1XBIA

High resolution structure of methanocaldococcus jannaschii l7ae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
b'HMAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
publication title The Crystal Structure of the Methanocaldococcus jannaschii Multifunctional L7Ae RNA-Binding Protein Reveals an Induced-Fit Interaction with the Box C/D RNAs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein/structural protein
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1xbiA00
3N4ZA 1W41A 3LWQC 1Q7YH 2OTJF 2QEXF 4TZZA 1VQKF 3LWRC 3CPWF 2KTVA 3GYQA 1IPAA 3PAFA 3V7EA 4C4WC 2VGMA 3VMFB 4X3MA 3RA6A 5A2QM 1QVGF 1NJIH 3CCQF 1T0KB 1VQ7F 5GAPK 3G6EF 2CZWA 3VI6A 1YJWF 2BO1A 1CN7A 1YJNF 1VQOF 3CC7F 3HJWC 3CG6A 2QA4F 1W3EX 1VQ5F 1X7PA 1VQMF 3CCEF 2AIFA 3I55F 5FJ4C 2WALA 1DT9A 1CK2A 1E7KA 2ALEA 3PLAC 1K73H 1GO0A 1VQ4F 1Q86H 3CCUF 1YI2F 3NK6A 2LBXA 4NUTA 1W40A 5EO3A 2HVYD 1ZWZA 3OBYA 1NMUB 3SIVA 1RA4A 1QVFF 2VGNA 3CCVF 1M90H 3LWVC 3CMEF 1VQ8F 3E1YA 1K8AH 3CC4F 3E20B 5GINC 2OTLF 1YIJF 3RA5A 1X7OA 1YHQF 4LCKA 1VQNF 1VQLF 3I56F 3ON1A 4X3LA 3CCMF 1W2BF 5G4UC 5GIPC 1GZ0A 1M1KH 1SDSA 1Q81H 3IR9A 2I6DA 1YITF 1S72F 1K9MH 4BW0B 3LWPC 3G71F 1VQPF 5DCVA 3CCRF 2KG4A 3JCMM 1KQSF 3WXMB 2OHWA 3N4YA 3J81M 5GANK 3G4SF 3NMUC 1X52A 3CCJF 1YJ9F 3NK7A 1PXWA 3JAMM 1VQ6F 1JJ2F 3CC2F 1GO1A 3CPQA 5G4VC 3NVKE 5FLXM 2KTUA 5EWRA 3CMAF 1RLGA 3SIUA 2QI2A 1W42A 3O85A 3OBWA 3HAXD 2FC3A 2LBWA 5GIOC 3LFOA 3J80M 1KD1H 1H7MA 3MCAB 3OW2F 3CD6F 3NVIB 3AGKA 1KC8H 1XBIA 1Q82H 1VQ9F 2OZBA 2JNBA 3LWOC 3CCLF 3CCSF 4BY9D 3CXCF 3FFMA 3J7AR 1N8RH 5IT9M 3V7QA
chains in the Genus database with same CATH superfamily
1W41A 5HP8A 2MQEA 1Q7YH 3QUWA 4TZZA 2G9IA 2RHJA 5EYPA 3ZP7A 3VO8A 3B6NA 3PAFA 5CA0A 4X1YA 3KJJA 3QHDA 1FFXB 4X1KA 5A2QM 1QVGF 1RLUA 1COMA 3CCQF 4WBNB 3RYHA 2AMTA 3VYSC 2CSLA 5EAZA 1J7HA 1YJWF 2GLZA 4F6RA 2BO1A 2IQQA 3ERNA 1VQOF 2W8BC 3LYBA 2IG8A 1H48A 1VQMF 3CCEF 3I55F 3R0PA 1CK2A 3Q8HA 3VCZA 2Q1XA 3OONA 5JCOC 3VOBA 1K73H 3P4EA 1GO0A 2HS3A 1FFXA 4IIJB 3FD6A 5KX5A 4WBNA 3CCUF 3HKBB 2F9ZC 1W57A 4NUTA 3JALA 5C8YB 4I55B 