1XBLA

Nmr structure of the j-domain (residues 2-76) in the escherichia coli n-terminal fragment (residues 2-108) of the molecular chaperone dnaj, 20 structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNAJ
publication title NMR structure of the J-domain and the Gly/Phe-rich region of the Escherichia coli DnaJ chaperone.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1996-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1xblA00
1BQ0A 3APOA 2KQXA 1IURA 2GUZB 2CTWA 2GUZA 2YUAA 2Y4TA 2CTPA 2CTRA 2PF4E 2LO1A 3BVOA 2DN9A 1BQZA 2Y4UA 2CTQA 4IT5A 2QWRB 4J7ZA 2LGWA 1GH6A 2QWOB 2QWNB 4RWUA 3UO3A 2QWQB 2OCHA 2EJ7A 1FAFA 3AG7A 2N04A 4J80A 3UO2A 1NZ6A 1FPOA 3APQA 3UCSC 2DMXA 2QWPB 2YS8A 2N05A 1HDJA 1XBLA 2QSAA 2L6LA 1N4CA 1WJZA 2M6YA 2CUGA
chains in the Genus database with same CATH superfamily
1KU9A 1HNWO 3BHPA 1M5IA 2Q5ZA 2AW9A 4GKKO 2V1DA 4JAAA 4FK5C 4FMTA 5J2TB 1S5JA 3QNEA 3CRRA 4N21A 3RYCA 4JI4O 1K73W 1B6QA 4Z2WA 4EKWA 5EC1C 4O4JB 4J41A 4U3JB 4CH4A 2XTAA 5IJ0A 4UCOA 5LMNO 1QR8A 4WBNB 4JI5B 4EFEA 5JCOA 1ZWIC 1V9PA 1GO3F 1YITV 2W0FC 1S0VA 1W0KG 3QVNA 4K3AA 3AG1B 1ZX3A 2AGAA 4DR3O 1AILA 3BFRA 2EILB 2Y48A 1WP7A 4JF3A 5CA0B 3ASNB 2P6JA 4ZOLB 5LP6B 4QE7A 3ETQA 3E8FA 2Q7HA 3UKMA 3DC5A 3HKBB 4FZ1A 4DUZO 1US6A 3SJBC 4GZRB 1WN7A 3ICXA 2BE3A 1H8EG 1B04A 3SYOA 2K9PA 3UO2A 1BGYH 2BTQA 3RYHB 3ZMUA 5JVDB 1IDSA 3E8BA 3WB2A 3ZRVA 4WFBV 3RYIA 1YTFD 1FXKA 1J95A 1YIJV 5LYJB 4O2AA 3M7MX 2AHYA 1SESA 2Y4TA 4K0KO 1OCRB 4GCZA 1VF6A 1MMMA 1H2LA 4J7ZA 4DV2O 1VMGA 2N04A 1Z5VA 2Q68A 4LFCO 3BA9A 4O2BB 1N36O 2HLDG 2Q8VA 1HWYA 2EIKC 2Q0OC 1QR9A 2YXLA 5A2QN 4LH7A 1A32A 4B7EA 1Z5WA 3UT5A 2HP8A 4FLYA 4DYLA 2DYSB 3QO7A 4JAUA 3BEHA 2GTSA 3B40A 3H9VA 4RO2A 1D5NA 2ZE7A 2ZIMA 1I5XA 4DV1B 4JI1O 4PD4F 1PD3A 3Q4HB 2QSAA 3N2GB 4I5SA 3G80A 2FKXA 1WA8B 4FM1A 4PA9A 2IU0A 2ILMA 4WFFA 3A0BZ 2IH3C 1RSOA 2Q9LA 4R8CA 5IWAO 2CTPA 3U11A 1WP8A 4J9YB 1M9NA 2E5LB 1R3LC 1N33O 4JI8O 2UXCO 1XNQO 4O4HA 1I94B 1FYJA 1LUVA 1Q5OA 2AHZA 1XHXA 2ITDC 2YSUB 3CCUV 2BOBC 4FFKA 1NR1A 4ZI7B 2UXDB 1XOUA 4PA7A 2VWKA 4LFAB 2ARHA 3G71V 1XMQB 5LMUO 1SZXA 1BQZA 2JK5C 3JD3A 4TUYB 4JI3B 1Q8IA 2ATKC 2OTJV 4KUMA 3ZRWA 1XMOO 1Q82W 4LF6O 3FFQA 2XAFA 5AG2A 3JAWB 1CEZA 4PHZA 2F23A 4UV9A 4TT3G 1VF6C 3LDCA 1V54C 3S3XA 3FB6C 4KHPO 5B1OA 4X1IB 2CUGA 4QJFB 3CCJV 4LF9B 4DV4B 4PI2A 4IIJA 1N32B 3IC9A 4DR2B 1JFFA 2CDYA 1CXZB 2CTRA 3K5OA 4YJ3A 3OM3B 3JCUZ 4YJ2B 4CS2A 4B3MO 1NTKH 3CCEV 3RVZA 2F4VO 4I7ZB 1NS1A 1YEWA 4X1YB 4K35A 4LNUA 1BHBA 1VF7A 2WA4A 1XHZA 4ZHQB 4GUNA 2WLNA 4X64B 3JD0A 2AZ0A 1N34O 2LW1A 4MVSA 3THOA 3B8MA 5TISZ 1NTZH 4O4IA 4DUYO 5CA3A 5KA5A 2ITCC 5B1NA 3CXCU 2Y4UA 2EJRA 4LWSA 1FFXB 4J42A 3ETGA 1F7YA 5CMUA 2HKOA 2K1EA 1XL4A 2CH7A 2GDSA 4WFHA 2Q69A 3SYPA 2YC0A 4WFAV 1K4CC 4X62O 4I50B 2WLLA 2KKWA 2QKAA 3OTOB 2HJDA 5J2UB 1G8MA 3W7UA 5EYPB 1SA0A 1JJ2U 5H5NA 2HHHB 2JGDB 4TSFG 2EIKB 2QWQB 3ABUA 3JD4A 4MVQA 4DV6O 1QBZA 2BSKA 2EULA 3P3NA 4IHJB 1NKDA 1GN4A 2RN9A 2UXBB 4NVPA 3ZHVA 3ABTA 3NR7A 1YSCA 4P9PA 3WB1A 3W7TA 1QCEA 1MG1A 1EZVH 5C8YB 3ETEA 1AI6A 1QLNA 1MNGA 2F95B 3RYCB 2HJFC 2O57A 4RUEA 4JAVA 4ICGA 2EX3A 2UXNA 5IJ0B 2Q6AA 4NKGB 4JI5O 2P4VA 2RDCA 1ZL8B 3CHXA 3WG7C 3EHBB 2A06H 2R9RB 1GN3A 5BR8B 4F6EA 4Q20A 2FTKA 1XNRB 1AVMA 1TA8A 1I08A 3AG7A 1NZ6A 5JH7A 1THZA 2XHBA 2ZKOA 2ZR2A 5B3SC 3E89A 4RQFA 1HNZO 3BY6A 1M1KW 2QKCA 2P67A 2Q73A 3CCRV 1FFTB 4ZBMA 1SC5B 2LGWA 1AP5A 1PKXA 2UUCB 2BTQB 2ZXWC 4DR5B 2CK3G 2VRZA 2DMXA 3OUFA 3RYIB 1S77D 4KXRA 2LFRA 4B3RB 4O2AB 1AJQA 3CRMA 3HB3B 2GUZB 3VQYA 3N2KB 4DW1A 4CC5A 1H2SB 1Y4MA 1V54B 1QU7A 3JASA 2DYRB 3JCZA 3ABKC 2JEUA 2JGUA 1IBKO 2HVJC 2X7RB 1GN6A 1YTFB 4QIWF 3ZHUA 4GX1A 2WAMA 3BAAA 1YJWV 1DK1A 2UUAB 2QTSA 5BZBA 3G4SV 3SDLA 4OX9B 4JYAO 2Q0AA 1K8AW 2E75B 4OPAA 4BWAA 5B1AC 3CC2V 3BRCA 1NU1H 3T1HB 3F5WC 2PI4A 1NI8A 2YS8A 2R9AA 4YIOA 4W4LA 4LF4B 2JS5A 2DWDC 3ASOC 2QEXV 2PYLA 3ZBHA 1LUWA 3VQWA 3CMEV 1KD1W 3WB0A 