 5A6MA 1SGKA 2ZX5A 3D2UA 5CBEB 1XH1A 1DLFH 3RILA 1SLWA 4BV1A 1BYOA 4Y9CA 3T3ME 3ARDB 4NM4H 3EO0A 4K9EH 1EJFA 3D4YA 5IEHA 2P49B 5IZ7A 4I3RL 1OARH 1GGBH 2VM4A 1GA2A 3V4UH 4EQ2A 2AJUH 3FB7A 4OD1L 3D3VD 4Q2ZB 2B4CL 4KJYB 5LBSA 5I15L 4M4PA 4QRPE 2ED6A 1INEL 3NJKA 1CD8A 2FATH 2FD6L 1S6NA 2GY7B 3C8HA 2DQTH 3K2UH 3O8XC 5GZNA 3GWJA 3NN8A 4O00A 5BXFB 2XV2A 4IBQA 3QUXA 3CXHK 4MDIA 1MFBH 3TA4D 5I5RA 4XTRD 5AZ2H 3U0WH 5MEQB 4QRRD 2J5WA 3Q06A 4A7TA 1JVOA 1DQLH 2EZ0C 3BDXA 5T1LD 3VD1A 1KLGA 1L5GA 2ZYSA 2FWOB 3KPSD 1MDTA 2IV8A 3RWHB 1N5AA 3V4LA 2MNUA 4WI2A 4KZEL 3QORC 1CFQA 3Q3GB 4JJ5B 4MXWL 1BJ1J 4WKXA 1KGCE 5F9AC 4XVJL 4JPKH 3U7WH 4Z7NB 2X2UA 3P9LB 4LNRB 4NUJA 1IFGA 2N7AA 2VDPL 4JM0A 2PR4H 4CL7A 5IHHA 1AD0A 4AH2A 4LL9A 4G9FE 5KSAA 2JTYA 5CP7B 3KEHA 2OSWA 4JN2B 4N2MA 4OJDH 4KZDL 1KPVA 2WSKA 4K3GA 3GS0A 3VXQA 4FZ8L 3C5SB 3O0RH 2VDKB 2FAUA 1DQQB 1DJYA 2B0SL 2O1AA 4X7DC 4B9KC 1UG9A 2XVLA 4FFWD 3CMOL 1CTOA 2WLIB 4NKDB 1P5UC 4YHZH 1I7RB 3E2HC 4MB4A 3E3QE 4AYDC 5D7IB 3ARGD 32C2A 2V7HB 3R1GH 3B2DC 5CUSL 1YZZA 4G8GE 1J5OL 3BVTA 3HNSL 3U79A 2NY6B 3FUMA 3OX8A 2VABB 1U6AH 4JFDB 3MHZA 5FX3A 3BZ5A 1CLOH 2UYLA 3L5WA 2IQAB 2R1YB 4MRCA 2FEDD 4OF7A 3WJLA 1E9OB 1K4DA 1TQWA 5E95B 4G8AC 1Z6JT 3I50H 2VAAA 1VENA 3VNYA 3PUUA 2CA3A 4X6CF 3NTCL 3CFUA 4JFXB 1IM9A 5IR1B 1OO2A 5KOVC 3ML9A 3QFGA 2Z92B 3TT3L 2X05A 3TO4D 4TSAH 4XODA 4BZYA 3P4OB 1FZOA 1SJVA 1YAZA 4M6MH 5EO0B 4R9HA 3TLRA 2APTA 4DCQB 12E8H 1KCUL 3DSFL 4FLHA 4MNHA 1M05A 3EJPA 5A2FA 1JV5B 2X1XR 3IJ8A 1TQBC 1CS6A 3AQXA 4GRWH 4N68A 4L3CA 2Y2WA 3UDWA 4D94A 4TQ8A 3WLBA 5IJDC 4KFMA 3AT0A 1MFAH 1O5PA 4AKOA 1SYVB 2N7SA 5HJDA 5FA3A 3ZHFA 2EDEA 1GZPA 2V4LA 4NP9A 1B0RA 4RMWA 4WK2B 5J3HD 4M6AA 5I17B 1NBZB 4BQBA 7FABL 2FUQA 5FGBC 1WEJH 2XKNA 2V9RA 3OAUH 3PAYA 3IMTA 4M4RA 4QRQB 3RNKB 4LRNL 3RZCC 3MRGA 4F58H 1BAWA 4RRPM 3ZE0F 3DI3B 1NIDA 1M3JA 2G3ZA 2KLTA 2FVNA 1USZA 4L8BB 5HI3D 1F45A 3KL5A 1UOVA 4PGDA 1I8KA 3N1MC 4DK3A 3LMJL 5EDSA 4U6YB 5D1ZB 2UXGA 4S2SA 3DO7A 1KIPB 4N28A 1IGCL 4HZLA 3ZK0A 5CZXC 3RKPA 2D7MA 5E9NA 4U6TA 4LPYA 4XVUD 5HDOA 3WFCH 2IH3B 4HMDA 4RETB 5LDUA 4TVSa 1ASOA 1CF8L 2ESVA 3L17A 4XAWH 4OKVB 1WBYA 3PWPE 2VN6A 3HAEH 1OAZH 5I1KH 3V5DB 1MAKA 4HG4J 4GG6B 5LKNA 5E8DH 4XPTL 4PTUA 1FYTE 3LPFA 2UZXA 1CLCA 2R0WL 1UM4L 4X0KB 3GSOB 3O8XA 4HT1H 5HYFA 4KHXL 4X5RA 3MV8B 4ZS6D 1J8SA 1E27B 4X9YA 3IDGB 2VDRH 4J3VA 3ATFA 4PRHA 2EXYC 2F53E 3G6JB 3QIUC 3OKDB 3SE3C 2CG9X 3IS1X 2WY3B 2APWA 2YPVH 1E7VA 3E80A 4RA3A 3PWLA 5TPWL 3RVTD 1SXAA 2JCCA 5TQ2H 1QPKA 2VB5A 3BXNA 2EAEA 3CGTA 5F21B 3QYNA 1RXLA 4JHZA 1TTRA 2ZUUA 5JIDA 4OJFL 2D9QB 4R5VA 4HOXA 3WAJA 2JKTM 3PRZA 1IV8A 1YNKH 4KZCA 1M7IA 1KF9B 1NKRA 2OX5B 2JELL 2I24N 1WJ3A 3EAKA 1XCTA 