1XBXA

Structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound d-ribulose 5-phosphate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIDLTGYWTWEQAQQWRDAGIGQVVYHRSVDAQAAGVAWGEADITAIKRLSDMGFKVTVAGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
publication title Evolution of enzymatic activities in the orotidine 5'-monophosphate decarboxylase suprafamily: structural basis for catalytic promiscuity in wild-type and designed mutants of 3-keto-L-gulonate 6-phosphate decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xbxA00
4IMCA 4NVTA 1XFBA 2E6FA 2NXHA 1ME8A 4ALDA 4UTUA 2EGZA 5HR7A 2QCCA 2G96A 3NM1A 3W23A 1YDNA 2C0AA 2CLMA 2HMCA 2XFWA 4UIOA 1XUZA 2G5WA 4AWTA 4UMCA 1TPFA 3BW3A 3M5YA 4O50A 3TXZA 5J5DA 1QWGA 3WJSA 4K39A 1FCQA 5AHEA 5D32A 4YWIA 5D37A 3NQCA 3W9ZA 5D02A 5AHIA 1EUNA 5LGXA 1XL9A 3CHVA 4ZQCA 1BWLA 4EOUA 3V75A 4M7SA 2ZTKA 3IVTA 2VFEA 4CCCA 1KLZA 1G7UA 5FF4A 1SUXA 2QUVA 4K8EA 1O5XA 3NL6A 2WKJA 4FNQA 4KWWA 4O4VA 1EP2A 1K02A 4O19A 4UTKA 1GWJA 2VEKA 4TR9A 4WXZA 3RNDA 3FIGA 1LRQA 3NVTA 1AG1O 2XN1A 3B0PA 3N3MA 4K38A 3NO5A 3T55A 4FNRA 4BK9A 5FF7A 1NAL1 4IUOA 2TPSA 3W72A 3OA3A 1QOPA 1W8SA 2RHGA 3P80A 3MBFA 3SSJA 2X16A 3CQ0A 4WOQA 2CZDA 1TJRA 4OE7A 1S5VA 4PC8A 3NG3A 4O15A 5EA9A 5K7JA 4WOZA 1PE1A 3GXPA 1YTKA 1RZMA 2HTMA 1H62A 2JGQA 4PEKA 4AHOA 2WOQA 3G1HA 4LV4A 5D30A 3NA8A 5FEPA 1VLIA 1PL9A 4WX2A 3FJLA 1XKYA 1WAUA 2CLKA 3EX2A 4AXKA 4O11A 3FFSA 3W7KA 3KOFA 3PSWA 1EP1A 2EF9A 3UPWA 5BOOA 3F4WA 1FWRA 1GVOA 1VCGA 2WSYA 2QCLA 2R94A 3W7HA 4NJGA 3E0IA 3TDFA 1H50A 3F03K 5CZJA 3MHUA 4MFDA 5G1YA 8TIMA 3TQVA 5I3HA 4PH6A 3DHDA 1FX6A 3NOEA 1RQBA 1IXQA 2Y63A 4LVGA 5DN1A 3N2MA 1GPWA 4ZQNA 2RDWA 1OX5A 3LHZA 3LHYA 3KRZA 1W5MA 4IPJA 3TSMA 5FEWA 1QMLA 4UFJA 2Q3OA 2CW6A 4IMGA 3TROA 4GUHA 3W1AA 3QQ1A 4O52A 3HGOA 3UXAA 4FX6M 2CZ5A 1K3UA 1MSSA 5G5IA 3PG8A 2NZLA 3A22A 3KVJA 3S8HA 4K7VA 5CZTA 1OK6A 2QCFA 3ATYA 4MVAA 1TPEA 1OYAA 4NUWA 3EWUA 1ZCOA 1AL7A 1LBMA 4UR7A 5EYWA 3W75A 3PBVA 5E93A 4TO8A 