1XBFA

X-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
b'VIEYSLKTSNDDQFIDITNLVKKAVDESGVSDGMAVVFCPHTTAGITINENADPDVTRDILVNLDKVFPKVGDYKHVEGNSHAHIKASLMGSSQQIIIENGKLKLGTWQGIYFTEFDGPRDRKVFVKIILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clostridium acetobutylicum Q97KL0
publication title X-RAY STRUCTURE NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET CAR10 FROM C. ACETOBUTYLICUM
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
total genus 31
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01894 UPF0047 Uncharacterised protein family UPF0047
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.460 Mainly Beta Sandwich Jelly Rolls YjbQ-like 1xbfA00
1XBFA 2P6HA 1VMJA 1VMFA 2CU5A 2P6CA 1VMHA 1VE0A 1VPHA
chains in the Genus database with same CATH superfamily
5CKNA 4BZ4A 1XNDA 2XWBB 3R6SA 2HLEA 2P17A 4AOCA 1VLNA 3CLPA 4TZDA 1HQLA 4EV0A 3FHIB 5FTTC 4FPLA 1EYBA 5HBAA 5IFTA 2WS93 2YU2A 2GMPA 1Q8OA 1ODNA 2JXAA 2P6CA 1XRUA 2RG4A 1BLZA 2VE1A 3DXUA 3IDAA 5EJ3A 3AP5A 5FP3A 4UFKA 3ZMOA 1G86A 1MQTC 1IZ3A 5JOZA 2IFWA 3RZMA 2BBVA 5GLWA 5GKAC 2P5BA 3Q9OA 1DGRA 1ND2B 4F8AA 1AR91 3POWA 1PMHX 1ULPA 2HEYF 2TNFA 5T52A 5ERLA 2DUQA 3NKGA 1KS4A 4W50A 2Q1FA 2YFZA 4M3CB 5F32A 2WNEA 1WCDJ 5IWFA 1RL3A 1COV2 3OUHA 2PMWB 4FTBA 4DEVA 4QT6A 4MADA 2YGMA 3L2HA 1QH7A 4ZXEA 2ARBA 3ZN6B 2KR2A 1HRI2 2QVSB 3K2OA 1S0GA 1DU3D 2WZ8A 5L7OA 5TSWA 5CBLA 4BK5A 4QKFA 1LECA 3AXDA 4FXGB 1S0CA 5BNNA 1RMU1 2R073 2RHPA 1EPZA 2W68A 1HQNA 1VBA2 2RS13 1V6IA 1JBCA 1UY2A 2W92A 4MH0E 4UFHA 3J7LA 1ZBA1 4P9IA 5L7OC 1MS9A 1WLCA 4UBHA 3SLIA 4MGTA 3ZFGC 4CCEA 1T6GC 1YHFA 2FMDA 3IPVA 3H1WA 4JAAA 1F15A 4R9DA 4UFMA 1BCXA 4D69A 4EZHA 2HWE3 4D8MA 1PVC1 2PAKA 3NKTA 3VDDC 4CP2A 3T09A 1W6NA 2Q5TA 4AWDA 4W65A 2VZSA 4NPRA 4RD7A 5DAPA 4TLGA 3RRDA 4PF5A 3QH6A 3AB0A 3AC0A 4P14A 2JIJA 3AK0A 2JG9B 3U1XA 1I5PA 2YB7A 3VB9A 1GUIA 4B7EA 4QGNA 4R4ZA 1JHNA 3ZYRA 1QJU2 4YZ3A 2MEV3 1LHWA 3WW2A 1JU4A 1DLLA 3LD8A 2WWJA 4Y22A 4QPGB 1FPN1 1W6QB 3ZFEB 4HXCA 4QDSA 5F8PA 4A41A 3ACGA 4ET7A 2AREA 2D40A 2IXIA 2JE8A 4WM8B 3V64A 1JYCA 1CAXB 1X7NA 2P1BA 3Q8CA 5FYYA 5LBCA 1G9AA 4FPGA 4D6SA 1IQAA 5KHGA 1J1TA 4I30A 2WLQA 1DQ6A 4AQ6A 2DCZA 1W0NA 2QCSB 2BRTA 5JMCA 2JDHA 2ZEYA 3GJBA 2VG9A 4HLTA 4BQ3A 4YZ5A 2RS33 3U75A 4Q4X2 2J1SA 4YWAA 1O5LA 5FP8A 4PDWB 5EYYA 1VMJA 1G9CA 2E63A 3IDBB 3I49A 2HWF1 5EIYB 5ABJA 1TZOA 4NAMA 1ZRFA 2JEMA 1RUJ3 1UYPA 4CA9A 4OFGA 3L2YA 1CAUA 1VBC3 2J1AA 3KF3A 2DUOA 5J98B 1AX2A 1ZRRA 2Y60A 5LB6A 3KHBA 4M4PA 4UAPA 5BNOB 3E97A 1Q8PA 4BQ2A 2W9XA 5FIXA 1FX5A 4CDUB 3JBG3 4N8MA 3LE0A 4N53C 1OA4A 3WDYA 3ZPOA 5A70A 1A34A 3IB3A 1DQ1A 3DPRB 4Q0QA 3WNPA 3ZLIA 5DAXA 5L19A 2ZKLA 2WT0A 5FZ1A 4D94A 1VAVA 5A33A 1C8M1 3DYOA 1OMIA 1QHDA 4Y5TA 4CCMA 1YC61 5A1FA 3TYJA 1B35B 2D3RA 3CIHA 3MYXA 4AFCA 4CE8A 3CBNA 4RN5A 3IDEA 3TWIA 1X8MA 1K5JA 1O4TA 1DCSA 3K3NA 4DEQA 4ASKA 2QDNA 4B29A 4ASLA 3ASIA 4MSVA 1HKDA 1WCQA 4HG6B 4GQ7A 2D6OX 1W04A 2ET7A 3MW4A 1BYHA 2JDMA 3ZDVA 1J3QA 2XQRA 3EMRA 4R8HA 2ZGUA 3A23A 2VUAA 3J8F3 2FCUA 4ATEA 4QQPA 3H8RA 4HFSA 4Q4V2 1Y9QA 2VC9A 4Y1ZA 3S7IA 1REEA 3JU9A 4I09A 4BQ4A 3I2JA 2JDNA 4Q8KA 4IE7A 5FZOA 4ZU5A 3LEGA 3SH3A 2WFF2 5E8AA 4L9BA 1CJDA 3AZVA 5A7WB 3SISA 1AX1A 1W3VA 1WW5A 2XBO3 1UYXA 3GYDA 1MS0A 4QB6A 2VNRA 4I3PA 4YGEA 4NO4A 2RS52 4IE6A 1NX9A 3WHUA 1RUE1 4OUMA 1BMV2 3UGHA 4RS5B 3ROUA 4QQLA 1FAYA 3M1HA 3TN91 5EPAA 3ZDSA 1XE0A 1NZIA 5D8AA 3HJRA 1RXFA 1VE0A 2W87A 4Y20B 3VDAA 1U5XA 1RUI2 2EVXA 4UBGA 1NKGA 1RUC3 3D0JA 4LBQA 2P6HA 3SEEA 2WZEA 4AG4A 4TTGA 3HBZA 5FZGA 3ME2A 5D8AC 4XEZA 3ORJA 4L0PA 1ZBE1 5FO7B 3VZJA 1SPPA 2AR6A 2AGSA 2ADEA 1M06G 4WM7A 2DTYA 1CPMA 5JWPA 2CWSA 4K3UA 4NOTA 5A3LA 5IK4A 2GNTA 5FP4A 2Q30A 2Y34A 4JDOA 3BTYA 2D6PA 3FE5A 3QACA 1QJX3 1K3IA 1O5UA 4O9EA 3VBFB 3N3HA 3PDQA 3K48A 2ILMA 1UPSA 4QPYA 5GZEA 1MVQA 1PO23 4WM7C 3OY8B 1VR3A 4NUBA 4RQPB 1QXJA 3X29B 1BK0A 1LGCA 3H8UA 3ILNA 3H50A 1QQP1 1EP0A 4QXHA 5K0UB 2VZUA 4XUTA 4OQ9A 5LCWL 4K40A 3I3QA 1PM7A 1AXYA 1V0AA 1LOFA 5DZEA 1C28A 2XL7A 3BU7A 4HSJA 5AC92 1AXKA 3W58A 4P9YA 5FXVA 3DN7A 4XAAA 1CGPA 5KXBA 4GJYA 3VZLA 4JHZA 2V5YA 4E4ZA 1NCQB 4AF9A 1A6CA 1OLMA 5M0TA 1LOFC 1L7RA 2MNGA 2B45X 4Q0PA 4XBNA 3RJ2X 1XQNA 2I45A 1KJLA 3ZSMA 1OOPA 4XHXA 3UKVA 3UJOA 2ZPXA 4CCLA 1H4HA 3J26N 5EJZB 3MEPA 4XYXA 4AFDA 1QOOA 2DWRA 2VPVA 3CU7A 3ZIWA 1ULFA 3PUIA 4L2NA 2ZGRA 4IESA 3UL2A 1OOPC 5K7PA 3JZVA 1RMU2 4LXLA 1GZTA 2VGDA 1SMVA 4XJ8A 1YJKA 1ZBA2 4AVTA 1UO9A 4CDXB 4QWNA 1EUUA 2H6CA 1VRH2 2O8OA 5IJRA 2XMLA 5B4NA 2BQPA 1TG7A 1NLSA 2WNUB 2RJKA 5JI7A 1JH5A 4AEDB 1DGWA 2DVGA 4OUSA 2VMIA 1ZX5A 4ZY9A 5I8TA 1PVC2 5CU1A 4GMP3 1OPMA 1W8FA 1JZ8A 3IIAA 1GOHA 3J7NA 4PQQA 1APNA 1OFNA 2VMFA 2YMZA 4UXAA 3K46A 1ENXA 4NHMA 2DBNA 5JUVA 2Q8CA 3HT1A 1A8DA 3IM0A 2XLFA 4BXFA 3GM8A 3ZN5A 2SLIA 2Q0AA 3H8OA 3WW1A 1AR93 3PHMA 3CJIB 1YLLA 2FDIA 3GGLA 2JX9A 1KRIA 2R042 2B5HA 4FPCA 1FPN2 2LROA 4OHXA 1US2A 4QB1A 2XJRA 4PBOA 1CQ9A 2DCYA 4ORFA 3PNAA 1LU2A 2VMHA 3O0XA 3WNMA 5KC6A 1W8UA 1RC6A 3RVHA 2XGXA 1VJ2A 5DAQA 4CP0A 2PHFA 4KBZA 5E1RA 1QU0A 1ZBA3 2OA2A 2RDQA 5FK8A 4NIIA 3OUIA 3B02A 5FYZA 1GZ9A 5FY9A 3WF0A 3MPPG 2WSUA 4H3WA 1GANA 1SFPA 4QHBA 1DYPA 2HWF2 3MO4A 3PU8A 3RI8A 1Z7S1 3BOWA 2XJSA 3N7MA 4P9WA 2OUHA 4RR3A 1LESA 3VL9A 3WQ1A 1L3JA 4XUOA 1PZ7A 1AR73 2P3YA 1LCLA 2VTXA 4M01A 4AQSA 4D0QA 3OJBA 1D4M1 3WQ0A 4BQWA 2F4PA 1YQ2A 1IG0A 1XOYA 1UMIA 4RR3C 1SZBA 2XKOA 1F31A 5DN2A 1R64A 5FY5A 5C8CB 2ZEWA 1URXA 1R091 4QPIA 1CIYA 1WD4A 3CMGA 2LW8A 3HEIA 2BVVA 3AYAA 3PIJA 1YJLA 3LFIA 5FYHA 4A42A 2W1UA 4YFZA 3I3MA 2GMEA 4GKXA 5JLVA 3USUB 4XTMA 1V6LA 1WCUA 1O6UA 2IZWA 1D7PM 1UU6A 1C8NA 2B9UA 2EA7A 4FP3A 4QPIC 1UIKA 2PLV3 3LF7A 2CYFA 4TXWA 4YG3A 5CB7A 4AR2A 4BYYA 1ODMA 1HJFA 1XNAA 4JQTA 1LEDA 5FPVA 1UOGA 3ILFA 3C3VA 3HPNA 4FO9A 3WQ7A 5I0UA 1IS5A 1CPNA 1K5MA 1X82A 2UYAA 4D6QA 3GZEA 3MLKA 3N36A 5E6HA 3AJZA 5IVEA 3VUOA 2I07B 2VZ3A 5BNPA 2C24A 5I93A 4CP9A 1RJ8A 1YUDA 4HL0A 4M0NA 1WMEA 1K5MC 4MVTA 2C1FA 4A45A 1ZRDA 1UY1A 4TN7A 2CU5A 2E51A 4JKKA 1OD3A 4XJAA 1QWRA 5A7SA 3TNPB 3U11A 3T1LA 5BNPC 1LHVA 3BYWA 2VUJA 5ANQA 3ZYJB 3A4UA 4CRQA 1LOAA 4XUNA 3NJZA 3WT3A 4AEJA 1PO13 1W9FA 1MQTB 1KQRA 2DYCA 4RGGA 2BWCA 1NLRA 4FQZA 1KJRA 4BIOA 1GOFA 3OEAA 3AL5A 4FOWA 4I3GA 1RTVA 2ARXA 4R52A 3EYPA 2YBPA 3BTXA 3ZX7A 1MZ5A 2XOMA 3K75B 1LB2A 1RUE2 1GNYA 4MOAA 5JR7B 4AI2A 1N3QA 4CEYA 4GAZA 1XSRA 4DINB 4Q4W3 3TN92 3WXPA 2R071 1NY71 5E16A 5H9QA 3IZOA 5FZEA 5AVPA 2P2KA 4FFHA 4CEYC 3QD6A 3C7GA 3LGRA 2AENA 2XVLA 5A3NA 1C8M3 1OI6A 1ZBE2 3E5QA 3N7KA 3WD5A 1J1LA 3M70A 3VZNA 4C8DA 4FPOB 5IK8A 4NWVA 2A71A 2HWE1 2PQSA 3WDTA 5L7OB 1JZ3A 1YRZA 1UYZA 1O3TA 2ZABA 3HT2A 1UYYA 5BNNB 3OPWA 4IGQA 4MZUA 3VBRA 3JCIA 4QB2A 3ZFGB 1IKPA 1FMD3 2VTXJ 2EIGA 5F7UA 3LA3A 2YFUA 3MUZ1 4FAHA 4X6RB 2WC2A 3IMMA 2GP3A 3OPZA 2BU9A 2HWD1 5GZGA 2X05A 4KG8A 3VBRC 1QQP2 1JYWA 4CXWA 2RV9A 1ZZ7A 1NQJA 3J9SA 3IPVB 4QHOA 1ULOA 4YSFA 2MEV1 5EWSA 1AZDA 1UF2C 3ZN4A 3WX5A 4YARA 4YNIA 1FYUA 1JS9A 3AZYA 3ZXGA 4E2SA 5L36A 2D6MA 3RYRA 4AW7A 3AZZA 1OQDA 2RMU2 2GMMA 1TME3 4FPYA 4DRRA 1OD5A 3OSDA 1G9BA 4W4ZA 3VDBA 1S2BA 1X9PA 5JI9A 1SFYA 2FZ2A 3CZJA 1O3QA 1Q8SA 1RUD3 2ZAAA 3KV5A 1AR61 4LBJA 3BTZA 1F5FA 3I2HA 4I0WB 3THCA 3U10A 1DQ5A 3HNBM 4YGCA 4Y22B 2RS31 4LIUA 5FZAA 3OGVA 2BGOA 3LDBA 3MHZA 2G4IA 3AKSA 3KLSA 1N3PA 2OQ7A 1ONAA 4D3WA 5HXMA 3ST7A 4RQPC 3S7EA 3KF5A 2VL4A 3HQXA 5FDBA 3V0BA 4EJRA 2DU1A 1RUJ1 3T0BA 1GV9A 1UNBA 2ZA9A 1GYKA 2J7MA 5K0UC 1JZ5A 2CV6A 3EJKA 5FBZA 4HANA 2WSVA 2WYSA 1FI2A 2PHLA 4A3ZA 4CCDA 1DQ4A 4D7YA 3U0ZA 3WP3A 3HWJA 4XACA 2WR9A 1UOJA 2VMCA 3ZXLA 5I0SA 3TBDA 4JDNA 3VBOA 1QF3A 1QQP3 3DXTA 3JBG1 4NRMA 2PYTA 4C0HA 1AJOA 1IKQA 1O4YA 3DL3A 1GNHA 1ZZ6A 2ZACA 3BODA 3RG0A 1DIWA 1F4AA 2VU9A 4Q2FA 3D0SA 1YFWA 5A1AA 1NE4A 3VBOC 4FVVA 2Y38A 3W9AA 1JYNA 2BNNA 4GB32 5FZHA 1CAUB 2P3JA 3IWZA 5D1IA 4EWEA 3I2KA 4LE4A 5A1LA 4EQVA 3ZXFA 3T0AA 1XYPA 2CHHA 2VOWA 4LULA 3HQUA 1H9PA 5JXJA 3H9AA 4M3CF 5FZIA 5JVVA 2CL2A 2FMYA 4LKFA 3RZLA 5FLJA 2ZMKA 4AEMA 4EROA 4Q0SA 3K4ZA 4JCKA 2WZR1 4E4DX 5F3CA 1QY4A 5FY1A 4HPKB 2TEPA 3NQHA 3WUCA 2PHUA 3J8F1 3N4MA 2R0FA 2HBUA 3Q8FA 3E5UA 4CDQA 2WNUC 3OYWA 4R9BA 5GLUA 4AHYA 3Q8BA 4Y1VA 2VXJA 1BVP1 3D4KA 4HT1T 1DZTA 1OLQA 1XU2A 2JENA 5T3NA 4ZHNA 1GOGA 3NJXA 3MDPA 5D21A 3WDWA 1LOBA 4QX2A 3ZSKA 4CDQC 5EJ1B 1S0DA 5J7MA 1HDKA 5JIAA 3O1RA 4EN8B 2EXIA 1NG0A 2WL1A 2QQPA 3MW2A 