1XBXA

Structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound d-ribulose 5-phosphate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIDLTGYWTWEQAQQWRDAGIGQVVYHRSVDAQAAGVAWGEADITAIKRLSDMGFKVTVAGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
publication title Evolution of enzymatic activities in the orotidine 5'-monophosphate decarboxylase suprafamily: structural basis for catalytic promiscuity in wild-type and designed mutants of 3-keto-L-gulonate 6-phosphate decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xbxA00
3L68A 4O15A 4NZFA 3R5EA 3L9CA 4K7YA 3C3NA 3RK8A 4FNRA 2BX7A 1DORA 4JTSA 5TIMA 3KHJA 4QISA 3S5YA 5CZ0A 2NV2A 3PWAA 1A5BA 1H62A 1LRTA 1MEHA 1GEQA 2DZSA 3FA5A 3LCIA 1QCWA 3MP3A 3LCGA 4DF1A 3I7RA 2B7NA 1EP2A 4JTTA 1EPXA 1VQTA 3C2VA 3INPA 3KXQA 1W3NA 4MYAA 2Y7GA 4ONVA 5E0KA 4Q33A 4PTNA 1L9WA 3L0NA 5F2GA 1TPC1 2HS6A 4RK8A 3PBVA 4FXSA 1ONRA 4M6PA 2A7PA 5F1VA 5J5RA 2G97A 4IWWA 2E1DA 1Q6OA 2CZEA 2CZFA 3IGXA 3FJLA 1JUEA 3N34A 4AH7A 3W23A 1JULA 5FF2A 3GR7A 5CZTA 1G7UA 1UUMA 4MJZA 3IVUA 5LZLA 2Y89A 3LCWA 1SR9A 4PFMA 4Y90A 3OA3A 1JRCA 2V81A 3C8FA 3R13A 4BR1A 5K3VA 2V2HA 1KW1A 4E38A 2AGKA 1D3GA 2V0TA 3KOFA 4FX6M 3L0KA 3LB0A 4ZMGA 1QFEA 1TJPA 2HSAA 3EB2A 1VCGA 2ZRXA 5CGQA 4Z1AA 5D30A 4JTLA 2ISVA 4LV9A 4FHAA 4WD0A 3PB2A 1TQJA 1OX4A 5LKYA 1GWJA 4LWWA 4XBSA 3IIOA 6TIMA 1S3HA 3MBFA 1TYGA 2X1SA 1FWRA 4UFIA 1GG0A 1YYAA 1TB3A 2VEPA 5G2HA 1Y0EA 4NVTA 4ADUA 3W7DA 2CLOA 3HB9A 3TXZA 1GTHA 4O53A 2ZA3A 3RMJA 3PSVA 2YW4A 3GX9A 3VE9A 4JEQA 1PE1A 1JCJA 2NLIA 1GG1A 4GUJA 4EIVA 2KZHA 4RZ6A 3HPXA 5DBUA 1EWDA 4RV8A 1V7YA 3GNNA 3O16A 4UUIA 3UWVA 2ZTKA 3TFXA 4O8RA 1WBHA 4JYDA 2EKCA 3K30A 5KMYA 4UTWA 1PHQA 1MSSA 2ISSA 3LERA 1RPXA 3FYOA 2QR6A 1TPUA 5F2IA 1SZNA 3W1MA 2QCNA 4FX8A 2FPTA 1S5WA 1OFOA 5D03A 1SW0A 4NJIA 2C19A 1TPWA 3ZWTA 1QR7A 1FCQA 3BG9A 2Z6JA 5DCDA 1B57A 1N8FA 4WQ6A 1WA3A 1BEUA 1HTIA 2Z0IA 3I68A 2TRSA 1CX9A 3N9SA 3T55A 5FF7A 2GQAA 5AHNA 1VHNA 3E12A 3LCXA 3BW4A 4X2RA 4RCXA 2P1FA 1JCMP 1HL2A 3T40A 1XC4A 3WK3A 3O15A 3ZS4A 3D0CA 5AYYA 2ZYFA 1VCVA 4UFKA 3C56A 1FUYA 2QJIA 2ABBA 1YLVA 3CHVA 5DCEA 2F84A 3LXCA 3STGA 4GWEA 1Q6LA 4ZVJA 4O14A 1GVSA 1VYRA 3NZ1A 2E5CA 3MUXA 4PL2A 1C8VA 3STCA 5F2MA 4A2SA 1H1YA 1ZAHA 1XUUA 1OFAA 5BOOA 3LRLA 3NAVA 4LY8A 4I7WA 1F05A 1M7OA 2NV1A 2CFFA 2Y70A 3TAKA 4CNOA 2CLLA 3CT7A 2B7QA 3B03A 3PF3A 5L9FA 1ZALA 3QH2A 2VELA 4PC8A 5D32A 3A23A 3MYOA 4MUZA 2FIQA 4DF2A 2ZRUA 4KWWA 4KFOA 4XKYB 3GNDA 3EX2A 3SGUA 2FTPA 1SZGA 1W5PA 2V82A 4UMBA 5K9XA 1TMHA 1VCFA 5LNWA 3GZ3A 4LVAA 2TMDA 1XDLA 3CM4A 2PRMA 3QEZA 4JNMA 3LBMA 1LTDA 3DKLA 5CSSA 1G67A 3RFAA 1UCWA 1NFBA 3DFTA 1UBSA 1VC4A 1KTCA 2VEIA 3EEGA 3Q2DA 3TW7A 1WYIA 4R33A 2E09A 2J88A 4BWLC 2J9ZA 3NXFA 1FCUA 4B5NA 2PC4A 4R34A 3M0ZA 3UWZA 2Y85A 1H5YA 3LOTA 1DKWA 2Y61A 4R53A 1VYPX 5CKSA 4FNPA 1XXXA 1TPEA 3KRUA 3P5YA 4JYFA 1TTJA 1X1OA 1OFQA 3OVPA 3N19B 2WPBA 1MO0A 4HPXA 3P74A 4NT0A 3RNDA 1G4EA 5EL1A 3NQMA 4D2JA 2WV8A 1WOAA 3Q94A 5KTLA 1O60A 3S8HA 4H4IA 5K9CA 1JCYA 3NQ7A 4I9AA 2E6AA 3NQ8A 2TSYA 5HUPA 2VKZG 1TO3A 4YCOA 2FPVA 3VNDA 2C3ZA 5IBXC 5C54A 4IMCA 1QAPA 4LC8A 4JN6A 2A6LA 1FX6A 1VLWA 4IPJA 3G1HA 4LS2A 4ZZ9A 3DENA 2FB2A 3O8AA 3CC1A 3UY7A 3W83A 1UASA 3THQA 3I6RA 1A5SA 4FO4A 4GJ1A 4IPIA 4N4PA 4PL1A 3G24A 1VZWA 4LT9A 2IQTA 2RH9A 2VFEA 3BGJA 3M16A 4M19A 4N02A 3HMJG 2QCEA 1OFPA 4A2RA 3KFTA 3W84A 4BI7A 4ZL1A 1I2QA 1KFCA 2YFNA 5DN1A 1H1ZA 1XDMA 4OHQA 4TMBA 1IIGA 1QOPA 1F74A 3BK0A 1OF8A 1DL3A 2I1OA 4M6VA 5HWNA 3NYZA 3OIXA 4X22A 3W70A 1WQ5A 1PVNA 1P1XA 2YZRA 2C0AA 5CG7A 5F4XA 3GDRA 4M6QA 4HSOA 5TQLA 1A5CA 2QCMA 4LC6A 3LI1A 1MEIA 3Q58A 4PCFA 2W0UA 1B4EA 1G4SA 5CZJA 4WOZA 1G69A 4UMAA 1OK4A 2H8ZA 3EXTA 4DF0A 1FCBA 2Y6ZA 1L2UA 2YXGA 4K36A 3W9ZA 2VC6A 1Z44A 3C52A 1LBMA 2QUVA 1FQ0A 3PBWA 3TMLA 3QZEA 4UFMA 3UWYA 3GAKA 5I3HA 2FDSA 2O7SA 4ZQPA 2YPIA 3TA6A 5K7JA 2OMAA 3CQ0A 5AHEA 1AW1A 3NOEA 4OV9A 4O0KA 4I7VA 3OEXA 1W5OA 3FS2A 3IVSA 3BV4A 3FIGA 3P81A 3A24A 3I7QA 4MFEA 3DAQA 1SSGA 1LYXA 3QF0A 1JUBA 4P2VA 4C1KA 4LVBA 5I3JA 1X7FA 4J9JA 3F03K 1W1ZA 1DVJA 3LCFA 4JX4A 5HJLA 1O95A 3EX6A 1R47A 3QYQA 4TU1A 1X8FA 3NL5A 2EPHA 5DXXA 1FWNA 5CPOA 1P0KA 1G4TA 2WO5A 3WJSA 3LM7A 1BKSA 4UXDA 3P62A 4YCPA 4LVFA 3O6YX 1I2PA 3W7LA 3CB8A 3NQVA 2J9XA 1W5QA 2XN2A 4ICNA 4NXKA 4JD4A 2FJKA 3PUEA 3M1ZA 4UFJA 3DFPA 1YXDA 3V1PA 2FPYA 3DGRA 1OHLA 4Y8FA 4JTIA 2QKFA 2X2GA 2CLEA 2FB3A 3U8GA 3G8RA 3C2EA 4NJGA 1YXCA 4O28A 1RQHA 2Y7FA 3W6YA 1ICPA 4O0ZA 4WXYA 3W07A 3IIZA 3QPZA 5D37A 2A5HA 3R89A 3T78A 1PCKA 4E2BA 3WK2A 1YTEA 2ZA2A 4XQ6A 1SZFA 3UWUA 1FDYA 4JR5A 1ML1A 3KX6A 2ZZ3A 1Q45A 1PS9A 1LRNA 3MWAA 4ZQMA 4N6EA 3EWZA 4E2DA 3KRSA 3P7YA 4ADSA 3M9YA 2LLEA 4JICA 3C4UA 4QQ3A 1KM4A 4O4VA 3RU6A 3S42A 3QRHA 5D2XA 4WY0B 4W9TA 1SFJA 1M7PA 4Z1DA 1EEPA 1P0NA 3FKRA 3QSRA 1LLWA 1QNVA 1I45A 2ZZ7A 5LNRA 1TV5A 5FF4A 1V5XA 2CWNA 1H7NA 1KTNA 4ZQNA 4HPJA 1H7RA 4NZJA 4WY0F 4DXVA 3CEPA 4HSNA 4S2CA 5HR7A 3NQCA 4R7JA 4IJBA 1FXPA 1A5AA 3ABRA 3G8EA 4HT3A 1IXNA 2NWRA 2E5DA 3EXRA 2C6QA 3CTLA 1J5TA 2WSRA 1H51A 4MKNA 4AXKA 4AVFA 1VJIA 1VYSX 1HG3A 3CWOX 