5IYZA 4WFGA 3AK1A 2F66C 2E5LO 1R73A 1K97A 5CBHA 3E22A 3ZMZA 5CBGA 2HG5C 3L75H 5KMGA 4WFEA 1BT8A 3OR7C 2IJKA 5FLXN 4OPHA 4EFBA 1QVGU 2RMKB 3E8HA 1MA1A 1W0JG 3TJTA 4D7SA 1XMQO 1B06A 1G1XB 1GMGA 1RM1C 5GONB 1HNXO 4JI3O 2A7WA 4NXMB 3F7VC 2XNDG 3OMAB 2A0LA 1VEWA 3CE2A 4Z1MG 3JARA 5LGTA 2NNUA 3MDSA 1IXMA 2FYUH 4U7NA 4C7UA 2L35A 3AK3A 4X88A 4JPRA 2Z5UA 3K3WA 3AEIA 2JJ1G 4KP4A 2P5OA 3HKDA 3L74H 3OD4A 1Y67A 2OCHA 4DRXA 1PP9H 5LHHA 3F7YC 4EB6A 5GTHZ 4JYBA 1K34A 3A0RA 3MHSC 3K0GA 1LR1A 2L6LA 3FAVA 4IIJB 2UU9O 2QM8A 3ZRXA 4DR6B 3FB8C 1K7DA 3BVOA 5FNVA 3JALB 4WCEV 4JV5B 3O65A 1SETA 1BMFG 2EJ7A 4PELA 4FM2A 1ZLZA 1AJPA 1VQ8V 4NR1A 5H9CA 3E86A 4X66O 2EZOA 5KHJA 1IVSA 3LDEA 1SQQH 3CC4V 4J11A 1N8RW 1MZEA 1SQGA 4BIUA 2OCCC 1BE3H 1AROP 5KX5B 4LWSB 2C2AA 4FLZA 1S5HC 3AG3C 3QO5A 3OT7A 4NTXA 3UCSC 1BSMA 1F4MA 1H2NA 4YHHB 4MVZA 3J81N 4FLXA 5GTIZ 4DV3O 2KG7B 5JQGA 1HDJA 2N74A 2AZ2A 3AG2B 5EZYA 3SJQC 1P84F 3CS5A 3ABKB 1PL0A 1K3EA 1RP3B 3L70H 3T4ZA 4DR1O 2QA4V 1PNMA 2HHHO 3A2FA 1OV9A 2F93B 2JRIA 3JYCA 4TWKA 1I0HA 1Q6UA 4I55A 4DV0B 3STLC 3UQ8A 2BSKB 3G6BA 2ZE6A 3RGBA 2UXBO 5L3EA 1XREA 1BHAA 4I0XB 2UUBO 3L9DA 3W7SA 5CA1A 1GAXA 1L0LH 1KUQA 3SPCA 3ABMC 4PDMA 5B1AB 4X65O 1TUBA 2WLIB 4FM0A 1M57C 2F43G 4LCUC 3ASOB 2UXXA 2M6YA 5B5EZ 1YJNV 3KKYA 5BR8O 4X20B 1TVKB 4F6RA 4HNAB 1XNRO 3ZS8C 4UCRA 2JS3A 2QWRB 3HKCA 3IGAC 2H94A 2YIAA 3CPWU 3ZHSA 5BMVA 2EIJC 2LP7A 1DF4A 1L0NH 3C90A 4E2LA 4MVOA 3T1YB 1RM1B 4GLXA 3ZEDA 1ROPA 3APOA 1GTOA 4L8JA 1UPGA 2VQEO 1EN6A 4K8XA 1K92A 4FFBA 4ZKIA 3VQXA 2UUCO 3CSXA 1VQPV 1NBMG 1JX9A 1IBMB 2D3OW 4R50A 2ZINA 4J80A 4MW8A 2Z3YA 2ZM6B 2XT9A 1LNQA 2Y0IA 4JYYA 4PDLA 3CD6V 3P3PA 4O4LA 1Q90D 3JATA 1N4CA 3KZIZ 5FPRA 1Q7YW 2DWEC 3LDDA 4GX5A 2OYQA 1SRYA 2ZT9B 4Q6GA 5IYBO 2XAHA 1Y6XA 4N23A 3B8NA 3ZHQA 4PA6A 3JAKA 1U97A 5JWPA 1OCOC 2UUAO 1NR7A 2IH1C 4X1KA 1M56C 5B1BC 2DJVA 1VQ7V 5IYDO 4DO2A 2V4DA 3CCSV 3A8TA 4KFMA 2FL4A 2Q7GA 2H3OA 3R65A 5JCOC 1GH6A 3T1HO 2VQFO 1Q3EA 3AG4C 4TOIA 4B08A 5H6RA 5JJEB 2LQTA 4Z1VA 1D5AA 4HBNA 1VP7A 3GVMA 2OCCB 3ABLC 1N0NA 3OEHG 5IDJA 1EN4A 2KB1A 3AG3B 5LXTA 5FPOA 2GV9A 4MTOA 2Y0PA 4NB5A 2A3QA 1KQSU 2PY5A 5KMGB 1NH2B 4CZZA 3D3IA 1S76D 4J7JA 5B66Z 1M4UA 4P9OA 1Q86W 1FXKC 4NXMO 4JGSA 4FJCC 4J7KA 1H2MA 1KP3A 2DN9A 2JIZG 3K0DA 1L8DA 2EZPA 1R1BA 2YIBA 2OTLV 4E4EA 3JARB 3PN1A 5LOVB 1P7GA 3ABMB 2CGOA 3RBZA 4YY3B 1TGOA 3X2QC 4XDJA 1GK9A 1M57B 1NTMH 2ODMA 3C3SA 2XAJA 4MVMA 2CTQA 1F23A 4P30A 2IW5A 1FXVA 4FPPA 4DV7B 5IJ9B 1HR0O 1R6KA 3OMIB 4B3TB 4JI0B 3D36A 4TV9A 2QM7A 1KP2A 4ZIBA 4LF5O 2GTAA 3TGUH 2EIJB 2LJ2A 3RYFB 1YHQV 2BCCH 5LA6B 3HPLC 4RWUA 4CS4A 4JI7B 5F2VO 1K33A 3GWKC 3KG2A 2ADQB 3VQVA 1Y76B 4PA3A 5JJJB 1IBLB 1R6TA 3DSQA 4CBCA 3TXSA 3DXRA 3K04A 2XAQA 2DQ0A 3LSQA 4TV8B 1PV0A 2B1GA 2QKSA 3B09A 4I4TA 2YICA 1AR1B 4JTDB 1AR4A 1Q6HA 3CC7V 4LF8B 4DV5B 2ZIOA 1SQBH 1VIBA 2QTOA 1BCCH 2H8PC 5BXZA 1R3KC 1SQVH 2DW4A 1HNWB 5LHIA 3OGIB 1OCOB 4I55B 1E79G 4LC1A 5J2TA 4RAIA 4UCTA 1M56B 5B1BB 4JI4B 4PA4A 5KUKA 5H2FZ 1SQPH 2CE4A 4UV8A 4U3JA 3FB7C 2HVKC 4WBNA 1TUBB 5LMNB 3AG4B 1OCZC 5LGUA 3W7XA 1KKDA 3VOUA 5GW7A 4LFBB 3TXQA 3K03A 3ABLB 4DR3B 2PI5A 1VQNV 4H44B 5CA0A 5DM6V 3ZJZA 3K5NA 4ZOLA 5LP6A 3M8AA 5D5QA 5EC2C 3HKBA 3DC6A 3GB7C 2LGQA 1W2BU 3ZX6A 4DUZB 1JR9A 5ITZA 2IJJA 4GX0A 1JCHA 3I56V 5BMVB 4PI0A 2G38A 1SZTA 2A9HA 1IZ3A 3T1YO 3RYHA 3ZHRA 5JVDA 3LSUA 1AP6A 1FXKB 3OUSA 2YEVA 3OW2U 5KHIA 1NVPD 5LYJA 3B4SA 4JTCB 1IX9A 3R66A 2QJ1A 5IE9A 4MVRA 2WA3A 3SJAC 2EIMC 3B2EE 4OGQB 3SYQA 4DV2B 3DGEA 4I9QA 3X2QB 5E79Z 4FVMA 4O2BA 4U3FH 4LFCB 1N36B 2YI9A 1WPXA 3K9AA 1JQ0A 4DR7B 1HW7A 3UT5B 1QLEC 3K79A 1OCCC 1PNKA 5H6QA 1SS3A 5LL6Y 4FLWA 1JA8A 3JAMN 3K9SA 3JAKB 3ML0A 4DV1O 4CC6A 2X6AA 1DTOA 2F1MA 3FKSG 3IJ4A 4CH5A 3Q4HA 4JI1B 3N2GA 4X1KB 3WFVA 1X59A 1NH2D 4JI6B 1Q6IA 1RSOB 4FIPC 1I7FA 3BABA 2ADPA 1WLEA 4LF7B 3CCVV 3HKEA 1FJGB 4CH6A 3MD0A 5IWAB 1QVFU 5EBLC 3STZC 1PL4A 3SPJA 1I94O 1UJWB 4O4HB 2X6BA 