1XBWA

1.9a crystal structure of the protein isdg from staphylococcus aureus aureus, structural genomics, mcsg
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
99
Chain Sequence
ETMKFMAENRLTLTKGTAKDIIERFYTRHGIETLGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHVPIINNKVITYDIGYSYMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein isdG
publication title Staphylococcus aureus IsdG and IsdI, heme-degrading enzymes with structural similarity to monooxygenases.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 21
structure length 99
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xbwA00
1OQ6A 5K9FA 2HQIA 1AFJA 3LGNA 1N5VA 1OQ3A 1TZ0A 3HDSA 1YJRA 2Q3PA 2RSQA 5T7LB 1R6YA 5B0DA 2XMMA 1W2IA 2K1RA 2FTRA 1Q8BA 1KVIA 1FVQA 4HH0A 3DXSX 5KAKA 5A6PA 3HHLB 2W4PA 2KT2A 2OAUA 1SQEA 1P6TA 1VQYA 2AJ0A 4OJ3A 2GA7A 1GXUA 2K2PA 2GGPB 2LDIA 2XMUA 2HIQA 4A47A 2G9OA 2EW9A 2IYGA 3MCSA 1X7VA 1VQSA 5B0FA 4EFAC 1K0VA 2ACYA 2OP5A 3BGUA 4A46A 2HFNA 2KKHA 3BB5A 3LGMA 2ROGA 3BR8A 2GV1A 3QGPA 2HLUA 4QOTA 2BBEA 1FEEA 4A4JA 4Y2IA 4NL5A 3HF5A 3HHLD 1MWYA 1N5SA 1FE4A 4DL0C 4HI2A 4YEAA 1N5TA 1XBWA 3DCAA 3GZ7A 3KG1A 1FE0A 4Y2MA 1TL4A 1CC8A 1SI9A 4NPOA 1FD8A 2RU9A 1TL5A 5B0AA 1KQKA 4HL9A 2N4DA 4ZA1A 1Q53A 3BM7A 2QIFA 4Q2MA 4U9RA 5F0WA 2OFHX 2LQBA 5B0EA 2OFGX 2QLWA 3WDOA 1P8GA 4OIXA 2FIUA 2FHMA 4HH1A 5B0BA 1X8DA 1V3ZA 3BDEA 4DPOA 2ROPA 5T7LA 3FRYA 3BF4A 2N7YA 2PGCA 3TRGA 1YJTA 1FESA 2W4DA 4A48A 2OD6A 1APSA 2QLXA 2KT3A 2QYCA 4Y2KA 3K7RA 4OJHA 2XMTA 3HHLA 2N4CA 3KG0A 3KNGA 2KYZA 2XMKA 3CJKB 2GCFA 2ROEA 1OPZA 4YDXA 2OMOA 1AFIA 2LXFA 2GGPA 3BN7A 2L3MA 3UDCA 1Q8LA 4FNHA 2FB0A 1MWZA 3HFKA 2GO8A 4F67A 1Q4RA 1GXTA 2IFXA 2HLTA 3VTIA 5A6WA 2K1RB 2W4CA 3TOQA 4DN9A 2BYCA 2XMJA 4HI1A 3F44A 1AW0A 1KVJA 1S6OA 1IUJA 1OSDA 5B08A 2K7KA 2BJEA 2AP6A 4OJ1A 1Y3KA 2JDJA 1SB6A 3IWLA 5B09A 1N5QA 2GFFA 2BUNA 1U7LA 1YRXA 1Y0HA 1YJVA 1WD6A 2ZDOA 2ASYA 3HX9A 2RILA 4FNIA 2AW0A 3FGVA 2IYIA 1LQ9A 2VH7A 3T9NA 2CRLA 1Y3JA 1TR0A 5F0UA 1X0PA 1QUPA 2VV5A 1CPZA 1FVSA 1YG0A 3TNVA 2ZDPA 1TUVA 2OKQA 2XMWA 3I9ZA 4Q2LA 5B0CA 3LO3A 1CC7A 1RJJA 2XMVA 2OD4A 5B0GA 4ZOSA 2PD1A 1ULRA 3IWXA 2LQ9A 3KKFA 2RMLA 1JWWA 3HHLC 3E8OA 1YJUA 3QMQA 4OJGA 1Y9OA 3CJKA 2HFOA 3FMBA 3MZIA 1JK9B 5IXUA 2AJ1A 1S6UA 2BJDA 2K7JA 1URRA
chains in the Genus database with same CATH superfamily
3H5UA 4MH8A 4DR3J 3J80Y 3OJUA 4G65A 1Q82T 1RT1A 5HI7A 2CPFA 1HYSA 2V8GA 3KXDA 4JI0J 3RUBL 3DFEA 3UWTA 3FBEA 2NXUA 2B9WA 4QR1A 2ZH2A 3UN2A 3U27A 2R7RA 1K1SA 4F4KA 1AZSA 4NE9C 4WFNQ 2EC0A 4RW7B 2W25A 1NRKA 3PDNA 4ITSA 4DSFA 3KG0A 3W2WB 2AIRB 2DK2A 1VR6A 2OMLA 1GXTA 1B0VA 3QO9A 2BKPA 4PPDA 2HVEA 4ZLNA 3QIPB 1F2GA 5MAOA 3LWMA 2VJVA 3VGSA 1TAQA 1CC7A 3MM9A 2UXDJ 3K5MA 3G8QA 1RYRA 4RPFA 1O51A 1OQ6A 3WC0A 4B3OA 1I94F 1LW0B 1HWJA 3AD7C 3CCUS 3LW5C 1TFWA 2HRTA 3H2VE 1Q81T 2JWNA 3PKYA 1SL0A 1GNKA 5DDOC 3CCVS 1S9EB 1L3VA 5A8WB 2UU9J 1UTAA 5HROB 5E3RA 1QTMA 1N36J 4UF4A 1LK5A 2E5JA 3FRYA 3P6YC 2W7OA 1APSA 3SCIE 4WPAA 1HQUB 2KHCA 1NB7A 5L1KA 2DIVA 3FCHA 5IV4A 1IKWB 2KRBA 2EK6A 1U1OA 2W9AA 1WF2A 4DUZF 4U7CA 2B7CB 4JI3J 2IBOA 4PUOB 2DR5A 2VFTA 1RZMA 3ZZYA 1HWUA 3SYZA 3TEHB 2PE8A 1YZ7A 1M5HA 3IR5B 4J37A 1BQMB 1J27A 1S1UA 5J2PA 3WIVA 2XWYA 5D4PA 4DV7F 1T05A 4EUVA 1TU0B 1T9UA 5AT1B 1UJ5A 2WONB 3QJPA 1UPMB 2LA4A 5L8RC 1RTJA 2GV1A 2BBEA 4GMKA 3NS7B 3PO5A 2UUWA 3ZTSA 2OUGA 4ZVGA 4OI2A 3H25A 3D1HA 5B0AA 2E1RA 1VJWA 1ZA2B 2SXLA 2DISA 1NJWA 2ZWPA 4ZPDA 1CJUA 3QYYA 5T41A 4WFXA 4UZBA 2DGXA 2BANA 4HT7A 2EK1A 3ELHA 2OMOA 4CH0S 4JI2J 1IBCB 1IKXB 1EJ7L 5KFAA 4OX9J 1RTDB 1R31A 3PO4A 3N79A 2JDJA 3Q8YA 3WZ0A 4DR2J 2QGFB 3OVBA 3W7BA 3W2VA 1HBOB 1SL2A 3ZZRA 2CNKB 4NZ6A 1DQAA 3DRRA 3O2IA 1XR7A 1TL3A 2VFUA 2Y0BB 2M8HA 1PJ7A 4QJVA 3VGVA 1B64A 1S6QB 4IR1A 2NXJA 2IM0A 3N01A 2K1RA 2XZTB 4NA2A 3V6DA 3GU0A 2FZKB 3KFWX 2EKNA 1LXNA 4UTGA 3CUNA 2FJWA 4JV1A 2OPQB 4HYKA 2HFZA 1KOOA 4B9TA 4Y0FA 3VCDA 4RW9B 4ZJQA 2APOA 2VBYA 4JYAF 2HWIA 4RW6B 4A48A 2V8HA 2PA3A 4MK8A 2ATCB 4FYDA 2VPZB 2R7WA 2X7IA 3GFXA 3IGNA 3FC9A 3UD4P 2R7UA 1A9NB 4LT6A 4NXNF 3TUZC 1PJ6A 2M52A 3ILIA 3CC2S 3NGKA 2BE9B 2VQFF 2ABYA 2VD3A 4DR4F 4B9NA 2F3JA 1NKEA 3OQ2A 5LSLA 5IC4B 4W92B 1FDAA 1SV5B 1YSJA 3HHNB 2MXYA 1URNA 2RT3A 1REGX 1OSCA 1VFJA 4USWA 4ZCMA 1REVB 1S49A 4K2JA 4MKVA 4B08A 2QV6A 4CZCA 3PJWA 4FXWA 4N8OA 3HULA 1VBKA 4YB5A 1RAIB 4K4YA 1WACA 4ZIVA 3KTQA 3HHKA 3DHXA 1V3SA 2VPWB 5KFZA 2GQ2A 2XZWA 1AUSL 3M8PB 1HARA 3KUEA 1AROP 4QIGA 9ATCB 4ZA1A 2IHR1 2LQBA 1TL7A 4U7UK 3WDOA 4I1TA 5U47A 4KIAA 4N77A 1CJTB 5T14A 3RAQA 5J2MB 2OSRA 1RU2A 1IKYA 4NLYA 1TVRA 2LQJA 2G1HA 1M90T 2ZBPA 1SKWA 1FRXA 3AQOA 4B3TJ 4LSNB 2VASA 1VQ9S 2BA9A 4OZ2A 3TZXA 2G2YA 5CH7B 1DARA 3B82A 5IV3A 2ZNYA 2OPPA 1U8WA 1IKVB 5KG7A 1EKSA 1FWPA 2JSXA 3KLGA 2WBRA 1B70B 4O44A 4F0HA 1VC6A 4P7VA 4H54A 4P75A 1E6YA 2MSSA 3KK2A 1P6TA 3MMCB 1LW2B 4HTIA 2IY5B 5JMNA 4QIVA 3G6VA 3TEGA 5JVGQ 2DY9A 2FUG9 3TVZA 1Z2LA 4RNNA 2B4OA 4F4XA 4OMFG 1NSAA 2AX0A 2PO4A 2HVDA 2E1AA 1SL1A 2ASDA 2MQOA 1VCTA 2ZH7A 4AD6A 3H2LA 2YTCA 2CQPA 4N56A 4CCHA 1I51B 2W01A 5BR8J 4P71A 4Y34A 1JJ2R 1MSWD 2MKYA 