1XBIA

High resolution structure of methanocaldococcus jannaschii l7ae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
HMAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Methanocaldococcus jannaschii Multifunctional L7Ae RNA-Binding Protein Reveals an Induced-Fit Interaction with the Box C/D RNAs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein/structural protein
molecule keywords 50S ribosomal protein L7Ae
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1xbiA00
1QVGF 3V7QA 5IT9M 1YHQF 5G4UC 1S72F 2KTUA 3E20B 1GO1A 1KD1H 3OW2F 1VQLF 3CD6F 5G4VC 5GANK 1YIJF 3WXMB 2OTLF 3LWPC 3NVIB 5EWRA 3PAFA 5GIOC 2OZBA 1VQ4F 1GO0A 1YI2F 3RA5A 5DCVA 2AIFA 5FLXM 3LWQC 3LWVC 1YJNF 3JCMM 1M1KH 2OTJF 1VQMF 2VGNA 3I55F 4NUTA 3FFMA 3LWOC 1VQPF 5A2QM 3NVKE 1YITF 3V7EA 2WALA 3RA6A 1VQ5F 1XBIA 1K8AH 1W2BF 3AGKA 1W40A 3OBYA 3I56F 3E1YA 4LCKA 2QI2A 1CK2A 1VQ8F 3HJWC 1GZ0A 3HAXD 3G71F 3CCVF 1W41A 3NK7A 3CC2F 3N4ZA 3CCQF 2JNBA 1KC8H 1H7MA 4BY9D 1X7PA 1RLGA 2HVYD 3LFOA 3PLAC 1VQ7F 2KTVA 3G6EF 1PXWA 1K73H 2ALEA 3CCLF 2BO1A 2QEXF 4X3MA 3SIUA 3J81M 4TZZA 1QVFF 1SDSA 1X52A 3CPQA 3OBWA 3NMUC 2KG4A 3CCMF 1VQOF 4X3LA 3CCSF 1ZWZA 3CXCF 1NJIH 3JAMM 5EO3A 1K9MH 3GYQA 4BW0B 5FJ4C 1IPAA 3SIVA 3CC4F 3LWRC 5GAPK 1VQNF 5GINC 3CCUF 1VQ6F 3O85A 1RA4A 3ON1A 1Q86H 3VMFB 3MCAB 3CCRF 2I6DA 2LBWA 2QA4F 1W3EX 3CCEF 1YJWF 3CG6A 1VQKF 1NMUB 3CMAF 2FC3A 3IR9A 3VI6A 3J80M 3J7AR 1Q81H 3CMEF 1X7OA 1T0KB 1KQSF 2LBXA 3G4SF 4C4WC 3N4YA 3CPWF 1Q7YH 2CZWA 2OHWA 1JJ2F 1YJ9F 1E7KA 1Q82H 3CCJF 2VGMA 5GIPC 3CC7F 1DT9A 1CN7A 1W42A 3NK6A 1M90H 1VQ9F 1N8RH
chains in the Genus database with same CATH superfamily
2UZHA 3V7QA 3RYIB 3I7TA 5KMGB 1VHAA 4ZHVA 3S03A 1VQVA 3JARA 3E22B 1KD1H 3OW2F 2V9YA 1R1MA 3WJRA 3M1XA 3CB2A 5G4VC 3GTZA 4TV8A 3JALB 4C82A 4LNUB 4R40B 2I6RA 3LWPC 1JD1A 1IV3A 4IHJB 2HP3A 2OZBA 1YI2F 1VH8A 4IIJB 3WGJA 3JAKB 3V4DA 3WJQA 3F0EA 2AIFA 5FLXM 1YJNF 1IV2A 5EYPA 5MN5A 1PF5A 1XV2A 3HKDB 3I55F 5A2QM 2UYKA 3V7EA 4I55B 3RA6A 1W2BF 3HKEA 3AGKA 4LCKA 4PWTA 4BT3A 1GZ0A 1DBFA 3NK7A 3CC2F 5HY0A 2JNBA 3M4SA 1KC8H 2HVYD 2EWCA 