2B9ZA 4CS3A 1N33B 1U96A 4JI8B 1XQ8A 1H38A 3O9OA 3KCYA 2UXCB 3B77A 1XNQB 3AG1C 2UXDO 3WU2Z 3FX7A 4LFAO 4UCUA 2YI8A 4BR6A 1AI5A 5HFLA 2GBOA 4TUYA 3RVYA 3ZRWB 2P90A 4MW3A 2NLJC 1J5EB 1XMOB 3I5DA 2R70A 1GRJA 1H8HG 1URFA 2P06A 1QNMA 2P4KA 3A0HZ 3CEIA 4MTXA 5EIBD 1PM9A 1OCRC 2OT5A 2IJIA 2YIDA 4KHPB 1R3IC 3OGCC 4YY3O 4LF9O 3MHHC 1OCZB 4DV4O 3WG7B 1VF5B 3W7WA 1N32O 4B3SB 4UVCA 4DR2O 1JFFB 1YZBA 4YJ3B 2WSSG 4DK0A 2RNBA 4H33A 2Z0AA 3RWRD 5CB4A 1YXBA 1CP9A 5CBFA 4YJ2A 5B3SB 1H2KA 1FKAO 1Y74A 4LNUB 4X1YA 3APQA 3D3QA 1ZSPA 3J80N 4JI0O 5KHGA 4D7TA 4UUJC 4ZHQA 1GN2A 4X64O 2CAZC 2WLHA 3UM7A 3P30A 1V55C 2GSMB 4DR4B 4UXNA 4O4IB 2YUAA 2ZXWB 3D8CA 5KAIZ 2LO1A 2YDEA 3KCXA 4DUYB 2XUMA 1JJOA 3LUTB 4MVUA 1ZUQA 3E35A 2CH7B 4IL6Z 4I50A 3OTOO 2WLLB 4D6TH 4BIZA 5J2UA 4NYKA 4J10A 2OIGA 1SA0B 1WPBA 5L3CA 4LF8O 1AJNA 2YXHA 2ZNIA 3ZHTA 5EBWC 4IHJA 1X4TA 1QLEB 3OAAG 2JEXA 3L73H 3GWOA 1OCCB 3TCUA 4XBFA 4ASUG 1Z2GA 1UFIA 2QM4A 2QDOA 1RPRA 1FS0G 2ZR3A 4A5UB 1BZKA 1KECA 1VQ4V 5C8YA 3FYEB 4CH3A 3LNMB 5K1XA 1I5YA 2CGNA 1O9GA 3CCLV 4QE9A 3IFXA 3CXHF 1YI2V 4AQYB 4FLVA 3LNNA 1VQKV 5HFMA 1E1RG 3K5MA 2LW7A 2WLMA 1ZL8A 3CJHA 4FLUA 5DEDA 2MW2B 4LFBO 2QWNB 2RJZA 2BTOA 5EIBC 1BL8A 5JH7B 4IYIA 3OTFA 2B5UA 4F4LA 2WWWA 4LH6A 4K8ZA 4LP8A 3T1CA 3EFFK 3VBBA 2KSDA 1HNZB 1JPXA 4OXSA 1T5EA 1Y66A 5ITZB 4KL1A 1SKVA 4DR5O 1YVWA 2BOCC 3CRCA 1O9HA 2DQ3A 2QWPB 4B3RO 1RPOA 1H2GA 4XDLA 3FB5C 2YEVB 1R3JC 3BPZA 3SR2C 1AB3A 1F51A 3ZN1A 2GUZA 1XEQA 3N2KA 1PPJH 3JASB 2PF4E 2IU3A 4EEQA 1WB7A 3QF7A 3SGIA 1OHHG 3CP1A 3H01A 4LBEC 4X8AA 1IBKB 4JYCA 4NTWA 1NVPB 2HFEC 1YDXA 4DR7O 2YXYA 1WJZA 4UVBA 4TQFA 3S3WA 4QGPA 2KQXA 5CN0A 4OX9O 4UCSA 4B7KA 3CWBH 3P32A 1N0JA 4JYAB 3OEEG 5L3FA 1DLBA 4HYOA 1XUQA 5IY5C 2OWOA 1V55B 1SQFA 3RT3C 4LF4O 4JI6O 2FB5A 2PZSA 1SF9A 4H37A 4LF7O 1NT2B 1FJGO 3ZCCA 3HKEB 5IYZB 4IYHA 1G6UA 2X0LA 1TAEA 1HP8A 2ZDIA 3H1JH 5L3BA 3E22B 2GHYA 5L3DA 2ZE5A 4NTYA 1VQ6V 1XILA 2YIBD 1K5SA 3QG5A 3JSNA 4ABMA 4RQEA 4FZ0A 3SPIA 1ENVA 3F5TA 4TQDA 5GONA 2E3CA 4G2KA 2XAGA 3ZMTA 1HNXB 2WPDG 4JASA 2WLKA 3UO3A 1SERA 4X9QA 1J5EO 3OE7G 4MTGA 1MABG 1S72V 2W0XA 2MK3A 1L1FA 2XOKG 1FXHA 1W59A 1BQ0A 5C93A 3K08A 2D2CB 2HEPA 1XL6A 3IC7A 2ZQMA 4JI2B 1IXBA 4IT5A 3HKDB 4DRXB 3IAYA 3CRQA 4DW0A 2V7QG 3H1LH 4EB6B 5EK0A 1NQTA 5LBQA 1B3QA 2DYRC 1MOFA 3N27A 1K4DC 4G28B 4B3SO 3E8GA 3FAVB 4DK1A 2R72A 1KB9F 3EXAA 1AR5A 1JVMA 4NXNB 4DR6O 2UU9B 3ZN0A 2M7WA 5L3GA 5IYCO 4JV5O 5CB4B 5FNVB 1VQOV 1YJ9V 3JALA 1Y74B 1YF2A 5LGNA 2XASA 5KLVH 5LHGA 3JD2A 5K1PA 2VS0A 4AI8A 5JJNB 2VWJA 4DR4O 1GKFA 3EVKA 4X66B 2NR5A 1IURA 3ZMSA 4J9ZB 4G27B 5KX5A 1DF5A 4MSWC 3K5LA 5KHKA 4GKJB 4YHHO 3ZIAG 2ZE8A 3T2MA 3H1HH 2ZDIC 5JQGB 1QHTA 2EINC 1GM7A 3L71H 2KG7A 1VQ5V 4U7OA 5EZYB 4DV3B 4UCVA 4UB6Z 3SPHA 5DECA 3SJCC 2ZCEA 4DR1B 2A79B 3K59A 4BW9A 4DV0O 2QWOB 3FYIB 4QNHB 2JDIG 4GKKB 1P4RA 4GX2A 3TK1A 3J7AU 4I0XA 4O4JA 1YCIA 1EFRG 5CA1B 2UUBB 1D2DA 2B1IA 1VQMV 4AILC 3E2EA 5BY1A 5IY5B 4X65B 2WLIA 1XDCA 1M93A 2HR3A 5EBMC 3RN4A 1EM1A 3FD9A 2EBOA 3OMNB 4AQYO 2N05A 2W6JG 1K9MW 3CJHB 2ZNJA 2W6IG 4JTAB 4BW5A 2Y69C 4F6RB 2E76B 3D36C 1TVKA 4X20A 3QTCA 5KHHA 4HNAA 2JJ2G 3CMAV 3HKCB 4GT1A 1MSDA 4DXWA 5FL7G 2PGGA 2JVDA 1QQCA 2IBZH 3CYOA 3LSSA 1KBHA 3RFRA 1KYOF 3JSLA 5J9PC 3OFNG 1XBLA 3OR6C 1EBOA 4L87A 3JD1A 3C3TA 5KAFZ 1KMIZ 4FFBB 3QO8A 2VQEB 1S3JA 1IBMO 2E74B 1ZTEA 4K0KB 2QE7G 1P49A 4MS2A 2ZM6O 5KUMA 1KC8W 4O4LB 3JATB 1OZ0A 1Q43A 4P2ZA 3SYCA 2Q4PA 3M99B 1TUEB 5DN6G 1R6NA 3AG2C 3RW0A 3H1IH 4XDKA 3G6EV 3L72H 4PDRA 4UFZA 4MT8A 3I55V 2X6CA 3ZRSA 4I9WA 4GYCB 3CRAA 4BIOA 3BCCH 1F4NA 1JMKC 1WA8A 4FLTA 1DGSA 2DE0X 2AXTZ 5KA6A 1VQ9V 4HZ3A 1GM8A 3U10A 2VQFB 2P7TC 3CCQV 1XI1A 1EN5A 1M90W 5A9GA 1MZFA 4ZI7A 2EILC 1AI4A 1P7BA 5LXTB 1WAZA 1EZJA 4YXWG 3ASNC 5LP6C 1OJHA 3U0ZA 4YIPA 3PJSK 5LMUB 2PUSA 4PJ0Z 2EINB 5D5PA 3TETA 3ZMVA 1FAFA 3SPGA 3T4DA 3CCMV 1JOYA 4RUFA 1BS3A 5E1AC 2RCVA 1MSWD 1RFYA 2RQ6A 4R7CA 1GM9A 4LF6B 3E83A 4MTFA 