2ZH8A 2XY5A 1U0HB 2KT5A 1CS4B 4DI6A 2CJ9A 3OXGA 1Q78A 4DG1A 1RWOB 2V4QA 2HFOA 2KVIA 2OEKA 4DU8A 2QL5B 4KY3A 5A8KA 1VQMS 2P9EA 4CLLA 2LECA 2J9CA 2M7SA 3GR0A 4KHPF 3BSOA 5A2QU 2WAQD 4NL5A 2ATLA 5D0EA 1U2CA 4LF1A 5HANA 2UV8G 1BHNA 3FQLA 3CJ0A 1YJ7A 4KGZB 3EDRB 3AH6A 2BOPA 1U02A 3KK1A 3Q8SB 1VDHA 2XMTA 4ELVA 4DQQA 2D3ZA 3C15B 3TP2A 3SQGA 1JX4A 3PG9A 3CD7A 1TMJA 2EFNA 5HVHA 2VFSA 4RLEA 2O67A 3S01A 3M6XA 1UVLA 5F8HA 2GX8A 2L9WA 1ZTWA 4ZKAA 2MY8A 4XAKA 3M2UB 1TKZA 1T9VA 1QAJA 3U1NA 5F0UA 1VRTA 2OD4A 3QT8A 2BQ3A 1IBMF 3FEZA 4F26A 3PW0A 3CNQP 2LLZA 1S10A 1C0TA 1URRA 5KG3A 3JAMY 4LFCF 4PZVA 2HVIA 2OELA 3MMAB 3QO9B 3GR1A 3LPYA 4TVAB 3OLBA 3KLFA 2RF2B 4TKTA 1GXUA 3CD0A 2MYFA 3DRPA 3ISNC 4ZHRB 1V5VA 3F0NA 2VF3A 3T1HJ 4LJMA 5KT2A 2F65A 4I2QA 5L1LA 2BKNA 3I0SA 3Q2SC 4XTTA 1H73A 2MJNA 3HVWA 1F60B 2WVFA 3HHEA 4GKJF 4WTYA 1RAFB 4IRKA 1VK8A 1AFIA 1AYEA 4PWDA 2LU1A 3W9JA 3K59A 3D6TB 2Z2YB 1IQTA 5M2RA 3NS6A 2IDLA 4ETXA 1QY7A 2VODA 1WTFA 3UR3C 1RAEB 1G6BA 2B9XA 4UQGA 1X4HA 4M94A 4JI4J 1KWMA 3KHHA 3WX4A 1OY8A 4DR1J 3CWJA 4DV5J 4RZRA 1LWFB 3C6UB 1WSVA 3LA0A 3HCXA 5RUBA 2HHQA 5HQMA 2ZHBA 4USVA 2MJUA 3FQKA 4X4QA 3W3SA 4OI0A 1U45A 2NZ4A 3P3DA 2XYPB 1UCNA 4L3NA 3GIJA 4A4JA 1RT4A 1XWLA 6AT1B 4M5MA 2FDNA 5HBMA 2VOOA 4WYLA 3AOBA 5J2PB 3NG8A 1N8RT 5F0WA 2HFVA 3GONA 3NCPA 2Z57B 3WX8A 2XSJA 4YMEA 1T05B 2KM8B 2DH8A 1XJWB 1JLGA 2YKNA 5KG2A 1XR5A 3K7RA 1RT5B 1VBZA 1B0TA 1YRTA 2NXNA 1BXNA 1SKUB 1PYOB 1Q4RA 3EZOA 1W2BR 2J0XA 1T94A 2P9GA 1OSDA 1KRPA 3GP9A 1I6JA 2I9SA 2PIIA 5HJXA 1IBLF 2V4JB 1MN7A 2I2YA 2EEYA 3G87A 4JBCA 2BANB 1HW8A 3NGSA 3R5BA 2HMIB 1YJUA 1N5YA 3R2DJ 3RYLA 3K58A 3SCKE 4KPYA 2CQIA 1PAEX 2AJ4A 5E5NA 3CJ5A 1XN9A 1EQMA 3TUJC 3EDQB 1RTIB 4DCJB 2ZE2A 4C8YA 5F8MA 1BQNB 4HHJA 1VRQC 3PNIA 1MW7A 5IWAJ 1VIXA 3TR5A 3U7JA 3QFHA 5F3TA 3IO1A 4Y6IA 1HBMB 1H7XA 2RAQA 1LXJA 2B4PA 3BF4A 2HRYA 4MFBB 2N4CA 1UJ6A 2BJ8A 1EAYC 5HN0A 7FDRA 4NXMJ 4UUXA 1AB8A 2ZH4A 3LF0A 2OSQA 1VRUA 3BO2A 2HGMA 2HNZB 3PXGa 4FN5A 2PFFB 3T1AA 1N6QB 2DGQA 4RW4A 5GAEI 2YY3A 1VC5A 4FF2A 3CCJS 3CULA 3W64A 1VBXA 5J1EB 1N33F 4EO6A 5GAHI 1W2IA 3BDPA 5LSOA 3WHIA 3M9OB 3KLIA 4DL0C 1MU2A 4L75A 1FE0A 2DTJA 1KTQA 4KAIA 2Z2MA 2C3MA 2JFKA 2DHHA 2W9CA 2H5IB 2NPFA 4C11B 1NHUA 3BSAA 2BQUA 2QLBB 3TI0A 3KJFB 3M1VB 3CTRA 2E5IA 3HFKA 3HK2A 1DTTB 3R9LA 5EWFA 1S4FA 2G1DA 2UV8A 5BJRA 1S6OA 2XGQA 1TL7B 2DVIA 2UXCJ 1S1VB 3MM5B 4PKDB 4U8VA 4K8RA 2LVWA 3E51A 2WBMA 3GE9A 2XMVA 1JIHA 2XSFA 3ITHA 1RP5A 1RI7A 2EFQA 1MLAA 5A8RA 4KO0A 3ZXWA 4JI1F 5KFNA 3K5PA 2CDQA 2AYEA 5ETLA 5LMUF 1K9MT 2VBZA 4NLWA 4KHRA 3HHLB 4NMXA 2DEJA 1RWUA 3GSDA 3BGUA 3PW7A 1WNEA 4IH6A 4QW9A 5HMZA 3DNCA 3D2WA 1T9YA 5B0EA 2CPIA 3D3CJ 1UP1A 2MSTA 3PM9A 4BWJA 1RSCA 4JB8B 3MWBA 1KN6A 5KFLA 2CJXB 4DFPA 1S57A 4F50A 4F02A 4IO1A 2V9WA 3QJLA 1WDTA 2BJEA 3RAMA 3EGZA 1WC4A 2G4BA 4ZVHA 1HMVA 3HVTB 1X4AA 3FVYA 2GAGC 3OR1A 2LXIA 1M5OC 2NYHA 1J5EF 2JX2A 2C28A 4OI1A 4CLYA 2XMMA 4X65F 4DCPB 3BGRB 4WFAQ 5GVQA 2OAUA 1NKCA 1XMBA 4M5DA 2VKRA 2YNGA 4DG1B 3ISZA 5KFRA 2C22A 1VLYA 3HF5A 1FD8A 5L9NA 2N4DA 2HPUA 2VG5A 4WJBA 4MAKA 1KKHA 2PDAA 1L3SA 2PGCA 4IKAA 2MLYA 5L1JA 3HP6A 1RA6A 3UW1A 3OJSA 4RNMA 2B4VA 2JVRA 3BR9A 4M1KA 4MJKA 3GQCA 1S77D 3D6HB 4ZP7A 3O3LA 3A13A 1P27B 2GHPA 3PJ9A 2VH7A 2QSFA 2RKIB 4YUDA 3KK1B 2DITA 2O66A 3W9HA 1U6BA 3CJ4A 4PRFA 2DHGA 1X31C 3I5CA 4PEOA 1DLOA 1NUEA 2HNDA 2R7TA 3C16A 2HZVA 2JVOA 1Q8KA 2CVIA 2XI3A 4PQUA 3T9ZA 2DCLA 3K8VA 3MM8B 4PXBA 2MKSA 3EWGA 2J9EA 1MWYA 1U49A 4KT0C 1D9FA 1XBWA 2ZEJA 1C0TB 5DLGA 4Y2MA 1ROFA 4RWWA 4L6V3 1DFDA 1T9XA 3KMQA 3AJ1A 1ZA1B 3KUHA 3EVMA 4O4GA 2WSEC 2KJVA 1A6LA 3DRPB 1BWEA 4FP9A 4I64A 1S6PB 4K5SA 2R2SA 2HG4A 3RTVA 2BVZA 2V94A 2WVCA 3RB0A 2POKA 3MPYA 1W25A 2OPSA 3GV5B 4E8UA 1FVSA 1VQPS 4DL3A 4E0DA 3A3NB 1NNDA 2CA9A 4HKQA 4ID5B 2WVBA 4OZJA 1N34J 2UUAJ 2HEKA 1EIYB 1SIWB 4NEZA 4HR2A 4Q7AA 1RTZA 4YHHJ 5CABA 3NNHA 5K8OA 3DOKA 4NLSA 2HWHA 4Y00A 1FTRA 2KM8C 1FE4A 1DURA 1RLDA 1VBYA 1RT2B 5CD4A 3FDSA 4JI8F 2J6TA 3JTPA 4NLQA 2VKZG 4ZCKA 4UZCA 1R3NA 3Q8VA 3H98A 5AE3A 2N82B 1HKAA 1MMLA 1DTQA 4I0WA 1RWNB 3OTEA 3MTJA 2B6AB 5HBMB 4RR5A 2W24A 1QE1A 3B4MA 1SQGA 2IBKA 9RUBA 3IC1A 2R7VA 1PBUA 2ZZTA 2OLWA 2M88A 3QSIA 1CJKB 2YKNB 1SJQA 1QM9A 1I5OB 2BMBA 1FKOA 2EC2A 4CH1A 1IWAA 3CJQA 4YN3B 5D8HB 5BYQA 2V2QA 1FF2A 2DXDA 1LWEA 1DQ9A 1Y4ZB 4M5JA 4GO7X 2CQBA 4RX6A 3UR0A 2MMYA 3J80U 3AOCA 3TJ9A 4PWUA 3NMRA 1RQ0A 4PABA 4P2MA 1GMWD 2W1BA 3BO3A 2HNYA 3JSRA 1TKXA 1P9QC 1NJIT 3GFYA 1IBKF 1S9GA 2AEMA 1Q86T 2DGTA 4NPOA 1IWGA 2D3UA 4Y2CA 3TVYA 1O8BA 3VR1A 4WXOA 4NA3A 5B0BA 2DHAA 1FX2A 1V3ZA 4WE1A 5KOXA 3FCVA 2ZE2B 5KT5A 4JI0F 3CJ2A 3I96A 4QW8A 5D0HA 1S7IA 3H8YA 5J2NA 1CJVB 3T9NA 3ADAC 2UUBJ 4JUZA 4NLOA 3OTDA 3NRBA 4X4VA 5M2PA 2F9JA 2DNNA 2ZC3A 2A3JA 5KFIA 4ZOSA 4O3SA 3DGVA 3IA0A 4ZVSB 2CQCA 2GJFA 2WW4A 4FS1A 1WI8A 4ILLA 1K44A 5CYMB 3KJNB 1QDUB 4EU0A 2B8QA 4HH0A 4LF5J 2CADA 4NLDA 2AU0A 3M8YA 2DPIA 4ZVPB 1RAJA 4QIWD 3M2VA 3R1LA 4JI5J 3VWSA 4Z7CA 2VOPA 3RR7A 2KXFA 4U67Q 5A0YA 1RCXB 2UXDF 3GG0A 2I8EA 4QYZK 5J1NA 4FXVA 4KC5A 4C3KA 3RU0A 4DN0A 2XS5A 3QLHB 3MECA 5LSRA 4JV2A 3OSNA 