2IG8A 5LYJA 2HS3A 2KTVA 4ZHWA 1TVKB 1QD9A 3HKCA 4O4LB 4BVRA 5ITZB 3J81M 4TZZA 1SZQA 2VXYA 3U0OA 3V3TA 2RHOA 3OBWA 3NMUC 2KG4A 4RHAA 5LP6C 4BT6A 2CHTA 3ZP4A 3F0DA 3ZO8A 3HKEB 4G4ZA 2LCAA 1NJIH 3S0WA 3HKBB 3UT5B 3HWUA 1QAHA 2NMUA 1YGYA 2OTMA 2MQEA 3JALA 5GAPK 1NQ3A 1VQNF 5IYZB 4IIJA 3FPIA 1Q86H 4EB6A 3CCRF 3VO8A 5LYJB 1U40A 2QA4F 1VQKF 1Z5WA 4LNUA 4I50B 2GVIA 3EORA 4I4TB 1KNJA 4I4TA 3CMEF 1Q81H 3LMEA 3N2GA 1T0KB 2LBXA 4O2AA 5C8YB 3N4YA 3Q8HA 3CPWF 1Q7YH 2CZWA 2OHWA 3D54A 3RYIA 1YJ9F 5LXTA 3CCJF 5JH7B 5GIPC 1CN7A 1DT9A 3HKBA 1IV1A 2Z1UA 1KNKA 4BVTA 1J7HA 1N8RH 3RYFA 4F6RA 1QVGF 4F6RB 4DRXB 5CB4A 1UI9A 3MCQA 5G4UC 5CA1B 3E20B 1GO1A 4O4HA 3K14A 4O4IA 2HS4A 1OFUA 3QHDA 2N48A 3VYTC 2IAFA 3TD3A 3HKCB 4RQOA 5EWRA 3PAFA 3F0FA 1GO0A 2RHJA 2FGYA 1TVKA 3K0TA 4YJ2B 4X1KB 4G4XA 4C8IA 2ZODA 1VQMF 2VGNA 5LA6B 4NWOB 4NUTA 3FFMA 3RYCA 1XBIA 4O4JB 2DT4A 5IYZA 1CK2A 4TUYA 1VQ8F 3HJWC 3VTIC 3QTYA 1H48A 5IJ9B 2BTUA 3RYHB 1W5BA 2PMPA 1H7MA 1X7PA 3P10A 5BMVB 3C9UA 2VAPA 1K73H 4BVSA 3FD5A 2HX0A 1CLIA 1QVFF 5JH7A 2Q1XA 2H8CA 3JARB 1W5AA 2HRUA 4X3LA 4ZI7A 2H6LA 1GX1A 5HY1A 4ZHYB 5EO3A 2R6R1 1K9MH 1UFYA 5EB0A 2ZOVA 1SA0A 1W59A 4EB6B 1FSZA 3IKFA 2L26A 2CW4A 3CC4F 5FJ4C 3LWRC 2DYYA 2LBTA 4C81A 5AVMA 2VAWA 3O85A 5CA0B 1RA4A 3C9SA 3ON1A 5EYPB 2RHHA 4O4IB 3L7QA 1TUBA 4I55A 1W3EX 2CSLA 3CG6A 4G4YA 4EI9A 2FC3A 3IR9A 2ZVZA 1W5FA 3S06A 1X7OA 3KJKA 4ZOLA 4EI7A 3G4SF 5KX5B 2F9ZC 4TV9B 1JJ2F 4O4JA 5EAZA 1Q82H 3MBMA 3IEWA 4X1IA 3RYCB 3NK6A 1M90H 1VK3A 5FNVA 4C8EA 5HY4A 2CWJA 3IEQA 3B6NA 1U43A 2UYNA 2R751 2BTQB 3JASB 1S72F 2AMTA 3JASA 4X1IB 2VAMA 3VCZA 5EZYB 3F0GA 3N2GB 2BTOA 1VQLF 4G88A 2B33A 3WPWA 3T80A 5GANK 3VOAA 2HP0A 1X25A 1W57A 5GIOC 1U3PA 4NQ3A 3JATB 2YYEA 2PHNA 3JAWB 5KX5A 3KIZA 5DCVA 5HWEA 3LWQC 5CB4B 3JCMM 2ZF8A 4BT4A 5MN4A 4X1YB 1QU9A 3WGMA 5JVDB 4TUYB 3LWOC 1YITF 3WGLA 3JAKA 2Z1TA 3RE3A 3RYHA 3JVHA 3K12A 5ITZA 5CA0A 5LP6A 5HXUA 3P0ZA 2IQQA 2Z01A 4O2AB 5C8YA 1SA0B 2HQSC 3CYQA 3HAXD 3G71F 3CCVF 3KE1A 2ZVYA 1RQ2A 1RLUA 5JCOC 4BY9D 4BT7A 4TV9A 1VQ7F 3CCLF 2QEXF 4X3MA 1COMA 1U3LA 3CPQA 4U39A 2GZLA 4O4HB 2HRYA 