3JAWA 4R6ZA 3MAQA 1KKCA 1VQLV 2OIEA 4JZGA 4LR3A 3NXSA 1ZAUA 3BA8A 4HAMA 4PV1B 1ORQC 2ETNA 1K5QA 4W4KA 2Q67A 3G67A 2FMLA 1NJIW 4X89A 5LOVA 1S5LZ 4X1IA 2R9IA 2IM9A 4QPJA 2ZD9A 4JI2O 2QGNA 3SYAA 3HR0A 4DV7O 2PYJA 2DYSC 4UVAA 4B3MB 3H1KH 1FPOA 2IJHA 2F4VB 3CX5F 5IJ9A 4B3TO 1COWG 2Y69B 1HR0B 4NXNO 2WLJA 4TV9B 3ETDA 5IT9N 2LFSA 3K57A 2P22C 4LF5B 1N34B 2PTMA 4JI7O 3RYFA 4UB8Z 2QR4A 3AK2A 3K06A 2Q7EA 3DTUB 5LA6A 4H0LB 2DOSA 3K58A 1FD9A 1FFXA 4BAYA 1Q81W 1VARA 1PNLA 4X62B 1IBLO 1Y76A 4JZ2A 2CTWA 4H13B 3DXRB 1AI7A 2EIMB 4AHCA 1E1QG 2NN4A 4PDVA 5EYPA 4GKJO 4TV8A 1G4YB 1SQXH 4I4TB 1WB8A 1CPYA 2JGDA 3CB2A 1WNSA 4DV5O 4QPKA 4WF9V 4DV6B 4IGGA
chains in the Genus database with same CATH topology
1BQ0A 3APOA 2KQXA 1IURA 2GUZB 2CTWA 2GUZA 2YUAA 2Y4TA 2CTPA 2CTRA 2PF4E 2LO1A 3BVOA 2DN9A 1BQZA 2Y4UA 2CTQA 4IT5A 2QWRB 4J7ZA 2LGWA 1GH6A 2QWOB 2QWNB 4RWUA 3UO3A 2QWQB 2OCHA 2EJ7A 1FAFA 3AG7A 2N04A 4J80A 3UO2A 1NZ6A 1FPOA 3APQA 3UCSC 2DMXA 2QWPB 2YS8A 2N05A 1HDJA 1XBLA 2QSAA 2L6LA 1N4CA 1WJZA 2M6YA 2CUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQ0 A;  3APO A;  2KQX A;  1IUR A;  2GUZ B;  2CTW A;  2GUZ A;  2YUA A;  2Y4T A;  2CTP A;  2CTR A;  2PF4 E;  2LO1 A;  3BVO A;  2DN9 A;  1BQZ A;  2Y4U A;  2CTQ A;  4IT5 A;  2QWR B;  4J7Z A;  2LGW A;  1GH6 A;  2QWO B;  2QWN B;  4RWU A;  3UO3 A;  2QWQ B;  2OCH A;  2EJ7 A;  1FAF A;  3AG7 A;  2N04 A;  4J80 A;  3UO2 A;  1NZ6 A;  1FPO A;  3APQ A;  3UCS C;  2DMX A;  2QWP B;  2YS8 A;  2N05 A;  1HDJ A;  1XBL A;  2QSA A;  2L6L A;  1N4C A;  1WJZ A;  2M6Y A;  2CUG A; 
#chains in the Genus database with same CATH topology
 1KU9 A;  1HNW O;  3BHP A;  1M5I A;  2Q5Z A;  2AW9 A;  4GKK O;  2V1D A;  4JAA A;  4FK5 C;  4FMT A;  5J2T B;  1S5J A;  3QNE A;  3CRR A;  4N21 A;  3RYC A;  4JI4 O;  1K73 W;  1B6Q A;  4Z2W A;  4EKW A;  5EC1 C;  4O4J B;  4J41 A;  4U3J B;  4CH4 A;  2XTA A;  5IJ0 A;  4UCO A;  5LMN O;  1QR8 A;  4WBN B;  4JI5 B;  4EFE A;  5JCO A;  1ZWI C;  1V9P A;  1GO3 F;  1YIT V;  2W0F C;  1S0V A;  1W0K G;  3QVN A;  4K3A A;  3AG1 B;  1ZX3 A;  2AGA A;  4DR3 O;  1AIL A;  3BFR A;  2EIL B;  2Y48 A;  1WP7 A;  4JF3 A;  5CA0 B;  3ASN B;  2P6J A;  4ZOL B;  5LP6 B;  4QE7 A;  3ETQ A;  3E8F A;  2Q7H A;  3UKM A;  3DC5 A;  3HKB B;  4FZ1 A;  4DUZ O;  1US6 A;  3SJB C;  4GZR B;  1WN7 A;  3ICX A;  2BE3 A;  1H8E G;  1B04 A;  3SYO A;  2K9P A;  3UO2 A;  1BGY H;  2BTQ A;  3RYH B;  3ZMU A;  5JVD B;  1IDS A;  3E8B A;  3WB2 A;  3ZRV A;  4WFB V;  3RYI A;  1YTF D;  1FXK A;  1J95 A;  1YIJ V;  5LYJ B;  4O2A A;  3M7M X;  2AHY A;  1SES A;  2Y4T A;  4K0K O;  1OCR B;  4GCZ A;  1VF6 A;  1MMM A;  1H2L A;  4J7Z A;  4DV2 O;  1VMG A;  2N04 A;  1Z5V A;  2Q68 A;  4LFC O;  3BA9 A;  4O2B B;  1N36 O;  2HLD G;  2Q8V A;  1HWY A;  2EIK C;  2Q0O C;  1QR9 A;  2YXL A;  5A2Q N;  4LH7 A;  1A32 A;  4B7E A;  1Z5W A;  3UT5 A;  2HP8 A;  4FLY A;  4DYL A;  2DYS B;  3QO7 A;  4JAU A;  3BEH A;  2GTS A;  3B40 A;  3H9V A;  4RO2 A;  1D5N A;  2ZE7 A;  2ZIM A;  1I5X A;  4DV1 B;  4JI1 O;  4PD4 F;  1PD3 A;  3Q4H B;  2QSA A;  3N2G B;  4I5S A;  3G80 A;  2FKX A;  1WA8 B;  4FM1 A;  4PA9 A;  2IU0 A;  2ILM A;  4WFF A;  3A0B Z;  2IH3 C;  1RSO A;  2Q9L A;  4R8C A;  5IWA O;  2CTP A;  3U11 A;  1WP8 A;  4J9Y B;  1M9N A;  2E5L B;  1R3L C;  1N33 O;  4JI8 O;  2UXC O;  1XNQ O;  4O4H A;  1I94 B;  1FYJ A;  1LUV A;  1Q5O A;  2AHZ A;  1XHX A;  2ITD C;  2YSU B;  3CCU V;  2BOB C;  4FFK A;  1NR1 A;  4ZI7 B;  2UXD B;  1XOU A;  4PA7 A;  2VWK A;  4LFA B;  2ARH A;  3G71 V;  1XMQ B;  5LMU O;  1SZX A;  1BQZ A;  2JK5 C;  3JD3 A;  4TUY B;  4JI3 B;  1Q8I A;  2ATK C;  2OTJ V;  4KUM A;  3ZRW A;  1XMO O;  1Q82 W;  4LF6 O;  3FFQ A;  2XAF A;  5AG2 A;  3JAW B;  1CEZ A;  4PHZ A;  2F23 A;  4UV9 A;  4TT3 G;  1VF6 C;  3LDC A;  1V54 C;  3S3X A;  3FB6 C;  4KHP O;  5B1O A;  4X1I B;  2CUG A;  4QJF B;  3CCJ V;  4LF9 B;  4DV4 B;  4PI2 A;  4IIJ A;  1N32 B;  3IC9 A;  4DR2 