2VJUA 3ZNUA 2PI4A 1U8SA 1CULA 1NDPA 4IRCA 3QNWB 5E3QA 2W9CB 2B51A 2GMLA 5KFFA 4IOCQ 2KG0A 2UU9F 1U2RA 2N3OA 3LO3A 3EGNA 3HHLC 1N36F 1ZS6A 4NWBA 5LT5A 5IXUA 3KOAA 2J8AA 3A3PB 3VV2B 5KFTA 3POTB 2MZJA 3R7NB 3IGVA 1N0UA 4U7UD 1SH0A 4FKXA 4LRFA 2C2OB 5C25A 2CQ1A 1V5IB 4OZLA 2YWGA 3AXKA 4KTQA 4Q0BA 2H3EB 3V81A 4LR9A 1UZHA 3OSPA 1LNQA 1FTCA 4HH1A 2XY7A 1YJNS 4K4VA 4IYQA 1E6VA 1XK8A 3BH6B 4LF7J 3JB9k 4IFYA 3M4XA 1PGZA 3OL7A 1V6HA 2ZH1A 4UQTA 4I67A 1KVJA 1IUJA 1CEZA 3OFEA 3V6KA 3O8WA 5I3UB 1NDCA 2DGOA 2QLFB 2V2KA 1VISA 2ALYB 4AFFA 2JZ5A 1C4CA 3ILLA 2VV5A 4X4UA 4ZJOA 4YB6A 2V63A 3PIPQ 5C42B 4C8NA 4LFBJ 3KKFA 5A2QY 3DLHA 4OJGA 2JEGA 4AQYJ 2J0SD 1WSRA 1EARA 4XPEA 3PTWA 4JI2F 4B3MF 1F5BA 2Y1LB 2W9BA 2Y1IA 5IT4A 3U02A 1U1PA 3K8WA 2YNFB 3C6TA 5ETPA 3P5TL 4DR2F 4K0KJ 5I4MA 2FLOA 2YH1A 1JLQA 2OGUA 3DCAA 3RAXA 3DM2B 1TK5A 4ZP8A 5E7OB 1ICEB 2UZAA 4X66J 3UNGC 4CT8A 1M5KC 4ZPTR 3MEDA 5AXLA 4FVCA 1ZYQA 3BDEA 4EK2A 2C2KB 3KNGA 4O3NA 3P45B 4EWTA 2DJWA 2CJQA 2ZH5A 5DZ6A 1WELA 2HKEA 4IOAQ 1UEVA 2ASYA 3BPDA 4YFUA 3PYDA 2Z58B 2IRYA 5KG5A 1C0UA 1YHQS 2LU2A 1N56A 1FKPB 1EP4B 3MEGA 1HBNA 2R3VA 3BH7B 2R7QA 2PEBA 3FJ2A 4UW2A 2ZOMA 4WKRA 1HR0J 3JSMB 2YH0A 3TJ8A 1JLEA 1T3NA 2KU7A 3TZWA 3MCSA 2MKJA 4ZVOB 5A76A 1RT7A 4PPZA 1TKDA 3CMQA 2NS1B 4OFZA 2PC6A 4DV1J 5KFYA 5D78A 4WFBQ 2G0CA 1EX8A 3GFZA 1FFWB 2KO1A 3TANA 4ECYA 1DLOB 3NWRA 2QLWA 2HNDB 4PG6A 3HO1A 2VB6A 3C16B 3T1YJ 3ZTRA 3FEYB 1WKKA 4CLKA 4PQUB 3V2UC 1C1BA 1FRMA 1H98A 3FK4A 4DFMA 4L74A 1Q1KA 1HQEA 1L3UA 2ROEA 2Z30B 1R8CA 3PR4A 4DQIA 3N6MA 3MMBA 4FXDA 2V69A 1KTVA 2BW7A 1D8ZA 5EWEA 1R7IA 2GFFA 2I5JB 4RW8A 2M70A 4LF9J 4ECVA 1NH8A 5ETVA 2WOMA 1FXDA 2IA6A 5HLFA 2XMWA 4M5GA 3J81U 2WRMA 4EBDA 4N41A 4C3LA 4G1QA 3ZZ0A 1K47A 1RWWB 3P4UB 1F9HA 1S1WA 3UO0A 2ZFHA 1PKUA 4PYAA 2GIFA 3MEKA 4TQSA 2PSZA 2DRBA 5CQGA 2B5JA 4MYTA 1VHIA 4IQXA 2P5VA 1Q5YA 4A46A 2F63A 4B3TF 1OIAA 5IQQA 1JXEA 1F9FA 1NEEA 2MHEA 3IBFB 3IMQJ 4GC7A 4NI2B 2LP4A 1GX5A 1LWCB 3OL6A 2JC1A 2MB0B 4OYBA 2VBXA 1UFLA 3CJRA 1MG7A 3ZTPA 2XO7A 3IP0A 3GJTB 3AJDA 4ED7A 3FUYA 4OHWA 2HZCA 4GVLA 3KHLA 1Y5IB 2HZAA 4RW7A 5ETTA 1KS2A 4USTA 4ILMA 1RBLA 1UEKA 2WZ1A 2H4WB 2OKQA 3I0RB 1ZTTA 2MKKA 4DFKA 4M5HA 1PSDA 1LEOA 2XO6A 1HNXJ 4FBUA 3JQKA 4ZIWA 4YOEA 3L9ZA 4LBIA 3W2WA 3HDSA 3I56S 1XQIA 2XTJP 1FDBA 3NAHA 2DXEA 4FDFA 5BR8F 4M5LA 4K4SA 2C1EB 5A6PA 1HL6A 3V6JA 1HI8A 4JP8A 3IRXB 4DSEA 1R43A 1XMQF 2CQGA 4X4PA 3ZTOA 3NGDA 1JNRB 5LXRA 5D15A 1VI7A 2E29A 3OPKA 4ELTA 4KGKA 5CZVA 2YKAA 2UP1A 3SQOP 1SKSA 2RU9A 1BC6A 3M7VA 2R2UA 1UPPA 3CCSS 4NX9A 2YX4A 2EKYA 3HJVA 4OIXA 2A6OA 2ZUAA 2M8DB 5C5JA 1LW0A 2HBYB 2HNYB 2W7PA 1TKXB 3UDCA 4C8ZA 1CSJA 1KQGB 1S9GB 3M30B 3CC4S 3X3UA 4NEYA 1S7HA 1S9EA 2DYAA 3H40A 5A8WA 1JXVA 4OQJA 1SBRA 2DPJA 3K17A 3UQSA 4FPIA 4USUA 4GRSA 4LRBA 1VC0A 3RB3A 2MHNA 1HQUA 3M8ZA 3CC7S 4OHXA 5CAAA 3OUYB 3CJ8A 2FJXA 1IKWA 1X0FA 1FRLA 2BACA 3CIMA 3AFGA 3N28A 3QBCA 4A8MP 3DLJA 4CYUB 3V4MA 3EVWA 4PUOA 3B4DA 1WC1A 1RT6A 4Y2IA 2M9KA 2HHXA 1RLCL 1CLFA 1YKWA 4A8KA 4D3HA 3Q8UA 3KUGA 2H1YA 1BQMA 3MUMP 4QBUA 3BGFA 4CNZA 5GAEU 1VQ6S 2AZ1A 4IDKB 4WZMA 2XMKA 3MCNA 4IFVA 5GAHU 3M2VB 2JLGA 2RRNA 3E01A 1QLNA 2ZOFA 1MWZA 3G86A 3HHDA 3GV7B 4OYIA 3F44A 2K8GA 3M6VA 4LR7A 1U1KA 2B8PA 1PCAA 3HX9A 3H5SA 1T0TV 2XEXA 2ADCA 3J7A1 2CNNB 3IS9A 2JEJA 3T6BA 1L3TA 3CO0P 3KJQB 3MECB 4DL6A 3DOLA 2DNYA 3H7HB 3OXLA 2ZZMA 4WXWA 1IKXA 3C66A 1RTDA 2OPRB 1NPPA 2BJ1A 3K2YA 2D7SA 2VBWA 2M0GB 4C98A 5CD4H 4LQ9A 2C2EA 4DLEA 3GCXP 1FJ7A 2WB1D 1HBOA 3OT9A 2HGNA 1KHVA 2RU3A 3IXQA 3PHEA 3LPEA 5E0OA 4K7QA 1NHVA 1SI9A 3M8QB 4JI4F 5D77A 2Q66A 3VAGA 4MIAA 4DV5F 1S6QA 2GC8A 1JNZB 2E1CA 5F8NA 3DDKA 3D54A 3MUVP 3TRGA 2HHHJ 5KFJA 3UFCX 4KV8A 2Z0GA 1RWPB 4QYZJ 3EGWB 5KOWA 4OZ5A 1RHMB 4QIFA 4PQAA 5C25B 2RD5C 1AW0A 1WEZA 2AGPA 2J76E 2PMWA 3QZ8A 4CO4A 1U7LA 3SSSA 3NOCA 1E6VB 2CWKA 2RJZA 1JLFA 2FVRA 2V68A 1RJJA 3R6LB 4IFYB 1S97A 4RW6A 1TUGB 1Y9OA 1FT8A 2DNZA 2DNMA 4J90A 4LSLB 1W7WA 2XC9A 4ERDA 4CLSA 3H20A 3PFOA 3GPAA 5ADZA 2LDYA 4TLRA 2B9YA 2E5GA 5DETA 3BR8A 2HFSA 1SV5A 2XZDB 3MEEB 2V67A 1U25A 3D66A 4DPTA 2OFHX 4K5RA 3HFVA 1REVA 2GHVC 2NQPA 2MDAA 1BQXA 1SCJB 3N6LA 3W1YC 3C6TB 1KQFB 2VICA 1NO8A 4WFYA 3VAJA 1YGYA 5AXMA 2Z2ZA 1PC5A 1H0HB 1WC3A 3ONQA 1IJFB 4ED5A 4UY85 1BGXT 1SC3B 1X4CA 1CJTA 3TUPA 2YNIA 5J2MA 5DLFA 2BOAA 4DJBA 4RNOA 2YX7A 2ZC4A 4YS2A 5ETQA 3MD3A 1A0OB 3SCJE 4NASA 1X9SA 3TA2A 2AD9A 4NCGB 3NNCA 4C7QA 2W4PA 4KGXB 2B3TB 5L39A 2DNQA 4NXMF 2ZJQQ 1C0UB 3RBEA 3R27A 2O3DA 4W98A 3MEGB 4QWEA 1VQ4S 3K57A 1YBUA 3DGPA 1IKVA 4Z2XA 3FCWA 2ZJPQ 4NXNJ 1JLEB 2E1MC 1ZBTA 2IIHA 2XB2D 3DKDA 5FDLA 2VQFJ 3A1YG 3SIPB 1LW2A 2HS4A 4LRAA 2AJFE 4USMA 1K73T 4BLGA 2BEFA 1OO0B 2V9KA 2VQEJ 1XIQA 3BKUA 3CPWR 4X2BA 1UAWA 5KFWA 5B0CA 3O44A 3LH2S 5E3PA 4H4MB 8ATCB 3C46A 5ETKA 1DJ0A 4GO5X 4S0MA 4F25A 1Q5VA 1HNVA 4DL4A 3R5CA 3HXMA 1PG5B 2E44A 3RB6A 1DQ8A 3ZZUA 3CCZA 3BEGB 1YVFA 4NLXA 2DH9A 4YDDB 1WTBA 1U0HA 2CJKA 1EZZB 1CS4A 1J5OB 4ID8A 2OO4A 3KMSA 1HPZA 1RAAB 1SPBP 1N48A 1S1WB 3ZTQA 4Q2MA 5IC6B 2Z56B 5D3GA 2FJAB 3CCMS 2BABA 3V6HA 2F8MA 1UVJA 4MMOA 1HHSA 2H9ZA 4FYVB 3BS9A 