1ZNPA 1W8WA 5A3OA 1DQ0A 4KU8A 1Z7S2 2HYKA 3AP9A 5A80A 2ZGPA 1PGL1 5FYSA 1ULCA 2DTWA 4YVSA 5FPLA 1W39A 2HEVF 1SLTA 3EXUA 2WZPP 1FOD3 1POQA 1D4M2 1DYKA 2QQWA 2RDSA 3IKWA 1W2OA 3KCXA 1YIPA 2QQOA 4YVSC 1HQWA 1YI7A 3GNEA 3SCHA 1R092 1W6OA 5D8AB 3VZKA 1QJX1 2P3KA 4H7LA 2Q8OA 5F5CA 3VBUA 3T0DA 2BNOA 1PO21 2WQ8A 3ZYFA 1S0IA 4WVWA 4KNCA 4A7KA 4AI8A 3H3ZA 1HB1A 2D7FA 2R49A 2JDKA 3VBUC 5C7GA 1SPPB 1S0FA 3EB7A 3GALA 2QQLA 2W3JA 4RHV1 1G6NA 1AYM3 4WM7B 3GBWA 5FYTA 1LOEA 4PF1A 3WG3A 3O1TA 5FZBA 2CY6A 2WS92 3USSA 2BBAA 5KHIA 5ISLA 2H0VA 1T6BX 1W2TA 1LOCA 1SHWB 2VQUA 3LEMA 1Q8VA 4KL1A 4AGRA 4BK4A 1S2EA 3BPZA 3I2DA 3TNQA 2R063 2Z4FA 2ZGQA 4OVEA 1HW5A 4PIYA 4QQ2A 4YGDA 5FY4A 4ZU7A 3O1PA 3AKRA 4GA9A 2ZEZA 4JGZA 1UN1A 4META 5IAXA 3NNFA 1UZWA 5DZFA 2DDUA 2IC1A 4BMEA 2WA4A 4DXRA 5FKBA 2W1SA 4N7UA 2VM9A 2RDRA 3PMEA 5GJ6A 3WLUA 4M3CE 4JGZC 3AXEA 1W8HA 1MZ6A 2E33A 2BFUL 2DBIA 4QPWA 2ZHLA 2GH8A 1RITA 2NM1A 1V9U1 2NYYA 3LA2A 5F2WA 4CPBA 1SCSA 2R072 3ACLA 1NY72 1UU5A 3H8XA 4A7YA 1IPJA 4XCAA 5KHHA 3KV6A 5IVCA 1AL0G 1W0OA 1OOPB 1WBLA 3E1F1 4OZOA 2EXHA 1UOFA 1MS5A 4NRQA 3ZYPA 5KC5A 2D6LX 1QDCA 5JCTA 4LUKA 5C3RA 1UKRA 1KXGA 2W1WA 2L9LA 4JX0A 2HWE2 3KV9A 3RS6A 4GMP1 1R1ZA 5A7PA 2UURA 1MVEA 4V1PA 4BA6A 1W2AX 5FZ0A 5LBBA 3ZYGA 3WW3A 4BH9A 4UF0A 4OUEA 4ZXKA 5JAXA 2J42A 1V6NA 2D3SA 4WZCA 1VBE1 2ENRA 4WVMA 2BUKA 3KGLA 1WW6A 2J1EA 3E6CC 3MPBA 5L73A 5E88A 3KMHA 1JZ6A 4OYUA 4AFBA 2WN2A 3WCRA 4FTSA 2QQJA 2MEV2 5C4WA 2EIDA 1NUKA 4XDQA 4UW3A 3POBA 3UK9A 3I2GA 3QCWA 4CEWA 3V0AA 5EFUA 1C5HA 4AXOA 1L7QA 1MS4A 1Q56A 5FPUA 3BN6A 2VD7A 2WYFA 3KVBA 4CEWC 3B7MA 1UZVA 4LK6A 5T5OA 2FDGA 2D98A 4J1XA 4YW1A 2BOJA 1NCRA 3UETA 1K12A 3KV4A 4XBQA 1LTEA 1FATA 1SDDB 1GR3A 2RS32 4ZKTB 5ACA3 1W9SA 4JZRA 2LS6A 5BNNC 2ADDA 1SBEA 4Q0UA 4OCTA 4RFT0 1ZRIA 3GF6A 4U2AA 3BU0A 1PIV3 1H1MA 1U12A 2WQ4A 4QDRA 5HV4A 1QEXA 1NCRC 4AVSA 4OI0A 2J1UA 1YQ5A 5FK7A 5K4LA 4DQAA 1DBNA 1L7LA 4C0BA 1GP4A 4IE5A 1LHOA 4HN1A 4LTAA 3ZSEA 4K1YA 1RUJ2 5DZGA 1YYNA 4D7SA 3WQBA 2CWMA 1DFQA 4LKDA 4XCBA 3PU3A 1VBC2 2JKBA 1JHJA 3ITQA 1AR71 2VNGA 5JR2A 2YDEA 2V72A 4MGZE 2HWD3 3NV3A 2XXZA 2B8MA 3H7YA 1GICA 1AYN1 3JBG2 1HB3A 4Y1YA 4UT5A 1AL23 2K0GA 2W2IA 2YC0A 5C70A 3O1MA 3K4DA 2Y6HA 1HXS3 4H14A 4XXAA 4LBKA 1LRHA 1OQ1A 1MR5A 2HWB1 1MS1A 3LZZA 3U4SA 4CCNA 3WNNA 1F9KA 1RHI3 4RR3B 4JRAA 2PLV1 4BLJA 3VD7A 2BDRA 3CKHA 3DECA 5DPNA 4GWJA 1STMA 3OGGA 5GLVA 1BBT3 5H9SA 2EICA 1AR63 1P8JA 4L99A 4Q29A 4QPIB 1FNZA 3ZR6A 1O91A 4GWNA 3DGTA 5FYBA 2WZR2 3AZXA 2DVBA 4NJ4A 3LAGA 4M4RA 4COVA 1ZZ9A 4RL7A 3J8F2 3FLTA 4Y1UA 4FQ4A 4JKLA 1XE7A 5SV8A 1CZTA 4I0AA 2LUWA 2PAEA 4XQDA 5LZ6A 4NN0A 2VQ0A 4Y5Z0 1PO11 2VCCA 2D5FA 1J58A 3M4FA 1K5MB 3OBZA 4NHLA 4XFHA 1IPKA 5HCFA 4FBFA 2WINB 2XBO2 5GALA 3P6BA 2JICA 5BNPB 5ABJC 4Z07A 4CP9B 5EZWA 3KCCA 3QLQA 4MXVA 5FPAA 3MF9A 4Q4W1 2PHDA 4DUXA 3DUIA 5GM0A 4CCCA 3ES4A 3THTA 1HLCA 1PGL2 1RUC2 5IVYA 2D44A 3BGAA 5BYNA 1WCKA 5FQ0A 3ZVXA 2A6YA 3CO2A 4HVQA 1Y9GA 2HBTA 3VKNA 2Z5WA 3ACHA 2NMNA 2JB8A 2WKKA 5KWRA 2VMGA 1ZA4A 4CCOA 2VQAA 3PTYA 2V73A 3VHNA 1BZWA 1N47A 4KQ7A 1CZSA 3WW4A 5CYYA 3WV6A 4CEYB 1OF3A 5FPZA 5FO8B 1JYXA 5CG8A 1UY4A 1QJX2 2UWCA 2PA7A 2RR13 1WLDA 4IXLA 3O1OA 1FMD1 1X50A 1NXMA 1PO22 3AMQA 1W2NA 1XYNA 2AACA 2TBVA 3MICA 4JC1A 1PHMA 5EP9A 4P9JA 2VW0A 3BOPA 2WZR3 2C5DA 2VBPA 4KWJA 1H2LA 4LHLA 4E4SA 3QBQA 3LEIA 2ZGOA 4X8PA 1HB2A 2YPJA 5FBJA 3ZSJA 3CL1A 1EPWA 3ON7A 5C3OA 1W9TA 4K9SA 1NLQA 4BOWA 1GFF2 3VBRB 5T55A 3LKJA 2FQPA 1YFXA 3S5QA 3DEMA 2ZMLA 5BPXA 4LHNA 2HYXA 3NV2A 1TME1 1EUTA 2YBSA 2WO7A 4AI1A 3TOJA 4K21A 3OF1A 3SC7X 1DLCA 1I1EA 1H2KA 5IVBA 4NIGA 1UXZA 1RUD1 1O8SA 2CDPA 1BXHA 4CZSA 2J22A 4YPJA 3NV4A 3OEBA 2NQYA 5FYUA 4GXLA 4KWLA 1GP6A 5JMOA 1BEV3 1OVPA 3B94A 1NAEA 5FLIA 2OKXA 3GZUC 1OLRA 4XETA 3TEZA 2VW1A 4HONA 5GZCA 4QXCA 4B1LA 4BPZA 1V9U2 3WG4A 3UV9A 4ONUA 2BGCA 2WA3A 2JG8A 3VHPA 3VN4A 4CUCA 2XJUA 1HRV1 4XBLA 3AP4A 3BVCA 3NNGA 1W03A 3EQEA 4WVVA 4O61A 2AYHA 4WZFA 2XR4A 1W6PA 4YG6A 1ND3A 4U36A 4NIHA 5CADA 2XDVA 3VKOA 1OXCA 4P5YA 1WW4A 3AP6A 3IIIA 2WJSA 4PIXA 3HNYM 4RSUA 3LDKA 5APAA 1YXWA 4RHV3 2GC3A 2VZPA 4HETA 3V0BB 2OQ6A 4NMIA 2WO3A 3VBSA 1ASJ1 2QUOA 2W47A 2W94A 2E7AA 3N9OA 5A7NA 3E6BA 3T2TA 1R1A3 3OUJA 4XABA 2X09A 3WSOA 3POSA 2W5FA 3OCPA 1F35A 3GZTB 4A3XA 2EIEA 3BB6A 3K4AA 1D2SA 1AR92 4I02A 4LBNA 4N9HA 3PUAA 2NLRA 3VBOB 1ULDA 1A78A 4M0HA 3KT4A 3URFA 2VQTA 1POV0 5CISA 1Y43B 2QQVA 5C6CA 3UNPA 1C1FA 1QKQA 2KM2A 2ZAHA 4ZPIA 3WDVA 3FL7A 5DUUA 1SG3A 1WA6X 4R9AA 3OGRA 1V9U3 2AEZA 4BHPA 1KDKA 2R1DA 2X8KA 2PAMA 5A32A 1G7YA 3JQWA 5I0DA 3O7OA 2FCTA 3D3AA 3NSTA 2A1XA 5C71A 2YUEA 3N7LA 4XFGA 2FCVA 1DP0A 3AFKA 1OA3A 2KD7A 2IXHA 5FZDA 1LKNA 3T2PA 4HKLA 4AFAA 1BJQA 4IEVA 4G4FA 4CDQB 3GDBA 3LA7A 3OYWB 1QGLA 2YG0A 1RVF3 1AR72 1UX6A 4K7JA 2PHWA 3VZMA 1VBE3 1VB4A 2VULA 3KT7A 1FOD1 5EV7A 2GN3A 1S1AA 1GZWA 2W1QA 4IETA 4XJWA 5FUPA 3U07A 5FPXA 4CCJA 2YPDA 4QAWA 1W6MA 2EAAA 1I6XA 3FZ3A 4AAXA 2J1RA 5HCBA 3O1SA 2Y6JA 2XLAA 3J7HA 2ZBJA 1GZCA 2E31A 2JWPA 1WLTA 3O0VA 2GSYA 4S2HA 5DDJ1 5T5JA 3CJXA 2ZEXA 3ZFFA 1XXNA 4B4PA 3OBAA 1OT5A 4BDVB 4BQYA 3BCWA 3FN9A 2C6SA 1UZYA 4YVSB 1ZZCA 1UQXA 1YNAA 1OHFA 4H55A 2PLV2 5FMBA 5L9VA 4UI9L 2QQNA 2R6QA 4LO8A 4Q4Y3 4DMIA 3JD73 3VKFC 2XJTA 1TVGA 1XU1A 3ZFFC 5JPNB 1CX4A 2IWGB 4XF9A 3WUDA 5C3SA 3AX4A 1AYM1 4LMFA 2BERA 3TRSB 1W6OB 3WF1A 2OX0A 3DYPA 1YQ8A 1BHGA 1O59A 3OD0A 4H7MA 5CG9A 2BZDA 3VBUB 5FYIA 3SCFA 4FCAA 3WZ1A 1ALYA 3AZWA 4MLOA 4QXKA 5FZ6A 3PLQA 1UCXA 3ZSLA 5KR7A 2R061 2RVAA 1X9TA 4D6RA 2GH2A 2RJLA 3D8CA 4QX0A 5DABA 1FXZA 3FUQA 4O9GA 3M2MA 1LODA 5DUWA 1H6YA 1G8WA 2J1TA 1PO12 4COWA 2ZGTA 3K51A 2IFRA 5LW9A 1ZRCA 1LGNA 2VBDA 4HOOA 5EXOA 3RMYA 4COZA 5FXWA 5C5TA 3ZXKA 3INAA 3O14A 3FFQA 4I01A 1O3SA 3MFAA 3S30A 4DIQA 4I2OA 1YFYA 5DG1A 4RFRB 4Q4W2 4AI3A 1AYN3 4GWMA 3T30A 4AE2A 3VHRA 2Z2SB 2JG9A 3HIFA 4F83A 4JGZB 4IL7A 4L8QA 2HWB3 4HK9A 4UWDA 5FO9B 1HIXA 4SBVA 4C1XA 2RM23 2AEYA 4QU2A 1C8M2 4QPGA 3RQ0A 3MV01 5CNAA 5C3QA 2DCKA 2G9ZA 3AMPA 3VLBB 1PK6A 4CUAA 2B42B 3O0WA 3NW4A 4L92A 1OUSA 5F39A 3AKTA 5E89A 5DAVA 5F2SA 3WG1A 5SV5A 4JTOA 4E4HA 1FMD2 1H9WA 2CAVA 4R4XA 5B4XA 1PK6C 5F5QA 2VVEA 2E7QA 5A6YA 4YW2A 2WBKA 5HCAA 4LIVA 3UKTA 3I7DA 4YYOA 5IVVA 2PHXA 1GBGA 4HN0A 4CSWA 2D5HA 3K3OA 2YC2A 4MHUA 4Y5SA 3IAPA 1R081 4LT5A 4LKSA 5LA1A 2ZX4A 3MIDA 4XFAA 1NA1A 1HJGA 4UF0B 3ENRA 2WABA 2Y0IA 1TME2 4WBBA 4WVMB 1FV3A 4YFWA 2OXBA 2DFCA 2W95A 1SQ4A 1WA4A 5A6QA 1RUD2 3P5BA 4MGQA 2NMOA 1JOBA 2WAOA 1DGLA 4CDUA 1WUVA 1ULGA 3N9LA 2FDKA 1KD7A 5ACA1 1JTZX 1OA2A 3BIWE 4CEWB 2JDPA 3WP6A 1PIV1 4LOTA 3V0AB 1ZZ8A 4HBNA 3M8LA 3AL6A 2R30A 1CN1A 1UMZA 5KBFA 4YGBA 3B93A 4DPNA 2Y6GA 3T1MA 1PMIA 3C7EA 4BJ0A 1MACA 1QJY3 4URTA 3WP5A 2CNAA 5J3UA 3WHTA 1SBFA 1NCRB 2GAUA 4QX5A 4IE0A 2YGLA 1UMHA 2E9QA 1WW7A 2DV9A 1CZVA 2YV8A 5LY2A 4JRLA 2W0XA 2X10A 2A6WA 1C5IA 3ILRA 1AL21 3MUY1 4H2AA 1HXS1 3RGBA 4Z2AA 3TEWA 5I0RA 1RINA 3PMSA 4YVWA 1US3A 3F95A 1RHI1 1W6NB 2FHRA 4JGYA 4LBLA 4QM8A 1RB8G 3FHQA 4C90A 3VKLA 3I97A 5A7WA 3AKPA 3NL1A 1EV13 2LM3A 4OULA 1KITA 2YHJA 5C3PA 1VRBA 3LSDA 1ZM1A 2WNVA 4KGGA 4YVWC 1H2MA 5FZ9A 1BBT1 4JGYC 4PJYA 4CUBA 2XJQA 4RS5A 5FZFA 4DXZA 2YC4A 1PM4A 5JIUA 3ZMNA 4LJHA 1OC1A 2WNOA 3R4DB 1DYOA 4GD4A 2A3XA 4IGPA 2WNVC 2BVBA 4IW3A 4KI5M 4LO7A 5FY8A 4DNYA 4GULA 4XE9A 1W99A 4AVVA 1QXPA 2DFBA 5FZCA 1LNSA 4RA0A 2HWC3 4FOYA 3WNKA 3OPTA 1CAWA 1GQGA 1I3HA 2LALA 1JXNA 1V6MA 2VNOA 1S2KA 2G1MA 3MIHA 3T4HB 5FXZA 3CDZB 1HX6A 1O4ZA 1UL9A 1HRI1 4XZPA 3ECQA 2LTNA 4IEQA 1GLHA 3M3EA 1HRV3 3D6EA 5I91A 3WY6A 1Y3TA 4PI0A 4CU6A 3P1IA 1KFXL 4LPLA 2BWAA 5IT6A 4IV3A 1V6OA 5IVJA 3KM5A 1Z78A 3EBRA 3NO8A 2VO5A 5EQUA 4EN9B 1MZFA 1CX1A 1GWLA 1DF0A 4MO3M 1U5IA 4XXPA 1CESA 1UXXX 1JN2P 2QZ3A 1JODA 2EIBA 2ZX3A 4IV3C 1EAH3 4FAGA 4K6BA 2VR4A 1PX3A 3L9JT 5ABJB 1X8EA 3LOBA 4W8JA 1OUXA 1D0HA 1ASJ3 5AFEA 4XQWA 1UZ0A 4K20A 4CXYA 1FOD2 4OI2A 3ZYHA 2VMDA 3NAPA 4BLIA 5FYMA 1POV1 3WR0A 3LDRA 4CVUA 3UGFA 3ZKYA 5CA6A 3POYA 4COUA 4LORA 4N90A 5GZDA 3NJYA 3IAQA 1PX4A 2RR11 3PUHA 4IE4A 4QX3A 3NAPC 3ZOIA 4AI9A 2JD9A 1ZA7A 4JVAA 2BGPA 3WF3A 2BV4A 2Q8DA 5JPMB 5LATA 2YXSA 1XPWA 1RYYA 3BUCA 5FR3A 4EE2A 5A33B 4NHKA 4TSVA 3PUQA 3S5AA 1JUIA 2QTWB 4GIQA 3UYJA 5LY1A 1QIQA 1K42A 4ZS3A 4EWDA 2IXKA 3J7MA 1AYM2 4AAPA 5CFCA 3BPSA 2EALA 2ATFA 2ZGMA 2PXJA 3MGUA 3RWNA 1MEC3 5T54A 2BJSA 3UKNA 1WZXA 3D82A 4DOUA 1H4GA 2VVFA 4CDXA 5CFCC 3VD5A 