B;  1JFF A;  2CDY A;  1CXZ B;  2CTR A;  3K5O A;  4YJ3 A;  3OM3 B;  3JCU Z;  4YJ2 B;  4CS2 A;  4B3M O;  1NTK H;  3CCE V;  3RVZ A;  2F4V O;  4I7Z B;  1NS1 A;  1YEW A;  4X1Y B;  4K35 A;  4LNU A;  1BHB A;  1VF7 A;  2WA4 A;  1XHZ A;  4ZHQ B;  4GUN A;  2WLN A;  4X64 B;  3JD0 A;  2AZ0 A;  1N34 O;  2LW1 A;  4MVS A;  3THO A;  3B8M A;  5TIS Z;  1NTZ H;  4O4I A;  4DUY O;  5CA3 A;  5KA5 A;  2ITC C;  5B1N A;  3CXC U;  2Y4U A;  2EJR A;  4LWS A;  1FFX B;  4J42 A;  3ETG A;  1F7Y A;  5CMU A;  2HKO A;  2K1E A;  1XL4 A;  2CH7 A;  2GDS A;  4WFH A;  2Q69 A;  3SYP A;  2YC0 A;  4WFA V;  1K4C C;  4X62 O;  4I50 B;  2WLL A;  2KKW A;  2QKA A;  3OTO B;  2HJD A;  5J2U B;  1G8M A;  3W7U A;  5EYP B;  1SA0 A;  1JJ2 U;  5H5N A;  2HHH B;  2JGD B;  4TSF G;  2EIK B;  2QWQ B;  3ABU A;  3JD4 A;  4MVQ A;  4DV6 O;  1QBZ A;  2BSK A;  2EUL A;  3P3N A;  4IHJ B;  1NKD A;  1GN4 A;  2RN9 A;  2UXB B;  4NVP A;  3ZHV A;  3ABT A;  3NR7 A;  1YSC A;  4P9P A;  3WB1 A;  3W7T A;  1QCE A;  1MG1 A;  1EZV H;  5C8Y B;  3ETE A;  1AI6 A;  1QLN A;  1MNG A;  2F95 B;  3RYC B;  2HJF C;  2O57 A;  4RUE A;  4JAV A;  4ICG A;  2EX3 A;  2UXN A;  5IJ0 B;  2Q6A A;  4NKG B;  4JI5 O;  2P4V A;  2RDC A;  1ZL8 B;  3CHX A;  3WG7 C;  3EHB B;  2A06 H;  2R9R B;  1GN3 A;  5BR8 B;  4F6E A;  4Q20 A;  2FTK A;  1XNR B;  1AVM A;  1TA8 A;  1I08 A;  3AG7 A;  1NZ6 A;  5JH7 A;  1THZ A;  2XHB A;  2ZKO A;  2ZR2 A;  5B3S C;  3E89 A;  4RQF A;  1HNZ O;  3BY6 A;  1M1K W;  2QKC A;  2P67 A;  2Q73 A;  3CCR V;  1FFT B;  4ZBM A;  1SC5 B;  2LGW A;  1AP5 A;  1PKX A;  2UUC B;  2BTQ B;  2ZXW C;  4DR5 B;  2CK3 G;  2VRZ A;  2DMX A;  3OUF A;  3RYI B;  1S77 D;  4KXR A;  2LFR A;  4B3R B;  4O2A B;  1AJQ A;  3CRM A;  3HB3 B;  2GUZ B;  3VQY A;  3N2K B;  4DW1 A;  4CC5 A;  1H2S B;  1Y4M A;  1V54 B;  1QU7 A;  3JAS A;  2DYR B;  3JCZ A;  3ABK C;  2JEU A;  2JGU A;  1IBK O;  2HVJ C;  2X7R B;  1GN6 A;  1YTF B;  4QIW F;  3ZHU A;  4GX1 A;  2WAM A;  3BAA A;  1YJW V;  1DK1 A;  2UUA B;  2QTS A;  5BZB A;  3G4S V;  3SDL A;  4OX9 B;  4JYA O;  2Q0A A;  1K8A W;  2E75 B;  4OPA A;  4BWA A;  5B1A C;  3CC2 V;  3BRC A;  1NU1 H;  3T1H B;  3F5W C;  2PI4 A;  1NI8 A;  2YS8 A;  2R9A A;  4YIO A;  4W4L A;  4LF4 B;  2JS5 A;  2DWD C;  3ASO C;  2QEX V;  2PYL A;  3ZBH A;  1LUW A;  3VQW A;  3CME V;  1KD1 W;  3WB0 A;  5IYZ A;  4WFG A;  3AK1 A;  2F66 C;  2E5L O;  1R73 A;  1K97 A;  5CBH A;  3E22 A;  3ZMZ A;  5CBG A;  2HG5 C;  3L75 H;  5KMG A;  4WFE A;  1BT8 A;  3OR7 C;  2IJK A;  5FLX N;  4OPH A;  4EFB A;  1QVG U;  2RMK B;  3E8H A;  1MA1 A;  1W0J G;  3TJT A;  4D7S A;  1XMQ O;  1B06 A;  1G1X B;  1GMG A;  1RM1 C;  5GON B;  1HNX O;  4JI3 O;  2A7W A;  4NXM B;  3F7V C;  2XND G;  3OMA B;  2A0L A;  1VEW A;  3CE2 A;  4Z1M G;  3JAR A;  5LGT A;  2NNU A;  3MDS A;  1IXM A;  2FYU H;  4U7N A;  4C7U A;  2L35 A;  3AK3 A;  4X88 A;  4JPR A;  2Z5U A;  3K3W A;  3AEI A;  2JJ1 G;  4KP4 A;  2P5O A;  3HKD A;  3L74 H;  3OD4 A;  1Y67 A;  2OCH A;  4DRX A;  1PP9 H;  5LHH A;  3F7Y C;  4EB6 A;  5GTH Z;  4JYB A;  1K34 A;  3A0R A;  3MHS C;  3K0G A;  1LR1 A;  2L6L A;  3FAV A;  4IIJ B;  2UU9 O;  2QM8 A;  3ZRX A;  4DR6 B;  3FB8 C;  1K7D A;  3BVO A;  5FNV A;  3JAL B;  4WCE V;  4JV5 B;  3O65 A;  1SET A;  1BMF G;  2EJ7 A;  4PEL A;  4FM2 A;  1ZLZ A;  1AJP A;  1VQ8 V;  4NR1 A;  5H9C A;  3E86 A;  4X66 O;  2EZO A;  5KHJ A;  1IVS A;  3LDE A;  1SQQ H;  3CC4 V;  4J11 A;  1N8R W;  1MZE A;  1SQG A;  4BIU A;  2OCC C;  1BE3 H;  1ARO P;  5KX5 B;  4LWS B;  2C2A A;  4FLZ A;  1S5H C;  3AG3 C;  3QO5 A;  3OT7 A;  4NTX A;  3UCS C;  1BSM A;  1F4M A;  1H2N A;  4YHH B;  4MVZ A;  3J81 N;  4FLX A;  5GTI Z;  4DV3 O;  2KG7 B;  5JQG A;  1HDJ A;  2N74 A;  2AZ2 A;  3AG2 B;  5EZY A;  3SJQ C;  1P84 F;  3CS5 A;  3ABK B;  1PL0 A;  1K3E A;  1RP3 B;  3L70 H;  3T4Z A;  4DR1 O;  2QA4 V;  1PNM A;  2HHH O;  3A2F A;  1OV9 A;  2F93 B;  2JRI A;  3JYC A;  4TWK A;  1I0H A;  1Q6U A;  4I55 A;  4DV0 