1XBIA

High resolution structure of methanocaldococcus jannaschii l7ae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
HMAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
publication title The Crystal Structure of the Methanocaldococcus jannaschii Multifunctional L7Ae RNA-Binding Protein Reveals an Induced-Fit Interaction with the Box C/D RNAs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein/structural protein
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1xbiA00
1Q86H 1YJWF 2KG4A 3CMAF 1QVFF 3NK6A 3VMFB 3CC2F 3LFOA 3CCRF 4LCKA 3CD6F 1GO0A 2CZWA 1X7OA 3LWVC 3FFMA 5EWRA 1H7MA 3MCAB 1VQOF 3LWPC 2QEXF 3E20B 1KQSF 1RA4A 3I55F 1KD1H 5G4VC 3LWOC 4X3MA 4BW0B 3J81M 3CXCF 3CPQA 3CCJF 3OBYA 3CCSF 3CG6A 3WXMB 5IT9M 1W41A 3CMEF 1YJNF 3CCLF 1W40A 3SIUA 1SDSA 2JNBA 2VGNA 3CCUF 1Q81H 2OTLF 3J80M 2HVYD 2I6DA 3OBWA 5A2QM 1K9MH 1VQ5F 1X7PA 3CCMF 1VQ6F 5GAPK 1YHQF 3PAFA 1VQ4F 2KTUA 5FJ4C 1M1KH 3CPWF 3G6EF 2LBWA 1W2BF 1W3EX 1YI2F 3CCEF 3JAMM 3VI6A 3RA6A 2VGMA 1VQ7F 1XBIA 1GZ0A 2FC3A 2AIFA 3GYQA 1E7KA 3HJWC 5G4UC 4BY9D 1VQPF 3SIVA 4NUTA 4TZZA 4C4WC 5GINC 1DT9A 1NJIH 3CC7F 3LWRC 5GIOC 1T0KB 3OW2F 1VQ8F 1GO1A 5FLXM 3V7EA 3HAXD 1K73H 1K8AH 3CCQF 1JJ2F 1YIJF 1S72F 2OZBA 3LWQC 1Q7YH 2BO1A 1M90H 1VQNF 1X52A 1QVGF 1YITF 2QA4F 5GIPC 3O85A 2LBXA 3PLAC 5GANK 3ON1A 1VQKF 1NMUB 3JCMM 1KC8H 3V7QA 1CN7A 2OTJF 2QI2A 3J7AR 1CK2A 1Q82H 5EO3A 2OHWA 3N4ZA 3I56F 5DCVA 3RA5A 1PXWA 4X3LA 1RLGA 3G4SF 1N8RH 3N4YA 1VQMF 3E1YA 1YJ9F 3NVIB 2KTVA 3NVKE 1W42A 3CCVF 1VQLF 2WALA 3G71F 2ALEA 1ZWZA 3NMUC 1IPAA 3AGKA 3IR9A 3CC4F 1VQ9F 3NK7A
chains in the Genus database with same CATH superfamily
3LDTA 4C8EA 1OAPA 4DRXA 2KG4A 2HQSC 3GTZA 2PHNA 3IEWA 3VMFB 5LOVA 3CC2F 2CHSA 5HP8A 3C9UA 5IYZA 1GO0A 2CZWA 1Z5VA 2IQQA 3KIZA 1VQVA 5BMVB 5HXUA 1U3PA 3QUWA 3KJJA 3Q8HA 1H7MA 1DBFA 1YQNA 5KMGA 1VK3A 5EB1B 3IKFA 3CXCF 4O2AA 4BT3A 3CCSF 2H6LA 4U3JB 4I4TB 3CMEF 3VCZA 1W40A 2JNBA 4X1IA 2HVYD 2CSLA 3WPWA 1FFXB 1X7PA 3JALA 4B46A 5GAPK 3K14A 4KWEA 1YHQF 3ZO8A 2Z1EA 3MBMA 1VQ4F 4HNAB 1YGYA 3U0OA 2GZLA 2LCAA 2KTUA 4TUYB 3CPWF 