1FFXA 2RHLA 3GHZA 3N2KB 3UT5A 3CCMF 1VQOF 5HXZA 5GONA 3TD4A 1ONIA 3CCSF 1ZWZA 4DRXA 3CXCF 1RQ7A 5JCOA 1TUBB 4BW0B 2G9IA 3SIVA 3WGKA 5IJ0B 2GLZA 5J2UA 1JN1A 4O4LA 2RB9A 3DC2A 5GINC 4U3JB 3ELCA 3CYPB 3CCUF 1VQ6F 5LA6A 3WGNA 2Z1EA 3JAWA 2ZAUA 4FFBA 2LBWA 3WJPA 4KWEA 1JFFB 4HNAB 4B62A 2Q1YA 1JFFA 4HNAA 5HP7A 5KMGA 2KGWA 3ZOPA 3J80M 1YQNA 5LOVA 4FFBB 4DXDA 2H8EA 5LOVB 5EIBC 4XCQA 5FNVB 3KJJA 5JQGB 4ZK7A 2AIZP 4O2BB 4ZHQB 4B5CA 1E7KA 3LYBA 4BVQA 2VGMA 3CC7F 1W42A 4WBNA 1VQ9F 3FD6A 5HP8A 4B45A 5BMVA 3OONA 5IJ9A 1ODEA 4X20A 5IJ0A 5IT9M 1YHQF 2KTUA 2CHSA 1T0AA 4ZOLB 3D00A 4X20B 3I3FA 1FNJA 3CD6F 3D01A 1XHOA 5J2TB 1YIJF 3WXMB 2OTLF 3NVIB 3R0PA 3VIUA 1FFXB 3N2KA 3JATA 5EIBD 4BT5A 1W5EA 1VQ4F 3E22A 1JY8A 3ERNA 3ESJA 3IKEA 2UYPA 3RA5A 2YXZA 3WPXA 1Q8RA 1W55A 4TV8B 3HTNA 3VOBA 3LWVC 3VYUC 1M1KH 4ZI7B 4I50A 2OTJF 1FNKA 1XRGA 2P6YA 3MQWA 1VQPF 3NVKE 5J2UB 2WALA 1VQ5F 3S0HA 4B46A 1K8AH 1W40A 4U3JA 3OBYA 3I56F 3E1YA 5LP6B 3HKDA 2QI2A 4EI8A 5EB1B 1W41A 3N4ZA 3CCQF 5LXTB 1OAPA 5CA1A 1RLGA 3LFOA 2W8BC 3PLAC 3ZP7A 3MDOA 4O2BA 3RYFB 4ZHQA 4G4WA 1PXWA 5JQGA 3G6EF 2ALEA 2BO1A 5HY2A 3SIUA 1SDSA 1X52A 4ERHA 5EZYA 4IHJA 2UYNB 2HS0A 3VYSC 3FBAA 3JAMM 1IV4A 2Z1FA 3GYQA 3P4EA 1IPAA 4X1KA 5J2TA 4YJ2A 3LDTA 3KHNA 1W581 3S0YA 5JVDA 4YJ3A 3VMFB 3MCAB 2CVLA 2I6DA 2K1SA 4E6EA 3C9RA 5B8FA 5GONB 4C8GA 3CCEF 3S02A 2UYJA 1YJWF 3DDNA 1NMUB 4X1YA 5MN6A 3CMAF 1H47A 2QTPA 4YJ3B 3VI6A 4M8IA 3J7AR 3F6MA 1Z5VA 1KQSF 4C4WC 3C9TA 3K2XA 4BT2A 3M84A 2HP0B 3TD5A 3QUWA 3BYQA 4G4VA 4WBNB 3IMPA 3C8LA
chains in the Genus database with same CATH topology
1QVGF 3V7QA 1N8RH 5IT9M 1YHQF 5G4UC 1S72F 2KTUA 3E20B 1GO1A 1KD1H 3D00A 3OW2F 1VQLF 3CD6F 5G4VC 5GANK 1YIJF 3WXMB 2OTLF 3LWPC 3NVIB 5EWRA 3PAFA 5GIOC 4NQ3A 2OZBA 1VQ4F 1GO0A 1YI2F 3RA5A 5DCVA 2FGYA 2AIFA 5FLXM 5HWEA 3LWVC 3LWQC 3JCMM 1YJNF 1M1KH 2OTJF 1VQMF 2VGNA 4NUTA 3FFMA 3I55F 3LWOC 1VQPF 5A2QM 3NVKE 1YITF 3V7EA 2WALA 3RA6A 1VQ5F 1XBIA 1K8AH 1W2BF 3AGKA 1W40A 3OBYA 3I56F 3E1YA 4LCKA 2QI2A 4EI8A 1CK2A 5HXUA 1VQ8F 3HJWC 1GZ0A 3HAXD 3G71F 3CCVF 1W41A 3NK7A 3CC2F 3N4ZA 5HY0A 2JNBA 3CCQF 