1XBLA

Nmr structure of the j-domain (residues 2-76) in the escherichia coli n-terminal fragment (residues 2-108) of the molecular chaperone dnaj, 20 structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the J-domain and the Gly/Phe-rich region of the Escherichia coli DnaJ chaperone.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords DNAJ
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1996-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1xblA00
3UO3A 1BQ0A 2M6YA 2KQXA 2YUAA 2QWRB 2PF4E 2L6LA 2QWNB 3APQA 2CTQA 3BVOA 1FAFA 2DN9A 2OCHA 2QSAA 4J80A 2N04A 3UO2A 2GUZB 1WJZA 2QWOB 2CTRA 2QWQB 2CTWA 1N4CA 2Y4TA 2N05A 2QWPB 1GH6A 2LO1A 1FPOA 2LGWA 1HDJA 2CUGA 3AG7A 1BQZA 2GUZA 1XBLA 2DMXA 3APOA 1IURA 4J7ZA 2Y4UA 2YS8A 4RWUA 4IT5A 1NZ6A 3UCSC 2EJ7A 2CTPA
chains in the Genus database with same CATH superfamily
4B3SB 1BQ0A 3CE2A 1MZFA 1L0NH 5B1BB 3KG2A 2JJ1G 2B1IA 1OZ0A 4QE9A 1MZEA 3P3PA 5CBFA 1N0NA 3M8AA 3JASB 4UVCA 4JI6B 3BFRA 2AHZA 1IBKB 4XBFA 3I5DA 4QIWF 2GSMB 1SA0A 2CUGA 5IY5B 2PYJA 1BT8A 3L71H 3ZMZA 2P22C 4RQFA 3RW0A 3ZS8C 4QGPA 1V54C 2CTQA 3P30A 5FL7G 5JWPA 4U3JB 4LF7O 3LDDA 5FNVA 2E76B 1VQLV 2OIEA 1EN6A 2DOSA 1GM8A 1JR9A 4X89A 3BAAA 4JI2O 1FS0G 4E2LA 2HG5C 2IW5A 3C3SA 1Q6HA 3IGAC 4UCTA 3ZHUA 3AG4C 2EIMB 1E1QG 3MAQA 2BOCC 1P4RA 1I08A 1X59A 2Y69B 1PM9A 2ZQMA 2MK3A 1FFTB 2ZDIA 2QSAA 1P84F 4FM1A 2CTWA 1TVKA 1LR1A 4AHCA 4AQYB 3C90A 3ETDA 2UUAB 3HKBB 4MW8A 4Z2WA 2LFSA 1VQMV 3QTCA 3ZCCA 4F6RB 1F4MA 3A0RA 2QEXV 1ZAUA 1WP7A 4LFAO 3ETGA 4P2ZA 2B9ZA 5LOVA 2R9IA 1MOFA 1VQOV 3SPGA 2XAHA 5LXTB 3K5LA 5CA0A 2DYRB 2Z5UA 1N34O 4JGSA 4LNUB 2XAFA 4JAAA 3CJHB 1N32O 4BIZA 1SC5B 2YEVA 4DR7B 2F4VO 4NXNB 5EYPA 4DV5B 1XMOO 3CX5F 1IZ3A 1ZTEA 4LFAB 3N2GA 3G71V 2YXYA 2JGDB 5ITZB 2OCCB 1IURA 2ZD9A 2Q0AA 2ADQB 2RMKB 4NTYA 1YTFB 4P9PA 1YJNV 3SPJA 1AR1B 4X64O 2DWEC 4R7CA 3L74H 1XMQB 1XMQO 1WP8A 4FPPA 1NQTA 5C8YA 1QHTA 3K3WA 3OTFA 3VQXA 1O9GA 3P3NA 1TUBB 4LR3A 3J80N 4O4HA 4QE7A 2UU9B 3L75H 4DK0A 3FB7C 2UXDO 4DV1O 1V55C 4DR4B 2R72A 3OEHG 5CBGA 5C93A 4DR3B 5KHKA 5EZYA 4DUYO 4PI2A 1PNKA 3CRCA 4UB6Z 2GUZB 2JRIA 4J42A 1OCZC 2N05A 1W2BU 1H2NA 5A2QN 1NT2B 5KAFZ 1HNWO 1I5XA 5IYDO 5DN6G 1B3QA 3ZHRA 4D7SA 1NS1A 1EFRG 3ZHTA 4LC1A 4DK1A 4I0XA 3QNEA 1AJNA 1JJOA 2CDYA 4H44B 4IIJA 4B3MB 1N36B 2GBOA 3ZHVA 2LW1A 4I50A 3CMAV 4X1IA 4W4KA 2ZE7A 4CZZA 1K8AW 4LFBO 2LP7A 1YITV 3ASNC 4WCEV 4O4JB 1VQ8V 3WB1A 4UCSA 1AJQA 5EIBC 4OGQB 2NLJC 1SRYA 3T2MA 4DUZO 2JK5C 4GLXA 1IBLB 4JASA 3AG2C 2NR5A 3E86A 4U3JA 2XAQA 1DLBA 1THZA 1SQPH 1GM7A 3ZRVA 1PL4A 1GN2A 1AR4A 1IXMA 4ABMA 1FXKC 1VF7A 1DGSA 5L3CA 2P67A 4IGGA 3AG1C 3R65A 4YHHO 4NXNO 1HWYA 2B5UA 2ZR2A 3SJAC 1MSWD 1M5IA 3K0GA 1G4YB 4DR2O 4LF8O 1NTZH 5CB4B 1PL0A 2KG7A 2XAGA 4X65O 3A0BZ 4LFCB 4TUYB 1K4DC 4LH6A 3JCUZ 3HR0A 4JI6O 2A79B 1Z2GA 2GDSA 4O4JA 4DYLA 2VWJA 3RYFA 1WA8B 1NU1H 3DC5A 1ORQC 2PI5A 4LFCO 2ZCEA 2ZDIC 4EB6B 5BMVB 1L8DA 3X2QB 5E1AC 2FTKA 2ZINA 2JS3A 3KCXA 1K33A 5CA1B 3CC7V 1ZLZA 5B3SB 1P7BA 1I0HA 1L0LH 4Z1VA 2YS8A 3AEIA 3OM3B 3B40A 1R3KC 1VQ4V 4A5UB 4Q6GA 3SPCA 2WLHA 1M57B 4TUYA 3DGEA 2F23A 2QKSA 5JCOC 2UUBB 4G28B 5IYZB 5H2FZ 3T1HO 2UXCO 5LP6A 2IJHA 2Q7GA 3RVYA 3UKMA 1SQGA 3AG4B 1S5LZ 4PA9A 3ASOB 2QE7G 2PGGA 3FB5C 1L1FA 4C7UA 4U7NA 1FJGO 5HFMA 3OUSA 2FMLA 3A0HZ 1LUVA 1NTMH 5FPOA 1YSCA 3IAYA 2BOBC 5LA6A 5J2TB 4IYHA 4KXRA 4DW1A 3OTOB 1YF2A 4JI1O 2CTPA 1EBOA 3GWKC 3JCZA 4J41A 5KMGB 3UO2A 2XUMA 3E8FA 3H1JH 3ICXA 4CH3A 3EHBB 3VBBA 2WLNA 5IYZA 1A32A 1SQQH 2EIKC 1MABG 4UCUA 2NN4A 1TVKB 4O4LB 1HW7A 3L9DA 4GX5A 1H38A 3P32A 2WA4A 4GKKO 4IL6Z 3ZBHA 4WBNB 4YJ2B 1NKDA 1DTOA 3ZRXA 2V7QG 1URFA 1M4UA 3HPLC 3B09A 1M93A 4Q20A 5CA0B 1HNZB 4ASUG 5LMNO 1CPYA 1XEQA 2QTSA 4MVOA 4UUJC 2QJ1A 4TV9B 2ZM6B 3W7XA 1H2GA 2CH7A 3OFNG 3CEIA 2AW9A 3LSUA 4JI8O 4UVBA 5JQGA 1KC8W 3BY6A 1ZL8A 1ZL8B 4PDMA 1XDCA 3CB2A 5LMUB 1HR0O 1OCOB 4LFBB 1M56C 2OT5A 5FPRA 3JAKA 4OX9O 1VF6A 2LW7A 5DEDA 3WU2Z 