2LBWA 1RQ7A 2ZVYA 5C8YB 3QHDA 1JFFB 5JQGA 3JAWA 2VGMA 1VQ7F 2AIFA 2BTUA 1E7KA 5LXTA 3P10A 4G4XA 4C8IA 5CB4A 4BY9D 1COMA 5CA1A 1W5AA 3EORA 4TV9A 4B5CA 2HS0A 1T0KB 3I3FA 3OW2F 1VQ8F 1GO1A 4YJ3B 3RE3A 4BT4A 2UYPA 3IKEA 4DXDA 3HAXD 3JASA 3FPIA 3CCQF 2B33A 3VIUA 4O4HA 4BT2A 1Q7YH 1X52A 2YXZA 4NQ3A 5GIPC 2LBXA 5LP6C 3PLAC 3ON1A 2PMPA 5EZYA 2R751 1ONIA 1ODEA 1KC8H 3RYHA 3ZP7A 2N48A 3J7AR 2I6RA 2P6YA 2UYJA 4IHJA 2OHWA 3UT5B 1PXWA 1SA0B 4BVSA 2NMUA 3VYUC 4ERHA 2F9ZC 3G4SF 5EYPA 3RYCB 2UYKA 3IMPA 4G4WA 3N4YA 2H8EA 1YJ9F 2KTVA 4ZK7A 3F6MA 3RYFA 4ZHYB 4DRXB 3HKCA 1ZWZA 4O2BB 1IPAA 3NMUC 3AGKA 3JARB 5LOVB 3TD3A 1VQ9F 3JAKB 2HX0A 3E1YA 3HWUA 2ZF8A 3KHNA 3P4EA 1J7HA 1TVKA 4BT7A 5LP6A 3HKDA 3CD6F 4C8GA 5LYJA 2R6R1 2VAWA 1X7OA 5ITZA 1PF5A 3DDNA 3LWVC 1CLIA 5EWRA 5LA6A 4EB6B 2QEXF 1U3LA 2Q1XA 4XCQA 3LWOC 4X3MA 3J81M 4ZHVA 5J2UB 3CG6A 3JALB 5IT9M 2AMTA 1YJNF 3E22A 3CCUF 3JATB 3J80M 2I6DA 5A2QM 3N2GA 3S02A 3N2KB 2UZHA 2H8CA 4BVQA 3JAWB 3G6EF 4O4LA 5CA0B 1RLUA 4ZHQB 2CHTA 4I55A 3ZOPA 3IEQA 2YYEA 3KE1A 3M84A 3WGLA 2FC3A 5CA1B 2CVLA 5JCOA 2UYNB 3HJWC 3MDOA 4BVTA 5MN6A 4O4IA 1TUBA 4C4WC 3DC2A 4E6EA 3JASB 1DT9A 5FNVA 5GIOC 1IV4A 1SZQA 4O4HB 4PWTA 4U39A 4B62A 3JVHA 3V7EA 4O4JB 5EIBC 4M8IA 1S72F 2OZBA 3WGKA 1JN1A 3F0FA 5EZYB 2GVIA 3HKBA 1QVGF 1YITF 1H47A 5IJ0B 4RQOA 2QA4F 5GANK 1VQKF 1VHAA 2RB9A 2Z1FA 3V7QA 5IJ9A 1CN7A 3KJKA 3FD5A 1CK2A 2Q1YA 1W581 3MCQA 2FGYA 4X1KB 4I50A 1XRGA 5JVDB 3I7TA 3M4SA 3RA5A 5DCVA 2EWCA 3S0YA 1RLGA 1W5EA 4ZOLB 2K1SA 3S0WA 3HKCB 3D00A 2ZOVA 4IIJA 5BMVA 2HP3A 4FFBB 3NVIB 5KX5B 5HY2A 2V9YA 2DYYA 2Z01A 5HP7A 2Z1TA 3TD5A 2RHHA 3IR9A 4YJ2B 2BTOA 1W55A 1X25A 5ITZB 4U3JA 1YJWF 4X1YB 4I4TA 5EB0A 3CMAF 3NK6A 4TV8A 3CCRF 3LFOA 5LA6B 1FNKA 3ESJA 1XV2A 3CYPB 2HP0B 3CB2A 1QD9A 1FFXA 3FFMA 3VOAA 1VQOF 3LWPC 4LNUB 2LBTA 1H48A 3E20B 1KQSF 4TUYA 2DT4A 5G4VC 3RYIB 2HRYA 3CPQA 3E22B 3CCJF 3OBYA 5C8YA 3OONA 1W41A 1IV2A 3F0EA 4EI8A 3CCLF 3SIUA 1SDSA 5IYZB 1Q81H 1QAHA 4G4VA 3CCMF 4O4LB 3PAFA 4BVRA 5HY1A 5KMGB 1XHOA 2ZVZA 4YJ3A 3WGJA 2ZAUA 3CCEF 4O2AB 5MN5A 3V4DA 3K0TA 5EAZA 2BTQB 3VYSC 2IG8A 3RA6A 2HRUA 