1KC8H 1H7MA 4BY9D 1X7PA 1RLGA 2HVYD 3LFOA 3PLAC 1VQ7F 2KTVA 3G6EF 1PXWA 1K73H 4BVSA 2ALEA 3CCLF 2BO1A 2QEXF 4BVRA 4X3MA 5HY2A 3SIUA 3J81M 4TZZA 1QVFF 1SDSA 1X52A 3CPQA 3V3TA 3OBWA 3NMUC 2KG4A 3CCMF 1VQOF 5HXZA 4X3LA 3CCSF 1ZWZA 3CXCF 5HY1A 1NJIH 3JAMM 5EO3A 1K9MH 3GYQA 4BW0B 5FJ4C 1IPAA 3SIVA 3CC4F 2GLZA 3LWRC 5GAPK 1VQNF 5GINC 3CCUF 1VQ6F 1VQ9F 3O85A 1RA4A 3ON1A 1Q86H 3VMFB 3MCAB 3CCRF 2I6DA 2LBWA 2QA4F 1W3EX 3CCEF 1YJWF 3CG6A 1VQKF 4EI9A 1NMUB 3CMAF 2FC3A 3IR9A 3VI6A 3J80M 3J7AR 1Q81H 3CMEF 1X7OA 1T0KB 1KQSF 4EI7A 2LBXA 4XCQA 3G4SF 4C4WC 2F9ZC 3N4YA 3CPWF 1Q7YH 2CZWA 2OHWA 1JJ2F 1YJ9F 1E7KA 1Q82H 4BVQA 3CCJF 2VGMA 5GIPC 3CC7F 1DT9A 1CN7A 1W42A 3NK6A 1M90H 4BVTA 5HY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG F;  3V7Q A;  5IT9 M;  1YHQ F;  5G4U C;  1S72 F;  2KTU A;  3E20 B;  1GO1 A;  1KD1 H;  3OW2 F;  1VQL F;  3CD6 F;  5G4V C;  5GAN K;  1YIJ F;  3WXM B;  2OTL F;  3LWP C;  3NVI B;  5EWR A;  3PAF A;  5GIO C;  2OZB A;  1VQ4 F;  1GO0 A;  1YI2 F;  3RA5 A;  5DCV A;  2AIF A;  5FLX M;  3LWQ C;  3LWV C;  1YJN F;  3JCM M;  1M1K H;  2OTJ F;  1VQM F;  2VGN A;  3I55 F;  4NUT A;  3FFM A;  3LWO C;  1VQP F;  5A2Q M;  3NVK E;  1YIT F;  3V7E A;  2WAL A;  3RA6 A;  1VQ5 F;  1XBI A;  1K8A H;  1W2B F;  3AGK A;  1W40 A;  3OBY A;  3I56 F;  3E1Y A;  4LCK A;  2QI2 A;  1CK2 A;  1VQ8 F;  3HJW C;  1GZ0 A;  3HAX D;  3G71 F;  3CCV F;  1W41 A;  3NK7 A;  3CC2 F;  3N4Z A;  3CCQ F;  2JNB A;  1KC8 H;  1H7M A;  4BY9 D;  1X7P A;  1RLG A;  2HVY D;  3LFO A;  3PLA C;  1VQ7 F;  2KTV A;  3G6E F;  1PXW A;  1K73 H;  2ALE A;  3CCL F;  2BO1 A;  2QEX F;  4X3M A;  3SIU A;  3J81 M;  4TZZ A;  1QVF F;  1SDS A;  1X52 A;  3CPQ A;  3OBW A;  3NMU C;  2KG4 A;  3CCM F;  1VQO F;  4X3L A;  3CCS F;  1ZWZ A;  3CXC F;  1NJI H;  3JAM M;  5EO3 A;  1K9M H;  3GYQ A;  4BW0 B;  5FJ4 C;  1IPA A;  3SIV A;  3CC4 F;  3LWR C;  5GAP K;  1VQN F;  5GIN C;  3CCU F;  1VQ6 F;  3O85 A;  1RA4 A;  3ON1 A;  1Q86 H;  3VMF B;  3MCA B;  3CCR F;  2I6D A;  2LBW A;  2QA4 F;  1W3E X;  3CCE F;  1YJW F;  3CG6 A;  1VQK F;  1NMU B;  3CMA F;  2FC3 A;  3IR9 A;  3VI6 A;  3J80 M;  3J7A R;  1Q81 H;  3CME F;  1X7O A;  1T0K B;  1KQS F;  2LBX A;  3G4S F;  4C4W C;  3N4Y A;  3CPW F;  1Q7Y H;  2CZW A;  2OHW A;  1JJ2 F;  1YJ9 F;  1E7K A;  1Q82 H;  3CCJ F;  2VGM A;  5GIP C;  3CC7 F;  1DT9 A;  1CN7 A;  1W42 A;  3NK6 A;  1M90 H;  1VQ9 F;  1N8R H; 