4AAJA 2GQ9A 3DHFA 4JTFA 4LVDA 1P5BA 3KVKA 4O12A 1W5NA 1D3HA 3LXAA 3O06A 3G3MA 2Q3RA 1KM0A 4UTJA 3T4CA 5BNKA 4MZ1A 5LSMA 4LRTA 3NEVA 3RF9A 3OBKA 2Y7DA 2OCZA 3QW3A 1FXQA 3PG9A 4KWVA 1K02A 3S5ZA 3O1NA 3EXSA 3FLUA 1TV7A 1U83A 3BG5A 3DBPA 3MJYA 1ZAIA 3GB6A 3QQ1A 2NWSA 1EIXA 1DQWA 1LDCA 3NQDA 4AHQA 3NL3A 1PL9A 3N2XA 1JCXA 4L4MA 2XN0A 4O1BA 2CLIA 1TQXA 3SSJA 2QJGA 3IIXA 3UPWA 2WSQA 4FX7A 3G3DA 4XUGA 2O7QA 5FEPA 5LHFA 4K38A 1QWGA 1LOQA 1WX0A 3NL2A 3NQFA 2CLKA 1TCDA 7TIMA 1L6WA 3LHZA 1QPOA 3I65A 3OVQA 3TDFA 1NEYA 1OFDA 3TX9A 2E77A 2ZRWA 3A5VA 3GAYA 3NQAA 3PULA 1LZOA 2RDTA 1OK6A 4LV4A 4K8HA 3PVFA 4IXXA 2Y88A 5D05A 1HO1A 1M6JA 3N14A 1EA0A 1XBXA 5AHIA 3QMRA 3TQ0A 1O5KA 4PA8A 4DPPA 4NX0A 4BK9A 1TPVA 4RJEA 1B9BA 3CWNA 1FY6A 5BW6A 3U2OA 2OT0A 4O50A 1EUAA 4IUOA 3G1FA 3FKKA 3FOKA 3LV5A 1C29A 4O1AA 3A5FA 2RDUA 3T44A 5D2TA 2E5BA 1YTKA 3THAA 3W73A 3TV8A 4UTTA 2VFGA 3W1UA 5LNUA 5F4SA 3H54A 3NQ2A 5LGXA 1HUVA 2AQWA 1W37A 3HGJA 5DCBA 3NPWA 3TK7A 3NR0A 5AYZA 5K4ZA 1S5VA 1YXYA 1LLZA 3HJZA 3W7GA 2G5WA 3B0PA 1FWTA 5KITA 1GOXA 1YDOA 4N9DA 1YDVA 2JBMA 2E6YA 3EKZA 1GT8A 3IEBA 4O57A 2E6DA 3W86A 1R2TA 2BLEA 3O07A 2FQIA 3GIYA 1EP1A 2HTMA 3YPIA 1W5MA 5KSWA 3GDMA 3LGEA 4GUGA 1QPRA 5HWMA 3QMSA 3U6WA 2NXIA 4LUIA 2W6RA 4UFLA 3O63A 3PG8A 2F7FA 3S6DA 2VOMA 1IXOA 1H7PA 3GYEA 3M5ZA 4O1DA 2GPTA 4XKYA 1X1ZA 3TAOA 3EKLA 2ZRYA 2EAWA 1Q3NA 5J5DA 4Z1BA 1GJPA 3USBA 1LOSA 1XI3A 3UPBA 1SZEA 4AHOA 1W31A 3VCRA 5LNVA 1ZHAA 1OFEA 5LHEA 3UQNA 1FCVA 3EWYA 1GVQA 4UIOA 5AHLA 3B8DA 3DFOA 3W75A 3STFA 3LHTA 3TNOA 4CCDA 1I2RA 3MO7A 3W1QA 4H3DA 2Q8LA 5CPNA 3LBCA 4KFPA 2DZWA 3OG3A 3TH6A 1O94A 4OU1A 2WQPA 2PRHA 3QFEA 3MBDA 3QC3A 3CIXA 2A1YA 2D73A 3IIPA 1FDZA 3SW6A 3TSBA 3FFSA 5LGZA 5C2XA 3TW6A 5C6MA 2JKPA 5C55A 1H50A 3P82A 3KAOA 1K7FA 2BWGA 4GE8A 1H7WA 1F6KA 3G1SA 4Z0JA 4NUWA 1JCLA 1JJKA 3VI2A 1XL9A 3GK0A 4JTJA 3W3OA 3S1WA 4AMAA 1IIHA 2X1UA 4UTKA 3CEUA 3ELFA 4IX0A 2QDHA 2HS8A 3E0IA 1EUNA 3W22A 3W76A 3TUUA 1MXSA 3TXVA 3MP4A 1K7EA 1FWWA 3S1VA 1H63A 2ATMA 2AAMA 3S1XA 5BMWA 4K6AA 3NPXA 3NL6A 4N9CA 2A7NA 2CZ5A 4Q4KA 1LBLA 4GXMA 3LCHA 4QITA 5HWJA 2WNNA 4MZ8A 1R2SA 3SJ3A 4JTGA 2QCLA 2WJZA 4UNLA 3EX3A 4UR8A 5AC8A 3NZRA 3C2OA 4O19A 3FYPA 5FF3A 2YDAA 4WJEA 1LCOA 1LRQA 2PURA 4AB4A 3M7WA 3UYCA 2GJNA 3N3MA 3SR7A 3DFQA 4MZYA 3W7PA 3W7JA 4EVZA 1F76A 3SGZA 3NVTA 2NUYA 5F1UA 2C15A 1ME9A 1DJNA 1KLYA 4HHPA 4JY8A 4QNEA 3ATYA 4EWND 1HO4A 4LS0A 1QOQA 2C16A 1KV5A 2GVJA 5F4WA 4IMEA 2V9DA 3W72A 2CW6A 3H53A 4MLJA 3N73A 3GXPA 1TTIA 4FIQA 4DO4A 4CLMA 3BLIA 2E6FA 2V2DA 3BPWA 4UFHA 1UB3A 4HNUA 2RFGA 3ZR4A 3W2KA 2P10A 1I4NA 2OZ0A 1OJXA 3M43A 4O10A 4AHPA 3W7QA 4Y9AA 3HIJA 1OYCA 4JTKA 2GVGA 2J9YA 3B04A 1OFRA 2NX9A 3W1AA 4YMZA 3W7HA 3W7RA 1DJQA 2A21A 2YW3A 3E02A 2NUWA 3GLCA 3GVGA 4C1LA 4DBDA 3L5AA 3P61A 1I8JA 1BWKA 4GUHA 1H7XA 3HPSA 1IF2A 3DI0A 1XBYA 3GXNA 3L65A 3UZ5A 4G1KA 4PEKA 5H91A 4YXGA 1YADA 5KZEA 4N6FA 2YX0A 2X16A 4LOCA 3HG3A 3G1DA 3OHIA 2CU0A 5TBOA 2DZXA 1W0MA 4FNTA 2QCFA 1SQ7A 5F2LA 3PS7A 3LTSA 3F4NA 4JTUA 3BLEA 3NG3A 4IGHA 4AWSA 3KVLA 1TV8A 4RKAA 2J6XA 3SIZA 2A0NA 2OT1A 3CU2A 5K9DA 2QAFA 3LCLA 3W7NA 1OABA 4L4LA 4FF7A 5G1TA 2EF9A 3PR2A 4UTUA 3LTYA 3L21A 3PM6A 1O4UA 1JUKA 1L6YA 5HQEA 4OE7A 3P8IA 1YDNA 4JX5A 3IRDA 1FWSA 3TQKA 1N7KA 4GFSA 2B0MA 4KKXA 4ZQRA 1TTPA 2I14A 1TIMA 3JR2A 3FEMA 2ZA1A 4DO6A 4M7TA 5I3IA 3VE7A 1ZAJA 1I2NA 4OQVA 5D2WA 1VGAA 2ZTJA 3TC7A 3PUDA 5CPLA 2GQ8A 1KBJA 5LNSA 2H3DA 1TPH1 1PCWA 1ALDA 1KA9F 5DXYA 5AHFA 3C2FA 4XTIA 2PE4A 2CLHA 2CLFA 1OYBA 4WY0A 5I3FA 2C18A 2QDGA 5EYWA 3C2RA 1R2RA 3G0SA 3M5XA 4JDYA 4A3UA 5G1YA 3PSWA 3MHUA 1RQBA 2TPSA 4IMDA 1KLZA 4BWLA 5AC6A 3W2LA 5EPDA 2VFIA 1TPFA 3I7SA 3CLMA 3BW3A 3SY5A 3JS3A 1AL7A 4JTEA 4TR9A 3E49A 2A7RA 5HULA 1KFLA 2ZZ1A 3EWXA 3H55A 3DFNA 1OVDA 4UTIA 4O11A 3W1XA 3PAJA 4FNUA 2GJLA 3BARA 8TIMA 3W2MA 4UTWC 3HQ1A 1C9DA 3EX4A 3P60A 4JS3A 3VKJA 1S5TA 4RLIA 3PBUA 3LX9A 1F73A 4HNVA 1VRDA 3GDLA 1SO3A 1OYAA 2G95A 2X1TA 3P80A 4ML9A 4WXZA 5U7SA 2BXVA 2BTMA 4S2BA 5IBXA 1LROA 5CSRA 3TJXA 4LRSA 1EP3A 3LHYA 1GVRA 4JTHA 1K03A 3NPVA 3HBLA 2VENA 2R8WA 1XCFA 1K3UA 1T96A 2ZRZA 3HO8A 3IV3A 3P67A 1KM6A 3R8RA 3QM3A 2QF7A 3M6YA 4QNWA 1PIIA 5FEWA 3UNDA 4TIMA 1O5XA 2ATSA 4O52A 3VFLA 3M5VA 1AW2A 2WOQA 3STEA 4NJHA 3W74A 3L66A 4N9EA 4CNPA 2DZTA 2QJHA 1H61A 3AJXA 1IGSA 3TSDA 1TPDA 4TX9A 3G1AA 3TJLA 4MY9A 5FF0A 5HNRA 1LORA 2GVLA 1SUXA 3LLFA 4IX2A 4IMGA 3W1LA 1JQVA 4X3ZA 3BG3A 2E68A 1QMLA 1SU5A 2ZBTA 2DJLA 5BRBA 1QPQA 4UR7A 4Y6GA 3S5OA 1XBZA 2XFWA 4GUIA 2ZZ6A 4LU0A 4Z1CA 3LXBA 2ZZ2A 3LV6A 1K8ZA 4MJMA 2EGZA 3O6CA 4BF9A 2FLIA 2YCEA 3W7IA 5BMXA 3GKFA 1TPB1 3L5MA 4PH6A 4DELA 4CQ8A 4K8EA 4YL2A 1RVGA 4MY8A 2ABAA 2Q3OA 3DZ1A 1D9EA 4LNYA 4AF0B 2V5BA 4UMCA 3PY2A 4UCGA 3T7VA 3UXDA 1NF7A 3PC0A 5G2IA 4WX2A 3ZWSA 2I9EA 3G0UA 4YWIA 4GRSA 1Q6QA 4Z08A 3N9RA 1AW5A 3EWUA 4OBTA 4N9BA 3HGSA 1XM3A 1WXJA 3ATZA 3QMTA 4PODA 4K37A 3SFKA 2YR1A 1T0OA 2C14A 4AWUA 4CQAA 4TO8A 2RKXA 1R46A 3P84A 4ZQOA 5FESA 3G0XA 2X30A 2H6RA 3F4WA 1SFLA 2Z6IA 2VFFA 5KZMA 3UWQA 3TMQA 4A21A 3HG4A 1SSDA 1Z48A 1ZNNA 3BO9A 3P5ZA 1P4CA 3HGOA 