B;  3STL C;  3UQ8 A;  2BSK B;  3G6B A;  2ZE6 A;  3RGB A;  2UXB O;  5L3E A;  1XRE A;  1BHA A;  4I0X B;  2UUB O;  3L9D A;  3W7S A;  5CA1 A;  1GAX A;  1L0L H;  1KUQ A;  3SPC A;  3ABM C;  4PDM A;  5B1A B;  4X65 O;  1TUB A;  2WLI B;  4FM0 A;  1M57 C;  2F43 G;  4LCU C;  3ASO B;  2UXX A;  2M6Y A;  5B5E Z;  1YJN V;  3KKY A;  5BR8 O;  4X20 B;  1TVK B;  4F6R A;  4HNA B;  1XNR O;  3ZS8 C;  4UCR A;  2JS3 A;  2QWR B;  3HKC A;  3IGA C;  2H94 A;  2YIA A;  3CPW U;  3ZHS A;  5BMV A;  2EIJ C;  2LP7 A;  1DF4 A;  1L0N H;  3C90 A;  4E2L A;  4MVO A;  3T1Y B;  1RM1 B;  4GLX A;  3ZED A;  1ROP A;  3APO A;  1GTO A;  4L8J A;  1UPG A;  2VQE O;  1EN6 A;  4K8X A;  1K92 A;  4FFB A;  4ZKI A;  3VQX A;  2UUC O;  3CSX A;  1VQP V;  1NBM G;  1JX9 A;  1IBM B;  2D3O W;  4R50 A;  2ZIN A;  4J80 A;  4MW8 A;  2Z3Y A;  2ZM6 B;  2XT9 A;  1LNQ A;  2Y0I A;  4JYY A;  4PDL A;  3CD6 V;  3P3P A;  4O4L A;  1Q90 D;  3JAT A;  1N4C A;  3KZI Z;  5FPR A;  1Q7Y W;  2DWE C;  3LDD A;  4GX5 A;  2OYQ A;  1SRY A;  2ZT9 B;  4Q6G A;  5IYB O;  2XAH A;  1Y6X A;  4N23 A;  3B8N A;  3ZHQ A;  4PA6 A;  3JAK A;  1U97 A;  5JWP A;  1OCO C;  2UUA O;  1NR7 A;  2IH1 C;  4X1K A;  1M56 C;  5B1B C;  2DJV A;  1VQ7 V;  5IYD O;  4DO2 A;  2V4D A;  3CCS V;  3A8T A;  4KFM A;  2FL4 A;  2Q7G A;  2H3O A;  3R65 A;  5JCO C;  1GH6 A;  3T1H O;  2VQF O;  1Q3E A;  3AG4 C;  4TOI A;  4B08 A;  5H6R A;  5JJE B;  2LQT A;  4Z1V A;  1D5A A;  4HBN A;  1VP7 A;  3GVM A;  2OCC B;  3ABL C;  1N0N A;  3OEH G;  5IDJ A;  1EN4 A;  2KB1 A;  3AG3 B;  5LXT A;  5FPO A;  2GV9 A;  4MTO A;  2Y0P A;  4NB5 A;  2A3Q A;  1KQS U;  2PY5 A;  5KMG B;  1NH2 B;  4CZZ A;  3D3I A;  1S76 D;  4J7J A;  5B66 Z;  1M4U A;  4P9O A;  1Q86 W;  1FXK C;  4NXM O;  4JGS A;  4FJC C;  4J7K A;  1H2M A;  1KP3 A;  2DN9 A;  2JIZ G;  3K0D A;  1L8D A;  2EZP A;  1R1B A;  2YIB A;  2OTL V;  4E4E A;  3JAR B;  3PN1 A;  5LOV B;  1P7G A;  3ABM B;  2CGO A;  3RBZ A;  4YY3 B;  1TGO A;  3X2Q C;  4XDJ A;  1GK9 A;  1M57 B;  1NTM H;  2ODM A;  3C3S A;  2XAJ A;  4MVM A;  2CTQ A;  1F23 A;  4P30 A;  2IW5 A;  1FXV A;  4FPP A;  4DV7 B;  5IJ9 B;  1HR0 O;  1R6K A;  3OMI B;  4B3T B;  4JI0 B;  3D36 A;  4TV9 A;  2QM7 A;  1KP2 A;  4ZIB A;  4LF5 O;  2GTA A;  3TGU H;  2EIJ B;  2LJ2 A;  3RYF B;  1YHQ V;  2BCC H;  5LA6 B;  3HPL C;  4RWU A;  4CS4 A;  4JI7 B;  5F2V O;  1K33 A;  3GWK C;  3KG2 A;  2ADQ B;  3VQV A;  1Y76 B;  4PA3 A;  5JJJ B;  1IBL B;  1R6T A;  3DSQ A;  4CBC A;  3TXS A;  3DXR A;  3K04 A;  2XAQ A;  2DQ0 A;  3LSQ A;  4TV8 B;  1PV0 A;  2B1G A;  2QKS A;  3B09 A;  4I4T A;  2YIC A;  1AR1 B;  4JTD B;  1AR4 A;  1Q6H A;  3CC7 V;  4LF8 B;  4DV5 B;  2ZIO A;  1SQB H;  1VIB A;  2QTO A;  1BCC H;  2H8P C;  5BXZ A;  1R3K C;  1SQV H;  2DW4 A;  1HNW B;  5LHI A;  3OGI B;  1OCO B;  4I55 B;  1E79 G;  4LC1 A;  5J2T A;  4RAI A;  4UCT A;  1M56 B;  5B1B B;  4JI4 B;  4PA4 A;  5KUK A;  5H2F Z;  1SQP H;  2CE4 A;  4UV8 A;  4U3J A;  3FB7 C;  2HVK C;  4WBN A;  1TUB B;  5LMN B;  3AG4 B;  1OCZ C;  5LGU A;  3W7X A;  1KKD A;  3VOU A;  5GW7 A;  4LFB B;  3TXQ A;  3K03 A;  3ABL B;  4DR3 B;  2PI5 A;  1VQN V;  4H44 B;  5CA0 A;  5DM6 V;  3ZJZ A;  3K5N A;  4ZOL A;  5LP6 A;  3M8A A;  5D5Q A;  5EC2 C;  3HKB A;  3DC6 A;  3GB7 C;  2LGQ A;  1W2B U;  3ZX6 A;  4DUZ B;  1JR9 A;  5ITZ A;  2IJJ A;  4GX0 A;  1JCH A;  3I56 V;  5BMV B;  4PI0 A;  2G38 A;  1SZT A;  2A9H A;  1IZ3 A;  3T1Y O;  3RYH A;  3ZHR A;  5JVD A;  3LSU A;  1AP6 A;  1FXK B;  3OUS A;  2YEV A;  3OW2 U;  5KHI A;  1NVP D;  5LYJ A;  3B4S A;  4JTC B;  1IX9 A;  3R66 A;  2QJ1 A;  5IE9 A;  4MVR A;  2WA3 A;  3SJA C;  2EIM C;  3B2E E;  4OGQ B;  3SYQ A;  4DV2 B;  3DGE A;  4I9Q A;  3X2Q B;  5E79 Z;  4FVM A;  4O2B A;  4U3F H;  4LFC B;  1N36 B;  2YI9 A;  1WPX A;  3K9A A;  1JQ0 A;  4DR7 B;  1HW7 A;  3UT5 B;  1QLE C;  3K79 A;  1OCC C;  1PNK A;  5H6Q A;  1SS3 A;  5LL6 Y;  4FLW A;  1JA8 A;  3JAM N;  3K9S A;  3JAK B;  3ML0 A;  4DV1 O;  