4FPJA 2R062 3PTRB 2IVIB 5C5UA 1XB9A 1UX7A 1VMHA 3EHKA 1CVNA 4PLMA 3JB4C 1Q5OA 4Q4X1 4TYSA 1OVSA 3VDCA 3W20A 3OB8A 2FZ1A 3MIFA 3B00A 3A21A 1TMF3 1BEV1 5FZOB 4DRVA 3GCWA 1TE1B 3OBRA 4JKMA 5J48A 4AEKA 4ARYA 3PL0A 4AQ2A 4CUGA 4ZZ8A 2WO2A 2C26A 4XAEA 4QM9A 2VZRA 1J3PA 3I3EA 1GP5A 3Q8AA 3R05A 5FY7A 4Z92B 1RUH1 1OLME 2R1BA 4XMAA 2EF6A 5DDJ3 4ATFA 4O65A 3MIGA 1BKZA 4QGLA 1U5YA 1EY2A 1UY3A 1F4HA 2CAUA 4LBQB 1WCSA 3NWKA 3B01A 4PBPA 2O0OA 5FYCA 4A6OA 4NPMA 1W3XA 4HK8A 4UOJA 4YW6A 1H0BA 4OI4A 1K45A 4QHZA 1XNCA 4XDOA 4NROA 3RDIA 4E8DA 4GH4A 1YEWA 2XVKA 1DZQA 1W8ZA 4XUPA 3GHNA 4XIKA 3MIBA 2H6BA 3ALQA 3AP7A 1E5IA 4MGYE 4ARXA 5A3MA 5IYYA 2Y64A 3APBA 1R1A1 4NE9A 1RUF3 4AGGA 1REFA 4GH4C 5CVRA 5BY5A 1N1YA 3RNSA 1W6PB 2C0ZA 1ND3B 4A7ZA 4DFSA 5LK7B 4BXSV 2VOVA 1LGBA 5G05L 4CTEA 1UKGA 1A3KA 5HV0A 4SLIA 1W05A 3N9NA 4QXBA 1N3OA 1AXZA 1UIJA 3IT8A 4MUVA 1QJZA 3SH5A 1ZREA 4KWKA 2ID4A 1JZ7A 4Q27A 3VBSB 3WNOA 2W46A 5J1XA 2W52A 3KWVA 4Z1VA 2GC1A 3PVOA 2WFF1 3DF0A 3G7DA 2PN5A 5BNQA 3ZPYA 2NN8A 2QQMA 3RYPA 4CU9A 2O14A 2WDBA 4F7ZA 1AUYA 1BVVA 1XE8A 1QDOA 5A3UA 2JKXA 5JZGA 1VBB1 4HZFA 5ACA2 1FNYA 1JI6A 4W6XA 5IK7A 2ZHKA 5DXDA 5FZ4A 1PIV2 5I8YA 2UY9A 2AUYA 1RUI1 2HKXA 5F9TA 2X5IA 2PHTA 4ZZ5A 4NHYA 3SCGA 3HN1A 1BQPA 3GBGA 5JZGC 4LEJA 2GU9A 4BWOA 1QNWA 1CIWA 5T5LA 5K9YA 1SLLA 2ZXQA 2MPFA 2WWUA 3NNLA 1TNRA 4UW6A 1RVF1 2I74A 2X5IC 5A32B 3A0KA 3S0MA 3TEYA 4LHKA 2JECA 3FX3A 4HKWA 5C33A 2Q4SA 4BQ5A 4OMDA 2HWD2 3H3LA 3AYEA 3ZM8A 4RGKA 5J36A 4N43A 1AL22 4Y24A 2A3YA 1HXS2 2B9VA 2GC0A 3SMHA 1YQCA 3AKQA 1FV2A 1R083 1V00A 1UZZA 3BKZA 4LOSA 1QH6A 1VBD3 3GBFA 4N43C 4AI0A 1LEMA 4CDWA 1RHI2 1RUG3 5FOJB 3FLRA 2A6ZA 1MQTA 4J1WA 3HVDA 5G04L 1W8TA 2VNVA 5C4WC 4DY5A 4Q4Y1 1WKYA 5AC91 3JD71 1XC6A 2C9KA 5LEJA 1OH3A 1SFNA 1GZWB 1ZYBA 4CDWC 3WP4A 1BBT2 1W6MB 2QQKA 2BW8A 2JD4A 3KVAA 4IEYA 4LE3A 1AR62 5CAZA 4DY3A 2Z79A 4OLLA 5FYVA 2LRPA 2DCJA 2VMEA 4JQRA 5FPBA 2OYZA 3ZFFB 2ZOEB 3RZZA 3PVNA 3WCSA 5HCHA 3IBMA 3C7FA 5IVFA 3RPQA 1NE6A 1NOVA 1Y4WA 2P3IA 5HI0A 1AR83 4YZ2A 4COYA 1PMJX 4CCKA 4FPFA 1ENRA 1QXRA 3RZJA 3U78A 1QOTA 3ZFGA 2XKPA 3I2OA 2CGNA 3PIGA 3RZGA 1LULA 4E8CA 3THPA 4DUWA 3UT0A 4G3YC 3VDDA 1DZRA 5LASA 2R16A 1VRH1 3WINE 2HEWF 4GJZA 3U4XA 4BM8A 5J96B 5A3PA 3AJYA 4BCUA 2IVJA 5FFOC 4CP1A 2RM21 2WAAA 2JB4A 4KBBA 4HMZA 1VALA 5F3GA 4CXXA 3CNAA 5B2GB 3NV1A 4UFIA 3A7QA 1ZVFA 1XNTA 2VOTA 2XUMA 4CPBD 3VGIA 1DDLA 1PNGA 4XF4A 4S2GA 4XILA 2FDFA 5KHKA 1KDMA 2RR12 4LKEA 4YG0A 4AVAA 3AM2A 4DS0A 3M3OA 3ES1A 4INDA 2CGOA 2ZGKA 5KHJA 1QMJA 4Z2WA 2ZKNA 2A5ZA 4UFJA 3ABZA 5FJHA 4DXSA 2D97A 5EYXA 2R041 4EWAA 2QE3A 1A8MA 2N7GA 5ANNA 2IXJA 5JSOA 4B3NA 4EYUA 5C9AA 1COV3 1IG3A 1JYTA 4AHWA 1VP6A 2VZVA 3ETPA 4NAOA 1PK6B 2ZMNA 4QGMA 4EN7B 2D3PA 3RMXA 2XWJB 3HQRA 4FFGA 2EAKA 3H1MA 4NHXA 4KG0A 1AVBA 1HRI3 2YZ4A 5CZKA 5LK5A 3ETQA 3N9MA 3FC0A 3LB9A 3N9PA 4M00A 4WV8A 2Q8EA 5C9AC 1E5HA 2AC1A 2A6XA 3CF6E 1IPSA 1GSLA 4LO5B 1QJFA 4MX3A 1VBA3 4QQHA 4QMAA 4KWUA 3SKJE 1Y7BA 2ZTNA 1UY0A 4XFFA 3RFRA 3BIEA 3RZKA 1B09A 2ZZQA 5FZ8A 1IQDC 3LQCA 3B3QE 2WLPA 3GXUA 4Q5OA 4B7KA 3VZOA 2A3WA 4YZ4A 2XHNA 1CWPA 3N35A 4AGVA 4K1ZA 4MXWA 2KXLA 4EZ4A 1YCIA 1BEV2 1QOSA 3POEA 3WDUA 3TEXA 1RJ7A 2QQUA 1NA1B 3C8XA 2DURA 2OUJA 1T2XA 2FDHA 2GC2A 2UU8A 3FFZA 4QU1A 1LJ7A 1NYWA 2D43A 1MS3A 5J37A 1J59A 1POV3 4LR4A 3WG2A 1OSGA 3S57A 5CEHA 1YI9A 4N53A 1GKBA 1RUH2 4QKBA 5LA9A 5CFDA 2WIIB 1QJY1 1JW6A 5FY0A 2DVFA 4MGKE 4OZXA 3T2QA 2TUNA 1W28A 3SNMA 1QJU3 4MG2A 3NNMA 5CFDC 5JOYA 4IEWA 2GALA 5BUVA 1C3HA 3AYDA 4HPKA 5F6LB 2D6KA 1W8OA 1RUOA 2R0HA 2I2SA 3F2ZA 2EXKA 4RHV2 2BEOA 3POFA 5IK5A 4S2FA 1NT0A 2R7EB 1O8PA 2W91A 3DYMA 1Y9MA 5DQ0A 4F3JA 5A6ZA 4AZZA 3JXSA 1R1A2 1SEFA 4HVRA 3O5SA 1NZCA 1CR7A 2ZS6B 3T2OA 1OFSA 1EV11 1HN0A 1KS5A 5LBFA 3KZ4C 3QH7A 5LRSA 3E6DA 1I9RA 1QJEA 5JOWA 5LEKA 3AFGA 5DUVA 5FZ7A 1GWKA 3NJVA 4Q4X3 2JDUA 2BYVE 5T5PA 3HNMA 2YYOA 4Q0VA 2VECA 1Q8QA 3I8TA 3POGA 3K77A 5A3TA 5F37A 1AX0A 1PGW1 4YVWB 2DVDA 1NQDA 2SBAA 4JGYB 4TWTA 3KHCA 1UU4A 2G9FA 4PCRA 1XNKA 1H8TA 2W39A 2HWC1 3HN3A 4YW7A 3O12A 4IV1A 2V09A 4DXTA 3OGJA 4KMQA 2OVUA 2WNVB 3CEWA 3I59A 3J4UH 5FREA 3VD3A 4XPVA 1IS4A 1RUH3 3V65A 4XF1A 1H8TC 1VBB2 1Z0HA 3I2IA 4KU7A 4IV1C 1OQEA 2ORXA 3NMBA 4J25A 4XDPA 1RXGA 1JOJA 5CIRA 1M4WA 4QX8A 1SLIA 1UPIA 3AVSA 4IQPA 2JJ6A 2JG8C 3VD4A 3I3DA 3FLPA 5IAVA 4XIOA 2YBKA 3LSEA 5GLTA 2XG3A 2DU0A 1CAWB 1U5ZA 3FUOA 1ND3C 1EAH1 4XJZA 3QOPA 1RVF2 1OBNA 4BQ1A 4EN0A 2GZWA 3WF2A 1VBE2 1WLWA 1ENSA 1RGSA 1H6XA 4FT8A 3VD9A 2ARAA 2C9AA 4FPHA 3LWCA 1IHMA 4IV3B 4KH9A 1SLCA 4QD2A 4S2DA 5FLHA 5FP7A 4YZ1A 1IOAA 3VBSC 2VCBA 3SKVA 1S0JA 3VBHA 4FOQA 1ST8A 2QKDA 2EXJA 3ZXJA 3WOGA 1S55A 4FOVA 4C1WA 2A7AA 2A70A 2XLGA 3B5LB 3P3PA 4Q4V3 3VBHC 4PIZA 4XVHA 4TLFA 1C1LA 2V4AA 5T50A 3A0NA 4Q4Y2 3JD72 1VIWB 4P02B 2F4LA 2QJVA 2JDZA 2UWBA 2WFF3 3NAPB 3U37A 1F8VA 1UWWA 1V70A 3KD4A 4XC9A 5F3IA 5IW0A 4B4RA 1Q3EA 1AHSA 4YRDA 4YM1A 2RMU1 4XW3A 2WUHA 2RS53 1J83A 1MEC1 1SLBA 5LA0A 1PGSA 1AF9A 4YM0A 1VBB3 1CAVA 2QBXA 4I0BA 3R4SA 4LA2A 3C7OA 4JDMA 1GQHA 1RUI3 2P4EA 3AYCA 2VOKA 2VJXA 3SEPA 1LHNA 1VMFA 3B69A 3I54A 4LLOA 3UJQA 1YWKA 1E57A 5FXXA 4B4QA 4P00B 2WWSA 2XJPA 2CTVA 4PLOA 4QQOA 1XNBA 1WMDA 5CFCB 2VY0A 2Y6KA 1SACA 1TMF1 2FD8A 4FP2A 4XOGA 5KXEA 4W6YA 2IUWA 1JYVA 4BB3A 3KB5A 3CHXA 1E5RA 2IXCA 3ZKUA 3RJRA 3M3CA 2K46A 1YO8A 2OZJA 3OG2A 2E32A 4FFFA 4EN6B 1AYN2 3M3IA 2YROA 3T4VA 1NXD1 1V6KA 3WNXA 4AHXA 3WDXA 2VCMA 1ND2A 3MI8A 5DAWA 4A44A 4FFIA 3KS7A 4PHZA 4Y26A 4D7TA 1GMMA 2HWB2 2PHRA 4LBQD 3H42B 2RM22 4M3CA 4XUQA 3NRUA 5IATA 1TNFA 1ND2C 5H9RA 5BXXA 3MLLA 4YM3A 4BMBA 3LPFA 4AHZA 3HOBA 5HPOA 5AC93 2DCTA 2MHFA 3OGSA 2V4VA 4GB31 2Y6FA 4PT6A 3BTAA 3ZN6A 4NVPA 4YW5A 1WBFA 3POIA 1D4VB 4IERA 1D0GA 1SBDA 2G19A 4OQ8A 5FCCA 3HR9A 4PQ9A 1RUF1 4X6QB 4UW5A 5FOBB 4XHBA 2R32A 3OD4A 5LWBA 1GQPA 4Z82A 2VOXA 2ZHMA 2PTMA 3C7HA 2XPJA 5JOXA 2B7YA 1IS3A 4P08A 2Q1ZB 5DMYA 5JSRA 3VHOA 4IEZA 2JDAA 4GH4B 3DKWA 4MYEA 3UESA 3SH4A 5A7OA 3LCPA 4ITCA 4P9GA 1RMU3 3WF4A 2OT7A 5F6KA 1H1AA 1KGYA 3A22A 1QNYA 3PJYA 4XTPA 2XONA 2WQZC 5A3WA 4FI9A 2UYBA 1DG6A 3JB8A 2WRAA 1VRH3 1FT9A 1JUHA 1IGOA 5JXHA 3B9IA 3ZYIB 3MZHA 4IEOA 2ZHNA 5CKMA 3WNLA 3DV8A 2ARCA 2WN3A 1H2NA 1PVC3 1TEIA 3PVBB 1LU1A 1W6QA 3ZFEA 2JG9C 2CDOA 1F2NA 4ZU4A 1G9DA 1O7FA 1WMXA 1W9YA 1H1IA 3FBMA 4WM8A 2E7TA 4V2VA 2OPKA 1CAXA 1OH4A 4YLZA 4KGQA 5AVAA 1XJAA 3H7JA 3PJQA 1RIRA 2E53A 2GNMA 4IEUA 2HJIA 4QPGC 3ZFEC 4CU7A 1QJY2 4WM8C 4P5HA 3LEKA 4LK7A 3D5OA 5JZGB 4PI2A 3HBKA 3O1UA 2Y8KA 3HD8B 2F6BA 1CJPA 2R043 2NP0A 4UYBA 3KT1A 1FPN3 3PURA 5FUNA 4NPLA 4A6SA 1O3RA 1OKQA 1OPOA 2X5IB 3JQXA 4Y3OA 1LHUA 2AH2A 4PDWA 1J3RA 4IGOA 3CQOA 3IN9A 1G9FA 4Y1XA 4XJ9A 1VBD1 2VTFA 5I8SA 4LQRA 4JHTA 3ACFA 1RUG1 2VZQA 4J6GA 4LBOA 1WGPA 1J84A 3E5XA 4PDWC 2A75A 1EV12 4L11A 2WS91 4JV4A 3IDCB 1KEXA 2ZJCA 4OMCA 1NA1C 3S6PA 4GMP0 4N43B 1WD3A 5BNOA 3MIEA 2XB6C 3ELNA 4K8FA 2ZX0A 2RDNA 5CKQA 3KCYA 3LOIA 1E5SA 4LA3A 4RGAA 1N1TA 1UD1A 4IDZA 2BNMA 5C4WB 2ZX2A 1W8NA 2HWF3 4DB5A 3RSJA 1PZ9A 4W6WA 1JMUB 1PGW2 3DPRA 5BNOC 2QZ2A 4CDWB 3ZXAC 1IS6A 4MHRA 1TQ5A 4QKNA 5LBEA 2HWC2 4FXKB 4CDUC 1D2QA 3T3YA 1OF4A 4XQ4A 4AQTA 2OIIA 4AVBA 1VAMA 4G9SB 3DPRC 1AR81 1B35A 1XSQA 1HRV2 3HAGA 2Q1MA 2VBBA 5FUIA 3ZXDA 2B39A 5FP9A 4B1MA 1WWYA 2RS11 4DO0A 3W5NA 5KXCA 3M3QA 4NIAA 4OI1A 1B35C 3ZXEA 2VW2A 1Q43A 2E26A 3GJAA 3MBWA 1PVXA 2Z69A 4HKOA 3MLJA 3VL8A 4ES9A 5D2AA 1EAH2 4HSLA 3POJA 2DF7A 3NNJA 4RYDA 1LOGA 2B4KA 5FRAA 5J09A 1UW8A 2VCAA 2A73B 2WT2A 1ASJ2 2VXRA 2QNKA 3N7JA 4Y33A 5A6XA 5F5IA 5DG2A 5FZKA 2DVAA 1OKOA 2XQXA 1LAJA 4LLFA 1LENA 3BALA 4LO4B 1REDA 2C4XA 4IEXA 4YW3A 3VKMA 5AFBA 2WFPA 3PUSA 3FJSA 1MPXA 1ULEA 1OURA 2FBEA 2BOIA 3VDDB 4R9CA 3M7AA 1RUNA 3HMYA 2P37A 4DUVA 1W2UA 1KFUL 5JXIA 5LRRA 2KA3A 1SCRA 3KGZA 3FWEA 1H30A 4Y20A 1X33A 3GCXA 4P9XA 4RS5C 4Q1PA 1COV1 3N9QA 1JZ4A 4QDQA 1JOPA 4AVCA 2Y33A 3PVEA 4MGSA 1GWMA 1I5ZA 2X29A 4GWIA 5IFPA 1MEC2 1RUE3 2Y6LA 1CD3G 5L9BA 4Z8BA 1N1SA 2XHKA 2XUEA 5FKCA 3TN93 1JYIA 3Q8EA 3VBFA 1VBA1 5GLZA 4DZGA 2OPWA 2VH9A 4GALA 2XVGA 3OTFA 4XF3A 3OY8A 3SXWA 1AJKA 2JIGA 3B9CA 3LFMA 4RQPA 2CGPA 4QX7A 2GN7A 3W59A 3THDA 4BQXA 4Q1RA 5C9AB 4NWWA 4QKDA 5JDBA 4LO6B 3VBFC 2ETEA 5K0UA 3SQOA 3MF6A 1ZBE3 2W08A 3KSCA 4FTEA 3LIHA 1TMF2 1UOBA 4Q26A 5FJKA 5EHDA 1GU3A 4OHWA 2PQQA 2XJVA 2ZCWA 3H0OA 3GZAA 3KQ4B 5FMCA 5FWEA 1VBC1 2JE9A 1MS8A 1X36A 2A6VA 1NCQA 4AL9A 