3A24A 4LQFH 4LOUC 1OD9A 4WTXA 3LV3A 3HG5A 1U92B 4QLRA 4BKLA 4RGNC 3PDGA 1M56B 2BVOA 4O2EB 2DTML 4R5TA 3DSNB 2F58H 4K7FB 3LPOA 4NUPA 1C1EL 3U2JA 3CSBA 1YG9A 5DFVC 1X5HA 2YEVB 4MD4B 3SYCA 3FQYA 4YPGB 4KK5C 4YDJA 2WKGA 1KTCA 4ZTEA 4TYUA 4BZ1A 1QP1A 4NRXA 3ZHNA 2A6KA 1AO7B 1ZT4A 3O3DB 2DWDB 3QQ9C 3F7PC 4P5MB 1G7QB 5B38G 1CWVA 1U8NB 3B43A 4PJFE 1W72A 3U7YL 5MENA 2PWEA 1E5CA 3PJSA 2PYEB 2YC1B 3N55A 4DERA 1P6AB 3SPHA 1IAII 4MJIA 4XCEA 1KXTA 3QWOB 5AW9B 1WIUA 3VRJB 2H45A 3IDJB 4MASA 4LCWA 5DQDL 3KGRA 4W9HC 1YPZA 1AZVA 3MUGB 4H7VA 1CDYA 4C4KT 4AQ8A 3QXVA 4F5CA 4E9TA 3EJTA 4GW4A 3K71A 5INCB 3A67L 1A4KB 4Y5VB 4AQZA 2ICWI 3JTSA 3LVEA 1BVLA 3FT0A 4N9OB 5D2NE 1B6UA 5EN3A 3D3VB 3IKKA 1MWAA 1NCJA 2VH5L 1UZ8B 1FIGL 4DN4H 4JO5A 5DYOA 4OZHB 3BKCL 1E42A 1OP4A 2O5ZL 5E00A 3LQAH 4WI8A 3P9MA 1RSYA 4G82A 2OS7A 1MCWW 3ARTA 4OD2A 2WZAA 1SVZA 3SY0A 4XWOD 1YMHB 5T1LB 5CBAB 2MQ0A 2ZX6A 3OKOA 3L7FA 4Z7QF 4M8VA 1TTBA 5KANI 3MRQB 2RCSL 3HC4H 1UWEH 1EEQA 1G5GA 4MXVF 1QQDB 4PG9B 4ZQTA 4G6FD 5KW9L 4OV5A 2ENJA 5KVEH 4MCYA 4XHJC 4XNYL 1LE9A 4UCFA 2I9TB 7CGTA 3J27A 2H0FA 2OAAA 1WFUA 2BJML 4UI2A 4R4BB 4WW1B 5CU5A 1XO8A 5CEZD 1WZ1L 2GFBB 4ZS7H 2VQ1A 3GZPA 4KKLC 5HHOE 4YEFA 4ZMAT 3EFFB 5ISZB 5J7CC 2RBLA 3BPLC 4GB9A 4UZUA 1LO0L 1JGLL 2WNWA 5E7FA 5EUKB 1O6SA 3Q6FA 5GGVY 3MLSH 4GRMB 3U2IA 4NN7C 5FYKE 4HKXB 4JQVC 2X9WA 3HR5B 2WUBH 3NACH 4PV9B 3BGFC 2DYPD 3LZLA 4DAGH 4NN6C 3ARGB 3S4SB 5I19L 3KPTA 1T3FB 1MCDA 1M2VA 4N0FB 3AM8A 4D0CA 5C1MB 1XF3B 4GXVH 4M8QB 4E41D 5J06A 5A2JH 1NDMB 5J13B 3SE3A 2VDLL 1ZLUK 2XN9D 3VFPB 4XO4A 2X4PB 2AQ3A 4LP8A 4PRDA 3PGDA 3TYGL 3F64A 2AAVA 2IIJA 4PI2A 1DVFC 3GXUB 1NCBL 2SEBB 3MBXH 3CVHA 1NSNL 1TVBB 1IMHC 3TF7C 4NFCA 3VGAC 5I1LB 1UENA 4JFFA 3TO4B 1MY5A 4ZFQA 4U4BA 4NHUB 2QPUA 1PX8A 3OM3B 1JXJA 1I8IB 3CFMA 1GIGL 2E27H 4RAUA 3HC3H 2HG0A 2HFGL 2VZOA 3DETC 5DVKA 3MJ9H 2A73A 5HDBB 1F00I 4ZQKA 4L1LA 2WZ0A 3LB6D 4KRNA 4WWKC 2A6JB 5A7BA 1GRWA 4KWUA 3EJZD 5A2BA 3Q48A 3SJVE 2OYLA 5KSBA 4TUJA 4WZ9A 3HG1A 4AXWB 1P7KA 2D03L 2OZ4L 1XR8A 3OKMB 3PYCA 3IN0A 4N1EA 4N8CL 1A3LH 5F2FA 5D7KD 3SKOA 5I1GH 4CDGC 5DEGB 1DBMH 1HYSC 2XWEA 4HJ0C 4EBQL 1AGEA 1AR1D 1D5XA 4J2XA 1WWBX 4TSCL 1UWGH 3P9WB 1UKSA 2IEPA 3MYJB 4KRPC 2FJFB 4ZUTA 4NN5C 3OZKA 5DRZA 3RLSA 1BBJB 3QHFL 4PJ5A 4F57L 1CR9L 5HHQB 3JWOC 4NO0A 4XXCA 4AM0A 3SGDI 3BEWB 4ZO8A 3LPPA 1GAFH 3SCMC 4C8XA 4PP2A 4PY7A 4I0PC 1XF4A 3RWCB 3C9NB 4PJXF 5C9KA 1N70A 1KN4L 1PZBA 2GJJA 15C8H 2F19L 4JM2C 1OGTA 2GAZB 4HHAA 2WK2A 1HEZA 2HFFB 2NR6C 2E86A 4KI5E 4IHOA 3POCA 4JHWL 2CR0A 1NCCL 5T3ZD 2DQUL 4FKKA 3D39E 4Y5XB 1BZQK 3WFBL 4LLAA 5KN5B 4GKZA 1CE6A 1CFTA 3PIQA 1A1NB 1ZHNB 2OMYB 1ND0B 3LXUX 4NP4H 2WXNA 3DDGA 1A4AA 4Q89A 1JNHA 2X4RB 