3ZHSA 4FLXA 1JFFA 4L87A 2E5LB 2QWNB 3RYHA 5L3DA 1H8EG 1G1XB 4ZI7B 3KKYA 1NH2B 1EZJA 1AJPA 4YJ2A 1H8HG 3MHHC 3CSXA 2H94A 3T4ZA 1OCZB 5EIBD 5L3EA 4O2BA 1V9PA 1H2KA 2YIBA 4AI8A 4LF4B 3E8GA 2RQ6A 2X7RB 4I5SA 5K1PA 1AILA 2QGNA 2V4DA 4G27B 4MW3A 3MDSA 1Y76B 4DV1B 5JQGB 3ZN0A 2QKCA 4XDLA 4B3MO 4X8AA 5B66Z 1HNXO 3W7SA 3ASNB 1SF9A 4FFBA 3AG3B 3NXSA 4PA7A 1GM9A 4MS2A 3N2GB 4QPJA 1AI6A 3HKCA 2QR4A 1WB7A 3ABLC 4LBEC 2WLJA 4I50B 5IYBO 1HP8A 1R3LC 3CYOA 3FB8C 4IHJA 4IHJB 4ZIBA 1GH6A 4JV5B 3MHSC 2XNDG 3L72H 3CS5A 1GK9A 2ZE5A 4D6TH 3QO7A 4P30A 5F2VO 3DXRA 4NR1A 1I5YA 3OR6C 4X20B 1XNRB 1I94B 1WB8A 4FJCC 4NTXA 5IE9A 4WFEA 4YXWG 1GN3A 5IJ0A 4LF5O 1S72V 4CBCA 2RJZA 1IX9A 1RSOB 2YICA 1XHXA 4B3TB 1U97A 1N34B 1UJWB 1FFXA 1K9MW 5BZBA 3ABKC 2VRZA 2Z0AA 2YIAA 4DR3O 4TQDA 3APQA 3T1YO 3K0DA 5JCOA 4B7EA 5DM6V 2RNBA 4FVMA 3OR7C 1XL4A 3CRAA 1KKDA 3ETQA 2E3CA 4JI4O 4U7OA 1W0JG 4DR2B 5JVDB 1SKVA 4BR6A 4JF3A 5IJ9B 1BL8A 2KQXA 3EXAA 1Z5VA 4PA6A 4DR1O 4LWSA 1AI5A 3TGUH 4X64B 2OCHA 3E22B 3CXHF 1V54B 4PV1B 4JI7O 4GCZA 2X0LA 3JASA 4PDVA 1JVMA 2WA3A 1BQZA 1SQFA 2HKOA 3G6EV 2EILC 4OX9B 3U0ZA 2Y0IA 1G8MA 1VQPV 3FYIB 1HDJA 2A3QA 4HZ3A 2UXDB 2WAMA 4RAIA 3ZMVA 2NNUA 1K34A 5H5NA 5L3FA 3M99B 2UUAO 5B1BC 1OJHA 3CD6V 2VS0A 3CXCU 1N32B 3S3WA 2Q9LA 3K79A 2IJJA 4LNUA 5JJJB 2DYSC 2YC0A 2P7TC 4PI0A 5IY5C 2M7WA 4X88A 2GHYA 4WFFA 3OUFA 2WWWA 1BE3H 3K03A 3LSSA 1ZWIC 2F66C 1M1KW 1VF5B 2P4KA 5KUMA 2JGUA 2Q8VA 4JI0B 4JI5O 4KL1A 4QPKA 3KZIZ 2DYRC 2LO1A 2UUCO 4AQYO 1JPXA 3VQVA 4IIJB 4O4LA 2LFRA 4ZI7A 1JQ0A 4OPAA 3SYOA 1YIJV 4O2AA 2ZXWC 4CC6A 2ZE6A 1R6KA 2FL4A 3D36C 3JD0A 4DR6B 4JPRA 5FNVB 4FLTA 3JALB 3K06A 2ZNJA 1GRJA 3JALA 3W7UA 1K5QA 1WPBA 2ETNA 3K5NA 5KHJA 2WLKA 2M6YA 2UUCB 4CS2A 2BCCH 1WAZA 1XUQA 1SETA 4MVRA 3D36A 3RYCB 5EC1C 3TETA 2DJVA 2UU9O 1GAXA 4GX2A 1BHBA 2P06A 4EFEA 2P5OA 4LF6B 2Y69C 1R6NA 2Y4UA 2HP8A 5JJNB 5KX5A 5IT9N 4MSWC 4DV3B 1F4NA 1HNZO 1V55B 1WNSA 2UXBB 2DN9A 1Q8IA 3GVMA 5CB4A 1GKFA 2L35A 3LSQA 1MSDA 4DR5B 5K1XA 4DV7O 1SQBH 4YJ3A 1FXVA 3J81N 4DV6B 1K3EA 2PF4E 2JIZG 1N33O 1VP7A 3K9SA 3K9AA 1Q43A 1QBZA 2OYQA 2HJFC 1YHQV 3SYPA 4BAYA 4BWAA 5BMVA 3K5OA 4YY3B 2AGAA 2QM7A 3K5MA 1HNWB 4H0LB 3CCUV 3OTOO 3OT7A 3HKDB 1PKXA 3H1HH 2OIGA 3U11A 1NJIW 1K7DA 3RYHB 1HR0B 4B3TO 1KBHA 2W6IG 1EN5A 1AP6A 3FAVB 5JVDA 3JATA 1AI7A 1ROPA 2KG7B 1FPOA 2A0LA 5C8YB 1XREA 3WB0A 4BW5A 2VQFO 2F95B 1J95A 1Q3EA 4R8CA 1EZVH 4MTXA 5GONA 4K3AA 2ZXWB 1QVGU 1FXKB 4NXMB 4TV8B 3STLC 3ABLB 4JYAB 4JYAO 5CMUA 2Z3YA 4FIPC 3TXSA 2GUZA 2R9RB 4FLYA 2RN9A 4UCVA 1FYJA 5LGUA 2C2AA 1RP3B 2ZIOA 3GWOA 3OMAB 4FFKA 1LUWA 1GN6A 3TXQA 3G80A 2Q69A 3OAAG 1CXZB 1M90W 4JI7B 1KMIZ 3STZC 5LL6Y 2QKAA 3HKCB 4JTAB 4F4LA 3ABMB 3UM7A 3H1LH 3D3QA 3BABA 3DXRB 1AB3A 1SS3A 2E74B 4EEQA 4HBNA 1YZBA 3RGBA 1YI2V 3ETEA 2WLMA 4FLVA 3SR2C 4O2BB 5LP6B 4O4IB 4O4IA 1NVPB 4X1KA 4LF9O 2ZR3A 2JS5A 4DR6O 1ZUQA 1CP9A 3GB7C 5IYCO 3IC7A 1GO3F 4J9YB 1KKCA 3CRRA 4L8JA 3JSNA 1NZ6A 1Q81W 4TV8A 1KU9A 2YUAA 3MD0A 2FYUH 1ENVA 4GX0A 4PJ0Z 3H01A 1QCEA 1IVSA 3WB2A 2K1EA 5LBQA 4LH7A 1X4TA 5EBWC 1XNRO 4UVAA 4JYYA 2ILMA 3S3XA 1M56B 2YEVB 4DV0B 2VQEO 5B1OA 2Q73A 3UO3A 1BS3A 2HLDG 3RYCA 1JX9A 4LWSB 4DUZB 1XQ8A 1CEZA 3THOA 5H6RA 2PUSA 3HB3B 5B1AB 4JYBA 3IJ4A 1PD3A 1K97A 4I55B 3CCRV 2EIJB 2PYLA 5A9GA 4XDKA 2R9AA 1YEWA 1TGOA 2DYSB 4DRXA 3ZIAG 4YY3O 4B7KA 2L6LA 4GKJB 3SYAA 4LF4O 1FAFA 3CCLV 3RYIA 3CRMA 4DV4O 4GUNA 3AK2A 3SPIA 3LDEA 4ZBMA 4GZRB 4X9QA 1Q6UA 1BSMA 2EINB 2OCCC 3DC6A 2ZIMA 2DMXA 2PTMA 3N27A 4NVPA 1S0VA 3CCMV 1Q6IA 1QR8A 3JAMN 2CK3G 1JJ2U 1PPJH 3O65A 4X62B 2OWOA 1D5NA 1ZSPA 4FFBB 4OXSA 2EZPA 2E5LO 1FJGB 3J7AU 1BHAA 1COWG 4DR4O 1IBMO 2P6JA 2W0XA 4X1IB 1S77D 3FAVA 3ZMTA 2UXBO 3CWBH 4DR1B 3G4SV 1Y74A 1Y74B 4X1YA 2X6BA 1VQ9V 3BHPA 1F51A 3CP1A 5LP6C 3JD4A 1SQXH 5LOVB 3JARA 2IH1C 2VQEB 4CS3A 1RPOA 5B1NA 2IBZH 2IJIA 3OMNB 2ZNIA 5GW7A 3EFFK 1RM1C 2ZT9B 3UT5B 4K0KO 1XNQO 1B6QA 2DQ3A 1KD1W 5D5QA 4BW9A 1GTOA 1VQ5V 3B77A 