1VCVA 4CCDA 4TMBA 5F2MA 1G67A 2Y6ZA 3GKAA 1NVMA 1VLWA 2UV8G 1XM3A 2WV8A 4JY9A 2BWGA 1LDCA 1SZFA 1EP3A 4ZZ9A 1XBXA 3SZ8A 4XTIA 3AO0A 3PAJA 3IGXA 4O1CA 5F4SA 1M7PA 1XCFA 3NNTA 3C3NA 3QSRA 1GQNA 5FI8A 2A7RA 3INPA 1A5AA 1PV8A 4LWWA 4AH7A 4Z08A 3OVPA 3TK7A 1J5TA 1OYBA 3R89A 1FQ0A 3T44A 1RQEA 1SW7A 6TIMA 4A21A 1R2RA 3UWVA 4OHQA 4FX8A 2I14A 2JKEA 2X30A 1JUEA 3NQGA 1FY6A 4O53A 1WV2A 3PULA 4IGHA 5LNUA 3QPYA 3ABQA 2JKPA 3JRKA 2CLIA 4M6VA 2J88A 5E1QA 2VELA 1F76A 5F2GA 1KFBA 1OFOA 3BARA 3LCXA 4HPXA 2VFDA 1JCNA 4MPQA 4HNNA 2NUWA 1FDZA 3DHFA 1EWDA 5C55A 5BMXA 2VEPA 4OWGA 1H7NA 4N6EA 3QM3A 3CM4A 2FPYA 5D2WA 1W5QA 1GT8A 3HB9A 4WY0F 1IXOA 1DQWA 3G0SA 3DFTA 3NM3A 1ML1A 4FF7A 5ABTA 1TV7A 3BGJA 4UTIA 3CEPA 3THAA 2OX1A 4X3ZA 1J2WA 2Z6JA 3MBDA 3PM6A 4BF9A 1Q6RA 3LOTA 1JUKA 5LNVA 5F1VA 5TIMA 4FNUA 3B04A 2W6RA 3FYPA 5HUOA 2G95A 2J9XA 5FEXA 2GQ9A 4Y9AA 3NL5A 1H1ZA 3G22A 2C18A 1M6JA 2AQWA 1ICQA 3SECA 4QNWA 3WFAA 3VI2A 3NQ8A 4FNTA 3F1QA 3KRUA 4DO4A 1EEPA 5D03A 1NF7A 2QUTA 4XZ9A 3HOJA 3P60A 3RK8A 4O1BA 5LNWA 1BKSA 2ABBA 3LX9A 2ZRYA 1TV8A 4GRSA 4MJZA 1ADOA 3G1AA 4IMDA 1QPNA 5D09A 4NNCA 3WK1A 2DJLA 3S5NA 4RKAA 3TCEA 1LCOA 3OVQA 4GBUA 3BG9A 4JEQA 1Q6QA 4JIQA 3PB2A 1F6KA 1DL3A 4WXYA 4WUIA 3CLMA 4RX0A 4JD4A 5K9CA 2C16A 1OVDA 2VKZG 4GUIA 1ZAJA 2NUXA 3SIZA 4TMCA 1OABA 4Q32A 3LXBA 2FB2A 3OIXA 3QW4B 1A5CA 3NPWA 3TFXA 3TXVA 5KZEA 2QF7A 1EUAA 3L21A 4DQWA 2J9ZA 4FO4A 2E09A 4EVZA 1YDVA 2V2DA 2P1FA 1TPC1 3QFEA 3ZFHA 1JVNA 4OQVA 1TYGA 1Z48A 3MP3A 5D33A 4EF8A 4JTJA 2O7SA 1QO2A 3MP4A 4Z1DA 3WJXA 1JCJA 5I3IA 3WK3A 1G4PA 2ZZ5A 2Y7EA 3PVFA 3P5YA 2A0NA 1K7EA 5CKSA 2HS8A 3GVGA 4ZMGA 3MO7A 1ICSA 3G0XA 3F4NA 3W87A 2E1DA 5F4WA 2B7PA 2YCEA 4GUFA 1KW1A 1RD5A 3FKKA 4OV9A 3SGZA 4N9DA 5HWNA 1U5JA 4MIMA 3VNDA 1GYLA 1XBYA 5E0KA 1WBJA 5LSMA 4Y6GA 2A1YA 5AC6A 1GEQA 3ABRA 2NX3A 2OMAA 3NL3A 2CU0A 4PCFA 4WD0A 1LBLA 3LTYA 3LV6A 1ICPA 2R14A 2NWRA 3OEXA 3LHUA 3B0UX 5EBUA 3M6YA 1H60A 4DEFA 2ZZ3A 1EPXA 4BI5A 1VRDA 3O8AA 5A8GA 5G2HA 2D73A 2Z1BA 4ZVJA 