5E51A 3N41F 5I8KH 2YSSA 3QK0A 2ICCA 5KBMA 4XNBA 5DI8B 1JPTH 1I1RA 2R7EA 4M6NH 2ATPA 5JIIA 1ZWIB 2K9UA 4GUPA 3M86A 2H8PB 5I16B 2R2BB 3ULVC 2EDWA 4XWGL 4P5TC 5IFJB 2K4WA 4IMLB 4M3JA 2YJLA 5CJQL 3SO3B 4Q6KA 3RWJB 5ABDE 2E6JA 1KJMA 3DPBA 5IBUG 4LVNC 1PCSA 1S5HA 3JWNG 1EVTC 2BVPA 4JHAH 3WHXA 2CDFA 3CHPA 1NCIA 4LLWA 2HLAA 3TFKC 4ZMTA 5E4AA 1JGVH 3BT2H 3NCJH 1H3WM 4P4KD 3R7QA 2NXYD 3EGSA 4NNPL 3FOLB 3SDDC 4JDEA 3ECQA 2PXYC 1NGZA 1NBQA 1GPOL 4KKQA 3V6FB 5ITFB 3ETTA 2AKRA 4M8RA 5HXMA 3UAJA 1LP9B 1BQHB 4WGVB 2FB4L 2RGSA 4N2IA 5GS2D 5FO9B 1Z9PA 4ONGH 3KW7A 5HYQA 4B5EA 2VLRD 1FVEB 5DVLA 2VXVL 4DF9A 5I1HL 5L2KE 5E4EB 1IC7L 2EINB 1DO5A 3Q01A 2AJZA 4HIIA 4P2CG 4YSSA 5J6HA 1J5IA 3FTVA 1IGIL 3VFTB 5L2JB 1NC2D 2MHAA 1OSZB 4L1TA 5F8RC 3MXVH 4IU2A 3MRLB 3FH8A 4HQQH 2GW5A 2FHCA 5JW5B 2CR6A 4MKMA 3CX2A 1R5VB 4UB0H 3C60B 3UACA 4DTGH 1P7QD 2WAHA 1X5GA 3I02A 1MHHB 4U1LB 3QNFA 3BAKA 4GRLA 3FRPG 4HFUL 2WBKA 4P2OD 4NZ8A 5EC1B 1KJ3L 3Q2LA 1F4YL 2Y1ZA 4FQ2H 2C9SA 3HS0B 3RDJA 2MCMA 1J8HB 3NPSB 4AYMC 5IUSA 4F37F 2FSDA 1N6VA 2JB5H 2ZPKH 2E7HA 4G59C 3B9KA 4N0YH 4TQEH 1XFPA 2GUOA 3IYLW 4PJ8D 4OCWH 5T8IA 2WN3A 5CZRA 4HIHA 1NFAA 3L3IA 4R97B 4R84A 3O6LH 4YDVA 1T2XA 3I2CH 1C08A 5FOBA 2X6MA 3FU7A 2GJZB 3NIDF 3TVMA 3VW3H 5AW0B 4DHLA 1LDPH 2JQAA 2M83A 2YK1H 4LSSL 4L29A 4XXDB 2XPZA 3ILQD 1UXSB 4QTHB 1R3LB 4G7YL 1OGAD 2CRYA 2WVVB 2NNAB 4LARH 4U2ZA 4I0PA 3QG6A 1SQ2N 2AK4A 3QUZC 2BZDA 2OMZB 3ZE2B 4WF7A 2WQXA 3C6LB 1FLTX 5C0BB 5D93C 2V8LA 4P23C 5SWSE 4YNYB 4PW4A 4IJTA 4B7IA 1TKWA 1CLVA 1DEEB 1NKGA 2E0PA 2NR6A 5HYJA 1IEAB 2GC7C 4MQSB 1JWMA 3REVA 3L4XA 1H15A 3ELQA 4WHTB 5KTEL 4JEGB 4RA0C 1OEZW 4CC4C 3KXFB 2CALA 2EDTA 2NY0D 2ERJC 1HQRA 1AGBA 1J0JA 3E7JA 3RQ3A 2VXTL 4NCC1 4E41B 4HUVB 2YIHA 4L2YA 1B2WL 4X5WB 1N6QH 4NNXA 3K72A 1PSKL 5A16B 4DGVL 4GRWF 3D07A 4L4TD 4BIKA 5GZOC 2DM4A 1BLIA 1D6EA 4GIOA 3Q1SH 2Z8WC 3RBGA 3VXUD 3APCA 3W56A 2AEOA 2DDQH 1HL9A 2FT8A 1JZ8A 1NCWL 2WQRA 4BZ2A 1DDHB 2IAMB 3P4NB 3GMRB 3CFJA 1OZTG 3CZNA 3MRMA 3P11H 4XVSL 4BUQA 3AU1B 2YD6A 3BDYL 2V0AA 1ET8A 4Z7OF 4Z7UE 5DJXB 4J4PD 2VL4A 5DUJA 4HJTA 3SDDA 3HBQA 4PR5B 1IGTA 5AOJA 3HFFA 4QRUB 4OZIE 3FT2B 1IAIL 3GO1H 5C08E 3HBGA 3VD9A 1WAPA 4HPYL 3TT1L 1NKOA 2V3FA 2V5YA 4MAUH 1FLRL 4GPVA 4TVPE 4HEMA 3GSQB 3HZ3A 4OCSH 4XP9H 4M61A 4UF7C 1F6FB 3VACA 2VDPB 1D5MA 5ANMA 1MI5B 3KJ6L 3LRMA 2DWEB 4U1JB 4X5LA 3T4YB 3BLBA 4BFKA 2P5WE 3OC8A 5TGBB 3TWYA 2W9DH 3UZQA 3NCYS 4G6KL 1AANA 2OMNA 1EXGA 5IB1B 1YN7B 4A63A 3FSWA 3DX7A 4Y16D 1UWXK 3IU4H 1SYSA 1C12B 1JI1A 3FB6B 3OAYK 3OJDA 1LEKA 2YA2A 4IDJL 2WCGA 2MOVA 1D7CA 2ZCHL 5I82A 5LBSL 2WKOA 2C3GA 2COQA 5JPMA 1IGYB 1QA9A 3EJJX 4ZI8A 1MFCH 5I6XC 4GW5B 2BX5A 2VLJA 2YBRB 4FHBD 5E8EA 