1OPIA 2Q43A 2LEBA 1NXIA 2W8LA 4P2XA 1P9YA 3UD5A 1U6FA 4D3GA 1EB0A 1HA1A 1JLBB 4NZ7A 4Q44A 4OYZA 2V50A 1ZZNA 2ZDPA 3K5LA 3CDAA 4NZ0A 1HW9A 4IRDA 4B17A 3C15A 1NK0A 1YRUA 3W5ZA 3DYAA 3JTNA 3DU6A 5DJBA 1N32J 3RBXA 2MZQA 1T95A 1RT3A 4TLQA 4TU7A 4FF4A 1RHKB 2HS3A 3C2PA 4W90B 3N0VA 4EFAC 2PN6A 3M2UA 2HLUA 4OI3A 3TA0A 3MPVA 2RUGA 1L3KA 1K8AT 4C8OA 4F4YA 2VZ9A 1NAQA 1WF0A 2OFGX 4H4OB 3MMAA 1VQ7S 5J1PA 2XS2A 2RF2A 2QMXA 2GNKA 4OV1A 2ZM6F 1G4CA 1KNZA 3W5XA 3CCLS 4ZHRA 3I9V9 4J9NA 3D6MB 5ETOA 4EYIB 3GCWP 1VGYA 1SQFA 4QR2A 3H4DA 3C14B 2W8KA 1R89A 5KFPA 5ETSA 1UETA 1T9TA 4KHPJ 2EI5A 1C1CA 3ETOA 2P9CA 2ILYA 1OQ3A 2RSQA 3K5NA 2Z2LA 3MR3A 3CDWA 3QAEA 1Y7PA 3LQVA 3EXYA 3IR6B 5KFQA 2KFNA 1KFSA 2KFZA 3FZBA 4DV3J 2XG8A 1NU4A 1LWFA 2GIRA 3C6UA 4LBPA 4P2SA 2CJAA 1FK9B 2QN6B 1HI0P 4ICLA 3IG1A 4KR0B 2PT0A 1T02A 2YKMB 1RT6B 1NZ8A 2DNGA 4DLGA 4FNHA 2FB0A 2UVVA 4YB7A 2CKWA 2R7SA 2CPEA 3VQTA 2IVFB 1VJQA 1FCAA 5HO4A 3FGVA 1NBEB 1FXLA 2IPOB 4Q2LA 4IFVB 3KHRA 4WBFA 3E01B 1RT5A 1R8AA 3QSYB 2DY1A 3TZYA 4F4ZA 3N5FA 3D67A 1M0SA 4J5OA 4Q5VA 2MZTA 1BWVA 4ETZA 1FNMA 1X4EA 2GA7A 3IS9B 1WG4A 2V4JA 3RGIA 4KGMA 3UE2A 2YBVA 3DOLB 3FEXB 4GKJJ 3PYEA 4DWIA 2HMIA 4GKKJ 3R8YA 1FKAF 4HL9A 4R25A 3PX4A 1WJ9A 3F41A 2FHMA 2KG1A 2QLXA 1QSSA 2MQ8A 3K89A 3OXFA 3W60A 4A8QA 2BM1A 2CNLB 3TAMB 1LFPA 3SV4A 1RTIA 1BQNA 1QJHA 2HHWA 5DDPC 4PCQA 3S8SA 3UVJB 2YVSA 4KV8B 1HBMA 1F5CA 3NBPB 2GVDB 4MFBA 2DNKA 4P2FA 2EFPA 1CQNA 2HFUA 4TY9A 1OS5A 3CVKA 2HBQB 2C42A 1NJYA 3MAAB 4M5NA 1JLFB 1X7VA 2KKHA 2HNZA 3MCMA 3QGPA 3FRZA 3QRRA 3PJXA 4RU9A 3TWZA 4U96A 5E33A 3H59A 4NYZA 4C3MA 1UL3A 3QZ7A 1HQ2A 1N6QA 3MURP 2FHJD 3T5KA 2ASJA 4ECXA 5JXSA 4WP8A 1TKTB 5J1EA 2MQPA 2FY8A 4PXCA 5JVHQ 5DS7A 4KJIA 2DHSA 4YY3F 1IBLJ 1WOPA 4URGA 3OLAA 2NZCA 4AL5A 2CQDA 4IG0A 2DNOA 2DO0A 1S0VA 2G0IA 2Y8WA 3T5LA 3L95X 1T7PA 2NUHA 4C11A 2RUSA 2QA1A 4TQRA 3DI6B 2OJ3A 4KKOB 3M1VA 3I4PA 2XNQA 2AJ1A 2YXLA 1RAHB 2BE7D 2UVUA 3Q83A 3A8IA 3DLGB 3MXHP 1C4AA 1DTTA 2E9ZA 5T7LB 2R2TA 2JFDA 2KFYA 5B7WA 1KLMB 3CO9A 3R3TA 4OX7A 1NSPA 4G3IA 1F1BB 1RISA 2D41A 2EW9A 3JSBA 3BQ2A 1S1VA 2YNIB 3MM5A 2IAJA 1VHFA 1FJCA 3O1LA 1KD1T 1UWAA 3PFEA 2J5AA 2H5JB 3Q8RB 2YPZA 5EX0A 4GVBA 3ET6A 1RXOB 2N3LA 4B9SA 2Q1LA 4UY8T 1WC0A 2E66A 1UVMA 3MFHA 1ZETA 1FJGJ 3HHLA 2QEXS 3CMAS 3LANA 3EE3A 4LF5F 5CCMA 3J81Y 4Q8EA 3DGPB 1B99A 3M8SA 2A18A 3NLCA 8RUCA 4JI5F 2ZD1A 1LQ9A 1N33J 4CO2A 4ED3A 5FDLB 1TQLA 2RMLA 4J91A 3CEDA 2F8HA 2MGZA 4IG3B 3RRGA 1HWLA 2E1PA 3L09A 1R0BG 4A8YA 1DRZA 2GQQA 2AJ0A 2WHOA 1LV5A 2YWKA 4MT1A 3BB5A 4DR7J 3HVTA 3ZO7A 1YDLA 1KVKA 1U48A 5D6GA 4DV4J 4RNFA 1P1TA 2FJBB 3QGHA 4F3MA 2YKQA 5I3QA 4UOHA 1HNVB 5IQ6A 4I2PB 4ZN3A 1M5SA 3W62A 1PO6A 2V8PA 3BGRA 1UW4A 1O0PA 2R7OA 2ZNZA 3QRQA 2GO8A 1HPZB 3BV8A 2LQ5A 2XMJA 3AA8A 5D3GB 5E3AA 1R27B 5HP1B 2B9EA 5DO2A 1PJ5A 1WEXA 4O3QA 5HVGA 3JYTB 1JLCB 2F7VA 2FC9A 2CQ3A 3FSIA 2AHOB 1WORA 5DG8A 2ZVSA 2IM2A 3MZIA 3AB4B 1AFJA 4DQRA 3SMZA 2ZJRQ 4LF7F 5J2QA 2LYVA 4BHQA 3HSZA 1TV6B 4A8FA 4C9DA 2CPXA 3KK3B 2BR0A 1RWVB 3KYLA 1VIOA 2VFRA 2RKIA 2LXUA 3M6UA 3UI3A 2H4YB 3EZ5A 1N5SA 2XMAA 3OFFA 4RUHA 2DNRA 3DYAB 5IM0B 2QIFA 3HM9A 1RT3B 4R8UB 1RHQB 3BBCA 4NRUA 2MKCA 3P96A 3BQ1A 4AQYF 3N5BA 2E7VA 3LUYA 3O6QA 2DGWA 2I1RA 3MM8A 2XLJA 4RJVA 4QYRA 3GG1A 1U1RA 2QA2A 4C8KA 3JQJA 2FLNA 2ZDOA 3GLJA 3M32B 2E7XA 2CRLA 1Y3JA 3G2XA 5B0GA 2RVJA 3ZNJ1 4DUYJ 4C8LA 2GHWA 6FD1A 1LK7A 1S6PA 2IC3B 4LF8J 3CJSA 2QX0A 1HNZF 2WW8A 5CA5A 5G0RA 2XMUA 4CM2A 1PAUB 2M4MA 1OY6A 2J9DA 1C1CB 3KNAA 2BE2B 1EETB 4ID5A 4DR6F 2XYGB 1N52B 2K06A 3D0HE 4PR6A 2UVRA 1IR1A 2IJNA 2W2PP 1HR0F 4ALZA 2VIHA 3MD1A 2GVZA 4NLPA 1T11A 4R5PB 2GS8A 2XS7A 1XNRF 2F1FA 2WSCC 3TARA 3BSNA 4LR8A 3PR5B 1RT2A 3KG4A 2AJQA 4ICLB 3IG1B 4QWBA 4DV1F 1HD1A 2V4RA 2IMWP 7FD1A 1SUQB 3PHTA 4DV2J 2HSEB 3T1YF 2I0XA 4CLZA 2AGOA 2B6AA 1UJ4A 3TYTA 5B0DA 1NMEB 1NK9A 3CD6S 1S1XB 2KT2A 3BO4A 3KLHA 1D9DA 4KYZA 5KT4A 3N9UC 4ZP6A 2HFNA 1CJKA 3SV3A 2DRDA 2C2DA 2EVZA 4LF9F 2L9NA 3T6JA 2E9RX 3GZ7A 2YQ0A 3AQPA 2N7CA 1D3WA 4WU2A 1SJRA 3IFEA 3WBZA 2R42A 3TX8A 2D9PA 5IS2A 3BGOP 1FJEB 1KHWA 3DLKB 2O01C 4KE5A 3Q89A 4Y2KA 2GJ2A 2AEJA 3T41A 2J8SA 2UUCF 2NR0A 2P2CB 3ENVA 1U1MA 4LF6J 4XPCA 1WUUA 3A4TA 1WC6A 3ILJA 2VA3A 4QWAA 1TUVA 4ZPAA 3GYGA 3W8GA 1H6KX 1JWWA 4OZ0A 5GAGU 1S99A 2LQ8A 1BY9A 5DQHA 2GAHC 5HMXA 3D0GE 3UN3A 1HWKA 1CJVA 4ECQA 4LF2A 2P8IA 5KFOA 1WHWA 1FO1A 4QCLA 5C24B 2PMHA 5D0RA 2J7KA 3W65A 3HKZD 2K3IA 3IM8A 5CYMA 2LA6A 4O3PA 2MLXA 3CB4A 4ZVRB 2GCFA 4UUWA 1OWXA 5DDQC 2FJDB 1Q8LA 1UW9A 1FWLA 2VC0A 4P72A 4J9QA 4O3OA 4DN9A 3I87A 2AP6A 3C3LA 2R9LA 1DBDA 2RH3A 4H4KC 3OW2R 5AE1A 4DX7A 2MLZA 2YWHA 5F8GA 3LP0B 4EGLA 1X0PA 3THPA 4NLRA 4CTAB 2DCUB 4IG0B 4X84A 3QLHA 2DGUA 2WK4A 5H9FK 3CJTA 3AJ2A 1MWQA 2HAFA 3BN4A 3SDEA 4OJ3A 2VU5A 2K2PA 2GGPB 2KI2A 1R8HA 2FC8A 1RACB 2QA4S 2DR6A 2YWFA 1SVDA 5H1SV 4EZ6A 3I5AA 1H2VZ 4F7VA 2FZGB 2XGPA 2VG7B 3ICLA 1QAIA 2RHSB 1TTHB 1Z4UA 2QL7B 5BYSA 2ZKUA 4F0MA 4OJHA 2IAJB 3POTA 1ZPVA 1M1GA 4F67A 1RTHB 2MZRA 4XK8C 1LOUA 3ZZOA 4GVBB 3PX6A 3ET6B 3BPSP 3RW7A 2XLIA 1NZAA 4BC9A 4LIWA 4CQ1A 2C2MB 2GZOA 4N5SA 2X3GA 3QIDA 