2O1QA 1HN1A 5L9RA 3G6JB 4AFMA 1WMFA 3R0RA 3BI3A 5DDJ2 2VAUA 2AZ5A 2JE7A 3WEZA 4A4AA 2BTVC 5FQ0B 2YU1A 4MXWB 2ES3A 1NCQC 4N9IA 1S4CA 4ES8A 5FZMA 2DUPA 1QJU1 2GP5A 4YW4A 3ZIXA 1W06A 1VPHA 2ZGNA 3DCQA 5FMDA 2VZ1A 4PLNA 2VUDA 1YIFA 1ENQA 2ZGSA 4N53B 1XBFA 2RMU3 3FMGA 2ZZJA 3KQRA 4AK3A 3O1VA 2HH9A 4Y4RA 4GKYA 2D93A 2P34A 5CFDB 4XURA 4CU8A 2OZ6A 3W5MA 1RUF2 2Y0OA 3LPGA 5C8WA 2ET1A 4NRPA 4UW4A 4E2GA 2XH6A 4MV2A 3ZR5A 2BP6A 2QDRA 2Z42A 2VVDA 3GHMA 4ISRA 3AMNA 2WNUA 3JUUA 3TAYA 2H0BA 3RYKA 4AEDA 2ZGLA 1GNZA 3C2UA 4OHYA 4CDXC 2OW4A 1HV0A 3AVRA 2WT1A 1N1VA 3MFCA 5FZ3A 4AYUA 4BIFA 2BPA2 1W9WA 4LUMA 1U0AA 2PFWA 4K8RB 4IUGA 5HXVA 3DKQA 4BE3A 3AMMA 4LBMA 2QFEA 4P9LA 3VV1A 4AEDC 4E27A 1C57A 1SLAA 5JXGA 2V5DA 4FPEA 1DGWX 4QX1A 1S0BA 1XYOA 2XBO1 2QQIA 2VZOA 4XFCA 5FAXA 2O8QA 4C91A 4WVZA 4XFBA 5FWJA 2K2SA 3CJIA 4JTNA 2GNDA 2IXLA 4MGIE 5FMOS 4E9KA 4Q8LA 4BU2A 1RUC1 5IUQA 1H8VA 5F3EA 4XF0A 1JU3A 3CJIC 2JDYA 2NPIA 2G9GA 3ATGA 1H8TB 4GB33 3SHRA 5GZFA 4V2WA 4XJUA 2VUCA 4FPKA 1UAIA 2B46X 4IV1B 4Y4YA 1HV1A 3MW3A 4ZS2A 5K8SA 2JG8B 1ACCA 3I59B 2BFUS 3WVJA 4YM2A 2GNBA 4B8EA 4NIDA 3LIGA 1F5JA 3I4IA 2UWAA 4CYDA 4GZ9A 3RI9A 1S0EA 4L97A 5FZLA 4UFLA 1BK1A 2YY1A 1PNFA 3EO6A 1SDWA 2FDJA 4X8NA 1YQ6A 5A7QA 5F1RA 1W90A 1R082 3R4UA 5I0TA 1VBD2 1DGRN 2K9ZA 2Y26A 1RUG2 1VB2A 1DQ2A 2GDFA 2X53S 2ZX1A 4O7XA 4Q4V1 2NZ9A 2VZTA 3FHAA 3I3BA 1PZ8A 2UY8A 4ASMB 3ZYBA 3RZHA 2RE9A 5DUXA 3IMNA 4XFIA 2F17A 3P3NA 3OBTA 3CZUA 4XMIA 2RS51 3MV11 5LA2A 2OS2A 3VBHB 4XZUG 5FMOL 3T08A 5C8CA 2J1VA 5IHRA 1BMV1 1MZEA 4A2UA 3V56A 2XL9A 2WO1A 3SITA 1CONA 2RJ2A 2ORZA 4E2QA 5BV6A 2CSGA 1Z7S3 3H1YA 3USUA 4ZONA 1DHKB 4OHVA 1HB4A 4BISA 5C8CC 3OOXA 4NR1A 5F5AA 2E6VA 3FBYA 3W21A 3TB0A 4FSJA 1AR82 1YFUA 5FV3A 1LR5A 1D4M3 3ZO0B 1ZZBA 4HVOA 4URAA 4LITA 1C4RA 1W0PA 2RS12 5KXDA 4ISQA 1R093 3NVCA 5H9PA 1CAVB 3ACIA 4LHSA 2PELA 3U14A 4OHZA 3UGGA 2ERFA 4IEPA 1V6JA 3I2FA 3H3UA 4LNVA 1VAKA 3AMHA 1JZ2A 2D6NA 5JSPA 3RWKX 4N7IA
chains in the Genus database with same CATH topology
1XBFA 2P6HA 1VMJA 1VMFA 2CU5A 2P6CA 1VMHA 1VE0A 1VPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBF A;  2P6H A;  1VMJ A;  1VMF A;  2CU5 A;  2P6C A;  1VMH A;  1VE0 A;  1VPH A; 
#chains in the Genus database with same CATH topology
 5CKN A;  4BZ4 A;  1XND A;  2XWB B;  3R6S A;  2HLE A;  2P17 A;  4AOC A;  1VLN A;  3CLP A;  4TZD A;  1HQL A;  4EV0 A;  3FHI B;  5FTT C;  4FPL A;  1EYB A;  5HBA A;  5IFT A;  2WS9 3;  2YU2 A;  2GMP A;  1Q8O A;  1ODN A;  2JXA A;  2P6C A;  1XRU A;  2RG4 A;  1BLZ A;  2VE1 A;  3DXU A;  3IDA A;  5EJ3 A;  3AP5 A;  5FP3 A;  4UFK A;  3ZMO A;  1G86 A;  1MQT C;  1IZ3 A;  5JOZ A;  2IFW A;  3RZM A;  2BBV A;  5GLW A;  5GKA C;  2P5B A;  3Q9O A;  1DGR A;  1ND2 B;  4F8A A;  1AR9 1;  3POW A;  1PMH X;  1ULP A;  2HEY F;  2TNF A;  5T52 A;  5ERL A;  2DUQ A;  3NKG A;  1KS4 A;  4W50 A;  2Q1F A;  2YFZ A;  4M3C B;  5F32 A;  2WNE A;  1WCD J;  5IWF A;  1RL3 A;  1COV 2;  3OUH A;  2PMW B;  4FTB A;  4DEV A;  4QT6 A;  4MAD A;  2YGM A;  3L2H A;  1QH7 A;  4ZXE A;  2ARB A;  3ZN6 B;  2KR2 A;  1HRI 2;  2QVS B;  3K2O A;  1S0G A;  1DU3 D;  2WZ8 A;  5L7O A;  5TSW A;  5CBL A;  4BK5 A;  4QKF A;  1LEC A;  3AXD A;  4FXG B;  1S0C A;  5BNN A;  1RMU 1;  2R07 3;  2RHP A;  1EPZ A;  2W68 A;  1HQN A;  1VBA 2;  2RS1 3;  1V6I A;  1JBC A;  1UY2 A;  2W92 A;  4MH0 E;  4UFH A;  3J7L A;  1ZBA 1;  4P9I A;  5L7O C;  1MS9 A;  1WLC A;  4UBH A;  3SLI A;  4MGT A;  3ZFG C;  4CCE A;  1T6G C;  1YHF A;  2FMD A;  3IPV A;  3H1W A;  4JAA A;  1F15 A;  4R9D A;  4UFM A;  1BCX A;  4D69 A;  4EZH A;  2HWE 3;  4D8M A;  1PVC 1;  2PAK A;  3NKT A;  3VDD C;  4CP2 A;  3T09 A;  1W6N A;  2Q5T A;  4AWD A;  4W65 A;  2VZS A;  4NPR A;  4RD7 A;  5DAP A;  4TLG A;  3RRD A;  4PF5 A;  3QH6 A;  3AB0 A;  3AC0 A;  4P14 A;  2JIJ A;  3AK0 A;  2JG9 B;  3U1X A;  1I5P A;  2YB7 A;  3VB9 A;  1GUI A;  4B7E A;  4QGN A;  4R4Z A;  1JHN A;  3ZYR A;  1QJU 2;  4YZ3 A;  2MEV 3;  1LHW A;  3WW2 A;  1JU4 A;  1DLL A;  3LD8 A;  2WWJ A;  4Y22 A;  4QPG B;  1FPN 1;  1W6Q B;  3ZFE B;  4HXC A;  4QDS A;  5F8P A;  4A41 A;  3ACG A;  4ET7 A;  2ARE A;  2D40 A;  2IXI A;  2JE8 A;  4WM8 B;  3V64 A;  1JYC A;  1CAX B;  1X7N A;  2P1B A;  3Q8C A;  5FYY A;  5LBC A;  1G9A A;  4FPG A;  4D6S A;  1IQA A;  5KHG A;  1J1T A;  4I30 A;  2WLQ A;  1DQ6 A;  4AQ6 A;  2DCZ A;  1W0N A;  2QCS B;  2BRT A;  5JMC A;  2JDH A;  2ZEY A;  3GJB A;  2VG9 A;  4HLT A;  4BQ3 A;  4YZ5 A;  2RS3 3;  3U75 A;  4Q4X 2;  2J1S A;  4YWA A;  1O5L A;  5FP8 A;  4PDW B;  5EYY A;  1VMJ A;  1G9C A;  2E63 A;  3IDB B;  3I49 A;  2HWF 1;  5EIY B;  5ABJ A;  1TZO A;  4NAM A;  1ZRF A;  2JEM A;  1RUJ 3;  1UYP A;  4CA9 A;  4OFG A;  3L2Y A;  1CAU A;  1VBC 3;  2J1A A;  3KF3 A;  2DUO A;  5J98 B;  1AX2 A;  1ZRR A;  2Y60 A;  5LB6 A;  3KHB A;  4M4P A;  4UAP A;  5BNO B;  3E97 A;  1Q8P A;  4BQ2 A;  2W9X A;  5FIX A;  1FX5 A;  4CDU B;  3JBG 3;  4N8M A;  3LE0 A;  4N53 C;  1OA4 A;  3WDY A;  3ZPO A;  5A70 A;  1A34 A;  3IB3 A;  1DQ1 A;  3DPR B;  4Q0Q A;  3WNP A;  3ZLI A;  5DAX A;  5L19 A;  2ZKL A;  2WT0 A;  5FZ1 A;  4D94 A;  1VAV A;  5A33 A;  1C8M 1;  3DYO A;  1OMI A;  1QHD A;  4Y5T A;  4CCM A;  1YC6 1;  5A1F A;  3TYJ A;  1B35 B;  2D3R A;  3CIH A;  3MYX A;  4AFC A;  4CE8 A;  3CBN A;  4RN5 A;  3IDE A;  3TWI A;  1X8M A;  1K5J A;  1O4T A;  1DCS A;  3K3N A;  4DEQ A;  4ASK A;  2QDN A;  4B29 A;  4ASL A;  3ASI A;  4MSV A;  1HKD A;  1WCQ A;  4HG6 B;  4GQ7 A;  2D6O X;  1W04 A;  2ET7 A;  3MW4 A;  1BYH A;  2JDM A;  3ZDV A;  1J3Q A;  2XQR A;  3EMR A;  4R8H A;  2ZGU A;  3A23 A;  2VUA A;  3J8F 3;  2FCU A;  4ATE A;  4QQP A;  3H8R A;  4HFS A;  4Q4V 2;  1Y9Q A;  2VC9 A;  4Y1Z A;  3S7I A;  1REE A;  3JU9 A;  4I09 A;  4BQ4 A;  3I2J A;  2JDN A;  4Q8K A;  4IE7 A;  5FZO A;  4ZU5 A;  3LEG A;  3SH3 A;  2WFF 2;  5E8A A;  4L9B A;  1CJD A;  3AZV A;  5A7W B;  3SIS A;  1AX1 A;  1W3V A;  1WW5 A;  2XBO 3;  1UYX A;  3GYD A;  1MS0 A;  4QB6 A;  2VNR A;  4I3P A;  4YGE A;  4NO4 A;  2RS5 2;  4IE6 A;  1NX9 A;  3WHU A;  1RUE 1;  4OUM A;  1BMV 2;  3UGH A;  4RS5 B;  3ROU A;  4QQL A;  1FAY A;  3M1H A;  3TN9 1;  5EPA A;  3ZDS A;  1XE0 A;  1NZI A;  5D8A A;  3HJR A;  1RXF A;  1VE0 A;  2W87 A;  4Y20 B;  3VDA A;  1U5X A;  1RUI 2;  2EVX A;  4UBG A;  1NKG A;  1RUC 3;  3D0J A;  4LBQ A;  2P6H A;  3SEE A;  2WZE A;  4AG4 A;  4TTG A;  3HBZ A;  5FZG A;  3ME2 A;  5D8A C;  4XEZ A;  3ORJ A;  4L0P A;  1ZBE 1;  5FO7 B;  3VZJ A;  1SPP A;  2AR6 A;  2AGS A;  2ADE A;  1M06 G;  4WM7 A;  2DTY A;  1CPM A;  5JWP A;  2CWS A;  4K3U A;  4NOT A;  5A3L A;  5IK4 A;  2GNT A;  5FP4 A;  2Q30 A;  2Y34 A;  4JDO A;  3BTY A;  2D6P A;  3FE5 A;  3QAC A;  1QJX 3;  1K3I A;  1O5U A;  4O9E A;  3VBF B;  3N3H A;  3PDQ A;  3K48 A;  2ILM A;  1UPS A;  4QPY A;  5GZE A;  1MVQ A;  1PO2 3;  4WM7 C;  3OY8 B;  1VR3 A;  4NUB A;  4RQP B;  1QXJ A;  3X29 B;  1BK0 A;  1LGC A;  3H8U A;  3ILN A;  3H50 A;  1QQP 1;  1EP0 A;  4QXH A;  5K0U B;  2VZU A;  4XUT A;  4OQ9 A;  5LCW L;  4K40 A;  3I3Q A;  1PM7 A;  1AXY A;  1V0A A;  1LOF A;  5DZE A;  1C28 A;  2XL7 A;  3BU7 A;  4HSJ A;  5AC9 2;  1AXK A;  3W58 A;  4P9Y A;  5FXV A;  3DN7 A;  4XAA A;  1CGP A;  5KXB A;  4GJY A;  3VZL A;  4JHZ A;  2V5Y A;  4E4Z A;  1NCQ B;  4AF9 A;  1A6C A;  1OLM A;  5M0T A;  1LOF C;  1L7R A;  2MNG A;  2B45 X;  4Q0P A;  4XBN A;  3RJ2 X;  1XQN A;  2I45 A;  1KJL A;  3ZSM A;  1OOP A;  4XHX A;  3UKV A;  3UJO A;  2ZPX A;  4CCL A;  1H4H A;  3J26 N;  5EJZ B;  3MEP A;  4XYX A;  4AFD A;  1QOO A;  2DWR A;  2VPV A;  3CU7 A;  3ZIW A;  1ULF A;  3PUI A;  4L2N A;  2ZGR A;  4IES A;  3UL2 A;  1OOP C;  5K7P A;  3JZV A;  1RMU 2;  4LXL A;  1GZT A;  2VGD A;  1SMV A;  4XJ8 A;  1YJK A;  1ZBA 2;  4AVT A;  1UO9 A;  4CDX B;  4QWN A;  1EUU A;  2H6C A;  1VRH 2;  2O8O A;  5IJR A;  2XML A;  5B4N A;  2BQP A;  1TG7 A;  1NLS A;  2WNU B;  2RJK A;  5JI7 A;  1JH5 A;  4AED B;  1DGW A;  2DVG A;  4OUS A;  2VMI A;  1ZX5 A;  4ZY9 A;  5I8T A;  1PVC 2;  5CU1 A;  4GMP 3;  1OPM A;  1W8F A;  1JZ8 A;  3IIA A;  1GOH A;  3J7N A;  4PQQ A;  1APN A;  1OFN A;  2VMF A;  2YMZ A;  4UXA A;  3K46 A;  1ENX A;  4NHM A;  2DBN A;  5JUV A;  2Q8C A;  3HT1 A;  1A8D A;  3IM0 A;  2XLF A;  4BXF A;  3GM8 A;  3ZN5 A;  2SLI A;  2Q0A A;  3H8O A;  3WW1 A;  1AR9 3;  3PHM A;  3CJI B;  1YLL A;  2FDI A;  3GGL A;  2JX9 A;  1KRI A;  2R04 2;  2B5H A;  4FPC A;  