3C9UA 2ZVZA 5CB4B 3CCVF 3S06A 2V9YA 3RYCA 3E1YA 3KHNA 2VAPA 5GINC 2OTLF 4ERHA 2LCAA 1YHQF 5CA1B 1VQNF 5EIBC 3DC2A 3I56F 4ZHVA 3KJKA 4YJ2B 2NMUA 3C8LA 4NWOB 5C8YA 4G4VA 1GZ0A 3JASB 1M1KH 3GTZA 1YQNA 4TV9B 3BYQA 5CB4A 3LWPC 5DCVA 2KG4A 3JVHA 3N4YA 5IYZB 4O2BB 5GANK 3FPIA 3FD5A 4C8GA 2EWCA 3E22B 3JAMM 1JJ2F 4X1IA 1QAHA 3CPQA 4TUYB 3RE3A 5FLXM 2KTUA 2UYNB 2UYPA 3CMAF 4PWTA 5JQGB 3RYIB 5LXTB 4TV8B 3VOAA 3HAXD 3I7TA 4O4HB 5MN4A 2VXYA 4B45A 5IYZA 1Z5WA 2VAMA 3ZOPA 1JFFB 2JNBA 5LP6C 3CCLF 3CCSF 1XHOA 3K2XA 3FBAA 5BMVA 3P10A 4TUYA 3EORA 3VIUA 4ZHQB 5HY0A 1W55A 3HTNA 4B46A 3WPWA 5LXTA 1DBFA 3KE1A 3VYUC 3LWRC 3CPWF 4O4HA 5ITZB 3GYQA 1IPAA 3TD5A 3V7EA 4C4WC 2GZLA 4X3MA 1UI9A 3WGKA 4RQOA 4ZI7A 5MN5A 2Z1FA 4RHAA 4DRXB 1JFFA 2R751 1T0KB 1VQ7F 5HY1A 3M84A 3ZP4A 5AVMA 2QTPA 3CG6A 4HNAA 3JATB 1W3EX 1X7PA 2HP0B 3IEQA 3WGMA 2AIFA 5LOVB 4BT3A 5FJ4C 2DT4A 2GVIA 3PLAC 1TUBA 4EB6B 5ITZA 4U39A 1ODEA 2R6R1 1X25A 2ZODA 2OTMA 1Q86H 3HKEA 1JD1A 4BVSA 2YXZA 3NK6A 5EO3A 3F0FA 5JCOA 2HP3A 3OBYA 1NMUB 4I4TB 5FNVB 1TVKB 3JARB 5LOVA 1K8AH 3E20B 1YIJF 3RA5A 4E6EA 4C8IA 3MQWA 5HY4A 4BVRA 5HXUA 1H47A 2HRYA 2UYJA 2UZHA 4X3LA 1JY8A 1W2BF 3N2KB 5GIPC 2RB9A 5EZYB 2CHTA 4ZOLB 1SA0B 1FNKA 1YITF 2HS4A 1TVKA 2YYEA 3F0GA 1IV4A 3JARA 4G4YA 1FNJA 3N2GB 1QU9A 1KNKA 3JCMM 3QTYA 4O4JB 3IKFA 5HWEA 5J2TB 4XCQA 4B5CA 2FGYA 1YJ9F 3NK7A 5GONB 3IMPA 2K1SA 2PHNA 3N2KA 4IIJA 3ESJA 3HKBA 2PMPA 3SIUA 1IV2A 5LP6B 3O85A 1U3PA 3WGJA 3OBWA 4I55A 2LBWA 2CW4A 2BTQB 3LFOA 3TD3A 1GX1A 1RQ2A 5HY2A 3MCAB 4O4JA 1IV1A 4C81A 5J2TA 1KC8H 1Q8RA 3TD4A 3U0OA 2OZBA 3D54A 1XRGA 3CXCF 2BTUA 5CA1A 3D01A 4BT6A 1W5AA 3WPXA 3OW2F 2H6LA 2Z01A 3LWQC 4YJ2A 2H8EA 4EI8A 2QEXF 3DDNA 5LP6A 3JASA 4TV9A 3JAWB 3VMFB 3HKDB 3RA6A 2ZOVA 4C8EA 3I3FA 3RYFB 4BT5A 5GAPK 3G6EF 3WGNA 2CZWA 3P0ZA 5KMGB 3C9TA 4O2BA 4EI9A 3VYTC 1U40A 3HJWC 4G4WA 5LYJB 2QA4F 1VQ5F 3HKCB 3E22A 3S0YA 1DT9A 2ALEA 2UYNA 5JQGA 4G4ZA 3RYIA 3LMEA 3JAWA 4TV8A 3S0WA 1VQ4F 3V3TA 2P6YA 4O4LB 4EI7A 1VHAA 2AIZP 2RHLA 2HVYD 3HWUA 1CLIA 1RA4A 2CVLA 3LWVC 3CMEF 1VQ8F 3HKCA 4M8IA 4LNUB 3MDOA 4ZHQA 3S03A 2CWJA 4LCKA 4O4IB 