4BBYA 2XLKA 2R2RA 2IRUA 1H2TZ 2FHOB 3BKFA 4A8SA 3KHGA 4N47A 4FYYB 4RKUC 1YK9A 5KFXA 4NYPA 5I42A 4N8NA 3V4IB 2IM1A 3THVA 2FVCA 2ZD1B 3IN5A 3MOZA 3FBFA 3I31A 5I3UA 3KJVB 3ENQA 1OYDA 4NA1A 1HFEL 2MGZB 3MM7B 5C42A 5FLXU 1MROA 5F9LA 1P8GA 2VUGA 1YITS 4DSJA 2WVEA 3P5BP 4PG4A 3CDEA 2W2NP 1QAXA 2XYHB 2YNFA 2G13A 3VHQA 2HLTA 4Y28C 1Y3KA 3IAM9 3DM2A 4DPXA 8AT1B 1ZOTA 4OHVA 2O5DA 4Z37A 4P6QA 4QZVB 2H54B 2UXBF 1PYSB 1D8YA 3AD8C 5HMYA 3ZC4A 2DH7A 1UA0A 3J7AN 3LP1B 1ITPA 1VS3A 2HHHF 3H5XA 2X1AA 2RRBA 1X5OA 5FJ4A 1FEHA 3RBDA 2GJIA 1X4BA 2B0GA 1NK8A 1K0VA 4R0JA 3D9BA 4OZ1A 4RUCA 5DM7Q 4WIIA 3EGVA 4CLFA 1FKPA 5K14B 3W63A 1EP4A 3MR6A 1G2EA 2G2ZA 3B8HA 3BM7A 5J2QB 3OFHA 1GX6A 3UNYA 3IR7B 2ZBIA 5D0GA 3L4BC 3JSMA 2N7YA 4LFAF 2WB4A 1QSLA 2EFOA 1U4BA 3OTCA 4I68A 1U1LA 3UDLA 1F3FA 2P6SA 3NAIA 2QMUB 1RBOB 4OL8A 1S4EA 3TA1A 4L76A 2HBRB 3W66A 1ELOA 5LMNJ 2RRAA 4CM0A 2FVPA 4B3MJ 2NXEA 1H7WA 3MR2A 2MQLA 1S0NA 2UUTA 1FRHA 1Z1ZA 3D28A 4MKAA 3H4BA 1N5VA 1SC6A 1W26A 5DGAA 3HZGA 3ILOA 3CXCR 4B3SJ 2I5JA 2XM3A 3L7OA 3GYXB 3N6NA 5SUHA 2AMCB 1WOSA 2L08A 4EMDA 3KG1A 2QZ8A 2C2RA 4USJC 4C8MA 2FHKA 4U9RA 1RUSA 3DOMB 1C2PA 4DX8H 1GAOA 4P9SA 3DLBA 3IBWA 3AXMA 5G0RB 5EUHA 2AEFA 1UWBB 4AUKA 4LF4F 4J9UE 2RQCA 5CHCB 1TFYA 3PVXA 4HI1A 2ACMA 4ZPVR 3C8YA 3OHAA 3VVTA 2WVDA 5D4OA 4NI2A 4LBHA 1X5PA 1NHKL 1LWCA 1AT1B 2QT7A 1S0MA 5EN1A 4OX8A 2GVZB 2EPIA 4FS2A 3D1QA 3MDFA 4DR5J 1UVNA 5AE2A 2BJ9A 1RAGB 2Q3PA 1KFDA 2J6SA 2BV3A 3RZAA 2E5LF 4WIQA 2RE1A 4FZVA 3S1TA 1S79A 2ACYA 4HHHA 5GADI 4CH7A 2VQEF 4RU2A 2CYYA 4RNHA 4HT5A 4TN2A 5KG1A 3I0RA 2D3O1 2VA2A 2VG6B 1N5TA 1X60A 4HHUA 5IFMA 5AXNA 5DG7A 3V5RA 1ZM3A 5ETRA 2AJ2A 2IMOA 2A2CA 3KLHB 2W4DA 3GJRB 3Q86A 4PG7A 3Q8QB 3G6XA 2HIYA 1ZAVA 1JMTA 2A1BA 3IRXA 3FZ2A 2CWXA 4ED0A 4F4WA 2H48B 1FNOA 4HACB 3GFHA 4CP5A 5KFBA 4OJ1A 2BRLA 2AYGA 1HNIA 3G82B 1D09B 1NK7A 2QTWA 4FBTA 3BYPA 2NREA 3DLEA 4DV6J 1KP6A 1HNWF 1QUPA 3SBMA 1MMDA 5DRKA 1XMOF 1UZDA 2RIJA 4Y3CA 2HBZB 5AJ3J 3DRSA 1A7GE 4DV0F 3BBBA 1FI4A 4JI7F 3DU5A 4J9PA 3EJMA 1T03A 1HBUB 3GJSB 2ZH9A 3M30A 4ECSA 3TW0A 4DFJA 4JV5F 4P74A 2AF6A 4J9VA 1IR0A 3DXSX 3GILA 4ZVQB 1U1QA 1VQYA 3OD2A 2CPHA 2YWWA 2QMWA 1YIJS 2HAIA 2J7UA 1HHTP 4DR3F 3EX7B 3SI8A 2EG1A 3KLEA 3OUYA 2D3OR 4RO0A 2R8IA 4CYUA 2RQKA 1XTZA 3LAMA 3CJKB 3QFWA 1N32F 3R2CJ 1G7CB 3RRHA 2HW3A 5LXYA 1RWKB 2LKZA 2QLJB 1O5JA 2FVSA 2X51A 2DNHA 1Y0HA 3JQMA 1NK6A 2D74B 1WHXA 2IYIA 2IM3A 2BX6A 1FERA 4NCBA 2DNLA 4IDKA 1UVKA 4FPRA 4NMLA 4I7FA 3PEJA 1XMQJ 1TL1A 3U1MA 2Y9HA 4NLUA 3H0PA 1VQOS 3NL0A 1KVIA 4WU3A 4V19J 3LALA 2X1GA 4DQPA 5CXTA 1Q0NA 2CQ2A 3HMJG 1XNQJ 4P10A 4MK9A 3JTOA 2QJ3A 2YNHA 5EWGA 1DAXA 1H72C 3UCUP 3ZFVA 2XNRA 4CT9A 4O3RA 2J7WA 1NLKL 2OH2A 4ANCA 3SDEB 3Q2TC 2J0QD 3VAHA 2EWHA 2OPRA 2HQCA 2PA8D 4MIBA 3QT7A 2HVHA 3HSGA 3ISND 2CVEA 1RCOB 1YJWS 1SH3A 4KBIA 4QU7A 1RT1B 3PIOQ 1HYSB 5B09A 3CD5A 2BUNA 2RQMA 3M8QA 3PACA 2F4VJ 4DV3F 2E9TA 1CPZA 5KG6A 1FD2A 2DIUA 3ENAA 1NCLA 2NSBA 3IWXA 1AZSB 4EO8A 4ZDNA 1FXRA 4CLWA 3MMJA 4OZ3A 1LKZA 1SC1B 4JI3F 1SJ1A 2FLLA 2R8HA 4OI4A 2MKIA 1PIEA 4ZLPA 5H9FJ 5KT7A 1KDNA 3MM6A 2F4FA 3EYZA 3R97A 2IYGA 2OP5A 3I55S 2ROGA 2FZCB 2V0NA 2ALZA 5DG9A 2COLA 4ZVUB 1SJ3P 3AD9C 4LSLA 1SXLA 1AXQA 3VAIA 4I6AA 5I42B 1YBTA 3R1HA 3X1LB 4URSA 3MM9B 1O6XA 2VPYB 2KYZA 2B43A 1WC5A 2HURA 4B3OB 4DS5A 3MEEA 1MROB 5B08A 3P49B 2LCWA 1HD0A 5H9EK 2B7BB 2HQFA 2HVZA 4GKKF 4B3RJ 4ZPWR 4IUFA 2Z4PA 4OX9F 4KSEB 5KFCA 3QMQA 1FRJA 2K7JA 3BBFA 4X64J 5K5MA 2HQIA 4ZCIA 5D4LA 2CDRB 4DBQA 3BQ0A 2V8VA 1F0XA 2W2OP 1SQEA 1FA0A 2VPXB 4LREA 4LRCA 3LP2A 2AWZA 1Q79A 2A0FB 1UFWA 2I6WA 5LM7E 5K8NA 1NPRA 2HHUA 2PMZD 5CCLA 2IA0A 5LJ5Y 4OHYA 1TL5A 3T19A 4ANEA 4TU9A 4YR2A 2KYXA 3RBZA 4NCGA 4UOFA 3EM1A 5C7PA 3GV8B 3R7SB 1X9MA 4I6YA 1B7FA 2OEMA 1S1UB 2C2NA 1EKRA 4IOBA 2BM0A 4WZQA 2D69A 3MR7A 5BYRA 5L46A 1K0TA 3TAQA 3D5MA 1PYTA 1Q7LB 1RTJB 2RILA 4QPTA 4O4RA 2AW0A 2ADBA 4DPWA 2O1PA 3DRYA 1WI6A 3ZZZA 1L5UA 2E5HA 3M05A 2QA4G 2FHJA 3E8OA 1YZ6A 2W2QP 1NJXA 1M1HA 1TUWA 3I4HX 3HZEA 1S6UA 4UOCA 2L41A 4YR3A 2OEJA 4DSIA 2Q6CA 1CJUB 3MGJA 1FDNA 1Y5NB 5KAKA 2IDEA 1KLNA 3SEOA 2CQ4A 1UA1A 2G9OA 1FFGB 1VQSA 2C3UA 2QC3A 4IH7A 1YQHA 2W7AA 1DY3A 4WK3A 3G71S 2HS0A 4L73A 4H4MA 1Q53A 3W2VB 4OV6A 1FRIA 2LEAA 3CIZA 4OYOA 3DRRB 1S76D 3D68A 2BXJA 2ZUGA 1TL3B 1GMUA 3IBCB 3O5TB 2CFXA 4OYMA 2QL9B 3GSIA 2RS8A 2BDPA 3QT6A 1WEYA 3B78A 5KFGA 1J5OA 3VTIA 5KTQA 5A6WA 2K1RB 2R7XA 2DR9A 1N0VC 3OR2A 5F8IA 3V6DB 4PG5A 2DXFA 5F3ZA 4PYDA 3THTA 3MOJB 3UDVA 3LOUA 1HWIA 2PFDA 2QRRA 2CUYA 4F2SA 4ZMMA 5IT9U 3CCWA 2JJ4D 2KXHA 3QWUA 1I3OB 3PRDA 4OYAA 4Y2AA 1UEUA 1F9EB 2F9DA 2WSFC 1FJGF 4WK1A 2V34A 1U09A 3BJYA 2JHEA 2BJ7A 4MKYA 3A8EA 1JQGA 3BGLA 1GH8A 1JLBA 3TVKA 1PBAA 3HI9A 2D9OA 1SJFA 1KQSR 4HI2A 3DC2A 2LEPA 3UCZP 1NPKA 3J7Z5 3OFGA 1WDDA 4ED8A 4PXEA 3ULHA 1KOHA 3OTOJ 1YJTA 3PW4A 2XBPA 3EMTA 5IT0A 3T3FA 2ZWOA 2RHQB 4LRDA 2V5HG 2CZ4A 3I32A 1S12A 4KPCA 3VF0B 4DR7F 1CBKA 4KHMA 2VL1A 1RKIA 4LIRA 4DV4F 1IN0A 2MQNA 2AYMA 3CGIA 4H4OA 2FJEB 1YG0A 3TNVA 5KG0A 1GEHA 2LQ9A 4DU7A 4L72B 4AL7A 3FMBA 1FWKA 5CZXA 1XERA 4X62J 5ITHA 2RNEA 1RWXB 1U47A 1HNIB 