1FPN 2;  2LRO A;  4OHX A;  1US2 A;  4QB1 A;  2XJR A;  4PBO A;  1CQ9 A;  2DCY A;  4ORF A;  3PNA A;  1LU2 A;  2VMH A;  3O0X A;  3WNM A;  5KC6 A;  1W8U A;  1RC6 A;  3RVH A;  2XGX A;  1VJ2 A;  5DAQ A;  4CP0 A;  2PHF A;  4KBZ A;  5E1R A;  1QU0 A;  1ZBA 3;  2OA2 A;  2RDQ A;  5FK8 A;  4NII A;  3OUI A;  3B02 A;  5FYZ A;  1GZ9 A;  5FY9 A;  3WF0 A;  3MPP G;  2WSU A;  4H3W A;  1GAN A;  1SFP A;  4QHB A;  1DYP A;  2HWF 2;  3MO4 A;  3PU8 A;  3RI8 A;  1Z7S 1;  3BOW A;  2XJS A;  3N7M A;  4P9W A;  2OUH A;  4RR3 A;  1LES A;  3VL9 A;  3WQ1 A;  1L3J A;  4XUO A;  1PZ7 A;  1AR7 3;  2P3Y A;  1LCL A;  2VTX A;  4M01 A;  4AQS A;  4D0Q A;  3OJB A;  1D4M 1;  3WQ0 A;  4BQW A;  2F4P A;  1YQ2 A;  1IG0 A;  1XOY A;  1UMI A;  4RR3 C;  1SZB A;  2XKO A;  1F31 A;  5DN2 A;  1R64 A;  5FY5 A;  5C8C B;  2ZEW A;  1URX A;  1R09 1;  4QPI A;  1CIY A;  1WD4 A;  3CMG A;  2LW8 A;  3HEI A;  2BVV A;  3AYA A;  3PIJ A;  1YJL A;  3LFI A;  5FYH A;  4A42 A;  2W1U A;  4YFZ A;  3I3M A;  2GME A;  4GKX A;  5JLV A;  3USU B;  4XTM A;  1V6L A;  1WCU A;  1O6U A;  2IZW A;  1D7P M;  1UU6 A;  1C8N A;  2B9U A;  2EA7 A;  4FP3 A;  4QPI C;  1UIK A;  2PLV 3;  3LF7 A;  2CYF A;  4TXW A;  4YG3 A;  5CB7 A;  4AR2 A;  4BYY A;  1ODM A;  1HJF A;  1XNA A;  4JQT A;  1LED A;  5FPV A;  1UOG A;  3ILF A;  3C3V A;  3HPN A;  4FO9 A;  3WQ7 A;  5I0U A;  1IS5 A;  1CPN A;  1K5M A;  1X82 A;  2UYA A;  4D6Q A;  3GZE A;  3MLK A;  3N36 A;  5E6H A;  3AJZ A;  5IVE A;  3VUO A;  2I07 B;  2VZ3 A;  5BNP A;  2C24 A;  5I93 A;  4CP9 A;  1RJ8 A;  1YUD A;  4HL0 A;  4M0N A;  1WME A;  1K5M C;  4MVT A;  2C1F A;  4A45 A;  1ZRD A;  1UY1 A;  4TN7 A;  2CU5 A;  2E51 A;  4JKK A;  1OD3 A;  4XJA A;  1QWR A;  5A7S A;  3TNP B;  3U11 A;  3T1L A;  5BNP C;  1LHV A;  3BYW A;  2VUJ A;  5ANQ A;  3ZYJ B;  3A4U A;  4CRQ A;  1LOA A;  4XUN A;  3NJZ A;  3WT3 A;  4AEJ A;  1PO1 3;  1W9F A;  1MQT B;  1KQR A;  2DYC A;  4RGG A;  2BWC A;  1NLR A;  4FQZ A;  1KJR A;  4BIO A;  1GOF A;  3OEA A;  3AL5 A;  4FOW A;  4I3G A;  1RTV A;  2ARX A;  4R52 A;  3EYP A;  2YBP A;  3BTX A;  3ZX7 A;  1MZ5 A;  2XOM A;  3K75 B;  1LB2 A;  1RUE 2;  1GNY A;  4MOA A;  5JR7 B;  4AI2 A;  1N3Q A;  4CEY A;  4GAZ A;  1XSR A;  4DIN B;  4Q4W 3;  3TN9 2;  3WXP A;  2R07 1;  1NY7 1;  5E16 A;  5H9Q A;  3IZO A;  5FZE A;  5AVP A;  2P2K A;  4FFH A;  4CEY C;  3QD6 A;  3C7G A;  3LGR A;  2AEN A;  2XVL A;  5A3N A;  1C8M 3;  1OI6 A;  1ZBE 2;  3E5Q A;  3N7K A;  3WD5 A;  1J1L A;  3M70 A;  3VZN A;  4C8D A;  4FPO B;  5IK8 A;  4NWV A;  2A71 A;  2HWE 1;  2PQS A;  3WDT A;  5L7O B;  1JZ3 A;  1YRZ A;  1UYZ A;  1O3T A;  2ZAB A;  3HT2 A;  1UYY A;  5BNN B;  3OPW A;  4IGQ A;  4MZU A;  3VBR A;  3JCI A;  4QB2 A;  3ZFG B;  1IKP A;  1FMD 3;  2VTX J;  2EIG A;  5F7U A;  3LA3 A;  2YFU A;  3MUZ 1;  4FAH A;  4X6R B;  2WC2 A;  3IMM A;  2GP3 A;  3OPZ A;  2BU9 A;  2HWD 1;  5GZG A;  2X05 A;  4KG8 A;  3VBR C;  1QQP 2;  1JYW A;  4CXW A;  2RV9 A;  1ZZ7 A;  1NQJ A;  3J9S A;  3IPV B;  4QHO A;  1ULO A;  4YSF A;  2MEV 1;  5EWS A;  1AZD A;  1UF2 C;  3ZN4 A;  3WX5 A;  4YAR A;  4YNI A;  1FYU A;  1JS9 A;  3AZY A;  3ZXG A;  4E2S A;  5L36 A;  2D6M A;  3RYR A;  4AW7 A;  3AZZ A;  1OQD A;  2RMU 2;  2GMM A;  1TME 3;  4FPY A;  4DRR A;  1OD5 A;  3OSD A;  1G9B A;  4W4Z A;  3VDB A;  1S2B A;  1X9P A;  5JI9 A;  1SFY A;  2FZ2 A;  3CZJ A;  1O3Q A;  1Q8S A;  1RUD 3;  2ZAA A;  3KV5 A;  1AR6 1;  4LBJ A;  3BTZ A;  1F5F A;  3I2H A;  4I0W B;  3THC A;  3U10 A;  1DQ5 A;  3HNB M;  4YGC A;  4Y22 B;  2RS3 1;  4LIU A;  5FZA A;  3OGV A;  2BGO A;  3LDB A;  3MHZ A;  2G4I A;  3AKS A;  3KLS A;  1N3P A;  2OQ7 A;  1ONA A;  4D3W A;  5HXM A;  3ST7 A;  4RQP C;  3S7E A;  3KF5 A;  2VL4 A;  3HQX A;  5FDB A;  3V0B A;  4EJR A;  2DU1 A;  1RUJ 1;  3T0B A;  1GV9 A;  1UNB A;  2ZA9 A;  1GYK A;  2J7M A;  5K0U C;  1JZ5 A;  2CV6 A;  3EJK A;  5FBZ A;  4HAN A;  2WSV A;  2WYS A;  1FI2 A;  2PHL A;  4A3Z A;  4CCD A;  1DQ4 A;  4D7Y A;  3U0Z A;  3WP3 A;  3HWJ A;  4XAC A;  2WR9 A;  1UOJ A;  2VMC A;  3ZXL A;  5I0S A;  3TBD A;  4JDN A;  3VBO A;  1QF3 A;  1QQP 3;  3DXT A;  3JBG 1;  4NRM A;  2PYT A;  4C0H A;  1AJO A;  1IKQ A;  1O4Y A;  3DL3 A;  1GNH A;  1ZZ6 A;  2ZAC A;  3BOD A;  3RG0 A;  1DIW A;  1F4A A;  2VU9 A;  4Q2F A;  3D0S A;  1YFW A;  5A1A A;  1NE4 A;  3VBO C;  4FVV A;  2Y38 A;  3W9A A;  1JYN A;  2BNN A;  4GB3 2;  5FZH A;  1CAU B;  2P3J A;  3IWZ A;  5D1I A;  4EWE A;  3I2K A;  4LE4 A;  5A1L A;  4EQV A;  3ZXF A;  3T0A A;  1XYP A;  2CHH A;  2VOW A;  4LUL A;  3HQU A;  1H9P A;  5JXJ A;  3H9A A;  4M3C F;  5FZI A;  5JVV A;  2CL2 A;  2FMY A;  4LKF A;  3RZL A;  5FLJ A;  2ZMK A;  4AEM A;  4ERO A;  4Q0S A;  3K4Z A;  4JCK A;  2WZR 1;  4E4D X;  5F3C A;  1QY4 A;  5FY1 A;  4HPK B;  2TEP A;  3NQH A;  3WUC A;  2PHU A;  3J8F 1;  3N4M A;  2R0F A;  2HBU A;  3Q8F A;  3E5U A;  4CDQ A;  2WNU C;  3OYW A;  4R9B A;  5GLU A;  4AHY A;  3Q8B A;  4Y1V A;  2VXJ A;  1BVP 1;  3D4K A;  4HT1 T;  1DZT A;  1OLQ A;  1XU2 A;  2JEN A;  5T3N A;  4ZHN A;  1GOG A;  3NJX A;  3MDP A;  5D21 A;  3WDW A;  1LOB A;  4QX2 A;  3ZSK A;  4CDQ C;  5EJ1 B;  1S0D A;  5J7M A;  1HDK A;  5JIA A;  3O1R A;  4EN8 B;  2EXI A;  1NG0 A;  2WL1 A;  2QQP A;  3MW2 A;  1ZNP A;  1W8W A;  5A3O A;  1DQ0 A;  4KU8 A;  1Z7S 2;  2HYK A;  3AP9 A;  5A80 A;  2ZGP A;  1PGL 1;  5FYS A;  1ULC A;  2DTW A;  4YVS A;  5FPL A;  1W39 A;  2HEV F;  1SLT A;  3EXU A;  2WZP P;  1FOD 3;  1POQ A;  1D4M 2;  1DYK A;  2QQW A;  2RDS A;  3IKW A;  1W2O A;  3KCX A;  1YIP A;  2QQO A;  4YVS C;  1HQW A;  1YI7 A;  3GNE A;  3SCH A;  1R09 2;  1W6O A;  5D8A B;  3VZK A;  1QJX 1;  2P3K A;  4H7L A;  2Q8O A;  5F5C A;  3VBU A;  3T0D A;  2BNO A;  1PO2 1;  2WQ8 A;  3ZYF A;  1S0I A;  4WVW A;  4KNC A;  4A7K A;  4AI8 A;  3H3Z A;  1HB1 A;  2D7F A;  2R49 A;  2JDK A;  3VBU C;  5C7G A;  1SPP B;  1S0F A;  3EB7 A;  3GAL A;  2QQL A;  2W3J A;  4RHV 1;  1G6N A;  1AYM 3;  4WM7 B;  3GBW A;  5FYT A;  1LOE A;  4PF1 A;  3WG3 A;  3O1T A;  5FZB A;  2CY6 A;  2WS9 2;  3USS A;  2BBA A;  5KHI A;  5ISL A;  2H0V A;  1T6B X;  1W2T A;  1LOC A;  1SHW B;  2VQU A;  3LEM A;  1Q8V A;  4KL1 A;  4AGR A;  4BK4 A;  1S2E A;  3BPZ A;  3I2D A;  3TNQ A;  2R06 3;  2Z4F A;  2ZGQ A;  4OVE A;  1HW5 A;  4PIY A;  4QQ2 A;  4YGD A;  5FY4 A;  4ZU7 A;  3O1P A;  3AKR A;  4GA9 A;  2ZEZ A;  4JGZ A;  1UN1 A;  4MET A;  5IAX A;  3NNF A;  1UZW A;  5DZF A;  2DDU A;  2IC1 A;  4BME A;  2WA4 A;  4DXR A;  5FKB A;  2W1S A;  4N7U A;  2VM9 A;  2RDR A;  3PME A;  5GJ6 A;  3WLU A;  4M3C E;  4JGZ C;  3AXE A;  1W8H A;  1MZ6 A;  2E33 A;  2BFU L;  2DBI A;  4QPW A;  2ZHL A;  2GH8 A;  1RIT A;  2NM1 A;  1V9U 1;  2NYY A;  3LA2 A;  5F2W A;  4CPB A;  1SCS A;  2R07 2;  3ACL A;  1NY7 2;  1UU5 A;  3H8X A;  4A7Y A;  1IPJ A;  4XCA A;  5KHH A;  3KV6 A;  5IVC A;  1AL0 G;  1W0O A;  1OOP B;  1WBL A;  3E1F 1;  4OZO A;  2EXH A;  1UOF A;  1MS5 A;  4NRQ A;  3ZYP A;  5KC5 A;  2D6L X;  1QDC A;  5JCT A;  4LUK A;  5C3R A;  1UKR A;  1KXG A;  2W1W A;  2L9L A;  4JX0 A;  2HWE 2;  3KV9 A;  3RS6 A;  4GMP 1;  1R1Z A;  5A7P A;  2UUR A;  1MVE A;  4V1P A;  4BA6 A;  1W2A X;  5FZ0 A;  5LBB A;  3ZYG A;  3WW3 A;  4BH9 A;  4UF0 A;  4OUE A;  4ZXK A;  5JAX A;  2J42 A;  1V6N A;  2D3S A;  4WZC A;  1VBE 1;  2ENR A;  4WVM A;  2BUK A;  3KGL A;  1WW6 A;  2J1E A;  3E6C C;  3MPB A;  5L73 A;  5E88 A;  3KMH A;  1JZ6 A;  4OYU A;  4AFB A;  2WN2 A;  3WCR A;  4FTS A;  2QQJ A;  2MEV 2;  5C4W A;  2EID A;  1NUK A;  4XDQ A;  4UW3 A;  3POB A;  3UK9 A;  3I2G A;  3QCW A;  4CEW A;  3V0A A;  5EFU A;  1C5H A;  4AXO A;  1L7Q A;  1MS4 A;  1Q56 A;  5FPU A;  3BN6 A;  2VD7 A;  2WYF A;  3KVB A;  4CEW C;  3B7M A;  1UZV A;  4LK6 A;  5T5O A;  2FDG A;  2D98 A;  4J1X A;  4YW1 A;  2BOJ A;  1NCR A;  3UET A;  1K12 A;  3KV4 A;  4XBQ A;  1LTE A;  1FAT A;  1SDD B;  1GR3 A;  2RS3 2;  4ZKT B;  5ACA 3;  1W9S A;  4JZR A;  2LS6 A;  5BNN C;  2ADD A;  1SBE A;  4Q0U A;  4OCT A;  4RFT 0;  1ZRI A;  3GF6 A;  4U2A A;  3BU0 A;  1PIV 3;  1H1M A;  1U12 A;  2WQ4 A;  4QDR A;  5HV4 A;  1QEX A;  1NCR C;  4AVS A;  4OI0 A;  2J1U A;  1YQ5 A;  5FK7 A;  5K4L A;  4DQA A;  1DBN A;  1L7L A;  4C0B A;  1GP4 A;  4IE5 A;  1LHO A;  4HN1 A;  4LTA A;  3ZSE A;  4K1Y A;  1RUJ 2;  5DZG A;  1YYN A;  4D7S A;  3WQB A;  2CWM A;  1DFQ A;  4LKD A;  4XCB A;  3PU3 A;  1VBC 2;  2JKB A;  1JHJ A;  3ITQ A;  1AR7 1;  2VNG A;  5JR2 A;  2YDE A;  