#chains in the Genus database with same CATH topology
 2UZH A;  3V7Q A;  3RYI B;  3I7T A;  5KMG B;  1VHA A;  4ZHV A;  3S03 A;  1VQV A;  3JAR A;  3E22 B;  1KD1 H;  3OW2 F;  2V9Y A;  1R1M A;  3WJR A;  3M1X A;  3CB2 A;  5G4V C;  3GTZ A;  4TV8 A;  3JAL B;  4C82 A;  4LNU B;  4R40 B;  2I6R A;  3LWP C;  1JD1 A;  1IV3 A;  4IHJ B;  2HP3 A;  2OZB A;  1YI2 F;  1VH8 A;  4IIJ B;  3WGJ A;  3JAK B;  3V4D A;  3WJQ A;  3F0E A;  2AIF A;  5FLX M;  1YJN F;  1IV2 A;  5EYP A;  5MN5 A;  1PF5 A;  1XV2 A;  3HKD B;  3I55 F;  5A2Q M;  2UYK A;  3V7E A;  4I55 B;  3RA6 A;  1W2B F;  3HKE A;  3AGK A;  4LCK A;  4PWT A;  4BT3 A;  1GZ0 A;  1DBF A;  3NK7 A;  3CC2 F;  5HY0 A;  2JNB A;  3M4S A;  1KC8 H;  2HVY D;  2EWC A;  2IG8 A;  5LYJ A;  2HS3 A;  2KTV A;  4ZHW A;  1TVK B;  1QD9 A;  3HKC A;  4O4L B;  4BVR A;  5ITZ B;  3J81 M;  4TZZ A;  1SZQ A;  2VXY A;  3U0O A;  3V3T A;  2RHO A;  3OBW A;  3NMU C;  2KG4 A;  4RHA A;  5LP6 C;  4BT6 A;  2CHT A;  3ZP4 A;  3F0D A;  3ZO8 A;  3HKE B;  4G4Z A;  2LCA A;  1NJI H;  3S0W A;  3HKB B;  3UT5 B;  3HWU A;  1QAH A;  2NMU A;  1YGY A;  2OTM A;  2MQE A;  3JAL A;  5GAP K;  1NQ3 A;  1VQN F;  5IYZ B;  4IIJ A;  3FPI A;  1Q86 H;  4EB6 A;  3CCR F;  3VO8 A;  5LYJ B;  1U40 A;  2QA4 F;  1VQK F;  1Z5W A;  4LNU A;  4I50 B;  2GVI A;  3EOR A;  4I4T B;  1KNJ A;  4I4T A;  3CME F;  1Q81 H;  3LME A;  3N2G A;  1T0K B;  2LBX A;  4O2A A;  5C8Y B;  3N4Y A;  3Q8H A;  3CPW F;  1Q7Y H;  2CZW A;  2OHW A;  3D54 A;  3RYI A;  1YJ9 F;  5LXT A;  3CCJ F;  5JH7 B;  5GIP C;  1CN7 A;  1DT9 A;  3HKB A;  1IV1 A;  2Z1U A;  1KNK A;  4BVT A;  1J7H A;  1N8R H;  3RYF A;  4F6R A;  1QVG F;  4F6R B;  4DRX B;  5CB4 A;  1UI9 A;  3MCQ A;  5G4U C;  5CA1 B;  3E20 B;  1GO1 A;  4O4H A;  3K14 A;  4O4I A;  2HS4 A;  1OFU A;  3QHD A;  2N48 A;  3VYT C;  2IAF A;  3TD3 