1FX4A 4RBUA 2ZHAA 1FNXH 5GMEA 1IKYB 3TJAA 3DLEB 1Y11A 1TVRB 1QTNB 4DUTA 4J9KA 1Q8IA 2AV5A 3AY0A 3DRSB 4JI6J 4YP3A 3C14A 1N4LA 1NJZA 4P52A 3A8JA 1T03B 3WIUA 1JJCB 5KFKA 5F8JA 4XO0A 3R5JB 2KJWA 2C3YA 1B0PA 2ILZA 2OPPB 3VAKA 4I56A 2LXFA 3KLGB 4O44B 4NYOA 3GB0A 2U1AA 2R4FA 1E6YB 4RBVA 3KLEB 3KK2B 2K7KA 2ERRA 2CQHA 2JEFA 4IH5A 4FNIA 2FD2A 4ES1A 1FK9A 5K8MA 4LSZB 2MZ1A 1HHQA 3JS9A 3SFUA 5L1IA 4OHZA 1IXKA 4NOHA 4V1Ak 2YKMA 3M9NB 2FQQB 2NUUG 2H5EA 4P73A 3PRBA 2C3OA 2DT9A 3R5DA 3RG6A 1R6YA 3R5AA 3CJ3A 4EBEA 1PILA 1N88A 5GMKa 4ED1A 4DSLA 3PV8A 2V8DA 1QAYA 4I7FB 4CI0B 3CCQS 2ZM6J 1TL1B 3PEHA 4Z7YA 3RJMB 2HQDA 4PXDA 5HVFA 4DPOA 2EFVA 3CCES 4DUYF 2NXCA 2KT3A 4LF8F 3UDEA 3T1HF 1I94J 2DO4A 1VQ8S 1YLXA 3MAQA 4ED6A 2OHDA 5A8KB 4ED2A 1R0CB 2YNHB 3QPIA 3QQCD 2QFIA 4P7TA 2Y8YA 2EBGA 3J7YI 3QT5A 1KC8T 4EEYA 1J2VA 5EGYA 3GIMA 1IJEB 5KFSA 4DZDA 1MNEA 5ETNA 4G6VB 2BJDA 5HL7Q 4F8RA 4IO9Q 5FLXY 3TAMA 4TY8A 4FF1A 2GIQA 2IVYA 4RL1A 4BWMA 5M2UA 4DDFA 4DR1F 3MUTP 3KDNA 2QO3A 4FKYA 2H51B 2HIQA 1T9WA 4ELUA 3DN9A 3SQGB 1X5SA 1X4DA 5HJYA 4DUZJ 1AUDA 4IR9A 1R6VA 3SZ2A 4PAAA 5GAGI 3UVJA 2JLEA 2FLPA 3NBPA 2GVDA 4LUBA 3I6PA 4USKA 1TKZB 2CPJA 1FDDA 2DB1A 2M3DA 3MM6B 5HK4A 3E3XA 4DV2F 4JOUA 3PZPA 3GMGA 1VRTB 2BQRA 4MIWA 1IQZA 4DQSA 1LFWA 3G4SS 3MAAA 1NKBA 4DV7J 1RWMB 4TYAA 3MPWA 4HDHA 1SIZA 2BYCA 3KLFB 1NK5A 4M95A 5MLCV 1YRXA 2DGSA 2H65B 4DZ6A 4DX6A 3NKYA 1U6ZA 2FGOA 1TR0A 3N4WA 2FPHX 1TKTA 5GMDA 5JJBA 4U95A 4EI2A 2HHPA 3NGRA 3QGIA 4EZ9A 4I2QB 2FGCA 2XCPA 4AE5A 3I0SB 3KDOA 4ZITA 3PRVA 5KFMA 1RA7A 4ES3A 2AZ3A 2X3DA 3NOGA 1S5ZA 3CCRS 4AL6A 5CYQA 4J9SA 4PWDB 1QSYA 4M8LA 3HPOA 4LF6F 3B54A 3SSRA 1WHVA 4ECTA 3D6FB 4ZCLA 4ED4A 2RDJA 4CO1A 3DI6A 3TQ1A 4KKOA 2Y1JA 3CF5Q 1YJ9S 2B4UA 4H4KA 1CG2A 3DLGA 3EICA 4M5KA 1N54B 3FNNA 5T7LA 2CJYB 4L3KA 4JV0A 3LP2B 3EZUA 1KLMA 3QRPA 4OZNA 3W61A 1XR6A 5IWAF 2QFJA 1R0AA 2L48A 1D9AA 1V9OA 4XIUA 2VDHA 3IWLA 2JRSA 1RB0A 3H5YA 4X4TA 4F04B 5H9EJ 1JB0C 3CSKA 1RT4B 1ZZFA 3I9ZA 3CCTA 4I6WA 2D1CA 1H3DA 1S72S 4JYAJ 5KFUA 3UPFA 5KFVA 2XSJB 4KQZA 4UOGA 1VYAA 1Y00A 3NCQA 3A8KA 4RWXA 2XCAA 1JLGB 3S6EA 1YBAA 3GWCA 4ZPCA 1F5AA 2HHVA 1X9WA 2X1FA 4C0BA 1RU1A 4O0NA 3VGTA 4DCOB 4ZPBA 4A8XA 1B4SA 2A10A 4DR4J 3RB4A 4YY3J 1VMBA 4ATNA 2CPZA 4FVMA 3W9IA 3A3OB 3LAKA 1B7YB 4IG3A 1UMJA 4A8OA 3R7BB 3T5HA 1IVZA 3U1LA 3VAFA 4RBTA 4WTOB 4AYBD 1N5YB 4F4AA 2HYIB 4XDCA 1S9FA 1OPZA 2VHGA 1ZAXA 2NPIA 3HSJA 4K4WA 1SC4B 3AODA 2YKOA 1Y5LB 1MMNA 3MR5A 4ZVFA 3M2RA 1Q16B 4TXSA 3MI7X 4X4SA 2ZVIA 4J9MA 1RDRA 4I2PA 3ZZPA 4I69A 2OTJS 3OV7A 3EPIA 4AXIA 2XHCA 4B9UA 2UXCF 1KONA 3MCOA 2KHDA 4CDIA 3OR2B 3MF5A 3VVUA 4FYXB 2HK2A 3M8WA 1GTHA 1I1GA 4A47A 2Q79A 5HP1A 2AT1B 2XULA 3Q0AA 1GT8A 2PI5A 4NLGA 3H2UB 1XC9A 2P6TA 3HHLD 3Q23A 2Y3YA 4YB1P 3JYTA 4E98A 1JLCA 3BYRA 3VZHA 3NEKA 4C6AA 2DR7A 3HFZB 1ZM4A 2JC0A 3QWPA 1VRUB 1KBRA 4QR0A 4GC6A 5LJ3Y 4AXJA 2ZITA 1X8DA 1BD6A 3HT3A 3BKTA 4WFZA 1VQLS 1FESA 4G1IA 2AYBA 1P1LA 4WYWA 4K4ZA 4RW4B 3DXBA 1TV6A 1NSQA 3I82A 2AX1A 3KK3A 1WWHA 1TK8A 5K8PA 4CO3A 2W4CA 1WG1A 4NLTA 3P8BB 5HMWA 5GADU 1VQ5S 4WWSA 2J6UA 2YX1A 3HD2A 1U2FA 4J9RA 3FFIA 5IM0A 3EVOA 4R8UA 3KLIB 4X4RA 1MU2B 3NCRA 5HQ8A 4C48A 1AA1B 3OBIA 3J7ZT 4X4NA 3Q8PB 3GIRA 4M5IA 1TZ0A 4M63A 4ANDA 4LVOP 3L3CA 1GQEA 2OTLS 4CLTA 2B56A 3M32A 1R8PA 3PX0A 4BS2A 3CDUA 6FDRA 4DF4A 1NK4A 4MTPA 3W8PA 1JLAA 1JKHA 3SCLE 4HTJA 4EYHB 1BUXA 3VZIA 3M8RA 2YKPA 3MFIA 2DKOB 7AT1B 2IC3A 2F5GA 4HVZA 2ROPA 3AB2B 4MKBA 3ITHB 4QU6A 3PYGA 4WF9Q 2JNJA 5A8RB 4ILRA 4TYBA 4DPYA 4KO0B 5E3CA 3G8SA 3AOAA 4ZLLA 3GYNA 5EDWA 1ZH5A 3G6YA 3IWNC 5HAOA 2BRKA 2ZH3A 1WD6A 5JUMA 3K0JA 2M2BA 2BE2A 2BW2A 4DL7A 1EETA 4ECZA 2DR8A 2KDOA 5LOQA 4ZVTB 3PCOB 5SZTA 4W4MA 4K4TA 1VLOA 2MQMA 5LL6d 3M6WA 3HT0A 2M5YA 3RW6A 4AT1B 5FD1A 1YX2A 4R5PA 1X4FA 4N7TA 3K5OA 2C3PA 2KXNB 4LQ3A 2DGVA 5LMNF 4KB7A 1SUQA 3G9CA 1KQKA 4F3QA 1HMVB 1IBMJ 1S0OA 2IJFA 1GMVA 2JH3A 3PW5A 3FMWA 4ZP9A 1WKJA 5EHHA 3WQPA 2ZHOA 3OR1B 1FFSB 4LFCJ 1S1XA 1TK0A 3PW2A 1TMMA 3AA9A 3GIIA 2KH9A 2ZKTA 1YTYA 1HI1A 2FVQA 3FBCA 1G1XA 4B3SF 1VQNS 3S7RA 2YWEA 2MQQA 3OHBA 1FRKA 2DBBA 1S48A 2RDDA 1SB6A 4QWCA 2V2VA 1YJVA 1OYEA 4M5DB 5F8LA 2YNGB 2RDIA 1CVJA 1S1TA 3HSDA 1HNZJ 1BE4A 2XWXA 3DLKA 3I5BA 3GTYX 2GMHA 3R6GB 2CJBA 4NCAA 2VG5B 3KWMA 3MAHA 4V19X 5DQGA 3MPUB 4U8YA 2Y0SD 1RHJB 4CO0A 4FYWB 4F3OA 2A6MA 2V2ZA 3L7PA 4CIOA 5IOLA 2KZZA 1QD1A 3CDBA 2LDIA 3RRKA 3MPDA 4DR6J 1U26A 4F36A 2HHSA 1QVFR 5K20B 3QGGA 1N34F 3R5GA 2UUAF 4QWDA 4YR0A 2CAJA 2IVMA 3F56A 1TL4A 1JXLA 3ETMA 3FBBA 3G6ES 4ECUA 3SSQA 5BXIA 3G8TA 4TY8B 3NY0A 4YHHF 3NS5A 3DHWC 3NGUA 2AQ4A 1XNRJ 1H74A 1NDKA 3PYFA 2OD6A 2F40A 4DR5F 3DMJA 3QJJA 4YDXA 4WCEQ 1M5VC 2MPUA 2X1BA 1ZAWA 5DQIA 4OI6A 2ZBRA 5C24A 3SXLA 4C0HA 3TUIC 3IRWP 1ZPWX 3H42A 1UVIA 2L9DA 3UCGA 2F8EX 4KFBA 4ZN1A 2FYXA 2AKWB 3CMES 1Z2ZA 2CNOB 2ZH6A 1ACMB 4O4GB 4DS4A 1FHTA 2QG9B 3T5JA 1QUVA 2DNPA 3HLUA 1UKUA 2HQ3A 3LP0A 1KR4A 1M1KT 3JXOA 4DV6F 4OLPA 4CTAA 2UUCJ 3C19A 1QVGR 2JL9A 2OPSB 1GMWA 5AJ3F 4K4UA 3GJQB 5I3PA 5CYQB 2YQ3A 1DZ5A 2GGPA 1Q7YT 3D7SB 3WC2A 4U6PA 1D1UA 4HLBA 3VQSA 3D3BJ 4XDDA 4B9VA 2VG7A 3DOKB 