1XBIA 4X1IB 3FBAA 1GZ0A 3LYBA 2W8BC 1VH8A 3BYQA 3S06A 1W5FA 1UI9A 3C9TA 1VQPF 4NUTA 5JH7A 4TZZA 3TD4A 5HY4A 5GINC 1IV3A 3CC7F 1NJIH 3LWRC 1OFUA 3T80A 3VO8A 3P0ZA 5JQGB 1K73H 4R40B 1K8AH 1JJ2F 2QTPA 3UT5A 3HTNA 1SA0A 3WPXA 3ERNA 3RYCA 3LMEA 4ZHWA 5LXTB 1M90H 1VQNF 3C9SA 5CB4B 4RHAA 3O85A 4WBNA 4TV9B 5MN4A 4I50B 2OTJF 4O2BA 2MQEA 3JARA 1QU9A 4BT6A 3S03A 3ELCA 5EO3A 3JAKA 2CWJA 3N4ZA 4IIJB 5GONA 4X3LA 1GX1A 1FNJA 4C82A 1N8RH 1VQMF 3B6NA 3NVKE 3WJQA 1RQ2A 1W42A 2HS4A 4EB6A 4ZI7A 2WALA 3CCVF 1VQLF 3L7QA 3RYHB 3VYTC 2ALEA 4BT5A 2OTMA 4TV8B 4X20A 5J2TA 4F6RA 3CC4F 4IHJB 5J2UA 1Q86H 3F0DA 3QTYA 3VTIC 1QVFF 3HKEA 1KNKA 3F0GA 5EYPB 4EI9A 4LCKA 1FSZA 3WJPA 3JATA 3N2KA 1T0AA 3MCAB 4EI7A 3RYFB 2RHOA 3FD6A 1RA4A 3I55F 1KD1H 5CA0A 4BW0B 4ZHQA 2RHJA 2L26A 3D01A 1TVKB 3WXMB 1W57A 5LP6B 3WGMA 3HKDB 2VGNA 2Z1UA 2OTLF 5LYJB 3OBWA 2UYNA 1K9MH 1VQ5F 1VQ6F 1UFYA 2ZODA 5FJ4C 1JD1A 1M1KH 3WGNA 1W2BF 1W3EX 1YI2F 3JAMM 3C8LA 4HNAA 2RHLA 4O4JA 3VI6A 4NWOB 2VAPA 5JH7B 3GYQA 3R0PA 3WJRA 2CW4A 3N2GB 3GHZA 5G4UC 1JFFA 5IJ0A 3SIVA 3V3TA 2G9IA 3K2XA 3M1XA 4G88A 5HY0A 1IV1A 4C81A 1W5BA 2VAMA 5HWEA 4G4ZA 4I55B 4X1KA 5FLXM 5JVDA 1YIJF 5EIBD 4WBNB 3LWQC 5HXZA 1JY8A 1U43A 2BO1A 4ZOLA 5B8FA 1Z5WA 3D54A 4FFBA 4O4IB 5KX5A 1TUBB 1W59A 1NMUB 4B45A 3JCMM 3S0HA 1KNJA 5FNVB 1NQ3A 2QI2A 2AIZP 5GONB 1Q82H 4YJ2A 2KGWA 3C9RA 4G4YA 3I56F 4X1YA 1U40A 2IAFA 1R1MA 4ZI7B 3HKBB 5AVMA 2VXYA 5JCOC 1Q8RA 3ZP4A 2HP0A 4X20B 5J2TB 2HS3A 4F6RB 4LNUA 3G71F 5IJ9B 2GLZA 3CYQA 3HKEB 3VOBA 3K12A 3RYIA 3MQWA 3NK7A
chains in the Genus database with same CATH topology
1Q86H 1YJWF 2KG4A 3CMAF 1QVFF 3NK6A 3VMFB 3CC2F 3LFOA 3CCRF 4EI9A 4LCKA 3CD6F 1GO0A 2CZWA 1X7OA 3LWVC 5HXUA 3FFMA 5EWRA 1H7MA 3MCAB 4EI7A 1VQOF 3LWPC 2QEXF 3E20B 1KQSF 1RA4A 3I55F 4XCQA 5G4VC 3LWOC 1KD1H 4X3MA 4BW0B 3J81M 3CXCF 3CPQA 3CCJF 3OBYA 3CCSF 3CG6A 3WXMB 5IT9M 1W41A 3CMEF 4EI8A 1YJNF 3CCLF 1W40A 3SIUA 1SDSA 2JNBA 2VGNA 3CCUF 1Q81H 2OTLF 3J80M 2HVYD 2I6DA 3OBWA 5A2QM 1K9MH 1VQ5F 1X7PA 3CCMF 1VQ6F 5GAPK 1YHQF 3PAFA 1VQ4F 4BVRA 2KTUA 4BVQA 5HY1A 1M1KH 3CPWF 5FJ4C 3G6EF 2LBWA 1W2BF 