A;  3HKC B;  4RQO A;  5EWR A;  3PAF A;  3F0F A;  1GO0 A;  2RHJ A;  2FGY A;  1TVK A;  3K0T A;  4YJ2 B;  4X1K B;  4G4X A;  4C8I A;  2ZOD A;  1VQM F;  2VGN A;  5LA6 B;  4NWO B;  4NUT A;  3FFM A;  3RYC A;  1XBI A;  4O4J B;  2DT4 A;  5IYZ A;  1CK2 A;  4TUY A;  1VQ8 F;  3HJW C;  3VTI C;  3QTY A;  1H48 A;  5IJ9 B;  2BTU A;  3RYH B;  1W5B A;  2PMP A;  1H7M A;  1X7P A;  3P10 A;  5BMV B;  3C9U A;  2VAP A;  1K73 H;  4BVS A;  3FD5 A;  2HX0 A;  1CLI A;  1QVF F;  5JH7 A;  2Q1X A;  2H8C A;  3JAR B;  1W5A A;  2HRU A;  4X3L A;  4ZI7 A;  2H6L A;  1GX1 A;  5HY1 A;  4ZHY B;  5EO3 A;  2R6R 1;  1K9M H;  1UFY A;  5EB0 A;  2ZOV A;  1SA0 A;  1W59 A;  4EB6 B;  1FSZ A;  3IKF A;  2L26 A;  2CW4 A;  3CC4 F;  5FJ4 C;  3LWR C;  2DYY A;  2LBT A;  4C81 A;  5AVM A;  2VAW A;  3O85 A;  5CA0 B;  1RA4 A;  3C9S A;  3ON1 A;  5EYP B;  2RHH A;  4O4I B;  3L7Q A;  1TUB A;  4I55 A;  1W3E X;  2CSL A;  3CG6 A;  4G4Y A;  4EI9 A;  2FC3 A;  3IR9 A;  2ZVZ A;  1W5F A;  3S06 A;  1X7O A;  3KJK A;  4ZOL A;  4EI7 A;  3G4S F;  5KX5 B;  2F9Z C;  4TV9 B;  1JJ2 F;  4O4J A;  5EAZ A;  1Q82 H;  3MBM A;  3IEW A;  4X1I A;  3RYC B;  3NK6 A;  1M90 H;  1VK3 A;  5FNV A;  4C8E A;  5HY4 A;  2CWJ A;  3IEQ A;  3B6N A;  1U43 A;  2UYN A;  2R75 1;  2BTQ B;  3JAS B;  1S72 F;  2AMT A;  3JAS A;  4X1I B;  2VAM A;  3VCZ A;  5EZY B;  3F0G A;  3N2G B;  2BTO A;  1VQL F;  4G88 A;  2B33 A;  3WPW A;  3T80 A;  5GAN K;  3VOA A;  2HP0 A;  1X25 A;  1W57 A;  5GIO C;  1U3P A;  4NQ3 A;  3JAT B;  2YYE A;  2PHN A;  3JAW B;  5KX5 A;  3KIZ A;  5DCV A;  5HWE A;  3LWQ C;  5CB4 B;  3JCM M;  2ZF8 A;  4BT4 A;  5MN4 A;  4X1Y B;  1QU9 A;  3WGM A;  5JVD B;  4TUY B;  3LWO C;  1YIT F;  3WGL A;  3JAK A;  2Z1T A;  3RE3 A;  3RYH A;  3JVH A;  3K12 A;  5ITZ A;  5CA0 A;  5LP6 A;  5HXU A;  3P0Z A;  2IQQ A;  2Z01 A;  4O2A B;  5C8Y A;  1SA0 B;  2HQS C;  3CYQ A;  3HAX D;  3G71 F;  3CCV F;  3KE1 A;  2ZVY A;  1RQ2 A;  1RLU A;  5JCO C;  4BY9 D;  4BT7 A;  4TV9 A;  1VQ7 F;  3CCL F;  2QEX F;  4X3M A;  1COM A;  1U3L A;  3CPQ A;  4U39 A;  2GZL A;  4O4H B;  2HRY A;  1FFX A;  2RHL A;  3GHZ A;  3N2K B;  3UT5 