1P7HL 2F9BT 3PV7A 4NQCB 3VXSD 3NJNA 3PHOB 4AL8H 4FQXA 1FAIL 4WENB 4RWHA 2WYIA 4JRYB 1J5HA 4LMQE 1E9QA 3IWUA 2X41A 1NEPA 3ARVA 4Y4HD 1K3ZA 2BVYA 4QF1A 1RL1A 3CFTA 4M7KH 1NUGA 5BMFL 1G84A 5D1XC 1H3XA 1WLHA 2Z93A 3BCFA 4H8UA 4W9FC 4E5XB 4Y5YA 5K9OB 5D5MB 4L8CB 3TN0D 1UYWL 2VR7A 1JNLH 5AUMA 1FBIH 2YUWA 2IPUG 3ASWA 5IW3A 4KHTH 4XOEA 4YDIH 1VLXA 1KTDB 1J05A 3HFML 4C4UA 4P23A 1PPIA 5ITBL 1AFVL 2VE6B 2YFNA 1NEZA 5EG6C 4P4KB 3KGUA 1NFDE 3RWFA 4MBRA 2NXYB 4P46A 5BS0B 2BERA 2V3DA 3M1BB 4MYPA 3V6ZA 3ILDA 2RFXA 4WFHE 3OKLB 4CC4A 3QRGH 2WLHA 4OGAD 4AMWA 3D9AH 1KWGA 4RESB 2PW1A 3V9EA 1NBCA 2PTTA 4ABQA 2PPDA 2GK2A 2AEWA 1QBBA 2XUWA 4E9QA 4UQBA 5ADOH 4X6EA 3DVGA 5LWYL 1SDAB 3BSGA 3RIFF 5CKAA 3BC9A 3JV6A 2QJDA 3CVIH 2BK8A 4NS0A 5GZOA 3EO1B 4L1DA 1S2EA 2ENPA 5MHSE 5K9QI 1THCA 1NC2B 2H6OA 1KWKA 3IDNA 2IADA 3LOWA 3Q2VA 2HSIA 5F0MB 2EDLA 5F96H 4J6RL 4MMYB 5ADPL 2AP2A 1PZ5B 5IW1A 4L18A 3UZVB 2ZKYA 3FQTA 3R19A 1Q1JH 1SJMA 1ES0B 2X4QB 3PXLA 3ATDA 1XF2A 3IDMB 5C0GB 2BHYA 1CYGA 3HN5A 4H0HB 4M56A 3W0WE 3GB7A 3FQUB 4Z7AA 1A1MA 4Y4KC 4YHOH 3P4MB 4FXGB 3RHWK 2WN2A 3QB7C 4ZFZA 1N10A 3QRBA 1WWCA 5DD5H 1CE1H 1NDTA 3UJIH 2FBJL 4F7CB 4TL5A 2PP9A 1EZVX 2BP5M 4PJEB 5ETUB 2GHZA 1ZVYA 4AGQA 2GJ6B 3OKNB 1UGKA 4N8VG 5E5UB 3QO1B 2WINA 1NUDA 2ROXA 1HH6A 2BOBA 3P30H 1UKTA 2E8YA 3BVNA 4WI3A 5JW4M 3X12B 1NCGA 4RFEA 1P6WA 1F6AA 3TBYA 5DZLA 4KQ4H 3KPRE 1F5WA 1MIEH 4PJ6A 1KB3A 2YD8A 3CDCA 2FTAA 4PRIA 4MLSA 4X6CA 4AY0A 5I8OH 1OGAB 3AG2B 3HE7D 4C57C 1D7DA 1HESA 1ZXQA 4I8DA 5DJAB 1FG2B 5G2NA 3VXRD 3C87A 3PP4H 2M26A 5EU6D 1T89C 4M6OH 4NLHA 5CJXA 3MLXL 5I18H 5F7YC 4HJIA 1G7JA 5L6YH 5D72H 3TZVC 5KVDE 2UUDH 2COVD 2WNKA 3W11C 2MNWA 1AKJD 5EOCL 5KYXB 4PRAA 1N67A 2GTWA 2WIMA 4MD0A 5T1DL 2NY0B 1GZHA 1JPGB 4XXWA 3E0GA 4EVNB 5F9DC 5EORH 3QIBD 2R1WB 4ZAKC 4Q9QL 5EU5B 3OB0H 3H2WA 4FQQB 1E2ZA 1KIQB 1OAKH 2F54E 4L4TB 1U8OB 5LCVA 3VGEA 2HP4A 2VDKH 2L4OA 2A4CA 2Y07H 5JR1H 2BXYA 4WDIA 3VXUB 4YX2L 3T6XA 2CUMA 2F5BH 1RUQH 1Q9WB 3T3PB 1AJ7H 4N24A 1EA9C 1J9CT 5EZOL 1TQUA 1E43A 1FO0H 1RJZB 1T4KB 3E6HB 3F5WB 3L54A 1CJYA 2QTVA 1D5ZA 4AENA 1U58B 4P3DA 4JKNA 4PJBF 3BWAA 3V0VB 1BFVL 4Z3IA 3BGMA 1SY6A 3QJFA 3O2DH 1KPUA 2EADA 1J48A 1O7VA 5E9DA 3ZTDC 3HOGA 3U4AA 4BZ1L 1E9PA 4NEHB 5L4FA 1O6VA 1PKOA 1D5IL 3SOBH 5CAYB 4PJCF 4PW3A 3T6ZA 4UMSA 1W72L 4HIXH 1YQVH 1GCFA 1WAEA 1M7UA 3RDTA 3MRCB 4RFOL 1IQDA 3D0VB 4IGBB 2VKXA 2IANE 2PETA 4X9BA 4GKNA 4ISVB 4PB0L 2VXSH 4ZMPA 5ESQB 3PGFH 3B2VL 5D7LA 3ZT7A 1KG0A 2XXMB 3S88H 2C9RA 3FU9A 2EICA 1MW0A 3KPNA 5I9QB 3NK3A 1MJUH 1QTYT 4IU3B 4Y16B 3LZQA 1HZHL 5E0QA 3QZOA 2O61A 1E5YA 4YFEA 3ATEA 1AMYA 2C9PA 2E6PA 4ZPTA 2CBOA 4P9HL 4Y4KA 4FERA 3CX5J 1BZ9A 1TDQA 3O41A 4NUGH 1MWAL 5IROC 