4CC6 A;  2X6A A;  1DTO A;  2F1M A;  3FKS G;  3IJ4 A;  4CH5 A;  3Q4H A;  4JI1 B;  3N2G A;  4X1K B;  3WFV A;  1X59 A;  1NH2 D;  4JI6 B;  1Q6I A;  1RSO B;  4FIP C;  1I7F A;  3BAB A;  2ADP A;  1WLE A;  4LF7 B;  3CCV V;  3HKE A;  1FJG B;  4CH6 A;  3MD0 A;  5IWA B;  1QVF U;  5EBL C;  3STZ C;  1PL4 A;  3SPJ A;  1I94 O;  1UJW B;  4O4H B;  2X6B A;  2B9Z A;  4CS3 A;  1N33 B;  1U96 A;  4JI8 B;  1XQ8 A;  1H38 A;  3O9O A;  3KCY A;  2UXC B;  3B77 A;  1XNQ B;  3AG1 C;  2UXD O;  3WU2 Z;  3FX7 A;  4LFA O;  4UCU A;  2YI8 A;  4BR6 A;  1AI5 A;  5HFL A;  2GBO A;  4TUY A;  3RVY A;  3ZRW B;  2P90 A;  4MW3 A;  2NLJ C;  1J5E B;  1XMO B;  3I5D A;  2R70 A;  1GRJ A;  1H8H G;  1URF A;  2P06 A;  1QNM A;  2P4K A;  3A0H Z;  3CEI A;  4MTX A;  5EIB D;  1PM9 A;  1OCR C;  2OT5 A;  2IJI A;  2YID A;  4KHP B;  1R3I C;  3OGC C;  4YY3 O;  4LF9 O;  3MHH C;  1OCZ B;  4DV4 O;  3WG7 B;  1VF5 B;  3W7W A;  1N32 O;  4B3S B;  4UVC A;  4DR2 O;  1JFF B;  1YZB A;  4YJ3 B;  2WSS G;  4DK0 A;  2RNB A;  4H33 A;  2Z0A A;  3RWR D;  5CB4 A;  1YXB A;  1CP9 A;  5CBF A;  4YJ2 A;  5B3S B;  1H2K A;  1FKA O;  1Y74 A;  4LNU B;  4X1Y A;  3APQ A;  3D3Q A;  1ZSP A;  3J80 N;  4JI0 O;  5KHG A;  4D7T A;  4UUJ C;  4ZHQ A;  1GN2 A;  4X64 O;  2CAZ C;  2WLH A;  3UM7 A;  3P30 A;  1V55 C;  2GSM B;  4DR4 B;  4UXN A;  4O4I B;  2YUA A;  2ZXW B;  3D8C A;  5KAI Z;  2LO1 A;  2YDE A;  3KCX A;  4DUY B;  2XUM A;  1JJO A;  3LUT B;  4MVU A;  1ZUQ A;  3E35 A;  2CH7 B;  4IL6 Z;  4I50 A;  3OTO O;  2WLL B;  4D6T H;  4BIZ A;  5J2U A;  4NYK A;  4J10 A;  2OIG A;  1SA0 B;  1WPB A;  5L3C A;  4LF8 O;  1AJN A;  2YXH A;  2ZNI A;  3ZHT A;  5EBW C;  4IHJ A;  1X4T A;  1QLE B;  3OAA G;  2JEX A;  3L73 H;  3GWO A;  1OCC B;  3TCU A;  4XBF A;  4ASU G;  1Z2G A;  1UFI A;  2QM4 A;  2QDO A;  1RPR A;  1FS0 G;  2ZR3 A;  4A5U B;  1BZK A;  1KEC A;  1VQ4 V;  5C8Y A;  3FYE B;  4CH3 A;  3LNM B;  5K1X A;  1I5Y A;  2CGN A;  1O9G A;  3CCL V;  4QE9 A;  3IFX A;  3CXH F;  1YI2 V;  4AQY B;  4FLV A;  3LNN A;  1VQK V;  5HFM A;  1E1R G;  3K5M A;  2LW7 A;  2WLM A;  1ZL8 A;  3CJH A;  4FLU A;  5DED A;  2MW2 B;  4LFB O;  2QWN B;  2RJZ A;  2BTO A;  5EIB C;  1BL8 A;  5JH7 B;  4IYI A;  3OTF A;  2B5U A;  4F4L A;  2WWW A;  4LH6 A;  4K8Z A;  4LP8 A;  3T1C A;  3EFF K;  3VBB A;  2KSD A;  1HNZ B;  1JPX A;  4OXS A;  1T5E A;  1Y66 A;  5ITZ B;  4KL1 A;  1SKV A;  4DR5 O;  1YVW A;  2BOC C;  3CRC A;  1O9H A;  2DQ3 A;  2QWP B;  4B3R O;  1RPO A;  1H2G A;  4XDL A;  3FB5 C;  2YEV B;  1R3J C;  3BPZ A;  3SR2 C;  1AB3 A;  1F51 A;  3ZN1 A;  2GUZ A;  1XEQ A;  3N2K A;  1PPJ H;  3JAS B;  2PF4 E;  2IU3 A;  4EEQ A;  1WB7 A;  3QF7 A;  3SGI A;  1OHH G;  3CP1 A;  3H01 A;  4LBE C;  4X8A A;  1IBK B;  4JYC A;  4NTW A;  1NVP B;  2HFE C;  1YDX A;  4DR7 O;  2YXY A;  1WJZ A;  4UVB A;  4TQF A;  3S3W A;  4QGP A;  2KQX A;  5CN0 A;  4OX9 O;  4UCS A;  4B7K A;  3CWB H;  3P32 A;  1N0J A;  4JYA B;  3OEE G;  5L3F A;  1DLB A;  4HYO A;  1XUQ A;  5IY5 C;  2OWO A;  1V55 B;  1SQF A;  3RT3 C;  4LF4 O;  4JI6 O;  2FB5 A;  2PZS A;  1SF9 A;  4H37 A;  4LF7 O;  1NT2 B;  1FJG O;  3ZCC A;  3HKE B;  5IYZ B;  4IYH A;  1G6U A;  2X0L A;  1TAE A;  1HP8 A;  2ZDI A;  3H1J H;  5L3B A;  3E22 B;  2GHY A;  5L3D A;  2ZE5 A;  4NTY A;  1VQ6 V;  1XIL A;  2YIB D;  1K5S A;  3QG5 A;  3JSN A;  4ABM A;  4RQE A;  4FZ0 A;  3SPI A;  1ENV A;  3F5T A;  4TQD A;  5GON A;  2E3C A;  4G2K A;  2XAG A;  3ZMT A;  1HNX B;  2WPD G;  4JAS A;  2WLK A;  3UO3 A;  1SER A;  4X9Q A;  1J5E O;  3OE7 G;  4MTG A;  1MAB G;  1S72 V;  2W0X A;  2MK3 A;  1L1F A;  2XOK G;  1FXH A;  1W59 A;  1BQ0 A;  5C93 A;  3K08 A;  2D2C B;  2HEP A;  1XL6 A;  3IC7 A;  2ZQM A;  4JI2 B;  1IXB A;  4IT5 A;  3HKD B;  4DRX B;  3IAY A;  3CRQ A;  4DW0 A;  2V7Q G;  3H1L H;  4EB6 B;  5EK0 A;  1NQT A;  5LBQ A;  1B3Q A;  2DYR C;  1MOF A;  3N27 A;  1K4D C;  4G28 B;  4B3S O;  3E8G A;  3FAV B;  4DK1 A;  2R72 A;  1KB9 F;  3EXA A;  1AR5 A;  