2JEUA 1D2DA 3JD1A 2YXHA 2F4VB 4DR7O 1B04A 3VOUA 3SJQC 3CCQV 3E83A 4PA3A 2OTJV 2F93B 4F6EA 1AI4A 1F23A 4I0XB 1N33B 5AG2A 4UCOA 4WFAV 5KHHA 2Y48A 2XASA 1VQNV 4MVZA 3QO5A 4FLWA 3BRCA 1QU7A 4NB5A 3AG2B 1QLEB 3RVZA 1QLNA 5B1AC 2IU3A 2D3OW 1TAEA 4PDLA 4EFBA 1VQ7V 5J2UA 5GTIZ 2WSSG 3AK3A 4GX1A 3AG3C 4WF9V 1BGYH 3K58A 1RSOA 4GYCB 4NTWA 1KECA 3PJSK 2ATKC 2IJKA 1MNGA 2W6JG 2A06H 2BTQA 2WPDG 1XBLA 4DXWA 3D8CA 4FMTA 3O9OA 4G2KA 1K92A 1E1RG 2EIMC 1PNLA 2CGNA 4TT3G 4I7ZB 1NBMG 1J5EO 2RDCA 4R6ZA 2PY5A 3ZEDA 3CRQA 1XILA 3ABUA 1OCOC 4JV5O 5LMUO 5EBMC 4W4LA 3SJCC 4DV2B 5LHGA 1Q5OA 1Y4MA 2IM9A 2HR3A 4H13B 1R3IC 3G6BA 5KAIZ 2EJRA 4B3RB 1VQKV 2DQ0A 4X20A 3SYCA 3WG7C 1NI8A 3T1YB 4JI1B 4CS4A 5IWAB 4I55A 4OPHA 3ZMUA 5IJ0B 3AG1B 3CCVV 3B2EE 2XAJA 1VIBA 1Y76A 2EZOA 5BXZA 4I4TB 1K4CC 1NR1A 2EBOA 4B3RO 1MG1A 2BE3A 3KCYA 3OD4A 1YVWA 2PZSA 3FKSG 1WPXA 4TSFG 1RM1B 4JI3B 1N36O 2QWOB 1S76D 1N4CA 4FLUA 4RUFA 1KUQA 4H37A 4RWUA 4PDRA 3UCSC 4DR5O 1W0KG 4Z1MG 1AVMA 5CN0A 5KA6A 5IJ9A 5KMGA 1OCRB 3FD9A 3X2QC 1NVPD 3H1KH 2ZE8A 5HFLA 4JYCA 3SGIA 5CA3A 4B08A 2QWQB 4DUYB 3HKEA 4HNAA 1US6A 4F6RA 2VQFB 3RYFB 1R3JC 1QQCA 1NTKH 4J11A 1JOYA 1KP2A 3ZRSA 4EB6A 4DW0A 4YJ3B 4LP8A 3ML0A 1WA8A 4FLZA 1YCIA 4BIOA 3IFXA 4I9QA 2X6AA 1FXHA 2N74A 2CH7B 1LNQA 1XL6A 5H6QA 2GV9A 3W7TA 4J9ZB 1XMOB 1Q90D 3K59A 4K8ZA 1N0JA 2HHHO 1SESA 2HFEC 4CH6A 5JH7A 3D3IA 2QTOA 3F7YC 4ICGA 1F7YA 4LCUC 2LGQA 4I9WA 4PELA 2IU0A 3BEHA 5JJEB 1JFFB 2A7WA 3QVNA 1VARA 2AXTZ 1H2MA 4JAVA 3APOA 2H8PC 2UUBO 1DF5A 1UPGA 4N23A 4IYIA 4KFMA 1QVFU 3I56V 4O2AB 1YXBA 2ZKOA 3RYIB 3ABTA 4XDJA 4FM2A 2Y0PA 3BPZA 2D2CB 3K04A 3WG7B 3B4SA 5J2UB 5EC2C 5LXTA 2Q4PA 5IWAO 3AG7A 4LF6O 1G6UA 5J2TA 4TV9A 3CCSV 1OCCB 4JI3O 3BVOA 2ADPA 1K5SA 4PD4F 5LA6B 3ABKB 5EYPB 3L70H 4MTGA 3WFVA 1MA1A 2ZM6O 3A8TA 1QNMA 1S3JA 4X66O 3ZRWB 2CTRA 3ZRWA 5KHGA 3B8MA 3T1HB 3TCUA 2EX3A 3SDLA 5GTHZ 1M9NA 3AK1A 3M7MX 4ZOLB 3ABMC 4KP4A 2YIDA 4HYOA 4DO2A 3LUTB 4JI2B 4YIOA 1BMFG 4WFHA 2N04A 3Q4HA 2QA4V 3Q4HB 1OCRC 1IBKO 3DTUB 4FZ0A 1MMMA 3ZHQA 3F5WC 4X1YB 2BTOA 3E89A 2G38A 5FLXN 3B8NA 3ASOC 1TUBA 2KSDA 4WFGA 1FXKA 2QWRB 3L73H 4JI0O 1J5EB 4K0KB 1SA0B 3I55V 4TOIA 4BIUA 4UFZA 5DECA 3N2KB 3T4DA 4JI5B 2UXXA 2X6CA 3T1CA 1QR9A 4J80A 2QDOA 5KA5A 3FFQA 3OGIB 3JD2A 2B1GA 4MTOA 2AZ0A 5EZYB 4ZHQA 5J9PC 3OMIB 1P7GA 4JAUA 1YJWV 1Y66A 1AP5A 4LF8B 2BSKB 4GKKB 2JGDA 5ITZA 3VQYA 4UV8A 4J10A 4JTCB 5LHHA 3BA9A 5BY1A 4YHHB 4NXMO 5BR8O 4CH5A 3FYEB 1R73A 5L3BA 1BZKA 1XNQB 4PA4A 1SERA 3E35A 2HVKC 1O9HA 1U96A 5L3GA 2V1DA 2AHYA 3JD3A 1I7FA 2P90A 5CBHA 3HKEB 1BCCH 1XHZA 2YIBD 2H3OA 2E75B 1PNMA 2ITDC 3JSLA 4RO2A 5H9CA 4DRXB 2VWKA 4X1KB 4K8XA 2Y4TA 5KHIA 2GTAA 4FM0A 2EINC 3LDCA 3N2KA 1VMGA 2LQTA 1DF4A 1K73W 3LNMB 3BA8A 4MVMA 1M57C 2BTQB 1SQVH 1YDXA 4HAMA 1JMKC 3RWRD 2YDEA 3CCJV 1EN4A 1VEWA 2ODMA 2HHHB 3JYCA 2WLIB 5LGTA 4X65B 1JA8A 4FK5C 2EILB 2FKXA 2WLLA 4MT8A 3ZJZA 3ZN1A 2R70A 4UV9A 2GTSA 2P4VA 1SZXA 2MW2B 5IDJA 4RUEA 4J7KA 3H1IH 4JZGA 4ZKIA 2KB1A 2K9PA 3CC2V 1H2SB 3CPWU 2Q68A 3K08A 4NYKA 4RQEA 4FZ1A 2DW4A 1E79G 1I94O 4I4TA 3RFRA 3RT3C 2CAZC 4DV6O 3CMEV 2XT9A 4N21A 4EKWA 2Q6AA 1PV0A 1P49A 2JEXA 4QNHB 3C3TA 3LNNA 4MVUA 4TQFA 1D5AA 3VQWA 2HJDA 2IH3C 4U3FH 1HNXB 2F1MA 4J7ZA 5JH7B 4JI4B 2OTLV 1VF6C 1JCHA 1GMGA 1Q86W 2JDIG 4E4EA 3BCCH 3A2FA 1RPRA 3U10A 4HNAB 4NKGB 2LGWA 1IXBA 1QLEC 2CE4A 3EVKA 3E22A 5LGNA 2Q7HA 3R66A 4QJFB 1XI1A 1Y67A 2YXLA 4MVSA 1RFYA 2YI9A 2QM4A 1WLEA 3NR7A 2Q7EA 4LF5B 4O4HB 4J7JA 2A9HA 4LF9B 4K35A 3E2EA 4DV2O 4H33A 2LJ2A 4DV4B 1WN7A 5EK0A 4AILC 2EIJC 1Y6XA 4B3SO 1IBLO 2ARHA 5BR8B 1YTFD 3CHXA 5KLVH 3OEEG 4KHPB 2RCVA 3QG5A 2FB5A 4JI8B 4ZHQB 1EM1A 2HEPA 3FB6C 4X66B 2Q0OC 3ZX6A 5B3SC 1Q82W 2F43G 2ITCC 5EBLC 1TUEB 1IBMB 1XOUA 5B5EZ 3HKDA 4IT5A 5LMNB 1Z5WA 5KUKA 5KX5B 3OW2U 1UFIA 4D7TA 1S5HC 3HKBA 5LHIA 1OCCC 3F7VC 1OV9A 3OE7G 3TK1A 2EULA 5E79Z 1WJZA 1ZX3A 2PI4A 4R50A 1VQ6V 2HVJC 2XHBA 3E8BA 3JARB 1R6TA 1T5EA 4LF7B 3F5TA 