1U4EA 2MQ3A 3DV4B 4WV1B 4F33A 4IHBA 1QTSA 4HXBH 3QJZA 4IJ3B 2VDLB 1AHWC 5IV2B 4FLSA 3D12B 1B9ZA 4U1HA 1QSED 4FQ1L 2IQ9L 3MRHB 4NQDE 2NZ9C 4JO1L 3NSJA 4UT6H 1L9MA 3FFCE 4IIQB 2HLFC 4Z77A 5BOJA 2XA8H 3EYFA 4LT7A 1JI2A 4XZUB 1QKZL 5T1MA 1C16A 2WBJD 4WNSA 2O93L 1AXTL 1PYWA 3FS9A 5IJVA 5D1QB 3OL2A 1BX2A 3QHTC 4FTVE 4Y4HB 3KVDD 5F1NB 5I1JL 1L9TA 4XPGH 3QC6X 4MCNA 2XG4A 1VB9A 3B3IB 5EOTB 5AB0A 2WC7A 1UKQA 25C8L 2WP3O 3TN0B 3MRNB 1BD2D 1Z0NA 4PCYA 4NQEA 4XBEH 3QUYC 1HVXA 4HKJB 2XPYA 2R29H 2NY1C 4NC1E 2B9AA 5L4JA 1ZGLA 2X28A 3DV6A 3U4EA 4MJ6B 4XCYB 4YGVB 2X0VA 3F05A 3UADA 3A21A 1MJ7L 4FYQA 2HMID 1WAAE 3EKCA 3Q5OA 4B41A 4MZ3A 4PLOB 4NQXA 4MAYC 3K46A 3KBEA 2IMMA 4DEWA 1G0XA 2Y2TA 4ZOBA 4G71B 3HPJA 3ZDYF 2PCPA 5EU4A 3GMLB 3IMRA 4BDVB 3BFWA 5D2NC 4YJZL 4WWOA 4KK6D 3MRKA 4JO8A 4ZAKA 3LRHA 2E75C 2ZXCA 2UZYB 4FQIH 4I5BB 4UOW0 3D2UD 4M5ZH 2QVIA 2HFEB 4L4JA 3DIFB 5DD6A 3H55A 2G5BA 2Q6WB 1OQOA 5ILTL 2P24B 5D7JC 2MPAL 4A66A 4TOYH 2I27N 3DUSA 1SJXA 2EIZA 4YE4H 4HCRA 4YL9A 3QW9A 2C1OB 1EEZA 4G6JH 2WVSA 4F7PA 1YAIA 4HOZA 2X6UA 3PWJA 3ZKMC 4MJ2A 3WNOA 3J8F7 3STLB 5DJ2B 4ZMWA 3ZR6A 4L0YA 4L1BA 4M1DH 1KTBA 5EFIA 3TIEB 1IEHA 2VISA 4JPSA 4KDWA 2WB1A 1A9EA 3DK2A 1OM3H 4C56A 1JNNL 3GXFA 5F9OH 3U9PH 3V4VL 2B3IA 2MTAA 1HU8A 1RJCA 4RFNB 2I5YL 2VZUA 1S3KL 3ILEA 4FXKA 4BHUA 4CNIA 1QEXA 5GZND 5LN8A 2Y6SD 4QCIA 2FK9A 4OLYH 4XE5B 3QUXD 2KKQA 2CDEB 4I48A 5J6GA 5LGHL 3HMWL 4GMTH 3N42B 1FA4A 4GP5B 3WTSA 4JPIB 4OT1H 3IXTB 4EN3C 3EFOA 1BFOA 3LSOB 4UDTA 4OI7A 3KPMB 5BRZB 3CH1A 1DBJH 3S36X 8FABA 1J88A 2VERA 4K9EC 3D33A 4RH4A 1R3IH 1NMCC 1KYUA 1EXUA 4M43L 4MX7A 1DQJA 1BQSA 4ZPVB 5KSAD 4J3WA 3WL9A 1RUKL 1B4JL 1IFRA 4XMVA 3W57A 5JTWA 1MG2C 1WBXB 3CVBA 5HGAA 4M7ZC 1Z5LB 5E2UL 3AT9A 4ENED 3VXMB 2AS5M 3QQNA 5EMYA 4NFDA 2WWKO 4LVOC 2YBGA 1IGJA 2GBUA 2DQMA 4AYFB 1UUNA 1OF0A 1VFOA 3PDOB 2LGNA 1KC5L 3VXRB 3SN6N 3CFDB 4GXUM 2X4OA 1VFBB 4YXHL 1I8MB 3IFOA 1ECYA 4YSCA 1P1ZB 4Z3JA 5IROA 1GMEA 4D3CL 2AXFB 3MR9A 3NIGF 3ZDZE 2EVJA 1AHWA 1QFPA 1Z9LA 2J88L 1R9FA 4NZUH 4E9XA 2FQDA 5BW7C 3OMAB 3KH4A 2A77L 2MOQA 3M8OL 3N50A 3RFZA 3N1QC 1NDGB 4BCYA 4F91B 2ZD0A 1XGUB 2DLTA 3QIBB 1TCRA 2LTQC 1OSYA 1SQMA 5ENWA 5JHDE 1FZMA 2XWCA 1THAA 2HRPH 2JFCA 3HEIB 4FKEA 4LHJB 3MLRH 3D1MC 1ZTXH 4RQQB 5GSVA 5IJKC 1K9TA 3A4FA 5IMOA 5EC2A 1A7RL 3O3BA 5DHXB 3TESA 2Q76B 1HN1A 2YAQA 1DP0A 43CAA 4N26A 4RMSA 5FUOH 2Z91A 1EZUA 4G9DA 1MFDH 2HT3C 2Q86A 2YD7A 4WUUB 2CBTA 4FG4A 3IDIA 3UGEA 5AAMA 2CK0H 1T2QH 1MAML 2EIKB 4BFFA 5KYYB 2I7OA 1R3HB 3DTUB 3KS0H 3TF4A 4PJXA 5G4OA 5BNXD 4XNMB 4LPXA 1JN6A 2XV6B 3I3EA 1HT6A 3MLTB 5BV7C 2XX1A 4IRZH 2BFVL 4C47A 1N64L 2KERA 1AQMA 1EDQA 1FIEA 1UXWA 2G5UA 3E9UA 3L5XL 1JZ3A 1EAJA 5G4MA 2DTSA 