2V8ZA 2NZLA 5GVJA 3DXIA 5I3GA 1DHPA 4JXCA 3S5NA 3MYPA 3UZJA 1RD5A 1ZCOA 1FDJA 3W2NA 5I3KA 3TFCA 1F2JA 4A29A 4RZ5A 4QIUA 3M44A 4JIPA 4XBKA 3CIWA 5DY3A 2Z1BA 2ZCGA 4MFDA 2YSWA 1QDSA 4FNQA 3GDTA 4E0CA 4RXFA 1Q6RA 3B0VC 5U4NA 4EOUA 2G96A 2H3BA 3G1YA 1JVNA 3LHUA 1KV8A 3KRZA 4BI5A 1W3TA 1NF0A 3W7MA 5C5YA 1FBAA 2RHGA 2DZPA 4JIQA 3W71A 4NNAA 1WBJA 2B7OA 1OX4B 1HFBA 3CPRA 1F7BA 3NQEA 3B05A 4HNNA 1AK5A 5FEZA 1G4PA 3WJWA 4OGZA 2QUUA 4BFAA 1KFJA 3ZFHA 4UTHA 3B06A 4JX6A 3E9AA 2R91A 4UC5A 3F1QA 1K7XA 3MW7A 4AEOA 1IXPA 2ZDRA 2YGYA 3WJYA 4HNTA 1M5WA 4NNCA 3C6CA 4BI6A 2FFCA 2C13A 1RQEA 5KZDA 5G4EA 3B0UX 3NDOA 4IXHA 3A21A 2NXHA 1B3OA 3NQ6A 1F5ZA 4MY1A 4UNKA 3P8JA 5AOUA 4IQLA 3DHDA 1K8XA 3LHWA 2GOUA 5A5WA 4HN4A 4I7UA 3GR8A 4QJ1A 5AYXA 4LW7A 3N2MA 3KVJA 3TCEA 3C0JA 2QCCA 4DQWA 2X1RA 2HMCA 3R2GA 3WFAA 1KFBA 3QJAA 2V5LA 3S0CA 1KM3A 5D33A 2DU2A 4N2YA 5DLCA 1KM1A 1WDWA 4NU7A 4RXGA 4EF8A 1EB3A 3ABSA 1UJPA 4Y96A 4GC4A 5H2ZA 1XFBA 1LP6A 1QO2A 5EA9A 4O13A 3IGUA 2JK2A 1WAUA 5DY2A 1YPIA 3LRMA 4CCEA 4CNNA 4O18A 1PV8A 3TKFA 4DO5A 3BW2A 2ISWA 1OX6A 2B7PA 3Q37A 3E96A 4HKPA 3L0GA 1R30A 4QSHA 2VEMA 3TE9A 5K4XA 1CW2A 4RZ4A 1ME7A 3RLUA 4UTLA 6ALDA 2NX1A 4U28A 1SO4A 5E93A 2NXGA 3DI1A 1LM1A 2CLMA 2QUTA 3L2IA 4MYXA 1NAL1 1THFD 3IVTA 5EBUA 2ZZ5A 2A2IA 2DZVA 2ZZ4A 4XWUA 1QPNA 5L6UA 1XBVA 4GUFA 5G5IA 3DH7A 4POCA 4NNBA 1VR6A 1J4EA 5FEXA 3RLVA 1MEWA 2TYSA 3KVMA 3ANYA 3MMTA 2DZUA 1KM5A 2BSLA 2YYUA 2CZDA 3UXAA 3NNTA 1EWEA 3NPUA 4N4QA 4U4MA 3W1PA 3W2JA 1A50A 2WNQA 3TU9A 5KINA 2Y62A 5EMUA 3BVJA 3W87A 3NM1A 1VS1A 4M5PA 2ZRVA 3LLDA 3QPYA 1W8SA 3S9YA 3W88A 1AG1O 4XZ9A 3LTPA 2C1HA 4ORIA 1PHWA 3PB0A 3HOJA 3BLFA 3A9IA 1B4KA 1T8XA 4NJKA 3PUOA 5DBTA 4QAIA 3LDVA 5AFDA 3HPZA 4FIRA 1F6PA 2OX1A 1J2WA 2J27A 2NX3A 4XTDA 3DKJA 1G6CA 4IMFA 5FI8A 1H60A 1L6SA 1VH7A 3C61A 4LVGA 5CZSA 3HGRA 3GXTA 2VFHA 3LHVA 2Z2UA 3UWWA 1TRDA 4LUJA 2NUXA 1KTBA 4NQ1A 2WSYA 3LRKA 3UY8A 1SPQA 4O54A 2JGYA 3MP5A 3MI6A 2R94A 1K8YA 4JY9A 1NVMA 5HINA 1ICSA 3W7KA 3LI0A 2Y63A 4RX0A 3ABOA 1GYLA 4MLRA 2QAPA 1GPWA 2JKAA 5SWUA 4WZHA 2XN1A 1ICQA 1U5JA 2YYTA 4P61A 4RR4A 2GUUA 3MI2A 3FJ6A 4OT7A 3GKAA 2H8XA 3TR2A 1QO5A 2YFOA 4GNJA 4ALDA 3NQGA 3SZ8A 1ZJIA 2BZNA 1SO5A 3W7OA 1ADOA 4DPQA 5D2YA 3EWBX 4MVAA 1TJRA 4HIBA 2J24A 1IXQA 2R14A 2ZFAA 1N55A 1GTEA 1MZHA 4M7SA 4OWGA 5AB3A 3NM3A 3SECA 1LOLA 1OG0A 5CPMA 4FEZA 2QEZA 1EX5A 4EF9A 1E51A 2VXNA 3WK1A 4O1CA 4S1FA 3WK0A 1AMKA 4H6KA 5AHMA 4AWTA 4Z0SA 3TROA 2WNZA 3NGJA 2OJPA 2UV8G 5HMSA 1W3IA 1SW7A 4MIMA 1OF6A 3M41A 2Q8ZA 3NA8A 1W54A 3HG2A 4K7VA 1TRIA 5D2VA 1JCNA 3ABQA 1YPFA 4IOTA 4DEFA 5D02A 1DV7A 4O17A 4FNSA 4KFNA 3S1UA 4JGDA 1ME8A 1JRBA 3DU0A 4LTSA 1DQXA 4ORMA 2Y7EA 1VPXA 3DFSA 3W1TA 5E1QA 1Z42A 4NX5A 4CQ9A 4YLWA 1I2OA 1GVFA 1RR2A 1ZY9A 4K39A 1KM2A 1XKYA 1SW3A 5D09A 1KBIA 4ADTA 1X6UA 2VEKA 4FB7A 1OX5A 3R12A 4O4WA 1TTQA 3W1RA 2QCHA 4UTMA 3EX1A 2DP3A 2JGQA 4OV4A 1KFKA 1RV8A 1UUOA 1ZENA 3O05A 2RDWA 1WV2A 1CI1A 3EWWA 3HG5A 3G1XA 1ZFJA 2A85A 2V30A 3A22A 3MHGA 5DELA 5AC7A 4FXRA 4NXSA 5HR6A 5EY5A 3W7EA 3TSMA 3WJZA 2QCDA 2B4GA 2WKJA 3MI3A 2PCQA 3W2UA 5K2ZA 3MHFA 2P0OA 3TQVA 3QQ0A 5EKYA 1TREA 4DBEA 3NO5A 1YTDA 3M47A 4WOQA 3OVRA 2VFDA 4Q32A 3HF3A 2EHHA 3V75A 3IIVA 3W1NA 1WOBA 3W7CA 5A8GA 1GQNA 3B4UA 3UD6A 2DORA 1GZGA 2A6NA 4ZQCA 3L67A 1SO6A 1LBFA 1JR1A 4JDBA 3PBYA 2QCGA 4UTTC 3G18A 5HUOA 3L5LA 1DOSA 1H7OA 3JRKA 3AO0A 4TMCA 5MHBA 4NJJA 1BWLA 3WJXA 1AL8A 2W79A 3QW4B 4X9SA 1GYNA 3G1VA 4GBUA 1KFEA 2V2CA 2H90A 1W56A 4A22A 5IM51 1T99A 2QCDB 1OFBA 1VLIA 5G2WA 1NSJA 3GDKA 3TIMA 1Z41A 1JQXA 1VHCA 4QM1A 4O16A 2ZQ0A 3QSTA 1A53A 1XUZA 2DJXA 3TC6A 5T26A 2A4AA 3IGSA 4WUIA 4CCCA 5D04C 2PRLA 4JYEA 5G4WA 5D38A 1DBTA 5ABTA 1TSIA 3M5YA 4MOZA 3BGGA 4MPQA 5AN7A 2ALDA 3W85A 1G7VA 1RZMA 3O6DA 4AF0A 1GVOA 3SI9A 1BTMA 4LS1A 2JKEA 3G22A
chains in the Genus database with same CATH superfamily
2WMJA 3RRXA 3GNRA 4O15A 4PRTA 2IPFA 4JHMA 5REQA 3R5EA 3L9CA 1RPKA 1NDZA 3URNA 4KMQA 1M7XA 4LALA 1X6LA 4QISA 3S5YA 1OT2A 4LUTA 2NV2A 3H2AA 3PWAA 1H62A 2VCBA 1GEQA 3CS2A 1ZRQA 3U2ZA 4WKAA 3LCIA 1QCWA 1LWJA 1EIBA 4JTTA 3CV7A 1XRSA 1KRAC 4WSHA 3VXGA 3C2VA 3INPA 3AZSA 2Y7GA 4ONVA 4PTNA 4J5NA 4H1ZA 1FH8A 4RK8A 4M24A 4FXSA 3PFRA 2A7PA 2G97A 1EYEA 2R1LA 4YTRA 3KBMA 4LGXA 2WPGA 2E1DA 1Q6OA 4ACZA 2CZEA 2MUCA 1PKYA 3MSDA 4BA0A 1JUEA 3PJXA 3N34A 3CV2A 4IJCA 4AH7A 4FP1A 5CZTA 4MJZA 2A3HA 3SCVA 1SR9A 4Y90A 3OA3A 3C8FA 1B31A 5A6JA 5K3VA 2V2HA 1KW1A 2AGKA 4JEJA 3EA1A 1XP3A 4U3AA 4ZMGA 1TJPA 1VCGA 2ZRXA 5CGQA 2BXZA 1DEDA 4KH2A 4IG2A 3C0QA 4WD0A 4HA1A 1J0HA 4LFYA 1S3HA 3BAIA 2HZGA 2X1SA 5E6YA 1GG0A 2VEPA 3M46A 1CBGA 1ZZMA 4WF7A 1GTHA 5GJPA 4O53A 2D1ZA 4NZ3A 4ML4A 3WLOA 2Z1KA 3MDUA 1E15A 1CNVA 3KL5A 2F38A 1S3TC 3HPXA 4HK7A 5DBUA 3RO6A 1V7YA 1E9YB 4KRZA 4PMVA 4PCTA 2ZVIA 3UWVA 2GJPA 4O8RA 2W27A 2EKCA 3M6DA 2QPSA 4XZHA 3LERA 1RPXA 3ITYA 2QR6A 1H5VA 1W3LA 4FX8A 1YQ2A 2FPTA 4EPEC 4Z2JA 3T0AA 1Q66A 3SSZA 4X60A 3CUHA 3ZWTA 5CCZA 1FCQA 2Z6JA 3AYTA 4WQ6A 3U5UA 3H7UA 3I68A 3BOLA 1C8QA 2TRSA 1B5TA 3M64A 3PZVA 1DJGA 5CAHA 4R9OA 3L2LA 2UBPC 3ZVIA 4MF4A 2L5HA 3T40A 5AYYA 