2HX0A 3MBMA 4IHJB 1VQLF 2H8CA 1W5EA 4BVQA 5J2UB 3V4DA 3ON1A 3MCQA 3CCMF 5G4UC 3CYPB 5JVDB 4DRXA 1W59A 3IR9A 4X1YB 5HP7A 4X1KB 1RQ7A 1S72F 3D00A 1FSZA 4BW0B 2Q1YA 5IJ0B 3G71F 5MN6A 1VQPF 3IEWA 4LNUA 1KQSF 1VQVA 4O2AB 3JATA 2HP0A 3F6MA 3T80A 5EIBD 3S0HA 4IHJA 4KWEA 3NMUC 5B8FA 5J2UA 1VQ6F 1OFUA 5LA6B 4EB6A 3CC2F 2ZVYA 5G4VC 3NVKE 1YGYA 2UYKA 5JVDA 3F0DA 1RLGA 3UT5B 2HS0A 1IV3A 1W42A 2N48A 1W5FA 5KX5B 5IJ0A 3ELCA 4I4TA 2Z1UA 3M1XA 5FNVA 1VK3A 4O2AA 3J80M 1KD1H 3JALB 3AGKA 3JAKB 1Q82H 1VQ9F 3LWOC 1XV2A 5LA6A 3RYCB 3K12A 1N8RH 3K14A 3F0EA 2CHSA 5IT9M 3N4ZA 2HQSC 4BT2A 5IJ9B 2OTJF 4ZHYB 4G88A 3UT5A 2L26A 5EB1B 5EZYA 1VQKF 2HRUA 1Z5VA 2DYYA 2KTVA 3M4SA 4U3JB 4BVTA 3GHZA 4BT7A 4ZOLA 2VGMA 1SA0A 3KIZA 1NJIH 1UFYA 3JAKA 3N2GA 2ZF8A 5EB0A 1PF5A 3WJPA 3VI6A 3WJRA 1CN7A 1YJNF 4YJ3B 3CC7F 1T0AA 4C82A 5IJ9A 1R1MA 2WALA 4X20B 5GONA 3ZO8A 4G4XA 1E7KA 2RHOA 4U3JA 4X1IB 4BT4A 2KGWA 3CB2A 1YI2F 2LBXA 1U3LA 1W40A 2IAFA 1ONIA 2ZAUA 1ZWZA 3SIVA 4YJ3A 1QVFF 2VGNA 1M90H 3WJQA 4DXDA 3CC4F 4X20A 1U43A 1X7OA 2BTOA 2I6RA 3WGLA 4ZK7A 5BMVB 3IKEA 2LBTA 4R40B 3VTIC 5HXZA 2Z1TA 3LDTA 1JN1A 3HKDA 1W5BA 3L7QA 1SDSA 1Q81H 4FFBB 3RYFA 2I6DA 2RHHA 5KMGA 1K9MH 4ZI7B 1W581 3C9RA 5JH7B 3CCRF 3CYQA 3WXMB 2OHWA 5LYJA 3J81M 4I50B 3G4SF 4HNAB 1X52A 3CCJF 1PXWA 4B62A 1GO1A 3C9SA 2B33A 1VH8A 5EWRA 1TUBB 1NQ3A 4O4LA 4FFBA 2QI2A 4ZHWA 3HKEB 2FC3A 1SZQA 5EYPB 5GIOC 5JH7A 3S02A 5CA0B 1H7MA 1KNJA 3CD6F 3NVIB 4I50A 3RYHB 1XBIA 2Z1EA 2VAWA 3K0TA 4BY9D 3FFMA 3J7AR 1QD9A 1OAPA 4F6RB 4O4IA 3V7QA 4NQ3A
chains in the Genus database with same CATH topology
5HY0A 3N4ZA 1W41A 3LWQC 1Q7YH 2OTJF 4EI8A 2QEXF 4TZZA 1VQKF 3LWRC 3CPWF 2KTVA 4BVTA 3GYQA 1IPAA 3PAFA 3V7EA 4C4WC 2VGMA 3VMFB 4X3MA 3RA6A 5A2QM 1QVGF 1NJIH 3CCQF 1T0KB 1VQ7F 5GAPK 3G6EF 5HY1A 2CZWA 3VI6A 1YJWF 2GLZA 4EI9A 2BO1A 1CN7A 1YJNF 1VQOF 3CC7F 3HJWC 3CG6A 2QA4F 1W3EX 1VQ5F 1X7PA 1VQMF 3CCEF 2AIFA 3I55F 5FJ4C 2WALA 1DT9A 1CK2A 1E7KA 2ALEA 3PLAC 1K73H 1GO0A 1VQ4F 3V3TA 1Q86H 3CCUF 1YI2F 2F9ZC 4BVSA 4EI7A 3NK6A 2LBXA 4NUTA 1W40A 5EO3A 2HVYD 1ZWZA 3OBYA 1NMUB 3SIVA 1RA4A 1QVFF 