2V72 A;  4MGZ E;  2HWD 3;  3NV3 A;  2XXZ A;  2B8M A;  3H7Y A;  1GIC A;  1AYN 1;  3JBG 2;  1HB3 A;  4Y1Y A;  4UT5 A;  1AL2 3;  2K0G A;  2W2I A;  2YC0 A;  5C70 A;  3O1M A;  3K4D A;  2Y6H A;  1HXS 3;  4H14 A;  4XXA A;  4LBK A;  1LRH A;  1OQ1 A;  1MR5 A;  2HWB 1;  1MS1 A;  3LZZ A;  3U4S A;  4CCN A;  3WNN A;  1F9K A;  1RHI 3;  4RR3 B;  4JRA A;  2PLV 1;  4BLJ A;  3VD7 A;  2BDR A;  3CKH A;  3DEC A;  5DPN A;  4GWJ A;  1STM A;  3OGG A;  5GLV A;  1BBT 3;  5H9S A;  2EIC A;  1AR6 3;  1P8J A;  4L99 A;  4Q29 A;  4QPI B;  1FNZ A;  3ZR6 A;  1O91 A;  4GWN A;  3DGT A;  5FYB A;  2WZR 2;  3AZX A;  2DVB A;  4NJ4 A;  3LAG A;  4M4R A;  4COV A;  1ZZ9 A;  4RL7 A;  3J8F 2;  3FLT A;  4Y1U A;  4FQ4 A;  4JKL A;  1XE7 A;  5SV8 A;  1CZT A;  4I0A A;  2LUW A;  2PAE A;  4XQD A;  5LZ6 A;  4NN0 A;  2VQ0 A;  4Y5Z 0;  1PO1 1;  2VCC A;  2D5F A;  1J58 A;  3M4F A;  1K5M B;  3OBZ A;  4NHL A;  4XFH A;  1IPK A;  5HCF A;  4FBF A;  2WIN B;  2XBO 2;  5GAL A;  3P6B A;  2JIC A;  5BNP B;  5ABJ C;  4Z07 A;  4CP9 B;  5EZW A;  3KCC A;  3QLQ A;  4MXV A;  5FPA A;  3MF9 A;  4Q4W 1;  2PHD A;  4DUX A;  3DUI A;  5GM0 A;  4CCC A;  3ES4 A;  3THT A;  1HLC A;  1PGL 2;  1RUC 2;  5IVY A;  2D44 A;  3BGA A;  5BYN A;  1WCK A;  5FQ0 A;  3ZVX A;  2A6Y A;  3CO2 A;  4HVQ A;  1Y9G A;  2HBT A;  3VKN A;  2Z5W A;  3ACH A;  2NMN A;  2JB8 A;  2WKK A;  5KWR A;  2VMG A;  1ZA4 A;  4CCO A;  2VQA A;  3PTY A;  2V73 A;  3VHN A;  1BZW A;  1N47 A;  4KQ7 A;  1CZS A;  3WW4 A;  5CYY A;  3WV6 A;  4CEY B;  1OF3 A;  5FPZ A;  5FO8 B;  1JYX A;  5CG8 A;  1UY4 A;  1QJX 2;  2UWC A;  2PA7 A;  2RR1 3;  1WLD A;  4IXL A;  3O1O A;  1FMD 1;  1X50 A;  1NXM A;  1PO2 2;  3AMQ A;  1W2N A;  1XYN A;  2AAC A;  2TBV A;  3MIC A;  4JC1 A;  1PHM A;  5EP9 A;  4P9J A;  2VW0 A;  3BOP A;  2WZR 3;  2C5D A;  2VBP A;  4KWJ A;  1H2L A;  4LHL A;  4E4S A;  3QBQ A;  3LEI A;  2ZGO A;  4X8P A;  1HB2 A;  2YPJ A;  5FBJ A;  3ZSJ A;  3CL1 A;  1EPW A;  3ON7 A;  5C3O A;  1W9T A;  4K9S A;  1NLQ A;  4BOW A;  1GFF 2;  3VBR B;  5T55 A;  3LKJ A;  2FQP A;  1YFX A;  3S5Q A;  3DEM A;  2ZML A;  5BPX A;  4LHN A;  2HYX A;  3NV2 A;  1TME 1;  1EUT A;  2YBS A;  2WO7 A;  4AI1 A;  3TOJ A;  4K21 A;  3OF1 A;  3SC7 X;  1DLC A;  1I1E A;  1H2K A;  5IVB A;  4NIG A;  1UXZ A;  1RUD 1;  1O8S A;  2CDP A;  1BXH A;  4CZS A;  2J22 A;  4YPJ A;  3NV4 A;  3OEB A;  2NQY A;  5FYU A;  4GXL A;  4KWL A;  1GP6 A;  5JMO A;  1BEV 3;  1OVP A;  3B94 A;  1NAE A;  5FLI A;  2OKX A;  3GZU C;  1OLR A;  4XET A;  3TEZ A;  2VW1 A;  4HON A;  5GZC A;  4QXC A;  4B1L A;  4BPZ A;  1V9U 2;  3WG4 A;  3UV9 A;  4ONU A;  2BGC A;  2WA3 A;  2JG8 A;  3VHP A;  3VN4 A;  4CUC A;  2XJU A;  1HRV 1;  4XBL A;  3AP4 A;  3BVC A;  3NNG A;  1W03 A;  3EQE A;  4WVV A;  4O61 A;  2AYH A;  4WZF A;  2XR4 A;  1W6P A;  4YG6 A;  1ND3 A;  4U36 A;  4NIH A;  5CAD A;  2XDV A;  3VKO A;  1OXC A;  4P5Y A;  1WW4 A;  3AP6 A;  3III A;  2WJS A;  4PIX A;  3HNY M;  4RSU A;  3LDK A;  5APA A;  1YXW A;  4RHV 3;  2GC3 A;  2VZP A;  4HET A;  3V0B B;  2OQ6 A;  4NMI A;  2WO3 A;  3VBS A;  1ASJ 1;  2QUO A;  2W47 A;  2W94 A;  2E7A A;  3N9O A;  5A7N A;  3E6B A;  3T2T A;  1R1A 3;  3OUJ A;  4XAB A;  2X09 A;  3WSO A;  3POS A;  2W5F A;  3OCP A;  1F35 A;  3GZT B;  4A3X A;  2EIE A;  3BB6 A;  3K4A A;  1D2S A;  1AR9 2;  4I02 A;  4LBN A;  4N9H A;  3PUA A;  2NLR A;  3VBO B;  1ULD A;  1A78 A;  4M0H A;  3KT4 A;  3URF A;  2VQT A;  1POV 0;  5CIS A;  1Y43 B;  2QQV A;  5C6C A;  3UNP A;  1C1F A;  1QKQ A;  2KM2 A;  2ZAH A;  4ZPI A;  3WDV A;  3FL7 A;  5DUU A;  1SG3 A;  1WA6 X;  4R9A A;  3OGR A;  1V9U 3;  2AEZ A;  4BHP A;  1KDK A;  2R1D A;  2X8K A;  2PAM A;  5A32 A;  1G7Y A;  3JQW A;  5I0D A;  3O7O A;  2FCT A;  3D3A A;  3NST A;  2A1X A;  5C71 A;  2YUE A;  3N7L A;  4XFG A;  2FCV A;  1DP0 A;  3AFK A;  1OA3 A;  2KD7 A;  2IXH A;  5FZD A;  1LKN A;  3T2P A;  4HKL A;  4AFA A;  1BJQ A;  4IEV A;  4G4F A;  4CDQ B;  3GDB A;  3LA7 A;  3OYW B;  1QGL A;  2YG0 A;  1RVF 3;  1AR7 2;  1UX6 A;  4K7J A;  2PHW A;  3VZM A;  1VBE 3;  1VB4 A;  2VUL A;  3KT7 A;  1FOD 1;  5EV7 A;  2GN3 A;  1S1A A;  1GZW A;  2W1Q A;  4IET A;  4XJW A;  5FUP A;  3U07 A;  5FPX A;  4CCJ A;  2YPD A;  4QAW A;  1W6M A;  2EAA A;  1I6X A;  3FZ3 A;  4AAX A;  2J1R A;  5HCB A;  3O1S A;  2Y6J A;  2XLA A;  3J7H A;  2ZBJ A;  1GZC A;  2E31 A;  2JWP A;  1WLT A;  3O0V A;  2GSY A;  4S2H A;  5DDJ 1;  5T5J A;  3CJX A;  2ZEX A;  3ZFF A;  1XXN A;  4B4P A;  3OBA A;  1OT5 A;  4BDV B;  4BQY A;  3BCW A;  3FN9 A;  2C6S A;  1UZY A;  4YVS B;  1ZZC A;  1UQX A;  1YNA A;  1OHF A;  4H55 A;  2PLV 2;  5FMB A;  5L9V A;  4UI9 L;  2QQN A;  2R6Q A;  4LO8 A;  4Q4Y 3;  4DMI A;  3JD7 3;  3VKF C;  2XJT A;  1TVG A;  1XU1 A;  3ZFF C;  5JPN B;  1CX4 A;  2IWG B;  4XF9 A;  3WUD A;  5C3S A;  3AX4 A;  1AYM 1;  4LMF A;  2BER A;  3TRS B;  1W6O B;  3WF1 A;  2OX0 A;  3DYP A;  1YQ8 A;  1BHG A;  1O59 A;  3OD0 A;  4H7M A;  5CG9 A;  2BZD A;  3VBU B;  5FYI A;  3SCF A;  4FCA A;  3WZ1 A;  1ALY A;  3AZW A;  4MLO A;  4QXK A;  5FZ6 A;  3PLQ A;  1UCX A;  3ZSL A;  5KR7 A;  2R06 1;  2RVA A;  1X9T A;  4D6R A;  2GH2 A;  2RJL A;  3D8C A;  4QX0 A;  5DAB A;  1FXZ A;  3FUQ A;  4O9G A;  3M2M A;  1LOD A;  5DUW A;  1H6Y A;  1G8W A;  2J1T A;  1PO1 2;  4COW A;  2ZGT A;  3K51 A;  2IFR A;  5LW9 A;  1ZRC A;  1LGN A;  2VBD A;  4HOO A;  5EXO A;  3RMY A;  4COZ A;  5FXW A;  5C5T A;  3ZXK A;  3INA A;  3O14 A;  3FFQ A;  4I01 A;  1O3S A;  3MFA A;  3S30 A;  4DIQ A;  4I2O A;  1YFY A;  5DG1 A;  4RFR B;  4Q4W 2;  4AI3 A;  1AYN 3;  4GWM A;  3T30 A;  4AE2 A;  3VHR A;  2Z2S B;  2JG9 A;  3HIF A;  4F83 A;  4JGZ B;  4IL7 A;  4L8Q A;  2HWB 3;  4HK9 A;  4UWD A;  5FO9 B;  1HIX A;  4SBV A;  4C1X A;  2RM2 3;  2AEY A;  4QU2 A;  1C8M 2;  4QPG A;  3RQ0 A;  3MV0 1;  5CNA A;  5C3Q A;  2DCK A;  2G9Z A;  3AMP A;  3VLB B;  1PK6 A;  4CUA A;  2B42 B;  3O0W A;  3NW4 A;  4L92 A;  1OUS A;  5F39 A;  3AKT A;  5E89 A;  5DAV A;  5F2S A;  3WG1 A;  5SV5 A;  4JTO A;  4E4H A;  1FMD 2;  1H9W A;  2CAV A;  4R4X A;  5B4X A;  1PK6 C;  5F5Q A;  2VVE A;  2E7Q A;  5A6Y A;  4YW2 A;  2WBK A;  5HCA A;  4LIV A;  3UKT A;  3I7D A;  4YYO A;  5IVV A;  2PHX A;  1GBG A;  4HN0 A;  4CSW A;  2D5H A;  3K3O A;  2YC2 A;  4MHU A;  4Y5S A;  3IAP A;  1R08 1;  4LT5 A;  4LKS A;  5LA1 A;  2ZX4 A;  3MID A;  4XFA A;  1NA1 A;  1HJG A;  4UF0 B;  3ENR A;  2WAB A;  2Y0I A;  1TME 2;  4WBB A;  4WVM B;  1FV3 A;  4YFW A;  2OXB A;  2DFC A;  2W95 A;  1SQ4 A;  1WA4 A;  5A6Q A;  1RUD 2;  3P5B A;  4MGQ A;  2NMO A;  1JOB A;  2WAO A;  1DGL A;  4CDU A;  1WUV A;  1ULG A;  3N9L A;  2FDK A;  1KD7 A;  5ACA 1;  1JTZ X;  1OA2 A;  3BIW E;  4CEW B;  2JDP A;  3WP6 A;  1PIV 1;  4LOT A;  3V0A B;  1ZZ8 A;  4HBN A;  3M8L A;  3AL6 A;  2R30 A;  1CN1 A;  1UMZ A;  5KBF A;  4YGB A;  3B93 A;  4DPN A;  2Y6G A;  3T1M A;  1PMI A;  3C7E A;  4BJ0 A;  1MAC A;  1QJY 3;  4URT A;  3WP5 A;  2CNA A;  5J3U A;  3WHT A;  1SBF A;  1NCR B;  2GAU A;  4QX5 A;  4IE0 A;  2YGL A;  1UMH A;  2E9Q A;  1WW7 A;  2DV9 A;  1CZV A;  2YV8 A;  5LY2 A;  4JRL A;  2W0X A;  2X10 A;  2A6W A;  1C5I A;  3ILR A;  1AL2 1;  3MUY 1;  4H2A A;  1HXS 1;  3RGB A;  4Z2A A;  3TEW A;  5I0R A;  1RIN A;  3PMS A;  4YVW A;  1US3 A;  3F95 A;  1RHI 1;  1W6N B;  2FHR A;  4JGY A;  4LBL A;  4QM8 A;  1RB8 G;  3FHQ A;  4C90 A;  3VKL A;  3I97 A;  5A7W A;  3AKP A;  3NL1 A;  1EV1 3;  2LM3 A;  4OUL A;  1KIT A;  2YHJ A;  5C3P A;  1VRB A;  3LSD A;  1ZM1 A;  2WNV A;  4KGG A;  4YVW C;  1H2M A;  5FZ9 A;  1BBT 1;  4JGY C;  4PJY A;  4CUB A;  2XJQ A;  4RS5 A;  5FZF A;  4DXZ A;  2YC4 A;  1PM4 A;  5JIU A;  3ZMN A;  4LJH A;  1OC1 A;  2WNO A;  3R4D B;  1DYO A;  4GD4 A;  2A3X A;  4IGP A;  2WNV C;  2BVB A;  4IW3 A;  4KI5 M;  4LO7 A;  5FY8 A;  4DNY A;  4GUL A;  4XE9 A;  1W99 A;  4AVV A;  1QXP A;  2DFB A;  5FZC A;  1LNS A;  4RA0 A;  2HWC 3;  4FOY A;  3WNK A;  3OPT A;  1CAW A;  1GQG A;  1I3H A;  2LAL A;  1JXN A;  1V6M A;  2VNO A;  1S2K A;  2G1M A;  3MIH A;  3T4H B;  5FXZ A;  3CDZ B;  1HX6 A;  1O4Z A;  1UL9 A;  1HRI 1;  4XZP A;  3ECQ A;  2LTN A;  4IEQ A;  1GLH A;  3M3E A;  1HRV 3;  3D6E A;  5I91 A;  3WY6 A;  1Y3T A;  4PI0 A;  4CU6 A;  3P1I A;  1KFX L;  4LPL A;  2BWA A;  5IT6 A;  4IV3 A;  1V6O A;  5IVJ A;  3KM5 A;  1Z78 A;  3EBR A;  3NO8 A;  2VO5 A;  5EQU A;  4EN9 B;  1MZF A;  1CX1 A;  1GWL A;  1DF0 A;  4MO3 M;  1U5I A;  4XXP A;  1CES