1YJ9V 2EJ7A 5LYJB 5LYJA 1KP3A 3CJHA 1KQSU 4YIPA 3UT5A 2YI8A 3G67A 4P9OA 3OGCC 1FFXB 2Q67A 4GT1A 3ZMSA 4KUMA 4UB8Z 1AR5A 3PN1A 4UCRA 3E8HA 1KB9F 4WFBV 3JAWA 2WLIA 3JAWB 3DSQA 4UXNA 4CH4A 3CC4V 2UXNA 4DV3O 3QO8A 2AZ2A 1R1BA 3K57A 2EIKB 5TISZ 1IDSA 3IC9A 3QF7A 4WBNA 1N8RW 1S5JA 3RBZA 2JJ2G 2UXCB 4KHPO 1GN4A 1KYOF 2KKWA 2JVDA 3SYQA 2O57A 5GONB 1AROP 4MTFA 5D5PA 3CCEV 4DV5O 1FD9A 3FX7A 4DV0O 1PP9H 2QWPB 1H2LA 4JTDB 3RN4A 1Q7YW 1OHHG 2DE0X 2YSUB 3SJBC 1DK1A 4MVQA 3TJTA 1NR7A 2DWDC 1NH2D 4JZ2A 2CGOA 4X62O 2QM8A 4CC5A 2XTAA 3JAKB 4ZOLA 5CA1A 4TWKA 1SZTA 4GKJO 1W59A 3W7WA 2WLLB 2W0FC 1TA8A 2BSKA 4DV7B 3JATB 3SPHA 3UQ8A 3H9VA 1FKAO 4PHZA 1B06A 2XOKG 2Q5ZA
chains in the Genus database with same CATH topology
3UO3A 1BQ0A 2M6YA 2KQXA 2YUAA 2QWRB 2PF4E 2L6LA 2QWNB 3APQA 2CTQA 3BVOA 1FAFA 2DN9A 2OCHA 2QSAA 4J80A 2N04A 3UO2A 2GUZB 1WJZA 2QWOB 2CTRA 2QWQB 2CTWA 1N4CA 2Y4TA 2N05A 2QWPB 1GH6A 2LO1A 1FPOA 2LGWA 1HDJA 2CUGA 3AG7A 1BQZA 2GUZA 1XBLA 2DMXA 3APOA 1IURA 4J7ZA 2Y4UA 2YS8A 4RWUA 4IT5A 1NZ6A 3UCSC 2EJ7A 2CTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UO3 A;  1BQ0 A;  2M6Y A;  2KQX A;  2YUA A;  2QWR B;  2PF4 E;  2L6L A;  2QWN B;  3APQ A;  2CTQ A;  3BVO A;  1FAF A;  2DN9 A;  2OCH A;  2QSA A;  4J80 A;  2N04 A;  3UO2 A;  2GUZ B;  1WJZ A;  2QWO B;  2CTR A;  2QWQ B;  2CTW A;  1N4C A;  2Y4T A;  2N05 A;  2QWP B;  1GH6 A;  2LO1 A;  1FPO A;  2LGW A;  1HDJ A;  2CUG A;  3AG7 A;  1BQZ A;  2GUZ A;  1XBL A;  2DMX A;  3APO A;  1IUR A;  4J7Z A;  2Y4U A;  2YS8 A;  4RWU A;  4IT5 A;  1NZ6 A;  3UCS C;  2EJ7 A;  2CTP A; 
#chains in the Genus database with same CATH topology
 4B3S B;  1BQ0 A;  3CE2 A;  1MZF A;  1L0N H;  5B1B B;  3KG2 A;  2JJ1 G;  2B1I A;  1OZ0 A;  4QE9 A;  1MZE A;  3P3P A;  5CBF A;  1N0N A;  3M8A A;  3JAS B;  4UVC A;  4JI6 B;  3BFR A;  2AHZ A;  1IBK B;  4XBF A;  3I5D A;  4QIW F;  2GSM B;  1SA0 A;  2CUG A;  5IY5 B;  2PYJ A;  1BT8 A;  3L71 H;  3ZMZ A;  2P22 C;  4RQF A;  3RW0 A;  3ZS8 C;  4QGP A;  1V54 C;  2CTQ A;  3P30 A;  5FL7 G;  5JWP A;  4U3J B;  4LF7 O;  3LDD A;  5FNV A;  2E76 B;  1VQL V;  2OIE A;  1EN6 A;  2DOS A;  1GM8 A;  1JR9 A;  4X89 A;  3BAA A;  4JI2 O;  1FS0 G;  4E2L A;  2HG5 C;  2IW5 A;  3C3S A;  1Q6H A;  3IGA C;  4UCT A;  3ZHU A;  3AG4 C;  2EIM B;  1E1Q G;  3MAQ A;  2BOC C;  1P4R A;  1I08 A;  1X59 A;  2Y69 B;  1PM9 A;  2ZQM A;  2MK3 A;  1FFT B;  2ZDI A;  2QSA A;  1P84 F;  4FM1 A;  2CTW A;  1TVK A;  1LR1 A;  4AHC A;  4AQY B;  3C90 A;  3ETD A;  2UUA B;  3HKB B;  4MW8 A;  4Z2W A;  2LFS A;  1VQM V;  3QTC A;  3ZCC A;  4F6R B;  1F4M A;  3A0R A;  2QEX V;  1ZAU A;  1WP7 A;  4LFA O;  3ETG A;  4P2Z A;  2B9Z A;  5LOV A;  2R9I A;  1MOF A;  1VQO V;  3SPG A;  2XAH A;  5LXT B;  3K5L A;  5CA0 A;  2DYR B;  2Z5U A;  1N34 O;  4JGS A;  4LNU B;  2XAF A;  4JAA A;  3CJH B;  1N32 O;  4BIZ A;  1SC5 B;  2YEV A;  4DR7 B;  2F4V O;  4NXN B;  5EYP A;  4DV5 B;  1XMO O;  3CX5 F;  1IZ3 A;  1ZTE A;  4LFA B;  3N2G A;  3G71 V;  2YXY A;  2JGD B;  5ITZ B;  2OCC B;  1IUR A;  2ZD9 A;  2Q0A A;  2ADQ B;  2RMK B;  4NTY A;  1YTF B;  4P9P A;  1YJN V;  3SPJ A;  1AR1 B;  4X64 O;  2DWE C;  4R7C A;  3L74 H;  1XMQ B;  1XMQ O;  1WP8 A;  4FPP A;  1NQT A;  5C8Y A;  1QHT A;  3K3W A;  3OTF A;  3VQX A;  1O9G A;  3P3N A;  1TUB B;  4LR3 A;  3J80 N;  4O4H A;  4QE7 A;  2UU9 B;  3L75 H;  4DK0 A;  3FB7 C;  2UXD O;  4DV1 O;  1V55 C;  4DR4 B;  2R72 A;  3OEH G;  5CBG A;  5C93 A;  4DR3 B;  5KHK A;  5EZY A;  4DUY O;  4PI2 A;  1PNK A;  3CRC A;  4UB6 Z;  2GUZ B;  2JRI A;  4J42 A;  1OCZ C;  2N05 A;  1W2B U;  1H2N A;  5A2Q N;  1NT2 B;  5KAF Z;  1HNW O;  1I5X A;  5IYD O;  5DN6 G;  1B3Q A;  3ZHR A;  4D7S A;  1NS1 A;  1EFR G;  3ZHT A;  4LC1 A;  4DK1 A;  4I0X A;  3QNE A;  1AJN A;  1JJO A;  2CDY A;  4H44 B;  4IIJ A;  4B3M B;  1N36 B;  2GBO A;  3ZHV A;  2LW1 A;  4I50 A;  3CMA V;  4X1I A;  4W4K A;  2ZE7 A;  4CZZ A;  1K8A W;  4LFB O;  2LP7 A;  