1W3EX 1YI2F 3CCEF 3JAMM 3VI6A 3RA6A 2VGMA 1VQ7F 1XBIA 1GZ0A 2FC3A 2AIFA 3GYQA 1E7KA 3HJWC 5G4UC 4BVTA 4BY9D 1VQPF 3SIVA 3V3TA 4NUTA 4TZZA 4C4WC 5HY4A 5GINC 1DT9A 1NJIH 3CC7F 3LWRC 5GIOC 5HY0A 3OW2F 1VQ8F 1T0KB 1GO1A 5HWEA 5FLXM 3V7EA 3HAXD 1K73H 1K8AH 3CCQF 1JJ2F 1YIJF 1S72F 2OZBA 3LWQC 5HXZA 1Q7YH 2BO1A 1M90H 1VQNF 1X52A 4NQ3A 1QVGF 1YITF 2QA4F 5GIPC 3O85A 2LBXA 3PLAC 5GANK 3ON1A 1VQKF 1NMUB 3JCMM 1KC8H 3V7QA 1CN7A 2OTJF 2QI2A 3J7AR 1CK2A 1Q82H 5EO3A 2FGYA 2OHWA 3N4ZA 3I56F 5DCVA 3RA5A 1PXWA 4BVSA 4X3LA 1RLGA 2F9ZC 3G4SF 1N8RH 3N4YA 1VQMF 3D00A 3E1YA 1YJ9F 3NVIB 5HY2A 2KTVA 3NVKE 1W42A 3CCVF 1VQLF 2WALA 3G71F 2GLZA 2ALEA 1ZWZA 3NMUC 1IPAA 3AGKA 3IR9A 3CC4F 1VQ9F 3NK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 H;  1YJW F;  2KG4 A;  3CMA F;  1QVF F;  3NK6 A;  3VMF B;  3CC2 F;  3LFO A;  3CCR F;  4LCK A;  3CD6 F;  1GO0 A;  2CZW A;  1X7O A;  3LWV C;  3FFM A;  5EWR A;  1H7M A;  3MCA B;  1VQO F;  3LWP C;  2QEX F;  3E20 B;  1KQS F;  1RA4 A;  3I55 F;  1KD1 H;  5G4V C;  3LWO C;  4X3M A;  4BW0 B;  3J81 M;  3CXC F;  3CPQ A;  3CCJ F;  3OBY A;  3CCS F;  3CG6 A;  3WXM B;  5IT9 M;  1W41 A;  3CME F;  1YJN F;  3CCL F;  1W40 A;  3SIU A;  1SDS A;  2JNB A;  2VGN A;  3CCU F;  1Q81 H;  2OTL F;  3J80 M;  2HVY D;  2I6D A;  3OBW A;  5A2Q M;  1K9M H;  1VQ5 F;  1X7P A;  3CCM F;  1VQ6 F;  5GAP K;  1YHQ F;  3PAF A;  1VQ4 F;  2KTU A;  5FJ4 C;  1M1K H;  3CPW F;  3G6E F;  2LBW A;  1W2B F;  1W3E X;  1YI2 F;  3CCE F;  3JAM M;  3VI6 A;  3RA6 A;  2VGM A;  1VQ7 F;  1XBI A;  1GZ0 A;  2FC3 A;  2AIF A;  3GYQ A;  1E7K A;  3HJW C;  5G4U C;  4BY9 D;  1VQP F;  3SIV A;  4NUT A;  4TZZ A;  4C4W C;  5GIN C;  1DT9 A;  1NJI H;  3CC7 F;  3LWR C;  5GIO C;  1T0K B;  3OW2 F;  1VQ8 F;  1GO1 A;  5FLX M;  3V7E A;  3HAX D;  1K73 H;  1K8A H;  3CCQ F;  1JJ2 F;  1YIJ F;  1S72 F;  2OZB A;  3LWQ C;  1Q7Y H;  2BO1 A;  1M90 H;  1VQN F;  1X52 A;  1QVG F;  1YIT F;  2QA4 F;  5GIP C;  3O85 A;  2LBX A;  3PLA C;  5GAN K;  3ON1 A;  1VQK F;  1NMU B;  3JCM M;  1KC8 H;  3V7Q A;  1CN7 A;  2OTJ F;  2QI2 A;  3J7A R;  1CK2 A;  1Q82 H;  5EO3 A;  2OHW A;  3N4Z A;  3I56 F;  5DCV A;  3RA5 A;  1PXW A;  4X3L A;  1RLG A;  3G4S F;  1N8R H;  3N4Y A;  1VQM F;  3E1Y A;  1YJ9 F;  3NVI B;  2KTV A;  3NVK E;  1W42 A;  3CCV F;  1VQL F;  2WAL A;  3G71 F;  2ALE A;  1ZWZ A;  3NMU C;  1IPA A;  3AGK A;  3IR9 A;  3CC4 F;  1VQ9 F;  3NK7 A; 