1RBAA 5L9XA 5L38A 2NSCA 4KGVB 2RS2A 4K50A 2KB2A 2PEHA 2QYGA 1R0AB 1MN9A 4CWBA 2MTLA 1KEKA 2C2ZB 2UUBF 4ZVEA 1RTHA 1F3VA 5DGBA 1DTQB 1SJ4P 2Z8QA 4R0EA 1M5PC 1D0EA 2LFVA 1R8BA 4EBCA 4DL5A 1V3RA 2J0WA 1QE1B 4N76A 3OVAA 4OYXA 1U1NA 3F73A 2FIUA 4ENOA 2CZVC 1FKOB 3QIPA 4BCAA 1ZM2A 5G4DA 3V4IA 3DDNA 3HD1A 2A2DA 4HEA9 4URQU 1RHRB 4C4WA 1U0SA 1LWEB 4RUAA 4J9LA 4ZK7M 2IJRA 3KJVA 4Q8FA 5IT9Y 2LMIA 3TZZA 4C97A 3ENWA 2KRRA 3IAS9 4ZLJA 3RR8A 3MM7A 4QIEA 3DLLQ 4K4XA 1BLUA 1YWXA 2MKHA 1XNQF 4F0KA 3VALA 2IRXA 1X4GA 5D4NA 1X5TA 4DMZA 1WKLA 1ULRA 4F2RA 4BDPA 1JJ4A 4OLOA 4O23A 1IM4A 2DD8S 4CRJA 3M2RB 2RB7A 5HROA 4WE1B 2DEIA 1NDLA 2HQGA 4LMZA 1FVQA 2CG8A 5EX3A 2ZBQA 1RK8A 3A12A 4RUBA 4QOTA 5HSPA 5THWA 2GMJA 4USIA 3JAMU 2F4VF 3CE8A 3NXZA 3D1OA 4J9OA 5J2NB 4A8WA 3LP1A 2VC1A 4DOZA 1DHMA 5DZ7A 4C0OC 4JI1J 2BJ3A 2E7WA 2QYCA 2KL8A 5LMUJ 2KVQE 1H38A 3CW2C 4UT4A 5C2GA 4KH1B 3US5A 3TOQA 4ER8A 2G0JA 2HWTA 5K14A 5AXKA 4DXLA 1Y10A 1GTEA 2WONA 2ZZNA 2BKOA 4MYUA 1G3OA 1K1QA 1LWXA 2PD1A 4QQBA 1U24A 2NYIA 2U2FA 2KZMA 2GQCA 1OMSA 3D0IE 5K9FA 3BSCA 1HIYA 3H90A 5A0YB 3VAMA 3FFIB 4J7CA 3MHYA 5DM6Q 3W5YA 2QSWA 4LFBF 2DRAA 2VONA 3LGMA 1RABB 1FEEA 2XY6A 1UFKA 2RQ4A 5KG4A 4TNOA 1CULB 2CZ9A 1WHYA 1GXLA 4B3RF 2JLFA 4KRWA 1T8EA 2CPYA 4K59A 4NRTA 4DHVA 2CIMA 3Q22A 4DX5A 2XI2A 4X64F 1J5EJ 4K0KF 4OX6A 2GO9A 2EBEA 3DDIA 4X65J 2ZBCA 3BN7A 2L3MA 2UXBJ 4X66F 4FF3A 4X4OA 1JLAB 1JKHB 2GW8A 3FSYA 1EHWA 2WCXA 2EXUA 1WF1A 1VOMA 5HQLA 5E41A 3OL8A 4PG8A 3DOMA 2J9DE 3HVAA 3Q24A 4BC7A 1KSPA 1RKJA 4Q0BB 3V81B 4CO5A 2FJVA 1UWBA 2CPDA 3EPGA 2OPQA 4DEZA 3ZZTA 3UD3P 1RGVA 1HLWA 2ASLA 4RW9A 4MK7A 3DRXA 5B0FA 2K3KA 3MTKA 5KT6A 5KFEA 1NH7A 4LFAJ 1SH2A 3HJFA 3M9MB 2HGLA 4LVNP 3KLVA 4B9MA 3G96A 4TU8A 2G2OA 3OL9A 3QATA 2OIHA 4DSKA 1B3TA 2JEIA 4DL2A 1IR2A 2UVWA 4B02A 1TP7A 4IQMA 2HK3A 4ES2A 4HDGA 3PY8A 2IFXA 3D4JA 2W9BB 2VG6A 2Y1RI 3TX0A 5C2CA 1EQ0A 4OYWA 3NWGA 5ETMA 1SKRA 4O0IA 4NLVA 1JLQB 5KFHA 1NM2A 3M8PA 4Q45A 2WTFA 3LGNA 2YQ1A 3MEDB 3JSYA 3CT9A 4HACA 3TO8A 2R8KA 2FTRA 2CQ0A 3VGUA 2HHTA 1S1TB 2MY7A 3G82A 4C2MA 2QE5A 4B9LA 3LWLA 3AT1B 3EXCX 3UN5A 5FIIA 3PKMA 4ZS6A 3LTOA 3J7YU 3B6BA 1CC8A 3FKBA 4LF4J 2KTQA 4KH0B 3QAUA 1NSKL 1RYSA 4E2FB 3BREA 1GK8A 4LSNA 1HBUA 3NNAA 1HBNB 1CQMA 5CYJA 5HATA 2KN4A 1TAUA 3L7UA 4WKYA 3IM9A 3HKWA 5E2QA 3NGTA 3BZQA 1N5QA 3HVRA 2NCKL 2XQCA 2JOQA 1RT7B 5F41A 3MMCA 3NP5A 4JI8J 3AAWB 2HRUA 3DMJB 2EFGA 2E5LJ 2ZOGA 4WP9A 4USHA 2MEWA 4QPXA 3CJKA 1JK9B 3OTOF 1OY9A 1F6TA 3E2EA 4PWWA 2AGQA 1RHUB 4K2XA 1YJRA 1C1BB 1TELA 1Q8BA 3FSXA 4DF8A 3OTBA 4YQWA 1HQEB 1XEZA 2NLWA 1H2UX 1RE1B 1NB2A 4WP3A 1HNXF 3MMBB 2YPYA 4KFBB 4Q43A 2DHXA 3J81j 2I38A 3SFGA 4YEAA 2VDIA 1YI2S 3AHPA 1VK3A 2CG4A 4G1PA 4RW8B 3TAPA 1WOOA 5DDRC 3EUNA 1VQKS 1Q95G 2WOMB 5HLFB 2R8JA 2CXEA 2Q6BA 3NMAA 1S59A 1RADB 2R8GA 4ECWA 3LGHA 4X62F 2BZ2A 1JJHA 2XHWA 5F9NA 1HNWJ 4G1QB 1IM6A 4DPUA 1XMOJ 5KT3A 4CLUA 2V6AA 3OVSA 2W2MP 4I4BA 3TQEA 2B5JB 4ZJLA 2OI2A 1RAOA 3GIKA 2EG2A 4DV0J 5KFDA 4JI7J 5IZHA 1IBKJ 4JI6F 1F2HA 2MZSA 2FY1A 1T3OA 1BMQB 4JV5J 1PC4A 4CNYA 2VFVA 1ZM9A 1WG5A 4OYPA 1OJ4A 4Y65A 4ECRA 1GFWB 4CLPA
chains in the Genus database with same CATH topology
3H5UA 4FS1A 5CZXA 1XERA 1WI8A 4MH8A 4ILLA 5ITHA 5CYMB 2RNEA 3J80Y 3OJUA 1U47A 4EU0A 1HNIB 1Q82T 4RBUA 2ZHAA 1RT1A 3L09A 4HH0A 5HI7A 2CPFA 4A8YA 1FNXH 1HYSA 1DRZA 2GQQA 2V8GA 4NLDA 1IKYB 2AJ0A 2AU0A 2WHOA 3DLEB 1LV5A 1TVRB 2DPIA 2YWKA 3DFEA 3BB5A 4J9KA 1Q8IA 2AV5A 3UWTA 1RAJA 2NXUA 3HVTA 2B9WA 4QR1A 4QIWD 3M2VA 3R1LA 2ZH2A 1U48A 5D6GA 3AY0A 4RNFA 1P1TA 3DRSB 3VWSA 3U27A 2R7RA 1K1SA 2FJBB 4YP3A 4F4KA 3QGHA 1N4LA 1NJZA 4F3MA 4WFNQ 2YKQA 2EC0A 5I3QA 2VOPA 1T03B 1HNVB 5IQ6A 5KFKA 4RW7B 3RR7A 2KXFA 5F8JA 4I2PB 4U67Q 2W25A 4XO0A 1NRKA 1M5SA 2KJWA 5A0YA 3PDNA 4ITSA 1PO6A 2UXDF 2C3YA 3GG0A 2I8EA 3BGRA 1UW4A 1B0PA 2ILZA 4DSFA 3KG0A 4FXVA 5J1NA 2OPPB 1O0PA 3VAKA 4KC5A 4I56A 4C3KA 2R7OA 2LXFA 3RU0A 2ZNZA 4DN0A 2XS5A 3QLHB 3MECA 3W2WB 3KLGB 4O44B 4NYOA 2DK2A 2GO8A 3GB0A 5LSRA 3OSNA 2U1AA 2OMLA 4JV2A 1HPZB 1GXTA 2R4FA 1E6YB 2PI4A 1U8SA 2LQ5A 2XMJA 4RBVA 1B0VA 3QO9A 3KLEB 3KK2B 3AA8A 2K7KA 2ERRA 5D3GB 2CQHA 5E3AA 4IRCA 2JEFA 1R27B 5E3QA 4IH5A 5HP1B 2W9CB 2B51A 2GMLA 5KFFA 4PPDA 4IOCQ 4FNIA 5DO2A 2FD2A 3QIPB 1F2GA 1WEXA 2KG0A 5MAOA 3LWMA 4ES1A 1FK9A 4O3QA 5K8MA 2UU9F 1U2RA 2N3OA 1TAQA 3JYTB 3LO3A 1CC7A 2MZ1A 1JLCB 2F7VA 2FC9A 3EGNA 3MM9A 3SFUA 2CQ3A 5L1IA 3HHLC 4OHZA 1IXKA 4NOHA 3FSIA 1N36F 2YKMA 4NWBA 5DG8A 5LT5A 2ZVSA 2IM2A 3M9NB 3K5MA 3MZIA 5IXUA 3G8QA 2NUUG 1RYRA 3AB4B 2H5EA 3KOAA 1O51A 1OQ6A 2J8AA 3WC0A 1AFJA 3PRBA 4B3OA 4DQRA 3SMZA 2ZJRQ 2C3OA 2DT9A 3R5DA 4LF7F 1I94F 5J2QA 1R6YA 2LYVA 3R5AA 4BHQA 1LW0B 1HWJA 5KFTA 3CJ3A 3CCUS 4EBEA 3POTB 3LW5C 2MZJA 1TV6B 1TFWA 1PILA 3H2VE 4A8FA 4C9DA 1Q81T 1N88A 2JWNA 5GMKa 2CPXA 4ED1A 3IGVA 1N0UA 4DSLA 3KK3B 2BR0A 3PV8A 3KYLA 3PKYA 1VIOA 2VFRA 1SL0A 2RKIA 2LXUA 3M6UA 3UI3A 2V8DA 3EZ5A 1N5SA 1QAYA 1GNKA 1SH0A 3OFFA 4I7FB 4RUHA 5DDOC 4CI0B 5C25A 3CCVS 2DNRA 2CQ1A 1S9EB 3CCQS 1L3VA 3DYAB 1TL1B 4OZLA 2YWGA 5A8WB 4KTQA 4Q0BA 3V81A 5IM0B 3PEHA 5HROB 2QIFA 3HM9A 3OSPA 5E3RA 4PXDA 1FTCA 1RT3B 1QTMA 4R8UB 4HH1A 2XY7A 1YJNS 4K4VA 4IYQA 1E6VA 4DPOA 2EFVA 1LK5A 3CCES 4DUYF 1XK8A 2E5JA 3FRYA 4NRUA 2MKCA 3P6YC 2W7OA 3P96A 1APSA 2KT3A 3SCIE 3BQ1A 3N5BA 4AQYF 4LF8F 1HQUB 2KHCA 3LUYA 3T1HF 3JB9k 1NB7A 3O6QA 2DGWA 5L1KA 2DIVA 3M4XA 3FCHA 4IFYA 1PGZA 2DO4A 3OL7A 1IKWB 2KRBA 1VQ8S 1V6HA 2I1RA 2EK6A 3MAQA 3MM8A 2ZH1A 1U1OA 2XLJA 4ED6A 4UQTA 5A8KB 4ED2A 4I67A 4QYRA 2YNHB 3GG1A 2W9AA 1KVJA 1IUJA 1U1RA 1WF2A 2QA2A 4U7CA 4DUZF 3QPIA 1CEZA 3OFEA 3V6KA 3O8WA 2B7CB 4P7TA 4C8KA 5I3UB 2IBOA 4PUOB 2FLNA 2ZDOA 2DGOA 2DR5A 2V2KA 2EBGA 2VFTA 3J7YI 1KC8T 3M32B 4AFFA 2E7XA 2CRLA 2JZ5A 1Y3JA 1C4CA 4EEYA 3ZZYA 1J2VA 1HWUA 2VV5A 4X4UA 5EGYA 3GIMA 4YB6A 3SYZA 1IJEB 5KFSA 3PIPQ 5B0GA 5C42B 4C8NA 2PE8A 2RVJA 1MNEA 3KKFA 5A2QY 3DLHA 4OJGA 1M5HA 4G6VB 2BJDA 5HL7Q 3IR5B 2JEGA 4J37A 4C8LA 4F8RA 1BQMB 2GHWA 1S1UA 6FD1A 1LK7A 1S6PA 2IC3B 5J2PA 2J0SD 4IO9Q 5FLXY 3TAMA 4XPEA 2XWYA 4TY8A 4FF1A 2GIQA 2IVYA 5D4PA 4DV7F 4JI2F 4BWMA 1T05A 4EUVA 1HNZF 4B3MF 1F5BA 5M2UA 2W9BA 4DDFA 1UJ5A 2Y1IA 2WW8A 3MUTP 4DR1F 2QO3A 5IT4A 2WONB 3QJPA 5CA5A 5G0RA 2XMUA 2HIQA 2LA4A 5L8RC 4ELUA 3DN9A 3SQGB 1RTJA 1X5SA 1X4DA 3U02A 1U1PA 3K8WA 1AUDA 4IR9A 2GV1A 2YNFB 3C6TA 2BBEA 3SZ2A 3P5TL 4GMKA 3PO5A 5GAGI 4DR2F 2UUWA 2M4MA 2JLEA 5I4MA 2FLOA 4ZVGA 2YH1A 1JLQA 2FLPA 2J9DA 3DCAA 3NBPA 3RAXA 3DM2B 4LUBA 1TK5A 3I6PA 1C1CB 4OI2A 3H25A 3D1HA 5B0AA 2E1RA 3KNAA 4ZP8A 5E7OB 1VJWA 2BE2B 2SXLA 1TKZB 1EETB 2CPJA 2DISA 2UZAA 1FDDA 4ID5A 2DB1A 2M3DA 3MM6B 3UNGC 1NJWA 3E3XA 4DR6F 4CT8A 1M5KC 4DV2F 4ZPDA 4ZPTR 3MEDA 5AXLA 4FVCA 4JOUA 1ZYQA 3BDEA 3PZPA 1N52B 3GMGA 1VRTB 3QYYA 5T41A 2BQRA 4WFXA 4MIWA 1IQZA 3D0HE 4PR6A 2UVRA 4DQSA 2DGXA 2IJNA 3KNGA 1LFWA 3G4SS 2BANA 4HT7A 2EK1A 1HR0F 2OMOA 4O3NA 4ALZA 1NKBA 4CH0S 3MD1A 4EWTA 2DJWA 1IKXB 4NLPA 2CJQA 4TYAA 3MPWA 4HDHA 5KFAA 1RTDB 1SIZA 2BYCA 4R5PB 3KLFB 1NK5A 2XS7A 1XNRF 1R31A 4M95A 3PO4A 2F1FA 2WSCC 3N79A 2ZH5A 5MLCV 2JDJA 3TARA 3BSNA 3PR5B 3WZ0A 1RT2A 1YRXA 2DGSA 3KG4A 1WELA 2AJQA 4IOAQ 1UEVA 3OVBA 2ASYA 3W7BA 4YFUA 3W2VA 4ICLB 3NKYA 3IG1B 1U6ZA 2FGOA 1TR0A 3N4WA 4QWBA 4DV1F 1HBOB 2FPHX 1SL2A 3ZZRA 1HD1A 2IRYA 1TKTA 4NZ6A 1DQAA 5KG5A 2V4RA 1C0UA 1YHQS 2LU2A 1N56A 3DRRA 3O2IA 1FKPB 5JJBA 7FD1A 1EP4B 1SUQB 3MEGA 2IMWP 1HBNA 1XR7A 2HHPA 1TL3A 2VFUA 3T1YF 2I0XA 2M8HA 2R7QA 3QGIA 4QJVA 4I2QB 4EZ9A 2FGCA 1B64A 3FJ2A 2XCPA 2B6AA 2AGOA 1UJ4A 4AE5A 1S6QB 4IR1A 3I0SB 4UW2A 2ZOMA 3TYTA 4WKRA 2IM0A 3JSMB 3N01A 5B0DA 3CD6S 1NK9A 5KFMA 2YH0A 1S1XB 2K1RA 1RA7A 4ES3A 4NA2A 1JLEA 1T3NA 2KT2A 3V6DA 3BO4A 3KLHA 3CCRS 4AL6A 1D9DA 5CYQA 5KT4A 4J9SA 2KU7A 3MCSA 2MKJA 4PWDB 1QSYA 3N9UC 4M8LA 4ZP6A 3HPOA 4LF6F 2HFNA 3SSRA 3SV3A 1RT7A 1WHVA 4PPZA 4ECTA 2C2DA 3KFWX 2EVZA 1TKDA 4ZCLA 4LF9F 2NS1B 4OFZA 2L9NA 3T6JA 2E9RX 2RDJA 2PC6A 3GZ7A 1LXNA 4CO1A 3CUNA 3DI6A 5D78A 5KFYA 3TQ1A 4KKOA 3AQPA 2N7CA 4WFBQ 2FJWA 1D3WA 4JV1A 2G0CA 2Y1JA 3GFZA 4WU2A 2KO1A 3CF5Q 1SJRA 2OPQB 4ECYA 3TANA 1DLOB 3IFEA 2HFZA 1KOOA 3WBZA 4HYKA 2B4UA 4H4KA 1YJ9S 2QLWA 2HNDB 2D9PA 3TX8A 4B9TA 5IS2A 4PG6A 3HO1A 2VB6A 1CG2A 3DLGA 1FJEB 4Y0FA 3VCDA 4RW9B 1KHWA 1N54B 2APOA 2VBYA 3FEYB 3FNNA 5T7LA 3DLKB 4JYAF 2O01C 3V2UC 1C1BA 2HWIA 4KE5A 4RW6B 2V8HA 4JV0A 4A48A 4PQUB 3LP2B 1FRMA 2PA3A 3EZUA 1KLMA 4MK8A 4Y2KA 1H98A 2GJ2A 4DFMA 4OZNA 4FYDA 2VPZB 2R7WA 1Q1KA 1HQEA 3GFXA 1L3UA 2ROEA 3IGNA 1XR6A 1R8CA 3PR4A 4DQIA 3N6MA 5IWAF 2UUCF 3MMBA 2NR0A 4FXDA 3UD4P 2QFJA 1KTVA 3ENVA 2R7UA 1A9NB 1U1MA 4LT6A 1R0AA 4NXNF 2L48A 1D8ZA 3TUZC 5EWEA 1D9AA 1V9OA 2M52A 4XIUA 3NGKA 3CC2S 4XPCA 3IWLA 1R7IA 2GFFA 2I5JB 2JRSA 3H5YA 4RW8A 2M70A 2VQFF 2ABYA 4X4TA 2VD3A 4ECVA 1NH8A 4DR4F 4B9NA 2F3JA 5H9EJ 1JB0C 1NKEA 2VA3A 3OQ2A 2WOMA 3CSKA 5LSLA 1FXDA 1RT4B 4QWAA 2IA6A 5HLFA 1ZZFA 3I9ZA 1TUVA 2XMWA 3CCTA 4W92B 1FDAA 1SV5B 1YSJA 3HHNB 4ZPAA 2MXYA 4I6WA 2D1CA 1H6KX 1JWWA 2WRMA 1H3DA 1S72S 1URNA 2RT3A 4EBDA 4N41A 5KFUA 3UPFA 5KFVA 4C3LA 4OZ0A 2XSJB 1OSCA 1VFJA 5GAGU 4KQZA 1Y00A 3NCQA 4G1QA 3ZZ0A 4ZCMA 1REVB 1S1WA 1S49A 4RWXA 2ZFHA 4B08A 2XCAA 1JLGB 3S6EA 1S99A 1YBAA 2QV6A 3GWCA 4ZPCA 4CZCA 1BY9A 1F5AA 3MEKA 4TQSA 2HHVA 2PSZA 5DQHA 2DRBA 3PJWA 4FXWA 4N8OA 5HMXA 1X9WA 5CQGA 2X1FA 2B5JA 4MYTA 3D0GE 4YB5A 4C0BA 4K4YA 2P5VA 4IQXA 1HWKA 1WACA 4A46A 3KTQA 3HHKA 3DHXA 4ECQA 1V3SA 4ZPBA 2VPWB 4A8XA 5KFZA 4B3TF 2GQ2A 2XZWA 1OIAA 2A10A 5KFOA 5IQQA 3RB4A 3M8PB 1JXEA 1WHWA 1HARA 1F9FA 1VMBA 4ATNA 1FO1A 2CPZA 4FVMA 1AROP 1NEEA 4QIGA 4QCLA 5C24B 2MHEA 3LAKA 2PMHA 4ZA1A 2IHR1 2J7KA 4IG3A 2LQBA 1UMJA 4GC7A 4U7UK 3WDOA 4I1TA 5U47A 4KIAA 4N77A 3HKZD 5T14A 2K3IA 3RAQA 4A8OA 1GX5A 5J2MB 3T5HA 1LWCB 5CYMA 2LA6A 3U1LA 4O3PA 3OL6A 3VAFA 4RBTA 2JC1A 2OSRA 4AYBD 2MB0B 4QYZJ 2VBXA 3CB4A 1N5YB 1UFLA 1IKYA 2GCFA 4XDCA 4NLYA 1S9FA 1OPZA 4UUWA 1OWXA 2HYIB 1TVRA 5DDQC 2FJDB 2LQJA 2XO7A 1Q8LA 1ZAXA 2NPIA 2VC0A 4J9QA 4K4WA 4O3OA 4ED7A 1M90T 2YKOA 1Y5LB 1MMNA 4DN9A 1SKWA 3MR5A 1FRXA 3I87A 4OHWA 3M2RA 4ZVFA 2AP6A 2HZCA 3C3LA 3AQOA 1Q16B 4TXSA 2R9LA 1DBDA 3KHLA 1Y5IB 2RH3A 4H4KC 4LSNB 3OW2R 3MI7X 5AE1A 2VASA 4X4SA 4J9MA 1RDRA 2YWHA 4RW7A 1VQ9S 1KS2A 4ILMA 5F8GA 4I2PA 3LP0B 4EGLA