2VGNA 3CCVF 1M90H 3LWVC 3CMEF 1VQ8F 3E1YA 1K8AH 3CC4F 3E20B 5GINC 2OTLF 1YIJF 3RA5A 1X7OA 1YHQF 4LCKA 5HY4A 1VQNF 4BVRA 5HXUA 1VQLF 4BVQA 3I56F 5HXZA 3ON1A 4X3LA 3CCMF 1W2BF 5G4UC 5GIPC 1GZ0A 1M1KH 1SDSA 1Q81H 3IR9A 2I6DA 1YITF 1S72F 1K9MH 3D00A 4BW0B 3LWPC 3G71F 1VQPF 5DCVA 3CCRF 2KG4A 3JCMM 1KQSF 3WXMB 2OHWA 3N4YA 3J81M 5HWEA 5GANK 4XCQA 3G4SF 2FGYA 3NMUC 1X52A 3CCJF 1YJ9F 3NK7A 1PXWA 3JAMM 1VQ6F 1JJ2F 3CC2F 1GO1A 3CPQA 5G4VC 3NVKE 5FLXM 2KTUA 5EWRA 3CMAF 1RLGA 3SIUA 2QI2A 1W42A 3O85A 3OBWA 3HAXD 2FC3A 2LBWA 5GIOC 3LFOA 3J80M 1KD1H 1H7MA 3MCAB 5HY2A 3OW2F 3CD6F 3NVIB 3AGKA 1KC8H 1XBIA 1Q82H 1VQ9F 2OZBA 2JNBA 3LWOC 3CCLF 3CCSF 4BY9D 3CXCF 3FFMA 3J7AR 1N8RH 5IT9M 3V7QA 4NQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Z A;  1W41 A;  3LWQ C;  1Q7Y H;  2OTJ F;  2QEX F;  4TZZ A;  1VQK F;  3LWR C;  3CPW F;  2KTV A;  3GYQ A;  1IPA A;  3PAF A;  3V7E A;  4C4W C;  2VGM A;  3VMF B;  4X3M A;  3RA6 A;  5A2Q M;  1QVG F;  1NJI H;  3CCQ F;  1T0K B;  1VQ7 F;  5GAP K;  3G6E F;  2CZW A;  3VI6 A;  1YJW F;  2BO1 A;  1CN7 A;  1YJN F;  1VQO F;  3CC7 F;  3HJW C;  3CG6 A;  2QA4 F;  1W3E X;  1VQ5 F;  1X7P A;  1VQM F;  3CCE F;  2AIF A;  3I55 F;  5FJ4 C;  2WAL A;  1DT9 A;  1CK2 A;  1E7K A;  2ALE A;  3PLA C;  1K73 H;  1GO0 A;  1VQ4 F;  1Q86 H;  3CCU F;  1YI2 F;  3NK6 A;  2LBX A;  4NUT A;  1W40 A;  5EO3 A;  2HVY D;  1ZWZ A;  3OBY A;  1NMU B;  3SIV A;  1RA4 A;  1QVF F;  2VGN A;  3CCV F;  1M90 H;  3LWV C;  3CME F;  1VQ8 F;  3E1Y A;  1K8A H;  3CC4 F;  3E20 B;  5GIN C;  2OTL F;  1YIJ F;  3RA5 A;  1X7O A;  1YHQ F;  4LCK A;  1VQN F;  1VQL F;  3I56 F;  3ON1 A;  4X3L A;  3CCM F;  1W2B F;  5G4U C;  5GIP C;  1GZ0 A;  1M1K H;  1SDS A;  1Q81 H;  3IR9 A;  2I6D A;  1YIT F;  1S72 F;  1K9M H;  4BW0 B;  3LWP C;  3G71 F;  1VQP F;  5DCV A;  3CCR F;  2KG4 A;  3JCM M;  1KQS F;  3WXM B;  2OHW A;  3N4Y A;  3J81 M;  5GAN K;  3G4S F;  3NMU C;  1X52 A;  3CCJ F;  1YJ9 F;  3NK7 A;  1PXW A;  3JAM M;  1VQ6 F;  1JJ2 F;  3CC2 F;  1GO1 A;  3CPQ A;  5G4V C;  3NVK E;  5FLX M;  2KTU A;  5EWR A;  3CMA F;  1RLG A;  3SIU A;  2QI2 A;  1W42 A;  3O85 A;  3OBW A;  3HAX D;  2FC3 A;  2LBW A;  5GIO C;  3LFO A;  3J80 M;  1KD1 H;  1H7M A;  3MCA B;  3OW2 F;  3CD6 F;  3NVI B;  3AGK A;  1KC8 H;  1XBI A;  1Q82 H;  1VQ9 F;  2OZB A;  2JNB A;  3LWO C;  3CCL F;  3CCS F;  4BY9 D;  3CXC F;  3FFM A;  3J7A R;  1N8R H;  5IT9 M;  3V7Q A; 
#chains in the Genus database with same CATH topology
 1W41 A;  5HP8 A;  2MQE A;  1Q7Y H;  3QUW A;  4TZZ A;  2G9I A;  2RHJ A;  5EYP A;  3ZP7 A;  3VO8 A;  3B6N A;  3PAF A;  5CA0 A;  4X1Y A;  3KJJ A;  3QHD A;  1FFX B;  4X1K A;  5A2Q M;  1QVG F;  1RLU A;  1COM A;  3CCQ F;  4WBN B;  3RYH A;  2AMT A;  3VYS C;  2CSL A;  5EAZ A;  1J7H A;  1YJW F;  2GLZ A;  4F6R A;  2BO1 A;  2IQQ A;  3ERN A;  1VQO F;  2W8B C;  3LYB A;  2IG8 A;  1H48 A;  1VQM F;  3CCE F;  3I55 F;  3R0P A;  1CK2 A;  3Q8H A;  3VCZ A;  2Q1X A;  3OON A;  5JCO C;  3VOB A;  1K73 H;  3P4E A;  1GO0 A;  2HS3 A;  1FFX A;  4IIJ B;  3FD6 A;  5KX5 A;  4WBN A;  3CCU F;  3HKB B;  2F9Z C;  1W57 A;  4NUT A;  3JAL A;  5C8Y B;  4I55 B;  3C9U A;  2ZVZ A;  5CB4 B;  3CCV F;  3S06 A;  2V9Y A;  3RYC A;  3E1Y A;  3KHN A;  2VAP A;  5GIN C;  2OTL F;  4ERH A;  2LCA A;  1YHQ F;  5CA1 B;  1VQN F;  5EIB C;  3DC2 A;  3I56 F;  4ZHV A;  3KJK A;  4YJ2 B;  2NMU A;  3C8L A;  4NWO B;  5C8Y A;  4G4V A;  1GZ0 A;  3JAS B;  1M1K H;  3GTZ A;  1YQN A;  4TV9 B;  3BYQ A;  5CB4 A;  3LWP C;  5DCV A;  2KG4 A;  3JVH A;  3N4Y A;  5IYZ B;  4O2B B;  5GAN K;  3FPI A;  3FD5 A;  4C8G A;  2EWC A;  3E22 B;  3JAM M;  1JJ2 F;  4X1I A;  1QAH A;  3CPQ A;  4TUY B;  3RE3 A;  5FLX M;  2KTU A;  2UYN B;  2UYP A;  3CMA F;  4PWT A;  5JQG B;  3RYI B;  5LXT B;  4TV8 B;  3VOA A;  3HAX D;  3I7T A;  4O4H B;  5MN4 A;  2VXY A;  4B45 A;  5IYZ A;  1Z5W A;  2VAM A;  3ZOP A;  1JFF B;  2JNB A;  5LP6 C;  3CCL F;  3CCS F;  1XHO A;  3K2X A;  3FBA A;  5BMV A;  3P10 A;  4TUY A;  3EOR A;  3VIU A;  4ZHQ B;  5HY0 A;  1W55 A;  3HTN A;  4B46 A;  3WPW A;  5LXT A;  1DBF A;  3KE1 A;  3VYU C;  3LWR C;  3CPW F;  4O4H A;  5ITZ B;  3GYQ A;  1IPA A;  3TD5 A;  3V7E A;  4C4W C;  2GZL A;  4X3M A;  1UI9 A;  3WGK A;  4RQO A;  4ZI7 A;  5MN5 A;  2Z1F