4D6CA 4PBEA 4AX6A 2P0IA 1YLVA 4CN1A 3HQNA 1SVDA 1G01A 1GVSA 2ACSA 3I10A 2AL1A 3UCCA 1TELA 1GOMA 3VC5A 2V6AA 2WBGA 1OFAA 1WKYA 5A6BD 3LRLA 3NAVA 1X8CA 4QSFA 1M7OA 4CNOA 3GTXA 3B03A 3ES8A 5L9FA 4MUZA 3WY1A 3LYEA 3RM8A 3A4JA 5D9PA 3AFBA 5D9NA 3EX2A 1OZMA 3HPAA 2PDYA 1FWFC 3EOUA 3L4TA 3PPHA 2V82A 5BXTA 4NZCA 3GW3A 3L4WA 4TQTA 3GZ3A 1GHSA 4LVAA 1M1BA 3CM4A 4GJIA 2PRMA 4JNMA 3SY1A 3VDGA 1FWBC 1LTDA 5CSSA 3AU6A 1UCWA 1NFBA 1HGYA 1X96A 1KTCA 1XPGA 3GIPA 5CJMA 3NQBA 1P6BA 2J9ZA 1DWIM 3NXFA 4B5NA 2PC4A 2VTFA 3SM0A 3UWZA 2WKLA 1H5YA 3VOCA 1GZJA 3KS5A 1TPEA 2EXOA 1VBJA 1MO0A 1CWYA 1G4EA 5EL1A 1EJWC 1EXBA 1A49A 1IWPA 5A94A 4BS0A 4GX9A 2WV8A 3GH4A 4ECLA 4H4IA 3VTRA 1MUCA 2TSYA 1BF2A 5HUPA 1VBHA 1E6QM 2VKZG 2OGJA 4YCOA 3VNDA 5C54A 5IDZA 1Q2RA 1QAPA 1NOFA 3BMXA 1CYGA 1FX6A 3VX1A 3H70A 4H9TA 3T4WA 4ZZ9A 3DENA 3GG0A 1V93A 4QEHA 3VC6A 4IPIA 4PL1A 3G24A 4JIRA 3BGJA 3M16A 2J8FA 4M19A 3M0HA 1ZCCA 4G7FA 3CWHA 1OFPA 4PMJA 2IPJA 4PBGA 3W84A 1KFCA 3N25A 4ZOBA 4AWEA 4XZNX 1XJBA 1MW1A 1F74A 1OF8A 2G3IA 2PWFA 2NQ5A 2I1OA 3W70A 3PPGA 1PVNA 4HCDA 3R8GA 4LBSA 1PZ1A 1J12A 2VGFA 3RRAA 3HA1A 4HSOA 4HYVA 1A5CA 2PFHA 1W9BM 1BG4A 3FSUA 3M0JA 3VMPA 1G69A 4UMAA 4TTUA 2Q01A 1YE4A 3P0WA 3VKCA 4MM1A 1LBMA 5H8UA 4IIEA 3WLKX 2P88A 3APGA 4ZQPA 2YPIA 3TA6A 5K7JA 3CQ0A 1GOIA 3NOEA 4DM1A 4O0KA 4I7VA 3OEXA 1W5OA 3FS2A 4FI4A 1PB0A 1S1RA 3I7QA 2OPJA 3MS8A 2PGRA 4MFEA 1RLDA 1PX8A 2JIEA 4C1KA 4QS6A 1E70M 4J9JA 1W1ZA 1DVJA 4JX4A 5HJLA 3EX6A 1R47A 4TU1A 3VKBA 3NL5A 3HQOA 5CPOA 1VFUA 3S2NA 1C3FA 2QULA 2JEPA 2O0TA 3W6LA 2WO5A 3WJSA 2E67A 3CZ8A 4IIBA 3VGGA 2WVVB 1UOZA 2D2HA 3KRBA 1WZMA 2PTXA 1JEZA 4MAVA 4JD4A 3DFPA 2HBXA 2FPYA 4ICMA 1EZWA 1OHLA 4DN1A 3NZGA 1UP2A 4O28A 4FR6A 2KAUC 3WCZA 4YHEA 1A5NC 3W07A 3QPZA 4DUOA 3T78A 1OSEA 1F8MA 4QS5A 4XQ6A 3BCFA 1O7AA 3DG7A 2ZZ3A 3AS3A 1KBBA 4LYKA 5EMYA 4HNCA 2CIPA 4L65A 2OQHA 3C2YA 3KRSA 5CJ5A 3AAMA 3SN0A 4O4VA 3RU6A 4IICA 1SFJA 2WLYA 1U1JA 2ZOXA 2VVSA 3SUWA 2EPNA 2VNCA 1QNVA 2QF8A 5B7YA 3O3RA 5G1MA 2ACQA 3BLKA 3K46A 1KTNA 2PAJA 2QNEA 2PP0A 1FTXA 1GQLA 3CEPA 3N6QA 3NQCA 1LUCA 4IJBA 1VBUA 1A5AA 2YA0A 4XISA 4HT3A 1TV2A 1WZAA 1SMAA 4CD4A 2E5DA 3EXRA 4Q8WA 4W8BA 2C6QA 3CTLA 1Z32X 1H51A 2SFPA 4MKNA 1ADDA 3DCPA 4AVFA 1VJIA 5BOFA 3GNXA 1VYSX 1LQ0A 4H19A 2B31A 3CZGA 3T08A 1TWIA 2GQ9A 2DQWA 1EJSC 1P5BA 3AIRA 2PGFA 3LXAA 2PGEA 3O06A 4US5D 4Q3MA 3UPMA 3G3MA 4H7ZA 2Q3RA 4UTJA 3BAYA 4D8LA 4MZ1A 2R6OA 3C8NA 4LRTA 4NHVA 1HKVA 1KCKA 3UW6A 1J18A 1EO7A 4AY1A 3AIWA 3WDRA 1GNXA 2XISA 1FXQA 3CHEA 3A4WA 1K02A 3EXSA 1DE6A 3VGEA 3BG5A 4HB7A 3QQ1A 1DQWA 1EIXA 3NQDA 4Q8MA 1VP5A 4AHQA 3NL3A 2FKPA 1YNQA 1PL9A 1JCXA 4L4MA 4O1BA 4MB1A 3RILA 5C7VA 1NQ6A 3BLDA 5EFDA 2VC7A 1BVZA 3SSJA 2QJGA 3TN3A 4AMCA 4FX7A 4B91A 4XUGA 2O7QA 5FEPA 1QI2A 5LHFA 3WBXA 5M03A 1LOQA 1GKRA 2BOEX 3I3DA 3PAOA 1QPOA 3K2GA 1A5KC 5A6KA 3OJGA 1NEYA 2C7FA 2WZEA 4ZTYA 3CZKA 2EEXA 2ZRWA 3CUFA 3GAYA 3PULA 4K8HA 4U33A 4H9VA 2O92A 2JIWA 2ZE3A 2Y88A 3BMVA 1HO1A 1M6JA 3VGHA 2PS2A 1UD4A 2WWCA 3KOYA 1QHPA 3TQ0A 1FKXA 2YL5A 4DPPA 4NX0A 4AX7A 1M7JA 4PSPA 3UFYA 3AHYA 2GWNA 4DAFA 4Y7EA 2PLJA 3LV5A 3EAUA 1S2TA 4S3JA 1ADSA 4L6DA 2RDUA 3T44A 3CMFA 5FCZA 4S3BA 3IANA 3LLXA 3TV8A 2QQ6A 4ILSA 2VFGA 1VFMA 1SFSA 1XYLA 3NQ2A 1V51A 5LGXA 2AQWA 3TK7A 3PNUA 4D6HA 1AJ2A 3B0PA 3GG8A 5KITA 1GOXA 4H41A 4FLSA 4L9YA 1YDVA 2GUYA 2JBMA 4D1IA 3F2BA 3RO8A 2BLEA 2GZXA 3GIYA 1TVLA 2HTMA 1W5MA 3CV1A 4MADA 1TJ0A 5HWMA 2R1KA 5LYRA 2PTYA 2NXIA 1S38A 3UJSA 2W6RA 4L1GA 1EHNA 2VOMA 1IXOA 1UD5A 3UVAA 1DWAM 2GPTA 3TAOA 3M07A 2WB5A 2ZRYA 1Q3NA 2HVOA 4Z1BA 3USBA 2DT3A 2POZA 3WMLA 3UPBA 1FWHC 5BCAA 4AHOA 2YL6A 1OFEA 5LHEA 4TXEA 2Z1XA 4UZSA 4MNLA 5CBIA 4B5UA 3STFA 1XH2A 5CC3A 3LHTA 1I2RA 4S23A 2Z1WA 3D46A 4MNMA 3PFMA 4C6LA 3K5XA 1O94A 3QFEA 2ZX5A 1YBQA 2D73A 3O0KA 5CLTA 3SW6A 3FFSA 3VCNA 4PMYA 3NWRA 2JKPA 5C55A 3KAOA 1K7FA 1UP0A 1H7WA 2FVLA 3V5FA 1XDJA 2PMQA 3GK0A 3H7VA 3MCMA 4GXPA 3F7JA 4UTKA 3CEUA 3FVMA 2QDHA 3MJMA 3E0IA 3W76A 1K7EA 3FJNA 2AAMA 3AI0A 5BMWA 3NL6A 3UG5A 2CZ5A 4MUPA 4MWAA 5HOSA 2WNNA 4X0NA 3A6OA 3V36A 1ODUA 1E40A 1UZ1A 5AC8A 3CZEA 3C2OA 1V3JA 5FF3A 4C7GA 1R8LA 4EWJA 3M7WA 4JQ3A 3N3MA 5FAGA 4W88A 3WO8A 1P43A 3DFQA 1F76A 2NUYA 5F1UA 1DJNA 3WH6A 1UG6A 4JY8A 4QNEA 1CXEA 4EWND 2VZOA 4EPBC 3AXHA 2BS9A 4P7NA 3U7VA 1UZHA 1UWTA 4MHBA 4MLJA 1ZP4A 5EMKA 4FIQA 4BZYA 4DO4A 3OGSA 2E6FA 1KXVA 4LB3A 3WD2A 1VEOA 2PU1A 4Y9OA 2OZ0A 4O10A 5DMLA 4G8TA 1IEWA 3W7QA 1E6RA 1EH9A 2QGYA 1V6VA 1DIEA 1YMYA 2H9AA 4Y9AA 1OYCA 4C91A 1AH3A 5T8GA 4GACA 4BEUA 1BYCA 3W1AA 2A21A 3O0FA 4UZUA 3TN4A 3GLCA 4YIWA 1I8JA 4V15A 5HDRA 5EBAA 3DI0A 1XBYA 1E9IA 3UZ5A 4G1KA 4S3AA 4YXGA 2RDXA 5KZEA 2YX0A 2X16A 4AZCA 4G5DA 2CU0A 1BAGA 1UH3A 1PKMA 4FNTA 4Z1YA 4RNIA 1A5MC 4H04A 3Q67A 1BFNA 2QT3A 4KWUA 2D2GA 3CU2A 4LQ1A 5G1TA 3PR2A 1Q7ZA 4C6BA 1HP4A 3L21A 3PM6A 1R6WA 5HQEA 5ECVA 5KZ6A 4FPSA 3VM5A 3P8IA 1DWFM 4GFSA 4ZQRA 3TW9A 4AVOA 1DJIA 3JR2A 4W93A 2XPKA 2ZA1A 1J11A 4LYRA 4M7TA 2NQLA 4LAZA 1I2NA 1MRAA 5A8NA 4DBWA 3N2OA 4FZIA 2C8NA 2ZTJA 1IEQA 4Y9NA 2HWGA 2GQ8A 1KBJA 4G6CA 1DXEA 3O2LA 4I8DA 