#chains in the Genus database with same CATH topology
 3LDT A;  4C8E A;  1OAP A;  4DRX A;  2KG4 A;  2HQS C;  3GTZ A;  2PHN A;  3IEW A;  3VMF B;  5LOV A;  3CC2 F;  2CHS A;  5HP8 A;  3C9U A;  5IYZ A;  1GO0 A;  2CZW A;  1Z5V A;  2IQQ A;  3KIZ A;  1VQV A;  5BMV B;  5HXU A;  1U3P A;  3QUW A;  3KJJ A;  3Q8H A;  1H7M A;  1DBF A;  1YQN A;  5KMG A;  1VK3 A;  5EB1 B;  3IKF A;  3CXC F;  4O2A A;  4BT3 A;  3CCS F;  2H6L A;  4U3J B;  4I4T B;  3CME F;  3VCZ A;  1W40 A;  2JNB A;  4X1I A;  2HVY D;  2CSL A;  3WPW A;  1FFX B;  1X7P A;  3JAL A;  4B46 A;  5GAP K;  3K14 A;  4KWE A;  1YHQ F;  3ZO8 A;  2Z1E A;  3MBM A;  1VQ4 F;  4HNA B;  1YGY A;  3U0O A;  2GZL A;  2LCA A;  2KTU A;  4TUY B;  3CPW F;  2LBW A;  1RQ7 A;  2ZVY A;  5C8Y B;  3QHD A;  1JFF B;  5JQG A;  3JAW A;  2VGM A;  1VQ7 F;  2AIF A;  2BTU A;  1E7K A;  5LXT A;  3P10 A;  4G4X A;  4C8I A;  5CB4 A;  4BY9 D;  1COM A;  5CA1 A;  1W5A A;  3EOR A;  4TV9 A;  4B5C A;  2HS0 A;  1T0K B;  3I3F A;  3OW2 F;  1VQ8 F;  1GO1 A;  4YJ3 B;  3RE3 A;  4BT4 A;  2UYP A;  3IKE A;  4DXD A;  3HAX D;  3JAS A;  3FPI A;  3CCQ F;  2B33 A;  3VIU A;  4O4H A;  4BT2 A;  1Q7Y H;  1X52 A;  2YXZ A;  4NQ3 A;  5GIP C;  2LBX A;  5LP6 C;  3PLA C;  3ON1 A;  2PMP A;  5EZY A;  2R75 1;  1ONI A;  1ODE A;  1KC8 H;  3RYH A;  3ZP7 A;  2N48 A;  3J7A R;  2I6R A;  2P6Y A;  2UYJ A;  4IHJ A;  2OHW A;  3UT5 B;  1PXW A;  1SA0 B;  4BVS A;  2NMU A;  3VYU C;  4ERH A;  2F9Z C;  3G4S F;  5EYP A;  3RYC B;  2UYK A;  3IMP A;  4G4W A;  3N4Y A;  2H8E A;  1YJ9 F;  2KTV A;  4ZK7 A;  3F6M A;  3RYF A;  4ZHY B;  4DRX B;  3HKC A;  1ZWZ A;  4O2B B;  1IPA A;  3NMU C;  3AGK A;  3JAR B;  5LOV B;  3TD3 A;  1VQ9 F;  3JAK B;  2HX0 A;  3E1Y A;  3HWU A;  2ZF8 A;  3KHN A;  3P4E A;  1J7H A;  1TVK A;  4BT7 A;  5LP6 A;  3HKD A;  3CD6 F;  4C8G A;  5LYJ A;  2R6R 1;  2VAW A;  1X7O A;  5ITZ A;  1PF5 A;  3DDN A;  3LWV C;  1CLI A;  5EWR A;  5LA6 A;  4EB6 B;  2QEX F;  1U3L A;  2Q1X A;  4XCQ A;  3LWO C;  4X3M A;  3J81 M;  4ZHV A;  5J2U B;  3CG6 A;  3JAL B;  5IT9 M;  2AMT A;  1YJN F;  3E22 A;  3CCU F;  3JAT B;  3J80 M;  2I6D A;  5A2Q M;  3N2G A;  3S02 A;  3N2K B;  2UZH A;  2H8C A;  4BVQ A;  3JAW B;  3G6E F;  4O4L A;  5CA0 B;  1RLU A;  4ZHQ B;  2CHT A;  4I55 A;  3ZOP A;  3IEQ A;  2YYE A;  3KE1 A;  3M84 A;  3WGL A;  2FC3 A;  5CA1 B;  2CVL A;  5JCO A;  2UYN B;  3HJW C;  3MDO A;  4BVT A;  5MN6 A;  4O4I A;  1TUB A;  4C4W C;  3DC2 A;  4E6E A;  3JAS B;  1DT9 A;  5FNV A;  5GIO C;  1IV4 A;  1SZQ A;  4O4H B;  4PWT A;  4U39 A;  4B62 A;  3JVH A;  3V7E A;  4O4J B;  5EIB C;  4M8I A;  1S72 F;  2OZB A;  3WGK A;  1JN1 A;  3F0F A;  5EZY B;  2GVI A;  3HKB A;  1QVG F;  1YIT F;  1H47 A;  5IJ0 B;  4RQO A;  2QA4 F;  5GAN K;  1VQK F;  1VHA A;  2RB9 A;  2Z1F A;  3V7Q A;  5IJ9 A;  1CN7 A;  3KJK A;  3FD5 A;  1CK2 A;  2Q1Y A;  1W58 1;  3MCQ A;  2FGY A;  4X1K B;  4I50 A;  1XRG A;  5JVD B;  3I7T A;  3M4S A;  3RA5 A;  5DCV A;  2EWC A;  3S0Y A;  1RLG A;  1W5E A;  4ZOL B;  2K1S A;  3S0W A;  3HKC B;  3D00 A;  2ZOV A;  4IIJ A;  5BMV A;  2HP3 A;  4FFB B;  3NVI B;  5KX5 B;  5HY2 A;  2V9Y A;  2DYY A;  2Z01 A;  5HP7 A;  2Z1T A;  3TD5 A;  2RHH A;  3IR9 A;  4YJ2 B;  2BTO A;  1W55 A;  1X25 A;  5ITZ B;  4U3J A;  1YJW F;  4X1Y B;  4I4T A;  5EB0 A;  3CMA F;  3NK6 A;  4TV8 A;  3CCR F;  3LFO A;  5LA6 B;  1FNK A;  3ESJ A;  1XV2 A;  3CYP B;  2HP0 B;  3CB2 A;  1QD9 A;  1FFX A;  3FFM A;  3VOA A;  1VQO F;  3LWP C;  4LNU B;  2LBT A;  1H48 A;  3E20 B;  1KQS F;  4TUY A;  2DT4 A;  5G4V C;  3RYI B;  2HRY A;  3CPQ A;  3E22 B;  3CCJ F;  3OBY A;  5C8Y A;  3OON A;  1W41 A;  1IV2 A;  3F0E A;  4EI8 A;  3CCL F;  3SIU A;  1SDS A;  5IYZ B;  1Q81 H;  1QAH A;  4G4V A;  3CCM F;  4O4L B;  3PAF A;  4BVR A;  5HY1 A;  5KMG B;  1XHO A;  2ZVZ A;  4YJ3 A;  3WGJ A;  2ZAU A;  3CCE F;  4O2A B;  5MN5 A;  3V4D A;  3K0T A;  5EAZ A;  2BTQ B;  3VYS C;  2IG8 A;  3RA6 A;  2HRU A;  1XBI A;  4X1I B;  3FBA A;  1GZ0 A;  