A;  4RHA A;  4DRX B;  1JFF A;  2R75 1;  1T0K B;  1VQ7 F;  5HY1 A;  3M84 A;  3ZP4 A;  5AVM A;  2QTP A;  3CG6 A;  4HNA A;  3JAT B;  1W3E X;  1X7P A;  2HP0 B;  3IEQ A;  3WGM A;  2AIF A;  5LOV B;  4BT3 A;  5FJ4 C;  2DT4 A;  2GVI A;  3PLA C;  1TUB A;  4EB6 B;  5ITZ A;  4U39 A;  1ODE A;  2R6R 1;  1X25 A;  2ZOD A;  2OTM A;  1Q86 H;  3HKE A;  1JD1 A;  4BVS A;  2YXZ A;  3NK6 A;  5EO3 A;  3F0F A;  5JCO A;  2HP3 A;  3OBY A;  1NMU B;  4I4T B;  5FNV B;  1TVK B;  3JAR B;  5LOV A;  1K8A H;  3E20 B;  1YIJ F;  3RA5 A;  4E6E A;  4C8I A;  3MQW A;  5HY4 A;  4BVR A;  5HXU A;  1H47 A;  2HRY A;  2UYJ A;  2UZH A;  4X3L A;  1JY8 A;  1W2B F;  3N2K B;  5GIP C;  2RB9 A;  5EZY B;  2CHT A;  4ZOL B;  1SA0 B;  1FNK A;  1YIT F;  2HS4 A;  1TVK A;  2YYE A;  3F0G A;  1IV4 A;  3JAR A;  4G4Y A;  1FNJ A;  3N2G B;  1QU9 A;  1KNK A;  3JCM M;  3QTY A;  4O4J B;  3IKF A;  5HWE A;  5J2T B;  4XCQ A;  4B5C A;  2FGY A;  1YJ9 F;  3NK7 A;  5GON B;  3IMP A;  2K1S A;  2PHN A;  3N2K A;  4IIJ A;  3ESJ A;  3HKB A;  2PMP A;  3SIU A;  1IV2 A;  5LP6 B;  3O85 A;  1U3P A;  3WGJ A;  3OBW A;  4I55 A;  2LBW A;  2CW4 A;  2BTQ B;  3LFO A;  3TD3 A;  1GX1 A;  1RQ2 A;  5HY2 A;  3MCA B;  4O4J A;  1IV1 A;  4C81 A;  5J2T A;  1KC8 H;  1Q8R A;  3TD4 A;  3U0O A;  2OZB A;  3D54 A;  1XRG A;  3CXC F;  2BTU A;  5CA1 A;  3D01 A;  4BT6 A;  1W5A A;  3WPX A;  3OW2 F;  2H6L A;  2Z01 A;  3LWQ C;  4YJ2 A;  2H8E A;  4EI8 A;  2QEX F;  3DDN A;  5LP6 A;  3JAS A;  4TV9 A;  3JAW B;  3VMF B;  3HKD B;  3RA6 A;  2ZOV A;  4C8E A;  3I3F A;  3RYF B;  4BT5 A;  5GAP K;  3G6E F;  3WGN A;  2CZW A;  3P0Z A;  5KMG B;  3C9T A;  4O2B A;  4EI9 A;  3VYT C;  1U40 A;  3HJW C;  4G4W A;  5LYJ B;  2QA4 F;  1VQ5 F;  3HKC B;  3E22 A;  3S0Y A;  1DT9 A;  2ALE A;  2UYN A;  5JQG A;  4G4Z A;  3RYI A;  3LME A;  3JAW A;  4TV8 A;  3S0W A;  1VQ4 F;  3V3T A;  2P6Y A;  4O4L B;  4EI7 A;  1VHA A;  2AIZ P;  2RHL A;  2HVY D;  3HWU A;  1CLI A;  1RA4 A;  2CVL A;  3LWV C;  3CME F;  1VQ8 F;  3HKC A;  4M8I A;  4LNU B;  3MDO A;  4ZHQ A;  3S03 A;  2CWJ A;  4LCK A;  4O4I B;  2HX0 A;  3MBM A;  4IHJ B;  1VQL F;  