3OYXA 2FHCA 3UZWA 2AQVA 3L12A 5DANA 3MANA 3BDKA 2CLFA 4WY0A 4JBRA 3SAZA 2QDGA 4C6NA 5I24A 3WF1A 4JDYA 3GTFA 3UESA 1P7TB 2G3JA 3QQWA 5CSUA 2DT2A 4DM2A 3H4GA 2VFIA 1TPFA 5ABEA 3CLMA 4PFHA 2NT0A 4JKKA 3E49A 2OO0A 3H7RA 1X1NA 3EWXA 3DFNA 1OVDA 3ARVA 5HQMA 1UIOA 3PAJA 4OVXA 3BARA 4F2BA 3EB4A 1WZKA 4RE4A 3EX4A 2ZUTA 4Z2HA 5C0QA 1S5TA 2Z2AA 4EXBA 1R3YA 3HV8A 3GDLA 1SO3A 3GM8A 3GVVA 5EMJA 1OYAA 2X1TA 3N4EA 4HMCA 4C6CA 2D24A 4RDWA 5IBXA 1ZJAA 2Z29A 5D9MA 3WQ8A 1K03A 2FZNA 3HBLA 2WHJA 4PMQA 5M2FX 2C0HA 2VENA 4H01A 2Z27A 6TAAA 2AOSA 3VZYA 4DY1A 3WZ0E 4ZGYA 1MZRA 4PCSA 2ATSA 4O52A 1XINA 3L66A 2DZTA 2QJHA 1MMFA 3KLKA 1A5OC 2DT0A 3HMCA 2IKIA 5FF0A 2ZWZA 3EYPA 4MY9A 4IGSA 1LORA 1GOQA 3V18A 3LZ3A 1BQCA 1HW6A 2VD8A 3OZMA 4AIEA 3BG3A 4FA3A 1SJCA 4S3EA 1PDYA 4GUIA 2ZZ6A 1KD0A 2DUXA 2Z26A 3K1GA 3IRSA 3WD3A 1KKOA 1DQUA 3VMNA 2J47A 1JNEA 2Y1HA 3W81A 3B0YA 4HHLA 3HPFA 2FLIA 9RUBA 3L5MA 3NYDA 2EQDA 1RVGA 2IKJA 4C6FA 8A3HA 5HNTA 1B30A 3DZ1A 4LNYA 3QV6A 1AMYA 2BHUA 5G2IA 3IUDA 4NZ5A 4WX2A 4IFKB 3SURA 4YWIA 4Z08A 3EWUA 4N9BA 2XINA 1L2QA 3CUZA 3SFKA 1QW9A 2OKTA 2V3DA 1T0OA 4TVCA 4LEQA 3CAQA 4CQAA 1R46A 3P84A 2GGGA 2MANA 4PTWA 3LD5A 4GNKB 3P14A 4H6RA 2Z6IA 1TUXA 4IIHA 4JAWA 3WN6A 2PB1A 3P5ZA 4DNHA 3CL7A 2FGBA 1W2VA 5GVJA 3QPEA 5MKGB 2RUSA 2HVMA 3DXIA 2PDXA 3GC2A 3FSTA 2DSWA 3CUJA 3UZJA 4NAFA 1RD5A 1W3JA 3T81A 3HTWA 3QGAC 4A29A 3M44A 4GQ0A 4JIPA 1XQLA 4XBKA 3AS0A 2DH3A 4XBJA 5DY3A 1JXKA 3WIJA 2YSWA 3TN5A 2V3GA 2J25A 4E0CA 5JBFA 1IZKA 1D7KA 1E6ZA 3G1YA 4DZAA 1FFQA 4D6FA 4GK8A 1UYQA 5T9CE 1CEOA 4A3QA 3W71A 4NNAA 1W1PA 2B7OA 1OX4B 4HNNA 3CPRA 1AK5A 1G4PA 2QUUA 1KFJA 3ZFHA 1IE7C 5I06A 4PUKA 2WJDA 4P7RA 1KKRA 4UC5A 1K7XA 3MW7A 1H49A 3RN6A 1G0CA 2WAGA 4ZFMA 4WGHA 3FEQA 2WMFA 3F2CA 4L4OA 2XGZA 1TZ7A 3EEZA 2V69A 2E4TA 4PMUA 4GLEA 2XIIA 1GQJA 5KZDA 3WQ5A 3B0UX 3F4CA 2FZDA 3SCTA 3EPOA 4H8UA 1A47A 4Y8EA 3VK5A 3NQ6A 3CUIA 1F5ZA 1PDZA 3WH7A 2W66A 4HN4A 3H2FA 4QJ1A 1T8QA 3KVJA 4AEFA 2WHLA 4AZIA 4XZWA 7REQA 4FOUA 2UY4A 2HMCA 3SQLA 3R2GA 4GH1A 3UGVA 4ZO9A 2DU2A 4RXGA 3ABSA 1PIGA 1QO2A 2JK2A 1WAUA 4LANA 4BQ2A 1YPIA 5AC5A 2TODA 3LRMA 4FSAA 1DJWA 4CCEA 4GFIA 4CNNA 3BMWA 4D6IA 4ZO6A 4ERGA 2ISWA 4E3VA 5HJYA 3E96A 1KCLA 1Q13A 4WDTA 4RZ4A 1ME7A 3A64A 4U28A 4JFUA 1YPXA 2J7HA 4BQ4A 3B9DA 2CLMA 1JPMA 2G37A 3L2IA 4HK5A 4MNJA 4KEUA 3IVTA 2ZZ5A 1OY0A 3N3TA 2DZVA 2ZZ4A 3FGCA 1CT5A 1XBVA 4IMAA 1PXGA 3FV9A 1HX0A 5FEXA 3S83A 3REQB 5HPCA 1DTNA 3KVMA 3MMTA 2ZX7A 5DFAA 3VDBA 2V67A 2G8ZA 1UR0A 1AJZA 1BYAA 2YYUA 3R0KA 2CZDA 2PWGA 4GIYA 1EWEA 3B3DA 4B92A 4AC1X 3W2JA 3CT2A 4JFSA 3U57A 1JFXA 3KCOA 1KGXA 3W87A 2FMOA 3OQEA 2W9MA 3ARSA 2I57A 1AG1O 1F4HA 3LTPA 2C1HA 3NSMA 3HOJA 2X0SA 2BNJA 3V4BA 3A9IA 3G77A 5DBTA 2DIEA 3CASA 3DESA 1QK0A 1US3A 1NFGA 1UMLA 3EDEA 3R7MA 2NX3A 3Q65A 4RV3A 4JIHA 3IK4A 5JBDA 2CPUA 5CZSA 2DVTA 3GXTA 1H0IA 1RCXB 2Z2UA 1TRDA 1PWLA 2YB4A 5FKYA 3LRKA 3UY8A 1SPQA 5E70A 4O54A 2NVCA 4UOQA 3LI0A 4ZB5A 1TWZA 1B54A 4RX0A 1WDQA 4MLRA 1RLCL 3GU9A 2QAPA 3AYVA 4QG8A 3ALFA 1ICQA 2GUUA 3MI2A 4IIDA 1CXHA 3WQGA 4NYYA 3FJ6A 3GXFA 2GGHA 1UBPC 4HZMA 2YFOA 2IPWA 3SZ8A 1I0DA 2P5NA 2D2OA 5BXSA 1TJRA 2R14A 2WW5A 2QS8A 1V7AA 3P3BA 2GK1B 1V3IA 4OWGA 5AB3A 3NM3A 3SECA 3TR9A 3NTYA 5CPMA 5D8ZA 2VZUA 4AXNA 1J0ZA 3AMCA 1M3UA 2VXNA 3DYPA 3H4WA 4I8YA 1UHVA 2WNZA 3NGJA 1W3IA 7CGTA 3K4DA 2O9RA 3NA8A 4AD5A 1JCNA 3ABQA 4DEFA 2GJXB 4YVVA 4O17A 4FNSA 2PGWA 1DJZA 3S1UA 1ME8A 1JRBA 1D7FA 4OOUA 4ORMA 1VPXA 4FXFA 1TIWA 3TC3A 4RNJA 4Q7NA 1I2OA 1MI3A 1V6UA 5D09A 3NUKA 4N7QA 1X6UA 3F5JA 1TR1A 4KERA 4L6HA 2V3EA 4U31A 2RDWA 1Q6EA 4NAEB 2ESCA 1U5VA 3ITCA 1ZFJA 3A22A 1WKFA 3AHZA 2CBIA 2WMGA 5AC7A 2Q02A 3TSMA 3WJZA 2QCDA 3W2UA 3QQ0A 3NO5A 4WOQA 4C7FA 1EF3A 1YX1A 1GQNA 5JMUA 2CC0A 4LB4A 1GZGA 4CD7A 1X98A 5BZAA 5DX7A 4QJ3B 1LT8A 2HK1A 5JIWA 1F3EA 3G18A 2WVUA 5HUOA 2HDJA 2PTDA 5D8WA 4PB3A 5EB8A 3WJXA 1G1YA 4GBUA 1KFEA 2V2CA 3CH0A 4A22A 4LF1A 4W4QA 5G2WA 1WPCA 2PEVA 3GDKA 1VHCA 2ZQ0A 1H09A 3IGSA 1PYMA 4JYEA 4I9MA 2CHNA 3HQPA 3CYVA 3MQTA 2J4GA 2INZA 1UKPA 1JZ3A 3ES7A 3GFYA 1XG3A 4C65A 4PYSA 3M5YA 5A8QA 2AGTA 1F6YA 1G7VA 1RZMA 4AF0A 2PP1A 4LS1A 1HJXA 4LUSA 3G22A 3L68A 2R1NA 4GOAA 1SJDA 4IUGA 6A3HA 4K7YA 4E4FA 1IR2A 3C3NA 3VCCA 3OOQA 3N04A 3KZPA 2DZBA 4J3ZA 2BG5A 4YTUA 3CUXA 1LRTA 2J6VA 1MEHA 5E9XA 5A8PA 1CGWA 3I3BA 1UP3A 3UERA 3LCGA 4DF1A 2B7NA 1EP2A 3O9NA 1EPXA 1D3CA 4D8AA 1OCQA 1UA7A 1W3NA 5AZ1A 3DIPA 4Q33A 4Q8OA 4QLKA 4MB3A 2Z28A 4C5YA 2HS6A 4JQ1A 5REQB 3CTTA 3BLOA 4ZE5A 4IWWA 5DMYA 4PB5A 3IAQA 4H6EA 5TD4A 2PTZA 2XH4A 2PI6A 3W23A 3GR7A 1ELSA 1UQZA 1QI4A 3AYSA 4FMVA 2PU0A 5I7GA 5C2CA 4E38A 4YVPA 4LX4A 2WKGA 5HMEA 4KGJA 3L0KA 3DYOA 2HSAA 2VDHA 3PUGA 4JTLA 2ISVA 3GRIA 4LV9A 4FHAA 1TQJA 5LKYA 1V0NA 1OQFA 4LWWA 1A80A 2VR2A 4Q8PA 3IIOA 3DDMA 1TYGA 5XINA 1FWRA 4C6EA 1YYAA 3BICA 5G2HA 1ISZA 2BVDA 2CLOA 3TXZA 4CVWA 2DSVA 2PDKA 1YNPA 3PSVA 2VQUA 2YW4A 4JCMA 4Q4OA 3VE9A 1XLFA 3SCUA 2NLIA 2Z2BA 4EIVA 1TV4A 2WNWA 1XQKA 4OBSA 3GVQA 5I78A 4M6UA 3KZSA 1VJZA 3O16A 4AIOA 3TFXA 2XVNA 5DRIA 2VL4A 3K30A 3MCNA 3RXZA 2ZX6A 3BH4A 1NWSA 5F2IA 1SZNA 3RX4A 