1JVM A;  4NXN B;  4DR6 O;  2UU9 B;  3ZN0 A;  2M7W A;  5L3G A;  5IYC O;  4JV5 O;  5CB4 B;  5FNV B;  1VQO V;  1YJ9 V;  3JAL A;  1Y74 B;  1YF2 A;  5LGN A;  2XAS A;  5KLV H;  5LHG A;  3JD2 A;  5K1P A;  2VS0 A;  4AI8 A;  5JJN B;  2VWJ A;  4DR4 O;  1GKF A;  3EVK A;  4X66 B;  2NR5 A;  1IUR A;  3ZMS A;  4J9Z B;  4G27 B;  5KX5 A;  1DF5 A;  4MSW C;  3K5L A;  5KHK A;  4GKJ B;  4YHH O;  3ZIA G;  2ZE8 A;  3T2M A;  3H1H H;  2ZDI C;  5JQG B;  1QHT A;  2EIN C;  1GM7 A;  3L71 H;  2KG7 A;  1VQ5 V;  4U7O A;  5EZY B;  4DV3 B;  4UCV A;  4UB6 Z;  3SPH A;  5DEC A;  3SJC C;  2ZCE A;  4DR1 B;  2A79 B;  3K59 A;  4BW9 A;  4DV0 O;  2QWO B;  3FYI B;  4QNH B;  2JDI G;  4GKK B;  1P4R A;  4GX2 A;  3TK1 A;  3J7A U;  4I0X A;  4O4J A;  1YCI A;  1EFR G;  5CA1 B;  2UUB B;  1D2D A;  2B1I A;  1VQM V;  4AIL C;  3E2E A;  5BY1 A;  5IY5 B;  4X65 B;  2WLI A;  1XDC A;  1M93 A;  2HR3 A;  5EBM C;  3RN4 A;  1EM1 A;  3FD9 A;  2EBO A;  3OMN B;  4AQY O;  2N05 A;  2W6J G;  1K9M W;  3CJH B;  2ZNJ A;  2W6I G;  4JTA B;  4BW5 A;  2Y69 C;  4F6R B;  2E76 B;  3D36 C;  1TVK A;  4X20 A;  3QTC A;  5KHH A;  4HNA A;  2JJ2 G;  3CMA V;  3HKC B;  4GT1 A;  1MSD A;  4DXW A;  5FL7 G;  2PGG A;  2JVD A;  1QQC A;  2IBZ H;  3CYO A;  3LSS A;  1KBH A;  3RFR A;  1KYO F;  3JSL A;  5J9P C;  3OFN G;  1XBL A;  3OR6 C;  1EBO A;  4L87 A;  3JD1 A;  3C3T A;  5KAF Z;  1KMI Z;  4FFB B;  3QO8 A;  2VQE B;  1S3J A;  1IBM O;  2E74 B;  1ZTE A;  4K0K B;  2QE7 G;  1P49 A;  4MS2 A;  2ZM6 O;  5KUM A;  1KC8 W;  4O4L B;  3JAT B;  1OZ0 A;  1Q43 A;  4P2Z A;  3SYC A;  2Q4P A;  3M99 B;  1TUE B;  5DN6 G;  1R6N A;  3AG2 C;  3RW0 A;  3H1I H;  4XDK A;  3G6E V;  3L72 H;  4PDR A;  4UFZ A;  4MT8 A;  3I55 V;  2X6C A;  3ZRS A;  4I9W A;  4GYC B;  3CRA A;  4BIO A;  3BCC H;  1F4N A;  1JMK C;  1WA8 A;  4FLT A;  1DGS A;  2DE0 X;  2AXT Z;  5KA6 A;  1VQ9 V;  4HZ3 A;  1GM8 A;  3U10 A;  2VQF B;  2P7T C;  3CCQ V;  1XI1 A;  1EN5 A;  1M90 W;  5A9G A;  1MZF A;  4ZI7 A;  2EIL C;  1AI4 A;  1P7B A;  5LXT B;  1WAZ A;  1EZJ A;  4YXW G;  3ASN C;  5LP6 C;  1OJH A;  3U0Z A;  4YIP A;  3PJS K;  5LMU B;  2PUS A;  4PJ0 Z;  2EIN B;  5D5P A;  3TET A;  3ZMV A;  1FAF A;  3SPG A;  3T4D A;  3CCM V;  1JOY A;  4RUF A;  1BS3 A;  5E1A C;  2RCV A;  1MSW D;  1RFY A;  2RQ6 A;  4R7C A;  1GM9 A;  4LF6 B;  3E83 A;  4MTF A;  3JAW A;  4R6Z A;  3MAQ A;  1KKC A;  1VQL V;  2OIE A;  4JZG A;  4LR3 A;  3NXS A;  1ZAU A;  3BA8 A;  4HAM A;  4PV1 B;  1ORQ C;  2ETN A;  1K5Q A;  4W4K A;  2Q67 A;  3G67 A;  2FML A;  1NJI W;  4X89 A;  5LOV A;  1S5L Z;  4X1I A;  2R9I A;  2IM9 A;  4QPJ A;  2ZD9 A;  4JI2 O;  2QGN A;  3SYA A;  3HR0 A;  4DV7 O;  2PYJ A;  2DYS C;  4UVA A;  4B3M B;  3H1K H;  1FPO A;  2IJH A;  2F4V B;  3CX5 F;  5IJ9 A;  4B3T O;  1COW G;  2Y69 B;  1HR0 B;  4NXN O;  2WLJ A;  4TV9 B;  3ETD A;  5IT9 N;  2LFS A;  3K57 A;  2P22 C;  4LF5 B;  1N34 B;  2PTM A;  4JI7 O;  3RYF A;  4UB8 Z;  2QR4 A;  3AK2 A;  3K06 A;  2Q7E A;  3DTU B;  5LA6 A;  4H0L B;  2DOS A;  3K58 A;  1FD9 A;  1FFX A;  4BAY A;  1Q81 W;  1VAR A;  1PNL A;  4X62 B;  1IBL O;  1Y76 A;  4JZ2 A;  2CTW A;  4H13 B;  3DXR B;  1AI7 A;  2EIM B;  4AHC A;  1E1Q G;  2NN4 A;  4PDV A;  5EYP A;  4GKJ O;  4TV8 A;  1G4Y B;  1SQX H;  4I4T B;  1WB8 A;  1CPY A;  2JGD A;  3CB2 A;  1WNS A;  4DV5 O;  4QPK A;  4WF9 V;  4DV6 B;  4IGG A; 
#chains in the Genus database with same CATH homology
 1BQ0 A;  3APO A;  2KQX A;  1IUR A;  2GUZ B;  2CTW A;  2GUZ A;  2YUA A;  2Y4T A;  2CTP A;  2CTR A;  2PF4 E;  2LO1 A;  3BVO A;  2DN9 A;  1BQZ A;  2Y4U A;  2CTQ A;  4IT5 A;  2QWR B;  4J7Z A;  2LGW A;  1GH6 A;  2QWO B;  2QWN B;  4RWU A;  3UO3 A;  2QWQ B;  2OCH A;  2EJ7 A;  1FAF A;  3AG7 A;  2N04 A;  4J80 A;  3UO2 A;  1NZ6 A;  1FPO A;  3APQ A;  3UCS C;  2DMX A;  2QWP B;  2YS8 A;  2N05 A;  1HDJ A;  1XBL A;  2QSA A;  2L6L A;  1N4C A;  1WJZ A;  2M6Y A;  2CUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...