4LHUD 2GTQA 5AVRB 3UMNA 1GGTA 4KI5C 1HHHB 2OA9A 3ZZQA 1S9WB 1LL1A 4NPYB 1PLBA 5D7JA 4Y1TA 5ERWB 4JPQA 4HWEH 4JRXD 3DO4A 4Z7NE 3A6CL 1I9RH 5ABZA 2NNCA 5H4YA 4D9QE 2ESVD 3QJHA 4OGYH 2D31A 2DKSA 3MRRA 3ZQWA 3WO4C 1HIML 4R7LA 5ALBL 5LXVA 4ODUB 2OYPA 5M7QA 1J0ZA 4B96A 1A7OL 1JPSL 5JUEL 2IGTA 1RURL 4WEBL 1TZIA 2EIMB 3UP1A 3WD5H 4WO0A 1EMTH 4R96B 1OV8A 1NOLA 5C8JA 2RB8A 5DMGC 4OVVA 5EWIL 1UM6L 2B1AL 3LPWA 1TZAA 5DC9B 1TJHH 1B4LA 2G4EA 2K45A 5HHOA 5D7IE 4PRHD 3W3BA 5IM7B 1B0GB 3E38A 3CZEA 3SKJL 5IQ9A 5JA9A 4EN3A 4YAQB 2X4SA 1QYGH 5AB2A 4FP8H 1QSEB 3EF4A 5CGBA 2D73A 3W37A 3U9UA 1QHQA 1NC4A 1PEWA 1U2YA 2PPEA 2VO5A 1R19A 2AEQL 1UA7A 1PLCA 2XTLA 3T0EC 1PF3A 2DQGL 5LO7A 4H25B 3M1OA 3JWOL 3GHEL 1I31A 2JQMA 4JFTA 4LLVA 4QEGA 4X9FA 3PL6C 3I6SA 1KGJA 1CIUA 5EZLA 1RZ8B 3BZEA 1Y07A 3N43B 2OJZH 1BD2B 2GCYB 2CH8A 2QKIC 3QUKB 2EDJA 1BF2A 1VADA 3MV9B 2DV6A 3LQMA 4MNGA 1QBML 4OR1A 3AQZA 3TNMA 4DIXA 1HHIB 3UJTL 2Y24A 4KK9D 5AVVB 3C75A 3HG3A 5DJ0B 1R33A 4S1QH 3CU1A 4WKZB 3FCTA 2DQEH 3FZUC 3PABA 3HHSB 4KMTL 4IOFD 4LASH 5MEND 3PF2A 4KKCD 5AL0A 5SWZB 1ORSA 2OI9B 1KCSL 1S9VA 4ADJA 2EDYA 4XH2B 4MJID 4UM8B 1D5BA 5B8CB 5JOFB 2MWCA 2ICWB 3BH9B 4JG1H 3P40A 3S34H 3D2UB 4RISL 4DUWA 3ILPA 4NZRH 5D7EA 3K6IA 4WFGD 4KXZH 2G5RA 2BVTA 1VCAA 2G30A 4UQ9A 2VJ8A 3RY6A 3EO0B 3O11A 1NMBH 4M3KB 4PY8I 3R8BB 5IEHB 3LH2L 1T66D 2B9BA 1FNEA 4D8OA 4BZ2L 3GMNA 4IBLT 1FL5A 1X7SA 4HHGA 4UILL 2D0FA 3FB7B 3RU8L 5DT1H 3DWTA 4X8GA 4EMZA 5FYLE 5BO1L 3LD8B 3SE4C 4DGUA 3REWA 5AQ0A 4XN7A 4LEOA 3WHE0 1O6TA 1OE2A 1ZDQA 1EAPA 2WXMA 4TNWK 2KH2B 2IWEA 3MLYL 3NN8B 5E2WH 4A39A 4GG6E 4ODTL 3I9AA 4DQOH 3BUIA 3QUXB 4MDIB 3VI4F 3QDJA 4W9IC 5EIIG 5JIHA 3MV8E 4XCFL 1AZCA 1KLGB 1L5GB 4B97A 2Z3FA 1N5AB 1FSKC 3OB8A 4TNEA 4XP1H 3OZLA 1CFQB 2LFEA 3G6JE 2L7JA 3V0DA 4XC3H 5HD8D 2IMNA 1E5ZA 4NUJB 4YSTA 2GB2A 5AVUB 3ULUH 2OXGA 1EFQA 1AD0B 1OCWL 1M2OA 2Z35A 3CWGA 4NT6A 4AH2B 4DP6X 5KSAB 4OCNC 1MUJA 1P5VA 2H2PC 2YPLD 2MNJB 4QR7A 1KPVB 1T0PB 3FU3A 3S3JA 1WZMA 4IOSD 3VXQB 2UXVA 3MU3A 4WNQA 3SBQA 2ILLA 3EOTL 3JVGA 4DP4X 2XQBL 1KIRA 4Y2OA 1BGXH 1C5CL 1KB9K 1ZANL 3L5HA 5B22A 1EK3A 4ABVA 1ZT1A 3KH3A 4EZKA 3V0HA 1YNTA 3OSVA 4CVZA 1TVHA 1DJHA 4TNFA 1FV1A 32C2B 3HHMA 4HUWA 3AADB 3WNPA 3U4BL 4PU2A 4PJ7F 2BWQA 5D7HA 3CFIC 5EOQH 4HULB 1ROCA 3EIFA 4GS7B 2FT7A 2WXJA 3OX8B 3UTPE 1SMDA 3L5WB 2B7DT 2UYLB 3ME0A 4PS3A 1FWXA 1C8QA 4Z7WF 5B1CA 3RTQC 1JGDA 1XVSA 1AO7E 4IW4C 1K4DB 5C3TA 4A2DA 1RZJL 2VAAB 3GLAA 2UVFA 1H8SA 5CEZH 5E6UB 5F9JA 2JSFA 2PYEE 3U36A 4AUUA 1IM9B 4MCMA 5L4MA 1RUAH 4M1GH 4K5OA 5HJBA 4JFFD 3HAEA 3UZEC 3T0EA 4RMVA 1FZOB 4BQ9A 3MVSA 3GTTA 1JD7A 5FLUA 1P4LA 3PL6A 4MNHB 4X7SL 1M05B 1LD9A 3SDYL 2PN5A 2V33A 3QAZB 2QKIA 2ZP9A 