5FIPA 4C60A 4AISA 3DC0A 1OBAA 2OELA 3ZYZA 1S5WA 2HE8A 4A4AA 1SW0A 1DJXA 4NJIA 1TPWA 4QCFA 3MV01 1DIKA 3WQDA 2R82A 2ZIDA 4H8VA 1EDTA 1E6SM 5CEWA 1B57A 3QHMA 3WLTA 1BEUA 2EPKX 2OLHA 1QW8A 4INFA 3T55A 3V0UA 2GQAA 1VHNA 5ABGA 3BW4A 4X2RA 4RCXA 2BOGX 2QLYA 1MNZA 1WO2A 2VP8A 4H7VA 1ZUAX 3BJFA 1OGBA 1FUYA 1OD0A 4F2TA 2QJIA 4DJFA 4NZ4A 3CHVA 3KE0A 5DCEA 4HNOA 3STGA 2WZTA 1Q6LA 3AXKA 4G7EB 3MVTA 4ZVJA 1SFTA 2WMHA 1QNPA 4GZJA 3PJUA 3STCA 5F2MA 3ZJ6A 1REQA 3BV7A 3QV8A 1ZAHA 1XUUA 3GO2A 1ZBWA 3R8HA 4IGNA 4I7WA 1F05A 2CFFA 3WUGA 4QE4A 3WDQA 1MRQA 4GVHA 3TAKA 2VUYA 3CT7A 3HZ3A 4E2VA 3VOHA 3PF3A 2NQJA 4DJEC 5D32A 3A23A 4GQGA 4DF2A 3ZJ8A 4KFOA 1JXJA 3FX4A 4PUWA 4LAUA 3SGUA 1Q6DA 4WLCA 4Q4MA 3AZRA 4H9ZA 4UMBA 1R9YA 1PX3A 1XC6A 2VHLA 1VCFA 2TMDA 4JTQA 1XDLA 3C0LA 1E43A 1G67A 4GYFA 4J40A 1VC4A 1WCGA 3TOPA 2VEIA 3EEGA 4R33A 4BWLC 4HHMA 3OLEA 1LWHA 3CHCA 2WLZA 2ICSA 3M0ZA 1TE1A 2A3EA 2Y61A 2OODA 1XXXA 3KCJA 4YYFA 3MKKA 1NWRA 1TTJA 1PTGA 1X1OA 3TTEA 3OIHA 3BC9A 4TTGA 1E4NA 3P74A 3RM9A 1R85A 1KGUA 2CBUA 5E6ZA 4D2JA 3WSUA 3W24A 3ZVHA 3S8HA 5K9CA 1H41A 1JCYA 1NOWA 3NQ7A 4I9AA 4LCQA 2E6AA 3TYCA 3I4EA 1BVNP 4UTFA 2FPVA 2OEJA 3IJLA 1E3ZA 1NQKA 3WLLA 1FOBA 4HU3A 1VFHA 4JN6A 4IPJA 4S38A 3G1HA 4NL1A 3VKDA 2UY3A 4ENLA 4KESA 3O8AA 3UY7A 3RPDA 1A5SA 2QZRA 1FWAC 4N4PA 3ITVA 1VZWA 4LT9A 2VFEA 4CUCA 5GJNA 3AHXA 3VAVA 4N02A 3IUHA 2DZAA 2QCEA 2D0HA 3NSXA 3KFTA 2XGIA 2NV9A 3PZ9A 4OHQA 4GKTA 3WD4A 4CQDA 3AWOA 1DL3A 4DWSA 3VO0A 4M6VA 3NYZA 1V0LA 2D69A 2BGSA 3R0UA 1P1XA 3U7BA 1TWDA 5CG7A 3GDRA 1E0VA 3IGHX 4ROPA 4E8DA 3WDPP 4REQA 3CPGA 4LC6A 3PN8A 3LI1A 1UWSA 4PCFA 3BAKA 1B4EA 1G4SA 5CZJA 1E1FA 4ASTA 3EXTA 4DF0A 2QHAA 2Y6ZA 3E6EA 2CCRA 2ZC8A 1M9HA 3B8IA 1F4AA 2VC6A 2QUVA 1WDSA 1U5HA 4UFMA 1US0A 3KCLA 5I3HA 4CQBA 4DYEA 1FP8A 1YKWA 2E8ZA 2PDWA 4UB9A 3USZA 3BQ5A 3H2CA 5HBFA 2QV4A 3IVSA 1I75A 3FIGA 3P81A 4QP0A 2DEPA 2WVTA 4W89A 1LYXA 3N15A 4P2VA 3QZAA 4J3SA 4LVBA 4DUXA 1TWSA 4M8UA 5FJPA 3QYQA 1X8FA 4AC7C 1FWNA 1P0KA 3UR7A 3TTQA 1XLCA 3LM7A 1QHZA 1BKSA 4UXDA 4LVFA 4NG3A 4M3PA 3CB8A 2J9XA 3GC4A 4QRNA 1ITQA 4ICNA 3R58A 4HJFA 3M1ZA 4UFJA 5LIWX 2ZUVA 4C1NA 2QKFA 5M3WA 2FB3A 2BHZA 4HOXA 2OXNA 5JH2A 1YXCA 8RUCA 2IUZA 1ZJBA 4WJXA 1ICPA 4KEMA 3CAKA 2A5HA 2DSZA 2P53A 1YTEA 3UWUA 2XIQA 4I6VA 5CH9A 4N6EA 1O12A 4XAGA 4A3YA 2O55A 5XIMA 1BQGA 3GW0A 1V3MA 1LL7A 3H8AA 3ARWA 2LLEA 3F5KA 4AZHA 3EPNA 1KM4A 3NZQA 5D2XA 2Q6ZA 2OSXA 3QSRA 4UCFA 1I45A 2ZZ7A 5LNRA 1IWBA 5FF4A 1U2YA 1HP5A 1V5XA 2YXOA 3WF3A 4ZQNA 1ODZA 3QLLA 3KUMA 3GTHA 4WY0F 5A2AA 5HR7A 3WEZA 1Q5MA 2Y8VA 2HNEA 3SUUA 1FXPA 3QR1A 4FK9A 1K9TA 1Y65A 2BGNE 1IXNA 1J0IA 4GG9A 3B9OA 4C6DA 4NP7A 3WYZA 3TTYA 1R3QA 4PN2A 4UQCA 1C92A 1DIDA 1HG3A 4IFRA 3K4WA 4KT2A 3DOPA 3RPTA 4HQVA 4LVDA 3KVKA 1W5NA 1OWQA 4GJJA 4W7VA 4W5UA 3AIEA 1KM0A 3T4CA 3QY6A 3NVDA 2VRQA 3IS4A 1EJTC 3OBKA 1CCWB 1V79A 3WLIA 2J7FA 4KWVA 4Y9PA 3FLUA 2X7VA 1TV7A 3P0XA 4OECA 3TYZA 4BKNA 2NWSA 5DRCA 1MFUA 1QK2A 1QT1A 3SBFA 2VVNA 1QI3A 1JZ7A 2DIJA 3WELA 4BY3A 4F48A 2PZ0A 2BP1A 4K38A 1QWGA 4YTSA 1WX0A 1KXQA 3NL2A 1DWHM 2CLKA 7TIMA 2GSJA 5IXEA 1L6WA 3VABA 2CKRA 4GGBA 2E9BA 3TDFA 1OFDA 4C6JA 3NQAA 2XZ9A 3S2JA 1AQFA 5D05A 3K8KA 2VO5A 1UJQA 2VX4A 2WSPA 1O5KA 1EHAA 4XO7A 4R9XA 3TYAA 2QJJA 3EOOA 3EMZA 4RJEA 1PKLA 3QN3A 3LQLA 3VNKA 1RY8A 5BW6A 3GHTA 3II1A 1MDLA 1E56A 2OT0A 2FTYA 3DFYA 1Y5VA 2F6KA 3FKKA 4NI8A 1XIBA 1JL8A 4O1AA 4GZEA 1TMQA 2JE8A 2QUNA 3WNPA 4Z17A 1U33A 2VUNA 1HVXA 2VQTA 3ZQ9A 1YTKA 4J35A 4UTTA 2G4JA 4M56A 5F4SA 7ENLA 1W9DM 1HUVA 3VZXA 5DCBA 1HJQA 1JZ2A 3NR0A 4PTXA 1S5VA 5BU6A 3B8VA 2OB3A 4HOZA 3MUAA 4I5XA 1YXYA 2C91A 3HJZA 3W7GA 3DERA 1PYFA 1GVEA 3WF2A 2FZBA 1OD8A 1UQYA 5GQBA 1W6TA 2XSAA 3IAPA 3H2MA 3RAOA 1YDOA 4N9DA 2OZ3A 4B2DA 3XINA 2F6UA 3EKZA 3IEBA 1Z8AA 3UJFA 3W86A 3VA8A 3SCWA 3T05A 1EP1A 4JQ4A 5KSWA 5A3HA 1VFFA 1H3GA 4GUGA 3QMSA 1PO9A 3WFLA 4LUIA 3RUBL 3A3XA 3O63A 4UFLA 3PG8A 1XIEA 1TKKA 2FFIA 3GYEA 1RUSA 1EO5A 1ONXA 4L80A 3EKLA 4QTGA 2EAWA 1GJPA 2IQ0A 4GC3A 3VGBA 1B3XA 1Z7AA 2DIKA 4AD4A 3QGVA 3S9IA 1NWUA 1FCVA 7XIMA 1JGMA 1GVQA 4UIOA 3SUVA 3B8DA 1GK8A 3DFOA 5BWAA 1JYVA 2OR2A 2VR4A 4DYKA 3MO7A 3W1QA 2CERA 3A9BA 2WJFA 4AZ5A 4KFPA 4K1WA 3I6EA 4M80A 5CC6A 3LPPA 2WQPA 2WM0A 3MBDA 3CIXA 2A1YA 2PP3A 2VI0A 3TW6A 2FVMA 3AJ7A 5C6MA 2R9RA 5LXEA 1EGMA 3WBWA 2ZDSA 4LNCA 1WUFA 5IHRA 3AIUA 3G1SA 2I56A 4QLJA 4NUWA 1JCLA 3KOXA 3ARRA 2OLAA 1NM9A 1P48A 2GVYA 4AMAA 5I77A 5JBEA 1IIHA 4XZMX 3EDJA 5I2UA 4YS1A 1MW2A 2YA2A 4IX0A 2VD9A 4AY8A 3UVIA 3WQOA 1HNYA 1NJJA 1MXSA 1HKWA 2GL5A 4GYPC 4PCPA 1BRLB 2ATMA 3BGAA 3VD3A 2VEGA 4B5SA 2GFTA 1V77A 3UEQA 3LCHA 2QDDA 5HWJA 2W61A 4XIAA 1CPUA 3QOMA 1CTNA 3M0MA 4GVGA 1OCNA 1TVPA 3S3GA 3FYPA 2YDAA 3MMUA 4JQ2A 5EU9A 3GU1A 1YIXA 4P7OA 2PURA 3S6OA 4AB4A 4W87A 4UQAA 2PDLA 3UYCA 1XGEA 3ME3A 1JAEA 4EVZA 4GHRA 3SGZA 3NVTA 4CNSA 1ME9A 4AZBA 3A12A 3GNOA 4XO6A 1JYXA 4GO9A 4F79A 1HO4A 3PZMA 2C16A 3B8SA 1KV5A 4XB3A 1RCOB 4DBSA 4ZBCA 2PDMA 2CW6A 1LL6A 4MWAB 3N73A 1JPDX 1XW8A 1GHRA 2QMKA 4HK6A 1CLKA 4QHRA 1V03A 3QOKA 3RITA 5JH1A 3BPWA 5FJOA 3MUZ1 4UFHA 4HNUA 2X7WA 2RFGA 