1YIT V;  3ASN C;  4WCE V;  4O4J B;  1VQ8 V;  3WB1 A;  4UCS A;  1AJQ A;  5EIB C;  4OGQ B;  2NLJ C;  1SRY A;  3T2M A;  4DUZ O;  2JK5 C;  4GLX A;  1IBL B;  4JAS A;  3AG2 C;  2NR5 A;  3E86 A;  4U3J A;  2XAQ A;  1DLB A;  1THZ A;  1SQP H;  1GM7 A;  3ZRV A;  1PL4 A;  1GN2 A;  1AR4 A;  1IXM A;  4ABM A;  1FXK C;  1VF7 A;  1DGS A;  5L3C A;  2P67 A;  4IGG A;  3AG1 C;  3R65 A;  4YHH O;  4NXN O;  1HWY A;  2B5U A;  2ZR2 A;  3SJA C;  1MSW D;  1M5I A;  3K0G A;  1G4Y B;  4DR2 O;  4LF8 O;  1NTZ H;  5CB4 B;  1PL0 A;  2KG7 A;  2XAG A;  4X65 O;  3A0B Z;  4LFC B;  4TUY B;  1K4D C;  4LH6 A;  3JCU Z;  3HR0 A;  4JI6 O;  2A79 B;  1Z2G A;  2GDS A;  4O4J A;  4DYL A;  2VWJ A;  3RYF A;  1WA8 B;  1NU1 H;  3DC5 A;  1ORQ C;  2PI5 A;  4LFC O;  2ZCE A;  2ZDI C;  4EB6 B;  5BMV B;  1L8D A;  3X2Q B;  5E1A C;  2FTK A;  2ZIN A;  2JS3 A;  3KCX A;  1K33 A;  5CA1 B;  3CC7 V;  1ZLZ A;  5B3S B;  1P7B A;  1I0H A;  1L0L H;  4Z1V A;  2YS8 A;  3AEI A;  3OM3 B;  3B40 A;  1R3K C;  1VQ4 V;  4A5U B;  4Q6G A;  3SPC A;  2WLH A;  1M57 B;  4TUY A;  3DGE A;  2F23 A;  2QKS A;  5JCO C;  2UUB B;  4G28 B;  5IYZ B;  5H2F Z;  3T1H O;  2UXC O;  5LP6 A;  2IJH A;  2Q7G A;  3RVY A;  3UKM A;  1SQG A;  3AG4 B;  1S5L Z;  4PA9 A;  3ASO B;  2QE7 G;  2PGG A;  3FB5 C;  1L1F A;  4C7U A;  4U7N A;  1FJG O;  5HFM A;  3OUS A;  2FML A;  3A0H Z;  1LUV A;  1NTM H;  5FPO A;  1YSC A;  3IAY A;  2BOB C;  5LA6 A;  5J2T B;  4IYH A;  4KXR A;  4DW1 A;  3OTO B;  1YF2 A;  4JI1 O;  2CTP A;  1EBO A;  3GWK C;  3JCZ A;  4J41 A;  5KMG B;  3UO2 A;  2XUM A;  3E8F A;  3H1J H;  3ICX A;  4CH3 A;  3EHB B;  3VBB A;  2WLN A;  5IYZ A;  1A32 A;  1SQQ H;  2EIK C;  1MAB G;  4UCU A;  2NN4 A;  1TVK B;  4O4L B;  1HW7 A;  3L9D A;  4GX5 A;  1H38 A;  3P32 A;  2WA4 A;  4GKK O;  4IL6 Z;  3ZBH A;  4WBN B;  4YJ2 B;  1NKD A;  1DTO A;  3ZRX A;  2V7Q G;  1URF A;  1M4U A;  3HPL C;  3B09 A;  1M93 A;  4Q20 A;  5CA0 B;  1HNZ B;  4ASU G;  5LMN O;  1CPY A;  1XEQ A;  2QTS A;  4MVO A;  4UUJ C;  2QJ1 A;  4TV9 B;  2ZM6 B;  3W7X A;  1H2G A;  2CH7 A;  3OFN G;  3CEI A;  2AW9 A;  3LSU A;  4JI8 O;  4UVB A;  5JQG A;  1KC8 W;  3BY6 A;  1ZL8 A;  1ZL8 B;  4PDM A;  1XDC A;  3CB2 A;  5LMU B;  1HR0 O;  1OCO B;  4LFB B;  1M56 C;  2OT5 A;  5FPR A;  3JAK A;  4OX9 O;  1VF6 A;  2LW7 A;  5DED A;  3WU2 Z;  3ZHS A;  4FLX A;  1JFF A;  4L87 A;  2E5L B;  2QWN B;  3RYH A;  5L3D A;  1H8E G;  1G1X B;  4ZI7 B;  3KKY A;  1NH2 B;  1EZJ A;  1AJP A;  4YJ2 A;  1H8H G;  3MHH C;  3CSX A;  2H94 A;  3T4Z A;  1OCZ B;  5EIB D;  5L3E A;  4O2B A;  1V9P A;  1H2K A;  2YIB A;  4AI8 A;  4LF4 B;  3E8G A;  2RQ6 A;  2X7R B;  4I5S A;  5K1P A;  1AIL A;  2QGN A;  2V4D A;  4G27 B;  4MW3 A;  3MDS A;  1Y76 B;  4DV1 B;  5JQG B;  3ZN0 A;  2QKC A;  4XDL A;  4B3M O;  4X8A A;  5B66 Z;  1HNX O;  3W7S A;  3ASN B;  1SF9 A;  4FFB A;  3AG3 B;  3NXS A;  4PA7 A;  1GM9 A;  4MS2 A;  3N2G B;  4QPJ A;  1AI6 A;  3HKC A;  2QR4 A;  1WB7 A;  3ABL C;  4LBE C;  2WLJ A;  4I50 B;  5IYB O;  1HP8 A;  1R3L C;  3CYO A;  3FB8 C;  4IHJ A;  4IHJ B;  4ZIB A;  1GH6 A;  4JV5 B;  3MHS C;  2XND G;  3L72 H;  3CS5 A;  1GK9 A;  2ZE5 A;  4D6T H;  3QO7 A;  4P30 A;  5F2V O;  3DXR A;  4NR1 A;  1I5Y A;  3OR6 C;  4X20 B;  1XNR B;  1I94 B;  1WB8 A;  4FJC C;  4NTX A;  5IE9 A;  4WFE A;  4YXW G;  1GN3 A;  5IJ0 A;  4LF5 O;  1S72 V;  4CBC A;  2RJZ A;  1IX9 A;  1RSO B;  2YIC A;  1XHX A;  4B3T B;  1U97 A;  1N34 B;  1UJW B;  1FFX A;  1K9M W;  5BZB A;  3ABK C;  2VRZ A;  2Z0A A;  2YIA A;  4DR3 O;  4TQD A;  3APQ A;  3T1Y O;  3K0D A;  5JCO A;  4B7E A;  5DM6 V;  2RNB A;  4FVM A;  3OR7 C;  1XL4 A;  3CRA A;  1KKD A;  3ETQ A;  2E3C A;  4JI4 O;  4U7O A;  1W0J G;  4DR2 B;  5JVD B;  1SKV A;  4BR6 A;  4JF3 A;  5IJ9 B;  1BL8 A;  2KQX A;  3EXA A;  1Z5V A;  4PA6 A;  4DR1 O;  4LWS A;  1AI5 A;  3TGU H;  4X64 B;  2OCH A;  3E22 B;  3CXH F;  1V54 B;  4PV1 B;  4JI7 O;  4GCZ A;  2X0L A;  3JAS A;  4PDV A;  1JVM A;  2WA3 A;  1BQZ A;  1SQF A;  2HKO A;  3G6E V;  2EIL C;  4OX9 B;  3U0Z A;  2Y0I A;  1G8M A;  1VQP V;  3FYI B;  1HDJ A;  2A3Q A;  4HZ3 A;  2UXD B;  2WAM A;  4RAI A;  3ZMV A;  2NNU A;  1K34 A;  5H5N A;  5L3F A;  3M99 B;  2UUA O;  5B1B C;  1OJH A;  3CD6 V;  2VS0 A;  3CXC U;  1N32 B;  3S3W A;  2Q9L A;  3K79 A;  2IJJ A;  4LNU A;  5JJJ B;  2DYS C;  2YC0 A;  2P7T C;  4PI0 A;  5IY5 C;  2M7W A;  4X88 A;  2GHY A;  4WFF A;  3OUF A;  2WWW A;  1BE3 H;  3K03 A;  3LSS A;  1ZWI C;  2F66 C;  1M1K W;  1VF5 B;  2P4K A;  5KUM A;  2JGU A;  2Q8V A;  4JI0 B;  4JI5 O;  4KL1 A;  4QPK A;  3KZI Z;  2DYR C;  2LO1 A;  2UUC O;  4AQY O;  1JPX A;  3VQV A;  4IIJ B;  4O4L A;  2LFR A;  4ZI7 A;  1JQ0 A;  4OPA A;  3SYO A;  1YIJ V;  4O2A A;  2ZXW C;  4CC6 A;  2ZE6 A;  1R6K A;  2FL4 A;  3D36 C;  3JD0 A;  4DR6 B;  4JPR A;  5FNV B;  4FLT A;  3JAL B;  3K06 A;  2ZNJ A;  1GRJ A;  3JAL A;  3W7U A;  1K5Q A;  1WPB A;  2ETN A;  3K5N A;  5KHJ A;  2WLK A;  2M6Y A;  2UUC B;  4CS2 A;  2BCC H;  1WAZ A;  1XUQ A;  1SET A;  4MVR A;  3D36 A;  3RYC B;  5EC1 C;  3TET A;  2DJV A;  2UU9 O;  1GAX A;  4GX2 A;  1BHB A;  2P06 A;  4EFE A;  2P5O A;  4LF6 B;  2Y69 C;  1R6N A;  2Y4U A;  2HP8 A;  5JJN B;  5KX5 A;  5IT9 N;  4MSW C;  4DV3 B;  1F4N A;  1HNZ O;  1V55 B;  1WNS A;  2UXB B;  2DN9 A;  1Q8I A;  3GVM A;  5CB4 A;  1GKF A;  2L35 A;  3LSQ A;  1MSD A;  4DR5 B;  5K1X A;  4DV7 O;  1SQB H;  4YJ3 A;  1FXV A;  3J81 N;  4DV6 B;  1K3E A;  2PF4 E;  2JIZ G;  1N33 O;  1VP7 A;  3K9S A;  3K9A A;  1Q43 A;  1QBZ A;  2OYQ A;  2HJF C;  1YHQ V;  3SYP A;  4BAY A;  4BWA A;  5BMV A;  3K5O A;  4YY3 B;  2AGA A;  2QM7 A;  3K5M A;  1HNW B;  4H0L B;  3CCU V;  3OTO O;  3OT7 A;  3HKD B;  1PKX A;  3H1H H;  2OIG A;  3U11 A;  1NJI W;  1K7D A;  3RYH B;  1HR0 B;  4B3T O;  1KBH A;  2W6I G;  1EN5 A;  1AP6 A;  3FAV B;  5JVD A;  3JAT A;  1AI7 A;  1ROP A;  2KG7 B;  1FPO A;  2A0L A;  5C8Y B;  1XRE A;  3WB0 A;  4BW5 A;  2VQF O;  2F95 B;  1J95 A;  1Q3E A;  4R8C A;  1EZV H;  4MTX A;  5GON A;  4K3A A;  2ZXW B;  1QVG U;  1FXK B;  4NXM B;  4TV8 B;  3STL C;  3ABL B;  4JYA B;  4JYA O;  5CMU A;  2Z3Y A;  4FIP C;  3TXS A;  2GUZ A;  2R9R B;  4FLY A;  2RN9 A;  4UCV A;  1FYJ A;  5LGU A;  2C2A A;  1RP3 B;  2ZIO A;  3GWO A;  3OMA B;  4FFK A;  1LUW A;  1GN6 A;  3TXQ A;  3G80 A;  2Q69 A;  3OAA G;  1CXZ B;  1M90 W;  4JI7 B;  1KMI Z;  3STZ C;  5LL6 Y;  2QKA A;  3HKC B;  4JTA B;  4F4L A;  3ABM B;  3UM7 A;  3H1L H;  3D3Q A;  3BAB A;  3DXR B;  1AB3 A;  1SS3 A;  2E74 B;  4EEQ A;  4HBN A;  1YZB A;  3RGB A;  1YI2 V;  3ETE A;  2WLM A;  4FLV A;  3SR2 C;  4O2B B;  5LP6 B;  4O4I B;  4O4I A;  1NVP B;  4X1K A;  4LF9 O;  2ZR3 A;  2JS5 A;  4DR6 O;  1ZUQ A;  1CP9 A;  3GB7 C;  5IYC O;  3IC7 A;  1GO3 F;  4J9Y B;  1KKC A;  3CRR A;  4L8J A;  3JSN A;  1NZ6 A;  1Q81 W;  4TV8 A;  1KU9 A;  2YUA A;  3MD0 A;  2FYU H;  1ENV A;  4GX0 A;  4PJ0 Z;  3H01 A;  1QCE A;  1IVS A;  3WB2 A;  2K1E A;  5LBQ A;  4LH7 A;  1X4T A;  5EBW C;  1XNR O;  4UVA A;  4JYY A;  2ILM A;  3S3X A;  1M56 B;  2YEV B;  4DV0 B;  2VQE O;  5B1O A;  2Q73 A;  3UO3 A;  1BS3 A;  2HLD G;  3RYC A;  1JX9 A;  4LWS B;  4DUZ B;  1XQ8 A;  1CEZ A;  3THO A;  5H6R A;  2PUS A;  3HB3 B;  5B1A B;  4JYB A;  3IJ4 A;  1PD3 A;  1K97 A;  4I55 B;  3CCR V;  2EIJ B;  2PYL A;  5A9G A;  4XDK A;  2R9A A;  1YEW A;  1TGO A;  2DYS B;  4DRX A;  3ZIA G;  4YY3 O;  4B7K A;  2L6L A;  4GKJ B;  3SYA A;  4LF4 O;  1FAF A;  3CCL V;  3RYI A;  3CRM A;  4DV4 O;  4GUN A;  3AK2 A;  3SPI A;  3LDE A;  4ZBM A;  4GZR B;  4X9Q A;  1Q6U A;  1BSM A;  2EIN B;  2OCC C;  3DC6 A;  2ZIM A;  2DMX A;  2PTM A;  3N27 A;  4NVP A;  1S0V A;  3CCM V;  1Q6I A;  1QR8 A;  3JAM N;  2CK3 G;  1JJ2 U;  1PPJ H;  3O65 A;  4X62 B;  2OWO A;  1D5N A;  1ZSP A;  4FFB B;  4OXS A;  2EZP A;  2E5L O;  1FJG B;  3J7A U;  1BHA A;  1COW G;  4DR4 O;  1IBM O;  2P6J A;  2W0X A;  4X1I B;  1S77 D;  3FAV A;  3ZMT A;  2UXB O;  3CWB H;  4DR1 B;  3G4S V;  1Y74 