2H8C A;  1W5E A;  4BVQ A;  5J2U B;  3V4D A;  3ON1 A;  3MCQ A;  3CCM F;  5G4U C;  3CYP B;  5JVD B;  4DRX A;  1W59 A;  3IR9 A;  4X1Y B;  5HP7 A;  4X1K B;  1RQ7 A;  1S72 F;  3D00 A;  1FSZ A;  4BW0 B;  2Q1Y A;  5IJ0 B;  3G71 F;  5MN6 A;  1VQP F;  3IEW A;  4LNU A;  1KQS F;  1VQV A;  4O2A B;  3JAT A;  2HP0 A;  3F6M A;  3T80 A;  5EIB D;  3S0H A;  4IHJ A;  4KWE A;  3NMU C;  5B8F A;  5J2U A;  1VQ6 F;  1OFU A;  5LA6 B;  4EB6 A;  3CC2 F;  2ZVY A;  5G4V C;  3NVK E;  1YGY A;  2UYK A;  5JVD A;  3F0D A;  1RLG A;  3UT5 B;  2HS0 A;  1IV3 A;  1W42 A;  2N48 A;  1W5F A;  5KX5 B;  5IJ0 A;  3ELC A;  4I4T A;  2Z1U A;  3M1X A;  5FNV A;  1VK3 A;  4O2A A;  3J80 M;  1KD1 H;  3JAL B;  3AGK A;  3JAK B;  1Q82 H;  1VQ9 F;  3LWO C;  1XV2 A;  5LA6 A;  3RYC B;  3K12 A;  1N8R H;  3K14 A;  3F0E A;  2CHS A;  5IT9 M;  3N4Z A;  2HQS C;  4BT2 A;  5IJ9 B;  2OTJ F;  4ZHY B;  4G88 A;  3UT5 A;  2L26 A;  5EB1 B;  5EZY A;  1VQK F;  2HRU A;  1Z5V A;  2DYY A;  2KTV A;  3M4S A;  4U3J B;  4BVT A;  3GHZ A;  4BT7 A;  4ZOL A;  2VGM A;  1SA0 A;  3KIZ A;  1NJI H;  1UFY A;  3JAK A;  3N2G A;  2ZF8 A;  5EB0 A;  1PF5 A;  3WJP A;  3VI6 A;  3WJR A;  1CN7 A;  1YJN F;  4YJ3 B;  3CC7 F;  1T0A A;  4C82 A;  5IJ9 A;  1R1M A;  2WAL A;  4X20 B;  5GON A;  3ZO8 A;  4G4X A;  1E7K A;  2RHO A;  4U3J A;  4X1I B;  4BT4 A;  2KGW A;  3CB2 A;  1YI2 F;  2LBX A;  1U3L A;  1W40 A;  2IAF A;  1ONI A;  2ZAU A;  1ZWZ A;  3SIV A;  4YJ3 A;  1QVF F;  2VGN A;  1M90 H;  3WJQ A;  4DXD A;  3CC4 F;  4X20 A;  1U43 A;  1X7O A;  2BTO A;  2I6R A;  3WGL A;  4ZK7 A;  5BMV B;  3IKE A;  2LBT A;  4R40 B;  3VTI C;  5HXZ A;  2Z1T A;  3LDT A;  1JN1 A;  3HKD A;  1W5B A;  3L7Q A;  1SDS A;  1Q81 H;  4FFB B;  3RYF A;  2I6D A;  2RHH A;  5KMG A;  1K9M H;  4ZI7 B;  1W58 1;  3C9R A;  5JH7 B;  3CCR F;  3CYQ A;  3WXM B;  2OHW A;  5LYJ A;  3J81 M;  4I50 B;  3G4S F;  4HNA B;  1X52 A;  3CCJ F;  1PXW A;  4B62 A;  1GO1 A;  3C9S A;  2B33 A;  1VH8 A;  5EWR A;  1TUB B;  1NQ3 A;  4O4L A;  4FFB A;  2QI2 A;  4ZHW A;  3HKE B;  2FC3 A;  1SZQ A;  5EYP B;  5GIO C;  5JH7 A;  3S02 A;  5CA0 B;  1H7M A;  1KNJ A;  3CD6 F;  3NVI B;  4I50 A;  3RYH B;  1XBI A;  2Z1E A;  2VAW A;  3K0T A;  4BY9 D;  3FFM A;  3J7A R;  1QD9 A;  1OAP A;  4F6R B;  4O4I A;  3V7Q A;  4NQ3 A; 