3ZR4A 1S46A 1OJXA 3M43A 3N4AA 2JFEX 4AHPA 1RSCA 1CZ1A 5A6AA 4Q4RA 3VD9A 3HIJA 3MC5A 4Q8UA 3RPMA 1CXKA 1E4LA 2GVGA 1GEHA 1OFRA 2NX9A 3W7HA 1W1A1 4DBDA 1IT7A 3P61A 2AQOA 3LU2A 4F0LA 4DI8A 1Q6FA 1IF2A 1V02E 4K2SA 3GXNA 3L65A 3MCOA 2JEQA 5H91A 3WNOA 3OHIA 3L4UA 4S3GA 4UOZA 2QCFA 1SQ7A 5F2LA 3PS7A 3F4NA 3UR5A 4Z42C 3BLEA 1EZ2A 4A8LA 2H9AB 2O56A 2OT1A 1UZDA 1ZPTA 2X0YA 1E0XA 4L4LA 1TJ1A 3LTYA 4Q4SA 1HQTA 1BYDA 2X41A 3E5PA 2ACRA 4U10A 1A3WA 1FWSA 1ZS2A 3TQKA 1JD7A 4HA0A 4QE5A 1XKJA 3SB0A 2I14A 2CNCA 2F6XA 3OPSA 3HJEA 5I3IA 3VE7A 1F9CA 5D2WA 3WMSA 3R94A 1VGAA 4YU1A 3TC7A 5I00A 1MW0A 3PUDA 2WM1A 3QY8A 1C93A 3BAJA 1ALDA 2Z25A 3CO8A 4H6QA 2PE4A 3R43A 5CC5A 4HZ6A 2CLHA 3MWCA 5I3FA 2C18A 3WQEA 3VOJA 3M5XA 3G1RA 3N9KA 4WKHA 5G1YA 3PSWA 1KLZA 2J7GA 3W2LA 4LUYA 4ZENA 3I7SA 3BW3A 3JZUA 2I9UA 4JTEA 4TR9A 3MT1A 4ZOEA 3OTRA 4JL2A 5HULA 3AXXA 3H55A 5I6SA 4O11A 3W1XA 2VC5A 3IUIA 3ALGA 3QHOA 2ONEA 1C9DA 5AKQA 3P60A 2QIWA 3AMDA 1NTHA 3PBUA 3VPLA 1F73A 2ZUNA 1OG6A 2G95A 4DZIA 4QQUA 3P80A 4J3XA 5U7SA 4LAOA 2BTMA 4JNZA 1TV3A 1NDYA 4LF2A 1XSKA 1EP3A 3LHYA 3PTDA 4MTVA 5GNZA 5HATA 3K8LA 4CKQA 3H2EA 1XCFA 1T96A 5FL1A 3HFYA 3HO8A 4NRRA 2Q71A 1EDQA 2FGZA 4QNWA 4PSRA 1V4YA 5CGTA 2BMBA 3CLWA 3N2BA 3SCQA 2WOQA 2V63A 4NJHA 1FWCC 3R10A 1RXOB 4N9EA 4GY1A 5A8OA 3AJXA 4H9YA 1TPDA 1QRQA 4TX9A 4DIAA 4EPKA 4IX2A 1JQVA 4X3ZA 2E68A 4J3UA 1VBGA 4GA8A 2VX6A 3S5OA 5LIXX 3O6AA 4AZGA 5FL0A 3DN5A 3LXBA 2GWGA 3FW6A 3LY0A 3PTKA 2OQLA 2Y4SA 2YCEA 1PUDA 3W7IA 4PH6A 4DELA 3MKCA 4CQ8A 4YL2A 5LIUX 4MY8A 8XIMA 4IPNB 3KS6A 3THUA 1W1TA 1D9EA 2V5BA 3OQ8A 3W00A 2UY2A 1NF7A 4IHCA 3ZT7A 1AQ0A 1AW5A 3HGSA 1WXJA 4ZFCA 4PODA 4K37A 4RDVA 2NT1A 2OZ8A 1ESWA 2HJPA 2VCCA 3BWWA 3KLLA 1SFLA 3TMQA 4A21A 1Z9AA 2A3BA 1SSDA 1SM9A 1O68A 2QJMA 3CAWA 4PEEA 1O5QA 2NLYA 3A13A 4ZODA 4AW7A 1J01A 1PPIA 1RA5A 3L7RA 1ECEA 4JKMA 4W7WA 2GGIA 4EKJA 1GGOA 1CDGA 4HYWA 4WSKA 1NFPA 2Q09A 3OYZA 3W2NA 1OM0A 1F2JA 4QIUA 3OZOA 4F0RA 1K70A 3CIWA 5GNXA 2Z1BA 1AD4A 2ZCGA 4LCRA 3PPFA 3JU2A 4DVOA 1QDSA 4FNQA 1V3LA 2D3NA 4RXFA 4CN6A 2XM1A 3BOXA 5GPRA 5CGMA 4J4KA 5U4NA 2G96A 3UJ2A 4BI5A 2NVDA 1NF0A 1VPYA 2F61A 1K9DA 3W7MA 1FBAA 3UXIA 2RHGA 2DZPA 4JIQA 3RG6A 4CD5A 5FEZA 3S6TA 2ZC1A 4OGZA 4BFAA 4NAFB 2Y8UA 1Q2SA 3E9AA 4YYCA 4PULA 4GYKA 2XSXA 1IXPA 2NQHA 2XDFA 2YGYA 1FVPA 3WJYA 4JFTA 1M5WA 4QGCA 4BI6A 2C13A 3GFZA 4R27A 3H4XA 5ENLA 4FLOA 1Q65A 4ATDA 2WVSA 3A21A 2V38A 3NZPA 3B4YA 1B3OA 4UNKA 3P8JA 3DHDA 1K8XA 2YBUA 3LHWA 2ZXBA 4GD0A 2FZMA 4A8NA 3GR8A 3PZQA 2RGLA 4MG4A 4D72A 3TCEA 2QCCA 2WSKA 4DQWA 1JF6A 2IXVA 3WFAA 1KFBA 2V5LA 3AU2A 1E9LA 5D33A 2E25A 4QFUA 5DLCA 1WDWA 2XWDA 5CBJA 1EB3A 1UJPA 1UC4A 1E3XA 1E9ZB 4Y96A 1MFVA 1E55A 5I3DA 2QYGA 3WH5A 1XLGA 1G9HA 1HZYA 2J7DA 5H6HA 3ECQA 4DO5A 4IP4A 4R5EA 1N2VA 3AHVA 2WANA 1PTAA 4QG6A 1OX6A 4FS9A 3SGGA 4HGXA 3TE9A 1WDPA 3GXDA 3TZFA 3EA2A 3QHNA 3QLDA 4UTLA 2NW0A 2W63A 2NXGA 3JW7A 2YCKX 1M03A 3ORWA 4MYXA 1V6WA 1OC6A 1NAL1 3C0SA 1UKTA 3WQFA 1Q4NX 1Q8AA 5L6UA 1LLOA 3M0XA 4POCA 4R88A 3ARXA 4JZ5A 3RLVA 4D6DA 3ANYA 2QV5A 4JOMA 1JYWA 3AS2A 2BSLA 4ERIA 3UXAA 1KRBC 3T07A 3DC8A 1JZ5A 2WNQA 2D0FA 2Y62A 1EFZA 4XAFA 3OGVA 3NM1A 4L64A 1UR9A 3BSHA 5LXXA 3CQKA 5CXPA 4M0XA 1XLJA 1B4KA 5A95A 2HK0A 5AFDA 3VUPA 1F6PA 1Z69A 1J2WA 5IFTA 3E2VA 3C61A 4GH3A 2PCEA 3UWWA 4LUJA 4GIAA 3CV6A 3AXMA 2DDXA 2WZIA 3UBPC 4XIMA 5GJMA 4H8NA 2JGYA 4JNYA 4IPLA 2WHKA 4JY9A 3W7KA 3T8LA 3S4TA 3ABOA 1GYLA 4ZTXA 1GPWA 5SWUA 4U5IA 3UU0A 1U5JA 1JGIA 2YYTA 1QTWA 3C5QA 3GKAA 1Q4WA 4R3UA 4DJDD 3NQGA 2ISDA 2BZNA 4AZ7A 3W7OA 4BHYA 1ADOA 3DG6A 4U2ZA 5D2YA 2PA6A 4MVAA 2OX4A 3CNYA 4LSBA 1FP9A 6PTDA 5CBBA 5LIKX 4G1NA 5FA5A 1WUEA 1Z3NA 3BOFA 3SCRA 3M0LA 4HZ7A 4Q7BA 5FSEC 1W17A 4CNTA 4GY0A 4JHZA 4ZXLA 2FHFA 2QEZA 1EX5A 1LT7A 4EF9A 3VNIA 4O1CA 1W1YA 3A3WA 4J3WA 4H6KA 3PHAA 1XYFA 2OJPA 3VDHA 4MIMA 1OF6A 3M41A 4K7VA 2HBVA 4IGMA 1TRIA 1GPFA 1YPFA 2ON3A 3SRDA 1P7TA 3WNNA 4S3CA 1HL9A 3WEOA 4KWOA 3EGJA 3W1TA 2OSYA 3NO1A 1Z42A 3KW3A 4YTTA 1AZ1A 2WZHA 4DBUA 4K39A 1GVFA 1ZY9A 4RDZA 1SW3A 3GQYA 4ADTA 2VEKA 3WLJA 4FB7A 3T09A 3W1RA 2QCHA 4Y9MA 4TOQA 2GQ3A 4PR4A 4LJ3A 1CI1A 3G1XA 2V30A 1ZBKA 4J2MA 6REQA 1UWQA 4B3LA 2FZ8A 5HR6A 1G94A 5EY5A 3W7EA 4V33A 2B4GA 5K2ZA 5EKYA 4Q32A 3HF3A 3EMQA 4A05A 1WOBA 2FTWA 1AA1B 5A8GA 1Q7QA 1IEXA 3UD6A 1UPPA 2XIMA 3IARA 3L67A 1SO6A 4HMEA 1R3RA 4JDBA 1UUQA 3H21A 2I16A 3PBYA 1S5NA 2QCGA 2AL2A 3W82A 5AVHA 3L5LA 2EJ1A 1DOSA 3JRKA 3LSCA 5I02A 1E1EA 2W79A 1TA3B 2P76A 1Y5XA 4ZSTA 5IM51 1W56A 1T99A 1BYBA 2QCDB 3WLRA 3TIMA 5A6SA 3TWBA 3NSNA 3OB8A 4CGTA 5A6BA 3B0XA 4PUNA 2BBFA 3NDYA 2VDIA 2A4AA 4CCCA 1Q6GA 1Z6KA 4AD0A 4G2DA 3APTA 1JI2A 4RNFA 3GXIA 3ZMRA 3KTCA 3AUOA 4J7RA 4J27A 1TSIA 1UH2A 2UY5A 3BGGA 1LF1A 4MPQA 4U3CA 4MDPA 3UG3A 3BZJA 3W85A 2R1PA 5TF0A 2E9LA 4QEEA 2XVPA 5ABHA 3VIPA 1OZQA 4NZFA 3WD0A 1GKQA 3NEHA 3GBEA 1Z89A 4FNRA 2BX7A 1DORA 4JTSA 2W62A 2PLKA 3KHJA 5CZ0A 4DHGA 3PWIA 1W8GA 1S2VA 1A5BA 3VILA 4E2OA 2DZSA 3SRKA 5AYBA 5IOBA 1X7IA 3MP3A 3CYJA 3DHPA 3TNBA 3OO2A 4PMDA 1VQTA 2BXYA 1EPVA 3KXQA 4H9MA 5E0KA 5CPSA 2CBJA 1L9WA 4B5XA 5MKGA 