A;  3CCM F;  1VQO F;  5HXZ A;  5GON A;  3TD4 A;  1ONI A;  3CCS F;  1ZWZ A;  4DRX A;  3CXC F;  1RQ7 A;  5JCO A;  1TUB B;  4BW0 B;  2G9I A;  3SIV A;  3WGK A;  5IJ0 B;  2GLZ A;  5J2U A;  1JN1 A;  4O4L A;  2RB9 A;  3DC2 A;  5GIN C;  4U3J B;  3ELC A;  3CYP B;  3CCU F;  1VQ6 F;  5LA6 A;  3WGN A;  2Z1E A;  3JAW A;  2ZAU A;  4FFB A;  2LBW A;  3WJP A;  4KWE A;  1JFF B;  4HNA B;  4B62 A;  2Q1Y A;  1JFF A;  4HNA A;  5HP7 A;  5KMG A;  2KGW A;  3ZOP A;  3J80 M;  1YQN A;  5LOV A;  4FFB B;  4DXD A;  2H8E A;  5LOV B;  5EIB C;  4XCQ A;  5FNV B;  3KJJ A;  5JQG B;  4ZK7 A;  2AIZ P;  4O2B B;  4ZHQ B;  4B5C A;  1E7K A;  3LYB A;  4BVQ A;  2VGM A;  3CC7 F;  1W42 A;  4WBN A;  1VQ9 F;  3FD6 A;  5HP8 A;  4B45 A;  5BMV A;  3OON A;  5IJ9 A;  1ODE A;  4X20 A;  5IJ0 A;  5IT9 M;  1YHQ F;  2KTU A;  2CHS A;  1T0A A;  4ZOL B;  3D00 A;  4X20 B;  3I3F A;  1FNJ A;  3CD6 F;  3D01 A;  1XHO A;  5J2T B;  1YIJ F;  3WXM B;  2OTL F;  3NVI B;  3R0P A;  3VIU A;  1FFX B;  3N2K A;  3JAT A;  5EIB D;  4BT5 A;  1W5E A;  1VQ4 F;  3E22 A;  1JY8 A;  3ERN A;  3ESJ A;  3IKE A;  2UYP A;  3RA5 A;  2YXZ A;  3WPX A;  1Q8R A;  1W55 A;  4TV8 B;  3HTN A;  3VOB A;  3LWV C;  3VYU C;  1M1K H;  4ZI7 B;  4I50 A;  2OTJ F;  1FNK A;  1XRG A;  2P6Y A;  3MQW A;  1VQP F;  3NVK E;  5J2U B;  2WAL A;  1VQ5 F;  3S0H A;  4B46 A;  1K8A H;  1W40 A;  4U3J A;  3OBY A;  3I56 F;  3E1Y A;  5LP6 B;  3HKD A;  2QI2 A;  4EI8 A;  5EB1 B;  1W41 A;  3N4Z A;  3CCQ F;  5LXT B;  1OAP A;  5CA1 A;  1RLG A;  3LFO A;  2W8B C;  3PLA C;  3ZP7 A;  3MDO A;  4O2B A;  3RYF B;  4ZHQ A;  4G4W A;  1PXW A;  5JQG A;  3G6E F;  2ALE A;  2BO1 A;  5HY2 A;  3SIU A;  1SDS A;  1X52 A;  4ERH A;  5EZY A;  4IHJ A;  2UYN B;  2HS0 A;  3VYS C;  3FBA A;  3JAM M;  1IV4 A;  2Z1F A;  3GYQ A;  3P4E A;  1IPA A;  4X1K A;  5J2T A;  4YJ2 A;  3LDT A;  3KHN A;  1W58 1;  3S0Y A;  5JVD A;  4YJ3 A;  3VMF B;  3MCA B;  2CVL A;  2I6D A;  2K1S A;  4E6E A;  3C9R A;  5B8F A;  5GON B;  4C8G A;  3CCE F;  3S02 A;  2UYJ A;  1YJW F;  3DDN A;  1NMU B;  4X1Y A;  5MN6 A;  3CMA F;  1H47 A;  2QTP A;  4YJ3 B;  3VI6 A;  4M8I A;  3J7A R;  3F6M A;  1Z5V A;  1KQS F;  4C4W C;  3C9T A;  3K2X A;  4BT2 A;  3M84 A;  2HP0 B;  3TD5 A;  3QUW A;  3BYQ A;  4G4V A;  4WBN B;  3IMP A;  3C8L A; 