3LYB A;  2W8B C;  1VH8 A;  3BYQ A;  3S06 A;  1W5F A;  1UI9 A;  3C9T A;  1VQP F;  4NUT A;  5JH7 A;  4TZZ A;  3TD4 A;  5HY4 A;  5GIN C;  1IV3 A;  3CC7 F;  1NJI H;  3LWR C;  1OFU A;  3T80 A;  3VO8 A;  3P0Z A;  5JQG B;  1K73 H;  4R40 B;  1K8A H;  1JJ2 F;  2QTP A;  3UT5 A;  3HTN A;  1SA0 A;  3WPX A;  3ERN A;  3RYC A;  3LME A;  4ZHW A;  5LXT B;  1M90 H;  1VQN F;  3C9S A;  5CB4 B;  4RHA A;  3O85 A;  4WBN A;  4TV9 B;  5MN4 A;  4I50 B;  2OTJ F;  4O2B A;  2MQE A;  3JAR A;  1QU9 A;  4BT6 A;  3S03 A;  3ELC A;  5EO3 A;  3JAK A;  2CWJ A;  3N4Z A;  4IIJ B;  5GON A;  4X3L A;  1GX1 A;  1FNJ A;  4C82 A;  1N8R H;  1VQM F;  3B6N A;  3NVK E;  3WJQ A;  1RQ2 A;  1W42 A;  2HS4 A;  4EB6 A;  4ZI7 A;  2WAL A;  3CCV F;  1VQL F;  3L7Q A;  3RYH B;  3VYT C;  2ALE A;  4BT5 A;  2OTM A;  4TV8 B;  4X20 A;  5J2T A;  4F6R A;  3CC4 F;  4IHJ B;  5J2U A;  1Q86 H;  3F0D A;  3QTY A;  3VTI C;  1QVF F;  3HKE A;  1KNK A;  3F0G A;  5EYP B;  4EI9 A;  4LCK A;  1FSZ A;  3WJP A;  3JAT A;  3N2K A;  1T0A A;  3MCA B;  4EI7 A;  3RYF B;  2RHO A;  3FD6 A;  1RA4 A;  3I55 F;  1KD1 H;  5CA0 A;  4BW0 B;  4ZHQ A;  2RHJ A;  2L26 A;  3D01 A;  1TVK B;  3WXM B;  1W57 A;  5LP6 B;  3WGM A;  3HKD B;  2VGN A;  2Z1U A;  2OTL F;  5LYJ B;  3OBW A;  2UYN A;  1K9M H;  1VQ5 F;  1VQ6 F;  1UFY A;  2ZOD A;  5FJ4 C;  1JD1 A;  1M1K H;  3WGN A;  1W2B F;  1W3E X;  1YI2 F;  3JAM M;  3C8L A;  4HNA A;  2RHL A;  4O4J A;  3VI6 A;  4NWO B;  2VAP A;  5JH7 B;  3GYQ A;  3R0P A;  3WJR A;  2CW4 A;  3N2G B;  3GHZ A;  5G4U C;  1JFF A;  5IJ0 A;  3SIV A;  3V3T A;  2G9I A;  3K2X A;  3M1X A;  4G88 A;  5HY0 A;  1IV1 A;  4C81 A;  1W5B A;  2VAM A;  5HWE A;  4G4Z A;  4I55 B;  4X1K A;  5FLX M;  5JVD A;  1YIJ F;  5EIB D;  4WBN B;  3LWQ C;  5HXZ A;  1JY8 A;  1U43 A;  2BO1 A;  4ZOL A;  5B8F A;  1Z5W A;  3D54 A;  4FFB A;  4O4I B;  5KX5 A;  1TUB B;  1W59 A;  1NMU B;  4B45 A;  3JCM M;  3S0H A;  1KNJ A;  5FNV B;  1NQ3 A;  2QI2 A;  2AIZ P;  5GON B;  1Q82 H;  4YJ2 A;  2KGW A;  3C9R A;  4G4Y A;  3I56 F;  4X1Y A;  1U40 A;  2IAF A;  1R1M A;  4ZI7 B;  3HKB B;  5AVM A;  2VXY A;  5JCO C;  1Q8R A;  3ZP4 A;  2HP0 A;  4X20 B;  5J2T B;  2HS3 A;  4F6R B;  4LNU A;  3G71 F;  5IJ9 B;  2GLZ A;  3CYQ A;  3HKE B;  3VOB A;  3K12 A;  3RYI A;  3MQW A;  3NK7 A; 