3L0NA 1ISVA 5F2GA 3VNJA 1TPC1 3WDJA 3CK5A 3PBVA 1ONRA 5F1VA 3WH8A 1RY0A 2I7GA 3BL3A 4BQ3A 3IGXA 1JULA 4BF7A 1G7UA 1AJ0A 2POTA 4V27A 1UUMA 4WEVX 5LZLA 1AH0A 4W8LA 3LCWA 4MPKA 4PFMA 1UMYA 3WNLA 1D3GA 4YNGA 2V0TA 3KOFA 2J74A 3VDCA 2PF0A 1QFEA 1LG2A 3VNZA 3VKKA 5D30A 3ZSSA 3PB2A 1OX4A 1AZ2A 4MWAC 3OVGA 1IYXA 4XBSA 6TIMA 4DJDA 3KL0A 4F0MA 1Y0EA 4NVTA 3QYSA 3W7DA 3GU2A 3DECA 3RMJA 1WZLA 4Q22A 1UR3M 4ZE4A 4PRRA 1PE1A 2JALA 4GUJA 4RZ6A 2X8RA 2A3CA 3VIGA 2DSKA 1GJWA 2CLPA 3DX5A 1WBHA 1J96A 1JDAA 2X42A 4UTWA 5KMYA 3W28A 1MSSA 3FYOA 1V3KA 3XIMA 1CECA 3UF9A 1H0GA 2Y24A 1O1HA 3V0SA 1NP0A 5D03A 3N11A 2FDMA 3KBSA 1B3WA 2C19A 4KQNA 3W6MA 4Q4PA 1SR0A 4M81A 4LCSA 5DCDA 3WKZA 4M29A 2Z0IA 5EFFA 1XLBA 4TX6A 2FH8A 1OINA 3LG3A 1CX9A 1D8CA 1GVYA 5FF7A 4KW2A 3E12A 3GHRA 3LCXA 2WBKA 1NDVA 2P1FA 1JCMP 3WK3A 3O15A 3ZS4A 5CSYA 3CL8A 1GOKA 3OZYA 2ZYFA 1VCVA 3C56A 2EKGA 1W9PA 2ABBA 1Q63A 5M17A 1GOOA 1JIBA 3NZ1A 3MUXA 2Z7KA 4PL2A 1C8VA 4OIFA 1QOXA 3RU8X 5IHSA 1FWEC 1W3HA 1N8WA 4LY8A 2NV1A 1KQYA 1FHVA 3TTOA 2VZVA 2CLLA 3PTMA 1JAKA 2Y5SA 2B7QA 1N8IA 1ZALA 4PC8A 2VELA 4KCUA 3LPGA 1B1YA 2FIQA 3N6HA 3VIFA 1FH7A 3FDKA 1J6PA 2W92A 4XKYB 2DVUA 1SZGA 1W5PA 3NOYA 3PZTA 2YL8A 1BSLA 1EJ7L 2NQ9A 5LNWA 3OLDA 3QEZA 3OA5A 2D2JA 4K8GA 3RFAA 3RR1A 4IF2A 1Y7VA 5C71A 1IQ8A 3Q2DA 3TW7A 3ZLHA 4IZGA 3S2MA 2J88A 4L9ZA 1FCUA 2I5IA 1B90A 2BOFX 2O9OA 3RLHA 1FA2A 1V3HA 3RCMA 3LOTA 4C6OA 4R7OA 1KBKA 4AIBA 5CKSA 1VYPX 4FNPA 2GSHA 3TCSA 4HU0A 3KRUA 4JYFA 3V35A 1ITXA 1LWIA 1BD0A 1OFQA 3OVPA 1EOKA 5E9AA 4BQ5A 5FOOA 1XLEA 3BCJA 1EBHA 4HPXA 3RNDA 4ZOCA 1UWIA 2VGGA 4US5A 3NQMA 2D22A 1BXCA 2VWSA 1YDYA 1WOAA 2QPXA 3FY1A 3B9EA 7TAAA 3MKVA 4KEVA 4V28A 1XH1A 3NQ8A 4CD6A 2OVLA 1TO3A 2C3ZA 5IBXC 4IMCA 3GFXA 4MB4A 1UD6A 4GKLA 1VLWA 4FAMA 1UR2A 4LS2A 2XZ7A 2FB2A 2QJNA 3CC1A 1X38A 1UASA 2VRJA 1F61A 2PZNA 3THQA 3I6RA 4FO4A 2C71A 5E09A 3CMJA 4PUDA 1QJWA 1K77A 4AVNA 3QV9A 5A6LA 4F3HA 2VDGA 3HMJG 4Q8TA 3ZVHB 2GJXA 1JNDA 4ZL1A 1I2QA 3GVWA 2YFNA 1WDRA 1H1ZA 1XDMA 4TMBA 2VWTA 1IIGA 1QOPA 2OYLA 2XTKA 2DPEA 5CAKA 3BK0A 5HWNA 1HXJA 3OIXA 4X22A 3TLLA 4WR3A 3FAWA 1PZ2A 2C0AA 2HV5A 5F4XA 4M6QA 3E2QA 2W67A 4D6EA 3RCYA 3H12A 1GQKA 1I1WA 3HV9A 3Q58A 5MF5A 2W0UA 3IJ7A 1G5AA 3WUFA 4HTYA 2H8ZA 1FCBA 4WGXA 3VZZA 1JZ4A 3AS1A 4K1GA 3W9ZA 1Z44A 4CVUA 4AYSA 1EYWA 3QZEA 3GUWA 3UWYA 3V5OA 4RDYA 4WK9A 4O0QA 2FDSA 2O7SA 2UZ9A 1QNOA 4NIRA 2OMAA 2ZUUA 5AHEA 1AW1A 3L23A 5C9XA 5DT7A 1AD1A 1KRCC 3N2CA 2EPOA 4REQB 3KHDA 3A24A 4KWSA 4OKDA 3RJXA 3QF0A 5I3JA 1X7FA 4J3VA 3F03K 2EPHA 5DXXA 1B3YA 1UKSA 3S1GA 1ONEA 1G4TA 3QY7A 3FN9A 3P62A 4YCPA 2ZVRA 3EOEA 4CQCA 3SY8A 1QI5A 3A4XA 3NQVA 1W5QA 3U9IA 1TVNA 3PUEA 4P8UA 1YXDA 3V1PA 3RR4A 1DTUA 3DGRA 5CJNA 3WLNA 3GSMA 4JTIA 2VCAA 4QX4A 3U8GA 3G8RA 4MKVA 1SGJA 3URQA 1RQHA 2Y7FA 1J0KA 3W6YA 4O0ZA 2CZVA 1MUMA 4HVXA 3R89A 5D37A 1K9FA 1E0UA 1PCKA 4E2BA 2QW5A 4LAKA 3WK2A 3MSGA 1JDCA 3TVAA 1SZFA 1E1CB 4L1XA 4QJ5B 4BEQA 2XJ7A 3MWAA 4ZQMA 2PDNA 3WDIA 3ISIX 2OYKA 3P7YA 3VFCA 1WXZA 1RBLA 3WUBA 4ADSA 2WC3A 2IKHA 3C4UA 4JICA 5M5DA 4QQ3A 3WG6A 1WKEA 3QBUA 3SQSA 4Z1DA 1T7LA 4Q6JA 1TV5A 2OLSA 2PLMA 3L4XA 4C1NB 4UR9A 1V8EA 4ICCX 4NZJA 2J66A 4GI9A 3QR0A 4HSNA 4S2CA 4R7JA 2G3FA 1GYMA 3G8EA 4NY2A 2YDSA 1J5TA 4AXKA 5IFPA 3UT0A 2IPGA 1VENA 5BROA 1DHKA 1D3HA 5JVLA 3E5BA 5A1AA 3HU7A 1XLKA 4L7ZA 5BNKA 3TLQA 1EDGA 2OSWA 4QDPA 4JTRA 5LA1A 2BASA 3RF9A 3D6NA 2O4MA 3RYSA 1TZ9A 1M68A 1XIFA 2OCZA 3JVAA 3QW3A 4OZOA 1JD9A 1Y5WA 1C91A 1BSIA 1VD6A 2QIIA 1UKQA 1RK6A 1U83A 2NSXA 3MJYA 1ZAIA 3GB6A 4H2HA 1LDCA 1KGWA 2VRKA 5EMLA 3N2XA 1KR0A 3MUIA 2XN0A 2CLIA 2J77A 4C6IA 1XIJA 3IIXA 2WZMA 4QBXA 1M04A 1A4LA 3G3DA 2X09A 5I79A 2VM8A 4YTQA 1JCTA 1C8YA 1TCDA 1GVIA 3AROA 4Q6XA 1R0MA 2YZ5A 4GABA 3A5VA 4TVUA 1LZOA 4LV4A 3NDZA 3PVFA 4IXXA 5TAOA 5EMMA 3N14A 5AHIA 3U0HA 3HURA 3QMRA 1TX2A 2PBGA 4LPCA 4PA8A 3H24A 1TPVA 4BK9A 3OP2A 2I17A 3CWNA 4IISA 1FY6A 1N82A 3LMYA 3COTA 4QROA 1T6MA 4O50A 4PMNA 3T9PA 1C29A 2PD5A 3A5FA 3OW1A 4GGHA 3MO4A 3AWNA 2DV0A 1B0IA 3THAA 1OEPA 1L8NA 1UA3A 5LNUA 3POHA 4Z2IA 3H54A 1Q7MA 4E6MA 2PSNA 1KWKA 3CMGA 3JZEA 1QXLA 1W37A 4PUEA 3NPWA 1P0EA 1UWUA 3DGBA 4RW5A 1P0BA 4GNVA 4G7EA 1RVKA 2G5WA 3T0CA 2BVWA 1FWTA 2BVYA 1GKPA 2QXWA 3D47A 3DFHA 3NURA 4LXFA 4EANA 3BZGA 1GT8A 4IL2A 4O57A 3O07A 1KR1A 1ZTVA 2FQIA 5KEZA 3T6CA 3YPIA 2IW0A 3LGEA 1UPMB 5AVNA 1QVBA 3ITOA 1EJRC 1XH0A 4FALA 4B5TA 3GS6A 3S6DA 1H7PA 1I0BA 3M5ZA 4IPPA 2ZXAA 3FAXA 1V6XA 4LYPA 4HNLA 4ATWA 5J5DA 1LOSA 2PC8A 1EGZA 1VB9A 1SZEA 1DWGM 1W31A 5FJJA 5LNVA 2XU2A 1ZHAA 1X39A 1P6CA 3UQNA 4AIUA 1EC9A 1YEYA 1NARA 3W75A 3OBEA 1XGZA 2D23A 1IZCA 3TNOA 3WQWA 5HJXA 5KETA 2TAAA 1GJUA 3H2OA 1GONA 4G9PA 4H3DA 2XH7A 3A3HA 3QC0A 2HXUA 5CPNA 2Q8LA 4XAZA 3OG3A 4HMNA 1TX0A 3G6LA 3TH6A 3L4ZA 2ALRA 5DO8A 3IIPA 1NWTA 4UWMA 3WLQA 3PANA 5LGZA 5C2XA 1ZQ5A 4PRWA 4RL3A 3PJWA 4I90A 2ASHA 5LA2A 4GE8A 3SRFA 4Z0JA 1JJKA 3VI2A 1XL9A 1O6IA 4ES4A 3B9AA 2FGLA 3ELFA 4ZO7A 2HS8A 1UR8A 1KRMA 2ZADA 3W22A 1UW9A 3TUUA 4KCTA 1ENUA 1GUVA 1HKJA 1FWWA 3PNZA 1H63A 1UD3A 3NCOA 1F8IA 1C90A 3SDOA 3NPXA 5C9UA 4Q4KA 3ARYA 3CHFA