A;  1UXX X;  1JN2 P;  2QZ3 A;  1JOD A;  2EIB A;  2ZX3 A;  4IV3 C;  1EAH 3;  4FAG A;  4K6B A;  2VR4 A;  1PX3 A;  3L9J T;  5ABJ B;  1X8E A;  3LOB A;  4W8J A;  1OUX A;  1D0H A;  1ASJ 3;  5AFE A;  4XQW A;  1UZ0 A;  4K20 A;  4CXY A;  1FOD 2;  4OI2 A;  3ZYH A;  2VMD A;  3NAP A;  4BLI A;  5FYM A;  1POV 1;  3WR0 A;  3LDR A;  4CVU A;  3UGF A;  3ZKY A;  5CA6 A;  3POY A;  4COU A;  4LOR A;  4N90 A;  5GZD A;  3NJY A;  3IAQ A;  1PX4 A;  2RR1 1;  3PUH A;  4IE4 A;  4QX3 A;  3NAP C;  3ZOI A;  4AI9 A;  2JD9 A;  1ZA7 A;  4JVA A;  2BGP A;  3WF3 A;  2BV4 A;  2Q8D A;  5JPM B;  5LAT A;  2YXS A;  1XPW A;  1RYY A;  3BUC A;  5FR3 A;  4EE2 A;  5A33 B;  4NHK A;  4TSV A;  3PUQ A;  3S5A A;  1JUI A;  2QTW B;  4GIQ A;  3UYJ A;  5LY1 A;  1QIQ A;  1K42 A;  4ZS3 A;  4EWD A;  2IXK A;  3J7M A;  1AYM 2;  4AAP A;  5CFC A;  3BPS A;  2EAL A;  2ATF A;  2ZGM A;  2PXJ A;  3MGU A;  3RWN A;  1MEC 3;  5T54 A;  2BJS A;  3UKN A;  1WZX A;  3D82 A;  4DOU A;  1H4G A;  2VVF A;  4CDX A;  5CFC C;  3VD5 A;  4FPJ A;  2R06 2;  3PTR B;  2IVI B;  5C5U A;  1XB9 A;  1UX7 A;  1VMH A;  3EHK A;  1CVN A;  4PLM A;  3JB4 C;  1Q5O A;  4Q4X 1;  4TYS A;  1OVS A;  3VDC A;  3W20 A;  3OB8 A;  2FZ1 A;  3MIF A;  3B00 A;  3A21 A;  1TMF 3;  1BEV 1;  5FZO B;  4DRV A;  3GCW A;  1TE1 B;  3OBR A;  4JKM A;  5J48 A;  4AEK A;  4ARY A;  3PL0 A;  4AQ2 A;  4CUG A;  4ZZ8 A;  2WO2 A;  2C26 A;  4XAE A;  4QM9 A;  2VZR A;  1J3P A;  3I3E A;  1GP5 A;  3Q8A A;  3R05 A;  5FY7 A;  4Z92 B;  1RUH 1;  1OLM E;  2R1B A;  4XMA A;  2EF6 A;  5DDJ 3;  4ATF A;  4O65 A;  3MIG A;  1BKZ A;  4QGL A;  1U5Y A;  1EY2 A;  1UY3 A;  1F4H A;  2CAU A;  4LBQ B;  1WCS A;  3NWK A;  3B01 A;  4PBP A;  2O0O A;  5FYC A;  4A6O A;  4NPM A;  1W3X A;  4HK8 A;  4UOJ A;  4YW6 A;  1H0B A;  4OI4 A;  1K45 A;  4QHZ A;  1XNC A;  4XDO A;  4NRO A;  3RDI A;  4E8D A;  4GH4 A;  1YEW A;  2XVK A;  1DZQ A;  1W8Z A;  4XUP A;  3GHN A;  4XIK A;  3MIB A;  2H6B A;  3ALQ A;  3AP7 A;  1E5I A;  4MGY E;  4ARX A;  5A3M A;  5IYY A;  2Y64 A;  3APB A;  1R1A 1;  4NE9 A;  1RUF 3;  4AGG A;  1REF A;  4GH4 C;  5CVR A;  5BY5 A;  1N1Y A;  3RNS A;  1W6P B;  2C0Z A;  1ND3 B;  4A7Z A;  4DFS A;  5LK7 B;  4BXS V;  2VOV A;  1LGB A;  5G05 L;  4CTE A;  1UKG A;  1A3K A;  5HV0 A;  4SLI A;  1W05 A;  3N9N A;  4QXB A;  1N3O A;  1AXZ A;  1UIJ A;  3IT8 A;  4MUV A;  1QJZ A;  3SH5 A;  1ZRE A;  4KWK A;  2ID4 A;  1JZ7 A;  4Q27 A;  3VBS B;  3WNO A;  2W46 A;  5J1X A;  2W52 A;  3KWV A;  4Z1V A;  2GC1 A;  3PVO A;  2WFF 1;  3DF0 A;  3G7D A;  2PN5 A;  5BNQ A;  3ZPY A;  2NN8 A;  2QQM A;  3RYP A;  4CU9 A;  2O14 A;  2WDB A;  4F7Z A;  1AUY A;  1BVV A;  1XE8 A;  1QDO A;  5A3U A;  2JKX A;  5JZG A;  1VBB 1;  4HZF A;  5ACA 2;  1FNY A;  1JI6 A;  4W6X A;  5IK7 A;  2ZHK A;  5DXD A;  5FZ4 A;  1PIV 2;  5I8Y A;  2UY9 A;  2AUY A;  1RUI 1;  2HKX A;  5F9T A;  2X5I A;  2PHT A;  4ZZ5 A;  4NHY A;  3SCG A;  3HN1 A;  1BQP A;  3GBG A;  5JZG C;  4LEJ A;  2GU9 A;  4BWO A;  1QNW A;  1CIW A;  5T5L A;  5K9Y A;  1SLL A;  2ZXQ A;  2MPF A;  2WWU A;  3NNL A;  1TNR A;  4UW6 A;  1RVF 1;  2I74 A;  2X5I C;  5A32 B;  3A0K A;  3S0M A;  3TEY A;  4LHK A;  2JEC A;  3FX3 A;  4HKW A;  5C33 A;  2Q4S A;  4BQ5 A;  4OMD A;  2HWD 2;  3H3L A;  3AYE A;  3ZM8 A;  4RGK A;  5J36 A;  4N43 A;  1AL2 2;  4Y24 A;  2A3Y A;  1HXS 2;  2B9V A;  2GC0 A;  3SMH A;  1YQC A;  3AKQ A;  1FV2 A;  1R08 3;  1V00 A;  1UZZ A;  3BKZ A;  4LOS A;  1QH6 A;  1VBD 3;  3GBF A;  4N43 C;  4AI0 A;  1LEM A;  4CDW A;  1RHI 2;  1RUG 3;  5FOJ B;  3FLR A;  2A6Z A;  1MQT A;  4J1W A;  3HVD A;  5G04 L;  1W8T A;  2VNV A;  5C4W C;  4DY5 A;  4Q4Y 1;  1WKY A;  5AC9 1;  3JD7 1;  1XC6 A;  2C9K A;  5LEJ A;  1OH3 A;  1SFN A;  1GZW B;  1ZYB A;  4CDW C;  3WP4 A;  1BBT 2;  1W6M B;  2QQK A;  2BW8 A;  2JD4 A;  3KVA A;  4IEY A;  4LE3 A;  1AR6 2;  5CAZ A;  4DY3 A;  2Z79 A;  4OLL A;  5FYV A;  2LRP A;  2DCJ A;  2VME A;  4JQR A;  5FPB A;  2OYZ A;  3ZFF B;  2ZOE B;  3RZZ A;  3PVN A;  3WCS A;  5HCH A;  3IBM A;  3C7F A;  5IVF A;  3RPQ A;  1NE6 A;  1NOV A;  1Y4W A;  2P3I A;  5HI0 A;  1AR8 3;  4YZ2 A;  4COY A;  1PMJ X;  4CCK A;  4FPF A;  1ENR A;  1QXR A;  3RZJ A;  3U78 A;  1QOT A;  3ZFG A;  2XKP A;  3I2O A;  2CGN A;  3PIG A;  3RZG A;  1LUL A;  4E8C A;  3THP A;  4DUW A;  3UT0 A;  4G3Y C;  3VDD A;  1DZR A;  5LAS A;  2R16 A;  1VRH 1;  3WIN E;  2HEW F;  4GJZ A;  3U4X A;  4BM8 A;  5J96 B;  5A3P A;  3AJY A;  4BCU A;  2IVJ A;  5FFO C;  4CP1 A;  2RM2 1;  2WAA A;  2JB4 A;  4KBB A;  4HMZ A;  1VAL A;  5F3G A;  4CXX A;  3CNA A;  5B2G B;  3NV1 A;  4UFI A;  3A7Q A;  1ZVF A;  1XNT A;  2VOT A;  2XUM A;  4CPB D;  3VGI A;  1DDL A;  1PNG A;  4XF4 A;  4S2G A;  4XIL A;  2FDF A;  5KHK A;  1KDM A;  2RR1 2;  4LKE A;  4YG0 A;  4AVA A;  3AM2 A;  4DS0 A;  3M3O A;  3ES1 A;  4IND A;  2CGO A;  2ZGK A;  5KHJ A;  1QMJ A;  4Z2W A;  2ZKN A;  2A5Z A;  4UFJ A;  3ABZ A;  5FJH A;  4DXS A;  2D97 A;  5EYX A;  2R04 1;  4EWA A;  2QE3 A;  1A8M A;  2N7G A;  5ANN A;  2IXJ A;  5JSO A;  4B3N A;  4EYU A;  5C9A A;  1COV 3;  1IG3 A;  1JYT A;  4AHW A;  1VP6 A;  2VZV A;  3ETP A;  4NAO A;  1PK6 B;  2ZMN A;  4QGM A;  4EN7 B;  2D3P A;  3RMX A;  2XWJ B;  3HQR A;  4FFG A;  2EAK A;  3H1M A;  4NHX A;  4KG0 A;  1AVB A;  1HRI 3;  2YZ4 A;  5CZK A;  5LK5 A;  3ETQ A;  3N9M A;  3FC0 A;  3LB9 A;  3N9P A;  4M00 A;  4WV8 A;  2Q8E A;  5C9A C;  1E5H A;  2AC1 A;  2A6X A;  3CF6 E;  1IPS A;  1GSL A;  4LO5 B;  1QJF A;  4MX3 A;  1VBA 3;  4QQH A;  4QMA A;  4KWU A;  3SKJ E;  1Y7B A;  2ZTN A;  1UY0 A;  4XFF A;  3RFR A;  3BIE A;  3RZK A;  1B09 A;  2ZZQ A;  5FZ8 A;  1IQD C;  3LQC A;  3B3Q E;  2WLP A;  3GXU A;  4Q5O A;  4B7K A;  3VZO A;  2A3W A;  4YZ4 A;  2XHN A;  1CWP A;  3N35 A;  4AGV A;  4K1Z A;  4MXW A;  2KXL A;  4EZ4 A;  1YCI A;  1BEV 2;  1QOS A;  3POE A;  3WDU A;  3TEX A;  1RJ7 A;  2QQU A;  1NA1 B;  3C8X A;  2DUR A;  2OUJ A;  1T2X A;  2FDH A;  2GC2 A;  2UU8 A;  3FFZ A;  4QU1 A;  1LJ7 A;  1NYW A;  2D43 A;  1MS3 A;  5J37 A;  1J59 A;  1POV 3;  4LR4 A;  3WG2 A;  1OSG A;  3S57 A;  5CEH A;  1YI9 A;  4N53 A;  1GKB A;  1RUH 2;  4QKB A;  5LA9 A;  5CFD A;  2WII B;  1QJY 1;  1JW6 A;  5FY0 A;  2DVF A;  4MGK E;  4OZX A;  3T2Q A;  2TUN A;  1W28 A;  3SNM A;  1QJU 3;  4MG2 A;  3NNM A;  5CFD C;  5JOY A;  4IEW A;  2GAL A;  5BUV A;  1C3H A;  3AYD A;  4HPK A;  5F6L B;  2D6K A;  1W8O A;  1RUO A;  2R0H A;  2I2S A;  3F2Z A;  2EXK A;  4RHV 2;  2BEO A;  3POF A;  5IK5 A;  4S2F A;  1NT0 A;  2R7E B;  1O8P A;  2W91 A;  3DYM A;  1Y9M A;  5DQ0 A;  4F3J A;  5A6Z A;  4AZZ A;  3JXS A;  1R1A 2;  1SEF A;  4HVR A;  3O5S A;  1NZC A;  1CR7 A;  2ZS6 B;  3T2O A;  1OFS A;  1EV1 1;  1HN0 A;  1KS5 A;  5LBF A;  3KZ4 C;  3QH7 A;  5LRS A;  3E6D A;  1I9R A;  1QJE A;  5JOW A;  5LEK A;  3AFG A;  5DUV A;  5FZ7 A;  1GWK A;  3NJV A;  4Q4X 3;  2JDU A;  2BYV E;  5T5P A;  3HNM A;  2YYO A;  4Q0V A;  2VEC A;  1Q8Q A;  3I8T A;  3POG A;  3K77 A;  5A3T A;  5F37 A;  1AX0 A;  1PGW 1;  4YVW B;  2DVD A;  1NQD A;  2SBA A;  4JGY B;  4TWT A;  3KHC A;  1UU4 A;  2G9F A;  4PCR A;  1XNK A;  1H8T A;  2W39 A;  2HWC 1;  3HN3 A;  4YW7 A;  3O12 A;  4IV1 A;  2V09 A;  4DXT A;  3OGJ A;  4KMQ A;  2OVU A;  2WNV B;  3CEW A;  3I59 A;  3J4U H;  5FRE A;  3VD3 A;  4XPV A;  1IS4 A;  1RUH 3;  3V65 A;  4XF1 A;  1H8T C;  1VBB 2;  1Z0H A;  3I2I A;  4KU7 A;  4IV1 C;  1OQE A;  2ORX A;  3NMB A;  4J25 A;  4XDP A;  1RXG A;  1JOJ A;  5CIR A;  1M4W A;  4QX8 A;  1SLI A;  1UPI A;  3AVS A;  4IQP A;  2JJ6 A;  2JG8 C;  3VD4 A;  3I3D A;  3FLP A;  5IAV A;  4XIO A;  2YBK A;  3LSE A;  5GLT A;  2XG3 A;  2DU0 A;  1CAW B;  1U5Z A;  3FUO A;  1ND3 C;  1EAH 1;  4XJZ A;  3QOP A;  1RVF 2;  1OBN A;  4BQ1 A;  4EN0 A;  2GZW A;  3WF2 A;  1VBE 2;  1WLW A;  1ENS A;  1RGS A;  1H6X A;  4FT8 A;  3VD9 A;  2ARA A;  2C9A A;  4FPH A;  3LWC A;  1IHM A;  4IV3 B;  4KH9 A;  1SLC A;  4QD2 A;  4S2D A;  5FLH A;  5FP7 A;  4YZ1 A;  1IOA A;  3VBS C;  2VCB A;  3SKV A;  1S0J A;  3VBH A;  4FOQ A;  1ST8 A;  2QKD A;  2EXJ A;  3ZXJ A;  3WOG A;  1S55 A;  4FOV A;  4C1W A;  2A7A A;  2A70 A;  2XLG A;  3B5L B;  3P3P A;  4Q4V 3;  3VBH C;  4PIZ A;  4XVH A;  4TLF A;  1C1L A;  2V4A A;  5T50 A;  3A0N A;  4Q4Y 2;  3JD7 2;  1VIW B;  4P02 B;  2F4L A;  2QJV A;  2JDZ A;  2UWB A;  2WFF 3;  3NAP B;  3U37 A;  1F8V A;  1UWW A;  1V70 A;  3KD4 A;  4XC9 A;  5F3I A;  5IW0 A;  4B4R A;  1Q3E A;  1AHS