1QPPA 2O5YH 1S5IL 4NPKA 4L3CB 1ETZA 5EZIL 4K3EH 3WLBB 2Q9OA 1AAJA 5EO1A 2DQDH 4PVMA 5AFAA 5KYUA 1IM3A 4QIRA 3GSUA 4X4KA 5FA3B 3M6DA 3HG1D 2J2ZA 1GZPB 3D3VE 1B0RB 4JRLA 3FBQA 2YPVA 3O6KL 1TZGL 4MQXD 4OZHE 5DMIL 1BVZA 2AGJL 1BEYH 2XKNB 4M4RB 1RZ7L 4AVIA 1IC5L 5B3SB 2NX5D 3MRGB 2D9CA 2FNBA 1DQMH 2A6DA 1N7ML 4TLSA 1P53A 5HGGS 4XPFL 4KBPA 1UATA 1SEQH 2E7MA 2L04A 3KLSA 4WI0A 5E5MA 4PGDB 4WI6A 3AWGA 1I8KB 5HP5A 2XETA 2WZ6A 4NO0D 3BUYA 5F1IA 1OT2A 3DO7B 1LYQA 4S2SB 4XB7A 3CXHJ 4HZLB 4K5LA 1INEH 4TRPL 3LKOA 2AJSL 2BP8A 2VM9A 2ESVB 3BJLA 4TV3A 4RAVA 1WBYB 1R24A 2VOTA 5L88L 3L9RA 5CR8A 1ZTXE 4POZC 5ISZE 2O6CA 3NRQA 2HKFL 5T3XH 1BOGA 2YAMA 4JB9L 4PTUB 4AEHL 2VZSA 4AVHA 2UZXB 1NZRA 2P8MA 3O8XB 2R56H 3BIKA 2Z8VC 1U3HC 3O9WC 1AMXA 4NI3A 3HVNA 1IO4C 1ZPUA 3QFJA 4ODSH 2D2OA 4PRHB 3T3MF 2R0LL 1N19A 4GNKB 4QY8A 1OQXA 3CLEL 4FZ8H 4YR6A 5FDWA 4JDZA 4KROC 1BPVA 4GKOA 3VD7A 3PWLB 4EUPH 1JHLH 2JCCB 1DVZA 4K2UL 2B0SH 1B2YA 4A2HA 3BXNB 3CHSA 4NO2A 3WXWL 1Z7JA 3H54A 2B20A 4YSPA 5HYIA 1WHPA 1A22B 1M7IB 1PZSA 2C4FU 3DGDA 1XXDC 3RIKA 4F9LC 5AENA 3MJ8A 1XCTB 2CJUL 4F15B 3FUFA 3HNSH 3LV3B 4FQLL 4FN0A 3PREA 2J44A 3QJXA 2Z34A 4B0MM 4BKLB 2R51A 4QRAA 1BIHA 2BVOB 5T3ZH 1QLRA 3E2HB 3DXAA 1FJ1A 3ECBA 5HDBE 1HHJA 1TQSA 5C09D 3OKEA 4CILA 4YDJB 4LHQB 3UAJD 2WO4A 3NTCH 4NRXB 4F37K 5C9JA 2A6KB 3O2VL 3EJYD 1ZT4B 1YYML 3AXHA 4H88L 1WCQA 3E8UH 3GS7A 5MENB 4K3JL 3RTQA 2WO2B 1W72B 1R0AL 2EDHA 3PJSB 4U3HA 3VD0A 3ZMEA 3DSFH 2B1HL 4MJIB 4XCEB 3ZUNC 1KXTB 2BO0A 3D6GA 4UV7H 3ZL1A 2NXZD 4QXUL 1N8ZA 3ECVA 4BK5C 1OWWA 1ZLVH 4LCWB 3VRIA 1G4MA 5LCVL 1YPZB 5C92A 3QUGA 3S7GA 3PPSA 4IMKC 5HGDA 1GYVA 4U1SA 2VSCA 5MERA 4NAMA 4GW4B 1AYRA 4N2GA 3AY2A 3K71B 4GRLD 1TQBB 1MNUL 1H0DA 3JTSB 1BVLB 4ZFGL 3T09A 5B1JA 1PAZA 4LRNH 3WFEH 3MFGB 1MWAB 3OHXA 4M02A 5DYOB 4UWQB 2DYRB 2AEIT 2HT4C 2JKXA 2IH8A 3ZRSA 5GS2H 3WUWG 3OVUB 5E00B 4JFEA 3B9KD 1PNDA 3P9MB 4IK6A 4NQUA 1H9VA 4OD2B 4GBXA 4FX5A 3M7FB 1U21A 4F80A 3SY0B 1IGCH 4DP8X 1SY6L 1T5WA 2DQFA 1MPAL 1WBZA 3STZA 3NH7H 3OKOB 1IFHL 3L7FB 5FIEA 3TVMD 2XACC 2CDGA 1EBPA 1CF8H 5AW3B 2MCG1 4UZGA 5BO0D 3GM0A 1OW0A 4GW1A 1NLBL 4OV5B 4JL2A 1OTTD 1BQKA 3MOQA 4YBHA 4MCYB 5LG1A 1ZHKA 2X89A 1PGRB 1LE9B 4IRSC 2BIOA 4ZMYA 3FT9A 1YLBB 2ZWZA 3MRFA 4XPTH 4B9JA 2EE9A 2KUTA 2R0WH 2AK4D 3MJ9A 1UM4H 2VQ1B 3EYUH 1CLYH 1F11A 3HNTL 1SHMA 3QVAA 3VD4A 2XU9A 2H0JA 1RPUA 3W9DA 2NY5C 3V0FA 3FL7A 1QFUL 1O6SB 3NAAL 1ZJBA 3Q6FB 2X38A 2FWSA 2BIQA 4U1MA 4S1DD 5TPWH 3O9WA 3VD5A 2Y1AA 4YN3A 3QZWA 3VRLF 3SO5A 1M2VB 4WO4C 4D0CB 5LBVA 2J4WH 3NCWA 4OJFH 2DWYA 1LP9E 5J5EA 3EOAA 4TKWA 1BMGA 2NW2A 4PRDB 2HWZL 5F88A 3PGDB 5JYMA 2M2DA 4WWID 1ECZA 1A6VL 1K4CA 1JCKA 2F74A 3CVHB 3KPQA 1ULVA 1LQSR 3QR0A 