#chains in the Genus database with same CATH homology
 5HY0 A;  3N4Z A;  1W41 A;  3LWQ C;  1Q7Y H;  2OTJ F;  4EI8 A;  2QEX F;  4TZZ A;  1VQK F;  3LWR C;  3CPW F;  2KTV A;  4BVT A;  3GYQ A;  1IPA A;  3PAF A;  3V7E A;  4C4W C;  2VGM A;  3VMF B;  4X3M A;  3RA6 A;  5A2Q M;  1QVG F;  1NJI H;  3CCQ F;  1T0K B;  1VQ7 F;  5GAP K;  3G6E F;  5HY1 A;  2CZW A;  3VI6 A;  1YJW F;  2GLZ A;  4EI9 A;  2BO1 A;  1CN7 A;  1YJN F;  1VQO F;  3CC7 F;  3HJW C;  3CG6 A;  2QA4 F;  1W3E X;  1VQ5 F;  1X7P A;  1VQM F;  3CCE F;  2AIF A;  3I55 F;  5FJ4 C;  2WAL A;  1DT9 A;  1CK2 A;  1E7K A;  2ALE A;  3PLA C;  1K73 H;  1GO0 A;  1VQ4 F;  3V3T A;  1Q86 H;  3CCU F;  1YI2 F;  2F9Z C;  4BVS A;  4EI7 A;  3NK6 A;  2LBX A;  4NUT A;  1W40 A;  5EO3 A;  2HVY D;  1ZWZ A;  3OBY A;  1NMU B;  3SIV A;  1RA4 A;  1QVF F;  2VGN A;  3CCV F;  1M90 H;  3LWV C;  3CME F;  1VQ8 F;  3E1Y A;  1K8A H;  3CC4 F;  3E20 B;  5GIN C;  2OTL F;  1YIJ F;  3RA5 A;  1X7O A;  1YHQ F;  4LCK A;  5HY4 A;  1VQN F;  4BVR A;  5HXU A;  1VQL F;  4BVQ A;  3I56 F;  5HXZ A;  3ON1 A;  4X3L A;  3CCM F;  1W2B F;  5G4U C;  5GIP C;  1GZ0 A;  1M1K H;  1SDS A;  1Q81 H;  3IR9 A;  2I6D A;  1YIT F;  1S72 F;  1K9M H;  3D00 A;  4BW0 B;  3LWP C;  3G71 F;  1VQP F;  5DCV A;  3CCR F;  2KG4 A;  3JCM M;  1KQS F;  3WXM B;  2OHW A;  3N4Y A;  3J81 M;  5HWE A;  5GAN K;  4XCQ A;  3G4S F;  2FGY A;  3NMU C;  1X52 A;  3CCJ F;  1YJ9 F;  3NK7 A;  1PXW A;  3JAM M;  1VQ6 F;  1JJ2 F;  3CC2 F;  1GO1 A;  3CPQ A;  5G4V C;  3NVK E;  5FLX M;  2KTU A;  5EWR A;  3CMA F;  1RLG A;  3SIU A;  2QI2 A;  1W42 A;  3O85 A;  3OBW A;  3HAX D;  2FC3 A;  2LBW A;  5GIO C;  3LFO A;  3J80 M;  1KD1 H;  1H7M A;  3MCA B;  5HY2 A;  3OW2 F;  3CD6 F;  3NVI B;  3AGK A;  1KC8 H;  1XBI A;  1Q82 H;  1VQ9 F;  2OZB A;  2JNB A;  3LWO C;  3CCL F;  3CCS F;  4BY9 D;  3CXC F;  3FFM A;  3J7A R;  1N8R H;  5IT9 M;  3V7Q A;  4NQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...