A;  1Y74 B;  4X1Y A;  2X6B A;  1VQ9 V;  3BHP A;  1F51 A;  3CP1 A;  5LP6 C;  3JD4 A;  1SQX H;  5LOV B;  3JAR A;  2IH1 C;  2VQE B;  4CS3 A;  1RPO A;  5B1N A;  2IBZ H;  2IJI A;  3OMN B;  2ZNI A;  5GW7 A;  3EFF K;  1RM1 C;  2ZT9 B;  3UT5 B;  4K0K O;  1XNQ O;  1B6Q A;  2DQ3 A;  1KD1 W;  5D5Q A;  4BW9 A;  1GTO A;  1VQ5 V;  3B77 A;  2JEU A;  1D2D A;  3JD1 A;  2YXH A;  2F4V B;  4DR7 O;  1B04 A;  3VOU A;  3SJQ C;  3CCQ V;  3E83 A;  4PA3 A;  2OTJ V;  2F93 B;  4F6E A;  1AI4 A;  1F23 A;  4I0X B;  1N33 B;  5AG2 A;  4UCO A;  4WFA V;  5KHH A;  2Y48 A;  2XAS A;  1VQN V;  4MVZ A;  3QO5 A;  4FLW A;  3BRC A;  1QU7 A;  4NB5 A;  3AG2 B;  1QLE B;  3RVZ A;  1QLN A;  5B1A C;  2IU3 A;  2D3O W;  1TAE A;  4PDL A;  4EFB A;  1VQ7 V;  5J2U A;  5GTI Z;  2WSS G;  3AK3 A;  4GX1 A;  3AG3 C;  4WF9 V;  1BGY H;  3K58 A;  1RSO A;  4GYC B;  4NTW A;  1KEC A;  3PJS K;  2ATK C;  2IJK A;  1MNG A;  2W6J G;  2A06 H;  2BTQ A;  2WPD G;  1XBL A;  4DXW A;  3D8C A;  4FMT A;  3O9O A;  4G2K A;  1K92 A;  1E1R G;  2EIM C;  1PNL A;  2CGN A;  4TT3 G;  4I7Z B;  1NBM G;  1J5E O;  2RDC A;  4R6Z A;  2PY5 A;  3ZED A;  3CRQ A;  1XIL A;  3ABU A;  1OCO C;  4JV5 O;  5LMU O;  5EBM C;  4W4L A;  3SJC C;  4DV2 B;  5LHG A;  1Q5O A;  1Y4M A;  2IM9 A;  2HR3 A;  4H13 B;  1R3I C;  3G6B A;  5KAI Z;  2EJR A;  4B3R B;  1VQK V;  2DQ0 A;  4X20 A;  3SYC A;  3WG7 C;  1NI8 A;  3T1Y B;  4JI1 B;  4CS4 A;  5IWA B;  4I55 A;  4OPH A;  3ZMU A;  5IJ0 B;  3AG1 B;  3CCV V;  3B2E E;  2XAJ A;  1VIB A;  1Y76 A;  2EZO A;  5BXZ A;  4I4T B;  1K4C C;  1NR1 A;  2EBO A;  4B3R O;  1MG1 A;  2BE3 A;  3KCY A;  3OD4 A;  1YVW A;  2PZS A;  3FKS G;  1WPX A;  4TSF G;  1RM1 B;  4JI3 B;  1N36 O;  2QWO B;  1S76 D;  1N4C A;  4FLU A;  4RUF A;  1KUQ A;  4H37 A;  4RWU A;  4PDR A;  3UCS C;  4DR5 O;  1W0K G;  4Z1M G;  1AVM A;  5CN0 A;  5KA6 A;  5IJ9 A;  5KMG A;  1OCR B;  3FD9 A;  3X2Q C;  1NVP D;  3H1K H;  2ZE8 A;  5HFL A;  4JYC A;  3SGI A;  5CA3 A;  4B08 A;  2QWQ B;  4DUY B;  3HKE A;  4HNA A;  1US6 A;  4F6R A;  2VQF B;  3RYF B;  1R3J C;  1QQC A;  1NTK H;  4J11 A;  1JOY A;  1KP2 A;  3ZRS A;  4EB6 A;  4DW0 A;  4YJ3 B;  4LP8 A;  3ML0 A;  1WA8 A;  4FLZ A;  1YCI A;  4BIO A;  3IFX A;  4I9Q A;  2X6A A;  1FXH A;  2N74 A;  2CH7 B;  1LNQ A;  1XL6 A;  5H6Q A;  2GV9 A;  3W7T A;  4J9Z B;  1XMO B;  1Q90 D;  3K59 A;  4K8Z A;  1N0J A;  2HHH O;  1SES A;  2HFE C;  4CH6 A;  5JH7 A;  3D3I A;  2QTO A;  3F7Y C;  4ICG A;  1F7Y A;  4LCU C;  2LGQ A;  4I9W A;  4PEL A;  2IU0 A;  3BEH A;  5JJE B;  1JFF B;  2A7W A;  3QVN A;  1VAR A;  2AXT Z;  1H2M A;  4JAV A;  3APO A;  2H8P C;  2UUB O;  1DF5 A;  1UPG A;  4N23 A;  4IYI A;  4KFM A;  1QVF U;  3I56 V;  4O2A B;  1YXB A;  2ZKO A;  3RYI B;  3ABT A;  4XDJ A;  4FM2 A;  2Y0P A;  3BPZ A;  2D2C B;  3K04 A;  3WG7 B;  3B4S A;  5J2U B;  5EC2 C;  5LXT A;  2Q4P A;  5IWA O;  3AG7 A;  4LF6 O;  1G6U A;  5J2T A;  4TV9 A;  3CCS V;  1OCC B;  4JI3 O;  3BVO A;  2ADP A;  1K5S A;  4PD4 F;  5LA6 B;  3ABK B;  5EYP B;  3L70 H;  4MTG A;  3WFV A;  1MA1 A;  2ZM6 O;  3A8T A;  1QNM A;  1S3J A;  4X66 O;  3ZRW B;  2CTR A;  3ZRW A;  5KHG A;  3B8M A;  3T1H B;  3TCU A;  2EX3 A;  3SDL A;  5GTH Z;  1M9N A;  3AK1 A;  3M7M X;  4ZOL B;  3ABM C;  4KP4 A;  2YID A;  4HYO A;  4DO2 A;  3LUT B;  4JI2 B;  4YIO A;  1BMF G;  4WFH A;  2N04 A;  3Q4H A;  2QA4 V;  3Q4H B;  1OCR C;  1IBK O;  3DTU B;  4FZ0 A;  1MMM A;  3ZHQ A;  3F5W C;  4X1Y B;  2BTO A;  3E89 A;  2G38 A;  5FLX N;  3B8N A;  3ASO C;  1TUB A;  2KSD A;  4WFG A;  1FXK A;  2QWR B;  3L73 H;  4JI0 O;  1J5E B;  4K0K B;  1SA0 B;  3I55 V;  4TOI A;  4BIU A;  4UFZ A;  5DEC A;  3N2K B;  3T4D A;  4JI5 B;  2UXX A;  2X6C A;  3T1C A;  1QR9 A;  4J80 A;  2QDO A;  5KA5 A;  3FFQ A;  3OGI B;  3JD2 A;  2B1G A;  4MTO A;  2AZ0 A;  5EZY B;  4ZHQ A;  5J9P C;  3OMI B;  1P7G A;  4JAU A;  1YJW V;  1Y66 A;  1AP5 A;  4LF8 B;  2BSK B;  4GKK B;  2JGD A;  5ITZ A;  3VQY A;  4UV8 A;  4J10 