#chains in the Genus database with same CATH homology
 1QVG F;  3V7Q A;  1N8R H;  5IT9 M;  1YHQ F;  5G4U C;  1S72 F;  2KTU A;  3E20 B;  1GO1 A;  1KD1 H;  3D00 A;  3OW2 F;  1VQL F;  3CD6 F;  5G4V C;  5GAN K;  1YIJ F;  3WXM B;  2OTL F;  3LWP C;  3NVI B;  5EWR A;  3PAF A;  5GIO C;  4NQ3 A;  2OZB A;  1VQ4 F;  1GO0 A;  1YI2 F;  3RA5 A;  5DCV A;  2FGY A;  2AIF A;  5FLX M;  5HWE A;  3LWV C;  3LWQ C;  3JCM M;  1YJN F;  1M1K H;  2OTJ F;  1VQM F;  2VGN A;  4NUT A;  3FFM A;  3I55 F;  3LWO C;  1VQP F;  5A2Q M;  3NVK E;  1YIT F;  3V7E A;  2WAL A;  3RA6 A;  1VQ5 F;  1XBI A;  1K8A H;  1W2B F;  3AGK A;  1W40 A;  3OBY A;  3I56 F;  3E1Y A;  4LCK A;  2QI2 A;  4EI8 A;  1CK2 A;  5HXU A;  1VQ8 F;  3HJW C;  1GZ0 A;  3HAX D;  3G71 F;  3CCV F;  1W41 A;  3NK7 A;  3CC2 F;  3N4Z A;  5HY0 A;  2JNB A;  3CCQ F;  1KC8 H;  1H7M A;  4BY9 D;  1X7P A;  1RLG A;  2HVY D;  3LFO A;  3PLA C;  1VQ7 F;  2KTV A;  3G6E F;  1PXW A;  1K73 H;  4BVS A;  2ALE A;  3CCL F;  2BO1 A;  2QEX F;  4BVR A;  4X3M A;  5HY2 A;  3SIU A;  3J81 M;  4TZZ A;  1QVF F;  1SDS A;  1X52 A;  3CPQ A;  3V3T A;  3OBW A;  3NMU C;  2KG4 A;  3CCM F;  1VQO F;  5HXZ A;  4X3L A;  3CCS F;  1ZWZ A;  3CXC F;  5HY1 A;  1NJI H;  3JAM M;  5EO3 A;  1K9M H;  3GYQ A;  4BW0 B;  5FJ4 C;  1IPA A;  3SIV A;  3CC4 F;  2GLZ A;  3LWR C;  5GAP K;  1VQN F;  5GIN C;  3CCU F;  1VQ6 F;  1VQ9 F;  3O85 A;  1RA4 A;  3ON1 A;  1Q86 H;  3VMF B;  3MCA B;  3CCR F;  2I6D A;  2LBW A;  2QA4 F;  1W3E X;  3CCE F;  1YJW F;  3CG6 A;  1VQK F;  4EI9 A;  1NMU B;  3CMA F;  2FC3 A;  3IR9 A;  3VI6 A;  3J80 M;  3J7A R;  1Q81 H;  3CME F;  1X7O A;  1T0K B;  1KQS F;  4EI7 A;  2LBX A;  4XCQ A;  3G4S F;  4C4W C;  2F9Z C;  3N4Y A;  3CPW F;  1Q7Y H;  2CZW A;  2OHW A;  1JJ2 F;  1YJ9 F;  1E7K A;  1Q82 H;  4BVQ A;  3CCJ F;  2VGM A;  5GIP C;  3CC7 F;  1DT9 A;  1CN7 A;  1W42 A;  3NK6 A;  1M90 H;  4BVT A;  5HY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...