#chains in the Genus database with same CATH homology
 1Q86 H;  1YJW F;  2KG4 A;  3CMA F;  1QVF F;  3NK6 A;  3VMF B;  3CC2 F;  3LFO A;  3CCR F;  4EI9 A;  4LCK A;  3CD6 F;  1GO0 A;  2CZW A;  1X7O A;  3LWV C;  5HXU A;  3FFM A;  5EWR A;  1H7M A;  3MCA B;  4EI7 A;  1VQO F;  3LWP C;  2QEX F;  3E20 B;  1KQS F;  1RA4 A;  3I55 F;  4XCQ A;  5G4V C;  3LWO C;  1KD1 H;  4X3M A;  4BW0 B;  3J81 M;  3CXC F;  3CPQ A;  3CCJ F;  3OBY A;  3CCS F;  3CG6 A;  3WXM B;  5IT9 M;  1W41 A;  3CME F;  4EI8 A;  1YJN F;  3CCL F;  1W40 A;  3SIU A;  1SDS A;  2JNB A;  2VGN A;  3CCU F;  1Q81 H;  2OTL F;  3J80 M;  2HVY D;  2I6D A;  3OBW A;  5A2Q M;  1K9M H;  1VQ5 F;  1X7P A;  3CCM F;  1VQ6 F;  5GAP K;  1YHQ F;  3PAF A;  1VQ4 F;  4BVR A;  2KTU A;  4BVQ A;  5HY1 A;  1M1K H;  3CPW F;  5FJ4 C;  3G6E F;  2LBW A;  1W2B F;  1W3E X;  1YI2 F;  3CCE F;  3JAM M;  3VI6 A;  3RA6 A;  2VGM A;  1VQ7 F;  1XBI A;  1GZ0 A;  2FC3 A;  2AIF A;  3GYQ A;  1E7K A;  3HJW C;  5G4U C;  4BVT A;  4BY9 D;  1VQP F;  3SIV A;  3V3T A;  4NUT A;  4TZZ A;  4C4W C;  5HY4 A;  5GIN C;  1DT9 A;  1NJI H;  3CC7 F;  3LWR C;  5GIO C;  5HY0 A;  3OW2 F;  1VQ8 F;  1T0K B;  1GO1 A;  5HWE A;  5FLX M;  3V7E A;  3HAX D;  1K73 H;  1K8A H;  3CCQ F;  1JJ2 F;  1YIJ F;  1S72 F;  2OZB A;  3LWQ C;  5HXZ A;  1Q7Y H;  2BO1 A;  1M90 H;  1VQN F;  1X52 A;  4NQ3 A;  1QVG F;  1YIT F;  2QA4 F;  5GIP C;  3O85 A;  2LBX A;  3PLA C;  5GAN K;  3ON1 A;  1VQK F;  1NMU B;  3JCM M;  1KC8 H;  3V7Q A;  1CN7 A;  2OTJ F;  2QI2 A;  3J7A R;  1CK2 A;  1Q82 H;  5EO3 A;  2FGY A;  2OHW A;  3N4Z A;  3I56 F;  5DCV A;  3RA5 A;  1PXW A;  4BVS A;  4X3L A;  1RLG A;  2F9Z C;  3G4S F;  1N8R H;  3N4Y A;  1VQM F;  3D00 A;  3E1Y A;  1YJ9 F;  3NVI B;  5HY2 A;  2KTV A;  3NVK E;  1W42 A;  3CCV F;  1VQL F;  2WAL A;  3G71 F;  2GLZ A;  2ALE A;  1ZWZ A;  3NMU C;  1IPA A;  3AGK A;  3IR9 A;  3CC4 F;  1VQ9 F;  3NK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...