A;  4JTC B;  5LHH A;  3BA9 A;  5BY1 A;  4YHH B;  4NXM O;  5BR8 O;  4CH5 A;  3FYE B;  1R73 A;  5L3B A;  1BZK A;  1XNQ B;  4PA4 A;  1SER A;  3E35 A;  2HVK C;  1O9H A;  1U96 A;  5L3G A;  2V1D A;  2AHY A;  3JD3 A;  1I7F A;  2P90 A;  5CBH A;  3HKE B;  1BCC H;  1XHZ A;  2YIB D;  2H3O A;  2E75 B;  1PNM A;  2ITD C;  3JSL A;  4RO2 A;  5H9C A;  4DRX B;  2VWK A;  4X1K B;  4K8X A;  2Y4T A;  5KHI A;  2GTA A;  4FM0 A;  2EIN C;  3LDC A;  3N2K A;  1VMG A;  2LQT A;  1DF4 A;  1K73 W;  3LNM B;  3BA8 A;  4MVM A;  1M57 C;  2BTQ B;  1SQV H;  1YDX A;  4HAM A;  1JMK C;  3RWR D;  2YDE A;  3CCJ V;  1EN4 A;  1VEW A;  2ODM A;  2HHH B;  3JYC A;  2WLI B;  5LGT A;  4X65 B;  1JA8 A;  4FK5 C;  2EIL B;  2FKX A;  2WLL A;  4MT8 A;  3ZJZ A;  3ZN1 A;  2R70 A;  4UV9 A;  2GTS A;  2P4V A;  1SZX A;  2MW2 B;  5IDJ A;  4RUE A;  4J7K A;  3H1I H;  4JZG A;  4ZKI A;  2KB1 A;  2K9P A;  3CC2 V;  1H2S B;  3CPW U;  2Q68 A;  3K08 A;  4NYK A;  4RQE A;  4FZ1 A;  2DW4 A;  1E79 G;  1I94 O;  4I4T A;  3RFR A;  3RT3 C;  2CAZ C;  4DV6 O;  3CME V;  2XT9 A;  4N21 A;  4EKW A;  2Q6A A;  1PV0 A;  1P49 A;  2JEX A;  4QNH B;  3C3T A;  3LNN A;  4MVU A;  4TQF A;  1D5A A;  3VQW A;  2HJD A;  2IH3 C;  4U3F H;  1HNX B;  2F1M A;  4J7Z A;  5JH7 B;  4JI4 B;  2OTL V;  1VF6 C;  1JCH A;  1GMG A;  1Q86 W;  2JDI G;  4E4E A;  3BCC H;  3A2F A;  1RPR A;  3U10 A;  4HNA B;  4NKG B;  2LGW A;  1IXB A;  1QLE C;  2CE4 A;  3EVK A;  3E22 A;  5LGN A;  2Q7H A;  3R66 A;  4QJF B;  1XI1 A;  1Y67 A;  2YXL A;  4MVS A;  1RFY A;  2YI9 A;  2QM4 A;  1WLE A;  3NR7 A;  2Q7E A;  4LF5 B;  4O4H B;  4J7J A;  2A9H A;  4LF9 B;  4K35 A;  3E2E A;  4DV2 O;  4H33 A;  2LJ2 A;  4DV4 B;  1WN7 A;  5EK0 A;  4AIL C;  2EIJ C;  1Y6X A;  4B3S O;  1IBL O;  2ARH A;  5BR8 B;  1YTF D;  3CHX A;  5KLV H;  3OEE G;  4KHP B;  2RCV A;  3QG5 A;  2FB5 A;  4JI8 B;  4ZHQ B;  1EM1 A;  2HEP A;  3FB6 C;  4X66 B;  2Q0O C;  3ZX6 A;  5B3S C;  1Q82 W;  2F43 G;  2ITC C;  5EBL C;  1TUE B;  1IBM B;  1XOU A;  5B5E Z;  3HKD A;  4IT5 A;  5LMN B;  1Z5W A;  5KUK A;  5KX5 B;  3OW2 U;  1UFI A;  4D7T A;  1S5H C;  3HKB A;  5LHI A;  1OCC C;  3F7V C;  1OV9 A;  3OE7 G;  3TK1 A;  2EUL A;  5E79 Z;  1WJZ A;  1ZX3 A;  2PI4 A;  4R50 A;  1VQ6 V;  2HVJ C;  2XHB A;  3E8B A;  3JAR B;  1R6T A;  1T5E A;  4LF7 B;  3F5T A;  1YJ9 V;  2EJ7 A;  5LYJ B;  5LYJ A;  1KP3 A;  3CJH A;  1KQS U;  4YIP A;  3UT5 A;  2YI8 A;  3G67 A;  4P9O A;  3OGC C;  1FFX B;  2Q67 A;  4GT1 A;  3ZMS A;  4KUM A;  4UB8 Z;  1AR5 A;  3PN1 A;  4UCR A;  3E8H A;  1KB9 F;  4WFB V;  3JAW A;  2WLI A;  3JAW B;  3DSQ A;  4UXN A;  4CH4 A;  3CC4 V;  2UXN A;  4DV3 O;  3QO8 A;  2AZ2 A;  1R1B A;  3K57 A;  2EIK B;  5TIS Z;  1IDS A;  3IC9 A;  3QF7 A;  4WBN A;  1N8R W;  1S5J A;  3RBZ A;  2JJ2 G;  2UXC B;  4KHP O;  1GN4 A;  1KYO F;  2KKW A;  2JVD A;  3SYQ A;  2O57 A;  5GON B;  1ARO P;  4MTF A;  5D5P A;  3CCE V;  4DV5 O;  1FD9 A;  3FX7 A;  4DV0 O;  1PP9 H;  2QWP B;  1H2L A;  4JTD B;  3RN4 A;  1Q7Y W;  1OHH G;  2DE0 X;  2YSU B;  3SJB C;  1DK1 A;  4MVQ A;  3TJT A;  1NR7 A;  2DWD C;  1NH2 D;  4JZ2 A;  2CGO A;  4X62 O;  2QM8 A;  4CC5 A;  2XTA A;  3JAK B;  4ZOL A;  5CA1 A;  4TWK A;  1SZT A;  4GKJ O;  1W59 A;  3W7W A;  2WLL B;  2W0F C;  1TA8 A;  2BSK A;  4DV7 B;  3JAT B;  3SPH A;  3UQ8 A;  3H9V A;  1FKA O;  4PHZ A;  1B06 A;  2XOK G;  2Q5Z A; 
#chains in the Genus database with same CATH homology
 3UO3 A;  1BQ0 A;  2M6Y A;  2KQX A;  2YUA A;  2QWR B;  2PF4 E;  2L6L A;  2QWN B;  3APQ A;  2CTQ A;  3BVO A;  1FAF A;  2DN9 A;  2OCH A;  2QSA A;  4J80 A;  2N04 A;  3UO2 A;  2GUZ B;  1WJZ A;  2QWO B;  2CTR A;  2QWQ B;  2CTW A;  1N4C A;  2Y4T A;  2N05 A;  2QWP B;  1GH6 A;  2LO1 A;  1FPO A;  2LGW A;  1HDJ A;  2CUG A;  3AG7 A;  1BQZ A;  2GUZ A;  1XBL A;  2DMX A;  3APO A;  1IUR A;  4J7Z A;  2Y4U A;  2YS8 A;  4RWU A;  4IT5 A;  1NZ6 A;  3UCS C;  2EJ7 A;  2CTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...