A;  4YRD A;  4YM1 A;  2RMU 1;  4XW3 A;  2WUH A;  2RS5 3;  1J83 A;  1MEC 1;  1SLB A;  5LA0 A;  1PGS A;  1AF9 A;  4YM0 A;  1VBB 3;  1CAV A;  2QBX A;  4I0B A;  3R4S A;  4LA2 A;  3C7O A;  4JDM A;  1GQH A;  1RUI 3;  2P4E A;  3AYC A;  2VOK A;  2VJX A;  3SEP A;  1LHN A;  1VMF A;  3B69 A;  3I54 A;  4LLO A;  3UJQ A;  1YWK A;  1E57 A;  5FXX A;  4B4Q A;  4P00 B;  2WWS A;  2XJP A;  2CTV A;  4PLO A;  4QQO A;  1XNB A;  1WMD A;  5CFC B;  2VY0 A;  2Y6K A;  1SAC A;  1TMF 1;  2FD8 A;  4FP2 A;  4XOG A;  5KXE A;  4W6Y A;  2IUW A;  1JYV A;  4BB3 A;  3KB5 A;  3CHX A;  1E5R A;  2IXC A;  3ZKU A;  3RJR A;  3M3C A;  2K46 A;  1YO8 A;  2OZJ A;  3OG2 A;  2E32 A;  4FFF A;  4EN6 B;  1AYN 2;  3M3I A;  2YRO A;  3T4V A;  1NXD 1;  1V6K A;  3WNX A;  4AHX A;  3WDX A;  2VCM A;  1ND2 A;  3MI8 A;  5DAW A;  4A44 A;  4FFI A;  3KS7 A;  4PHZ A;  4Y26 A;  4D7T A;  1GMM A;  2HWB 2;  2PHR A;  4LBQ D;  3H42 B;  2RM2 2;  4M3C A;  4XUQ A;  3NRU A;  5IAT A;  1TNF A;  1ND2 C;  5H9R A;  5BXX A;  3MLL A;  4YM3 A;  4BMB A;  3LPF A;  4AHZ A;  3HOB A;  5HPO A;  5AC9 3;  2DCT A;  2MHF A;  3OGS A;  2V4V A;  4GB3 1;  2Y6F A;  4PT6 A;  3BTA A;  3ZN6 A;  4NVP A;  4YW5 A;  1WBF A;  3POI A;  1D4V B;  4IER A;  1D0G A;  1SBD A;  2G19 A;  4OQ8 A;  5FCC A;  3HR9 A;  4PQ9 A;  1RUF 1;  4X6Q B;  4UW5 A;  5FOB B;  4XHB A;  2R32 A;  3OD4 A;  5LWB A;  1GQP A;  4Z82 A;  2VOX A;  2ZHM A;  2PTM A;  3C7H A;  2XPJ A;  5JOX A;  2B7Y A;  1IS3 A;  4P08 A;  2Q1Z B;  5DMY A;  5JSR A;  3VHO A;  4IEZ A;  2JDA A;  4GH4 B;  3DKW A;  4MYE A;  3UES A;  3SH4 A;  5A7O A;  3LCP A;  4ITC A;  4P9G A;  1RMU 3;  3WF4 A;  2OT7 A;  5F6K A;  1H1A A;  1KGY A;  3A22 A;  1QNY A;  3PJY A;  4XTP A;  2XON A;  2WQZ C;  5A3W A;  4FI9 A;  2UYB A;  1DG6 A;  3JB8 A;  2WRA A;  1VRH 3;  1FT9 A;  1JUH A;  1IGO A;  5JXH A;  3B9I A;  3ZYI B;  3MZH A;  4IEO A;  2ZHN A;  5CKM A;  3WNL A;  3DV8 A;  2ARC A;  2WN3 A;  1H2N A;  1PVC 3;  1TEI A;  3PVB B;  1LU1 A;  1W6Q A;  3ZFE A;  2JG9 C;  2CDO A;  1F2N A;  4ZU4 A;  1G9D A;  1O7F A;  1WMX A;  1W9Y A;  1H1I A;  3FBM A;  4WM8 A;  2E7T A;  4V2V A;  2OPK A;  1CAX A;  1OH4 A;  4YLZ A;  4KGQ A;  5AVA A;  1XJA A;  3H7J A;  3PJQ A;  1RIR A;  2E53 A;  2GNM A;  4IEU A;  2HJI A;  4QPG C;  3ZFE C;  4CU7 A;  1QJY 2;  4WM8 C;  4P5H A;  3LEK A;  4LK7 A;  3D5O A;  5JZG B;  4PI2 A;  3HBK A;  3O1U A;  2Y8K A;  3HD8 B;  2F6B A;  1CJP A;  2R04 3;  2NP0 A;  4UYB A;  3KT1 A;  1FPN 3;  3PUR A;  5FUN A;  4NPL A;  4A6S A;  1O3R A;  1OKQ A;  1OPO A;  2X5I B;  3JQX A;  4Y3O A;  1LHU A;  2AH2 A;  4PDW A;  1J3R A;  4IGO A;  3CQO A;  3IN9 A;  1G9F A;  4Y1X A;  4XJ9 A;  1VBD 1;  2VTF A;  5I8S A;  4LQR A;  4JHT A;  3ACF A;  1RUG 1;  2VZQ A;  4J6G A;  4LBO A;  1WGP A;  1J84 A;  3E5X A;  4PDW C;  2A75 A;  1EV1 2;  4L11 A;  2WS9 1;  4JV4 A;  3IDC B;  1KEX A;  2ZJC A;  4OMC A;  1NA1 C;  3S6P A;  4GMP 0;  4N43 B;  1WD3 A;  5BNO A;  3MIE A;  2XB6 C;  3ELN A;  4K8F A;  2ZX0 A;  2RDN A;  5CKQ A;  3KCY A;  3LOI A;  1E5S A;  4LA3 A;  4RGA A;  1N1T A;  1UD1 A;  4IDZ A;  2BNM A;  5C4W B;  2ZX2 A;  1W8N A;  2HWF 3;  4DB5 A;  3RSJ A;  1PZ9 A;  4W6W A;  1JMU B;  1PGW 2;  3DPR A;  5BNO C;  2QZ2 A;  4CDW B;  3ZXA C;  1IS6 A;  4MHR A;  1TQ5 A;  4QKN A;  5LBE A;  2HWC 2;  4FXK B;  4CDU C;  1D2Q A;  3T3Y A;  1OF4 A;  4XQ4 A;  4AQT A;  2OII A;  4AVB A;  1VAM A;  4G9S B;  3DPR C;  1AR8 1;  1B35 A;  1XSQ A;  1HRV 2;  3HAG A;  2Q1M A;  2VBB A;  5FUI A;  3ZXD A;  2B39 A;  5FP9 A;  4B1M A;  1WWY A;  2RS1 1;  4DO0 A;  3W5N A;  5KXC A;  3M3Q A;  4NIA A;  4OI1 A;  1B35 C;  3ZXE A;  2VW2 A;  1Q43 A;  2E26 A;  3GJA A;  3MBW A;  1PVX A;  2Z69 A;  4HKO A;  3MLJ A;  3VL8 A;  4ES9 A;  5D2A A;  1EAH 2;  4HSL A;  3POJ A;  2DF7 A;  3NNJ A;  4RYD A;  1LOG A;  2B4K A;  5FRA A;  5J09 A;  1UW8 A;  2VCA A;  2A73 B;  2WT2 A;  1ASJ 2;  2VXR A;  2QNK A;  3N7J A;  4Y33 A;  5A6X A;  5F5I A;  5DG2 A;  5FZK A;  2DVA A;  1OKO A;  2XQX A;  1LAJ A;  4LLF A;  1LEN A;  3BAL A;  4LO4 B;  1RED A;  2C4X A;  4IEX A;  4YW3 A;  3VKM A;  5AFB A;  2WFP A;  3PUS A;  3FJS A;  1MPX A;  1ULE A;  1OUR A;  2FBE A;  2BOI A;  3VDD B;  4R9C A;  3M7A A;  1RUN A;  3HMY A;  2P37 A;  4DUV A;  1W2U A;  1KFU L;  5JXI A;  5LRR A;  2KA3 A;  1SCR A;  3KGZ A;  3FWE A;  1H30 A;  4Y20 A;  1X33 A;  3GCX A;  4P9X A;  4RS5 C;  4Q1P A;  1COV 1;  3N9Q A;  1JZ4 A;  4QDQ A;  1JOP A;  4AVC A;  2Y33 A;  3PVE A;  4MGS A;  1GWM A;  1I5Z A;  2X29 A;  4GWI A;  5IFP A;  1MEC 2;  1RUE 3;  2Y6L A;  1CD3 G;  5L9B A;  4Z8B A;  1N1S A;  2XHK A;  2XUE A;  5FKC A;  3TN9 3;  1JYI A;  3Q8E A;  3VBF A;  1VBA 1;  5GLZ A;  4DZG A;  2OPW A;  2VH9 A;  4GAL A;  2XVG A;  3OTF A;  4XF3 A;  3OY8 A;  3SXW A;  1AJK A;  2JIG A;  3B9C A;  3LFM A;  4RQP A;  2CGP A;  4QX7 A;  2GN7 A;  3W59 A;  3THD A;  4BQX A;  4Q1R A;  5C9A B;  4NWW A;  4QKD A;  5JDB A;  4LO6 B;  3VBF C;  2ETE A;  5K0U A;  3SQO A;  3MF6 A;  1ZBE 3;  2W08 A;  3KSC A;  4FTE A;  3LIH A;  1TMF 2;  1UOB A;  4Q26 A;  5FJK A;  5EHD A;  1GU3 A;  4OHW A;  2PQQ A;  2XJV A;  2ZCW A;  3H0O A;  3GZA A;  3KQ4 B;  5FMC A;  5FWE A;  1VBC 1;  2JE9 A;  1MS8 A;  1X36 A;  2A6V A;  1NCQ A;  4AL9 A;  2O1Q A;  1HN1 A;  5L9R A;  3G6J B;  4AFM A;  1WMF A;  3R0R A;  3BI3 A;  5DDJ 2;  2VAU A;  2AZ5 A;  2JE7 A;  3WEZ A;  4A4A A;  2BTV C;  5FQ0 B;  2YU1 A;  4MXW B;  2ES3 A;  1NCQ C;  4N9I A;  1S4C A;  4ES8 A;  5FZM A;  2DUP A;  1QJU 1;  2GP5 A;  4YW4 A;  3ZIX A;  1W06 A;  1VPH A;  2ZGN A;  3DCQ A;  5FMD A;  2VZ1 A;  4PLN A;  2VUD A;  1YIF A;  1ENQ A;  2ZGS A;  4N53 B;  1XBF A;  2RMU 3;  3FMG A;  2ZZJ A;  3KQR A;  4AK3 A;  3O1V A;  2HH9 A;  4Y4R A;  4GKY A;  2D93 A;  2P34 A;  5CFD B;  4XUR A;  4CU8 A;  2OZ6 A;  3W5M A;  1RUF 2;  2Y0O A;  3LPG A;  5C8W A;  2ET1 A;  4NRP A;  4UW4 A;  4E2G A;  2XH6 A;  4MV2 A;  3ZR5 A;  2BP6 A;  2QDR A;  2Z42 A;  2VVD A;  3GHM A;  4ISR A;  3AMN A;  2WNU A;  3JUU A;  3TAY A;  2H0B A;  3RYK A;  4AED A;  2ZGL A;  1GNZ A;  3C2U A;  4OHY A;  4CDX C;  2OW4 A;  1HV0 A;  3AVR A;  2WT1 A;  1N1V A;  3MFC A;  5FZ3 A;  4AYU A;  4BIF A;  2BPA 2;  1W9W A;  4LUM A;  1U0A A;  2PFW A;  4K8R B;  4IUG A;  5HXV A;  3DKQ A;  4BE3 A;  3AMM A;  4LBM A;  2QFE A;  4P9L A;  3VV1 A;  4AED C;  4E27 A;  1C57 A;  1SLA A;  5JXG A;  2V5D A;  4FPE A;  1DGW X;  4QX1 A;  1S0B A;  1XYO A;  2XBO 1;  2QQI A;  2VZO A;  4XFC A;  5FAX A;  2O8Q A;  4C91 A;  4WVZ A;  4XFB A;  5FWJ A;  2K2S A;  3CJI A;  4JTN A;  2GND A;  2IXL A;  4MGI E;  5FMO S;  4E9K A;  4Q8L A;  4BU2 A;  1RUC 1;  5IUQ A;  1H8V A;  5F3E A;  4XF0 A;  1JU3 A;  3CJI C;  2JDY A;  2NPI A;  2G9G A;  3ATG A;  1H8T B;  4GB3 3;  3SHR A;  5GZF A;  4V2W A;  4XJU A;  2VUC A;  4FPK A;  1UAI A;  2B46 X;  4IV1 B;  4Y4Y A;  1HV1 A;  3MW3 A;  4ZS2 A;  5K8S A;  2JG8 B;  1ACC A;  3I59 B;  2BFU S;  3WVJ A;  4YM2 A;  2GNB A;  4B8E A;  4NID A;  3LIG A;  1F5J A;  3I4I A;  2UWA A;  4CYD A;  4GZ9 A;  3RI9 A;  1S0E A;  4L97 A;  5FZL A;  4UFL A;  1BK1 A;  2YY1 A;  1PNF A;  3EO6 A;  1SDW A;  2FDJ A;  4X8N A;  1YQ6 A;  5A7Q A;  5F1R A;  1W90 A;  1R08 2;  3R4U A;  5I0T A;  1VBD 2;  1DGR N;  2K9Z A;  2Y26 A;  1RUG 2;  1VB2 A;  1DQ2 A;  2GDF A;  2X53 S;  2ZX1 A;  4O7X A;  4Q4V 1;  2NZ9 A;  2VZT A;  3FHA A;  3I3B A;  1PZ8 A;  2UY8 A;  4ASM B;  3ZYB A;  3RZH A;  2RE9 A;  5DUX A;  3IMN A;  4XFI A;  2F17 A;  3P3N A;  3OBT A;  3CZU A;  4XMI A;  2RS5 1;  3MV1 1;  5LA2 A;  2OS2 A;  3VBH B;  4XZU G;  5FMO L;  3T08 A;  5C8C A;  2J1V A;  5IHR A;  1BMV 1;  1MZE A;  4A2U A;  3V56 A;  2XL9 A;  2WO1 A;  3SIT A;  1CON A;  2RJ2 A;  2ORZ A;  4E2Q A;  5BV6 A;  2CSG A;  1Z7S 3;  3H1Y A;  3USU A;  4ZON A;  1DHK B;  4OHV A;  1HB4 A;  4BIS A;  5C8C C;  3OOX A;  4NR1 A;  5F5A A;  2E6V A;  3FBY A;  3W21 A;  3TB0 A;  4FSJ A;  1AR8 2;  1YFU A;  5FV3 A;  1LR5 A;  1D4M 3;  3ZO0 B;  1ZZB A;  4HVO A;  4URA A;  4LIT A;  1C4R A;  1W0P A;  2RS1 2;  5KXD A;  4ISQ A;  1R09 3;  3NVC A;  5H9P A;  1CAV B;  3ACI A;  4LHS A;  2PEL A;  3U14 A;  4OHZ A;  3UGG A;  2ERF A;  4IEP A;  1V6J A;  3I2F A;  3H3U A;  4LNV A;  1VAK A;  3AMH A;  1JZ2 A;  2D6N A;  5JSP A;  3RWK X;  4N7I A; 
#chains in the Genus database with same CATH homology
 1XBF A;  2P6H A;  1VMJ A;  1VMF A;  2CU5 A;  2P6C A;  1VMH A;  1VE0 A;  1VPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...