1QRKA 2DTMH 4KNSA 5JQ6H 5E99L 4JFFB 4WY7L 3H85A 5DK2A 4LFHD 4F9LA 4NYLA 3CXDL 1DJXA 4F93B 4K07A 3L13A 1KT2A 4RAUB 1JWSA 4RGNB 2A73B 4EAEA 4JZNA 4ZQKB 2ORBL 1EZVY 3T8MA 4PJHA 5T1JA 2V17L 1JDCA 3JVFC 2FYVA 5JOPD 5KSBB 4TUJB 1T21A 3HG1B 4JO4H 2PP7A 1P7KB 2BNRD 2XWJA 1J8HE 1XR8B 5FKAA 2PUQT 3SKOB 3FU6A 5DQDH 4EEEA 2XWZA 4OZGF 5D4QA 4AC4A 3P2DA 5IVOA 2JIXA 1ZT7A 4B95C 1AGEB 4WHYH 1D5XB 3MUHL 2QQKH 3A67H 5B3JF 4ZUTB 2OL3H 3X1NA 4YZWA 5DRZB 3RGVA 4Y4FD 1ZEAH 2XCMC 4L5FL 4PJ5B 4BK5A 4N0UA 4NO0B 2R2CA 4AM0B 1FIGH 4GSDL 3FT1A 3WCYA 2CM6A 3ABZA 3EUDA 4HCRL 3BKCH 2AITA 2O5ZH 3ECWA 4PP2B 4PY7B 1XF4B 3AB0B 1Y6KR 3SQRA 5IQOA 1MEXL 1SLXA 2F7IA 5DLLA 5CEZE 1J1PH 1PJWA 1OGTB 1U8LA 4HHAB 5GHWL 2VXUL 4AQEA 1HEZB 4CADA 5C0BE 1Y1UA 2MOGA 4KTDH 5K39A 4IHOB 1EGJA 5GGQL 4KFZC 5IGXH 1VKXA 4WJKB 4Y8DC 5CJ8A 2RCSH 4AG4L 4ZW6A 2Q8AH 2YO3A 2X1QA 4HPHA 2OK0H 2EXWD 4GKZB 1CE6B 1CFTB 3PIQB 4GP4B 2NNRA 2XICA 4KKPA 4NC1C 1P4UA 2JVUA 4UQ3A 5F1OB 1T1XA 1WZ1H 1JNHB 4FQXD 3QHZL 3LZFL 4MA3A 5IKCA 1FNLA 2YSSB 3EJSA 1HL5A 4H2CA 5J9PA 2OMVA 2R7EB 4E41E 3RIFK 2ATPB 2CKBA 5TE7H 1ZTMA 4GUPB 1FYHB 5GS0H 3SKNA 1JGLH 1TZOA 4YXLL 4IRSA 4CSTA 1SN0A 1A3RL 2RACA 2QMKA 5BQ7A 1FC2D 2YSTA 1XH2A 3L4YA 4AEEA 1KJMB 3DPBB 5JORA 3CZJA 1S5HB 3VYOA 2BVPB 3WHXB 2CDFB 1FPTH 1AZZC 4LLWB 2HLAB 5G4NA 5BCAA 4UINL 1DJWA 5DZNA 5B39G 3EGSB 4P46D 1Z2KA 4JDEB 3F58H 1NGZB 4DKDC 2Y1YA 3BGFB 2AKRB 2HTKC 4AIZA 1BG1A 3OZ9H 4QGTA 3ARFA 4GQ9H 4PLJD 5HYQB 3BUPA 2UX7A 3SE9L 4HIIB 2AJZB 3HE6A 5J6HB 3H4HA 3NZ8A 1GIGH 2VMCA 4QAMB 1ML0A 2MHAB 2VM3A 5F3HA 4IU2B 1UFGA 1MI5E 2Y7MA 4GFXA 3VGAB 1EX0A 5HHMD 1IRAY 5HPMA 3TA3D 4A7UA 1Z1WA 3LXAA 1G7PA 3D0LA 3V5KA 4I0CC 3L4UA 1CFVH 3I02B 2FH8A 4KKAC 4GRLB 3FT3A 5FDYA 1KBWA 3BRFA 2O5XH 3E1F1 3RX5A 5DA0B 3JYBA 5DWUH 3FO9A 3MBEA 2WXHA 3EH2A 4KKRA 1U8IA 3ULUF 4FQJH 1NUNB 3B34A 5M95B 1BZEA 4ZMNA 1RFDH 1GSMA 4L8SC 3B9KB 4M7JH 2ZWKA 3IJ9A 2GUOB 1XTLA 2P8PA 3QHFH 4F57H 3K1DA 5CFAA 4X0NA 4ETYA 1NANH 1MQKH 1F4HA 4HIHB 3L3IB 4S1SH 4YDVB 2HH0H 1C08B 3GIVA 5FOBB 4GSQA 5EOCJ 3MODL 2NQDA 3RVUD 3HI5H 3FU7B 5DUBA 1KN4H 4L37A 2AQPA 2GSMB 3TVMB 2X1PA 4CVXA 3RA7L 4KPHL 4ZXBC 1E4XL 4L29B 1GZQA 2DQ6A 4JRYE 3H1ZA 4G11A 1RK0A 2EXSA 1G9MC 2KZ1B 4PRPA 4G3YL 2FECI 4I0PB 3BN9C 3QG6B 5HBBA 3NFSL 2AK4B 4NWUL 3O0LA 3ARYA 2DQUH 4MCZA 3SYAA 3MO1A 3TX4A 4JO2L 5J57B 1XZ0A 1EO8L 5DZJA 2CHDA 2VMDA 3QXDA 1TKWB 2W1NA 1IUZA 3S48A 3OR7A 1OZUA 3DO3A 4LSPH 3MLVH 5HYJB 3WLWD 3UBXG 1JWMB 3REVB 1H15B 1YYLL 5DA4A 2K3TA 1L4IA 4HJUA 3ARDC 2AV7A 3ATBA 5KYWA 1HQRB 1FE8L 4LIQL 1AGBB 4XWGH 5C07A 3T0WA 3D4ZA 3S35L 4FS0A 1UT1A 4RZCA 1YN6A 4NNXB 3K72B 5I1DA 2QT6A 4JE0A 2Q5BA 1WAAA 4YDZA 2DMGA 1D6EB 4NM4L 3EZ8A 2WVTA 3QJVB 5I75B