3USBA 3P62A 3NQMA 4QIUA 4IX2A 3W70A 2BXVA 2NWSA 2V9DA 3LERA 3TQ0A 1PIIA 1KBIA 1WDWA 3GAYA 3NQEA 2QEZA 3TX9A 5BW6A 1QNVA 5EY5A 1VS1A 4LC6A 3HPSA 3E12A 3A24A 1DQXA 4RLIA 1LZOA 1QR7A 2QJIA 3EXSA 4K7YA 1XUUA 3KHJA 4FEZA 3B8DA 3L5MA 4UFLA 4FX7A 4ZQPA 3NZRA 3W7DA 2FDSA 5HULA 2NXIA 3EEGA 2TRSA 4JX4A 3TAKA 4UFIA 3TJXA 1OFBA 2GJLA 3FLUA 3O63A 1KM6A 1DHPA 3W1UA 1QAPA 3EX3A 3W7EA 1R30A 3DKJA 4O18A 1THFD 1A5BA 3CIWA 3B03A 3W2KA 3TUUA 1B4KA 1QFEA 4QJ1A 2F84A 4I9AA 3WJZA 4MKNA 4LY8A 3L0KA 2DZPA 4U4MA 4AAJA 5LNSA 1H5YA 1LP6A 1MEIA 3KVKA 1QDSA 2EPHA 2ZRUA 4O14A 3BPWA 3GDLA 4QAIA 1W1ZA 3S1UA 2WNZA 4LVFA 5DBUA 1RR2A 5HINA 1W5OA 2TSYA 1RV8A 4JIPA 1ZFJA 2NX9A 4LVDA 3PC0A 4X22A 3H54A 1CX9A 3TE9A 4WY0A 3UQNA 1FBAA 3LTPA 3W7LA 3EWBX 3EWXA 3LHTA 3QRHA 2F7FA 1X6UA 3B0VC 2ZQ0A 3W2MA 1QO5A 3VCRA 1FWNA 1FWWA 3THQA 2FLIA 3W1PA 1LORA 2O7QA 5TBOA 3I7SA 4MY9A 5EL1A 2C6QA 1OJXA 3S0CA 2PC4A 1K03A 4LT9A 1N8FA 2QJHA 4DF2A 3TSDA 2ZRZA 3MI6A 2FTPA 1SZEA 3S5ZA 3A9IA 1D9EA 2YFNA 7TIMA 2E6YA 3NPXA 1UUMA 4ML9A 3GXNA 5DLCA 3BV4A 1BTMA 5LZLA 1TO3A 5I3FA 3C2FA 2Y70A 3TW6A 1DVJA 4DPPA 3E49A 3W1MA 3FEMA 3W1TA 3Q58A 1BWKA 3LB0A 5CGQA 4RXGA 2B0MA 3LHVA 3P7YA 3NXFA 1MO0A 4QISA 4FB7A 1H7OA 3FJ6A 4HPJA 1ME9A 2VFGA 5KZMA 3IRDA 3DI1A 3TU9A 4UFMA 4KFPA 4UFHA 2ALDA 4ZQOA 4UNLA 1EB3A 1JR1A 5AOUA 2ZZ4A 4N4QA 1WOBA 3UY7A 3DI0A 4L4LA 4RZ5A 1AW1A 3UZJA 3G1VA 4LVAA 3G1DA 3LCIA 4UTTC 4Z0SA 1R46A 3SR7A 5KZDA 2PRHA 2WQPA 1M5WA 3DZ1A 3V1PA 5AYXA 3W2JA 2QCGA 3KXQA 2A6LA 1KFEA 5DBTA 3C6CA 3TA6A 1ZAIA 3AJXA 4PL1A 3HQ1A 5FF3A 3TW7A 3NQDA 1TTPA 4Q4KA 4LS0A 4EIVA 2WSRA 3TNOA 1TPUA 1DOSA 2Q8ZA 1SW3A 3RMJA 1G4TA 1H63A 3WJYA 2AAMA 3DH7A 4UR8A 1FWTA 1HG3A 1TTJA 2RKXA 2X1RA 3L67A 1L6SA 4HSOA 4NJHA 4RJEA 1LLWA 3W1XA 4M7TA 3LCLA 3P84A 3ABSA 5CSSA 1GVSA 5J5RA 3NGJA 1KBJA 1I2OA 2WSQA 3K30A 2Q8LA 4MJMA 1UJPA 4O54A 4POCA 3IIXA 3NYZA 3MYOA 3M47A 5EMUA 4NXKA 5BRBA 2A7NA 2V30A 3GZ3A 2X1SA 3KFTA 1O94A 3QZEA 5D05A 4KFOA 1Q6LA 2J6XA 2Y62A 2YYUA 2C19A 3R5EA 1SU5A 2QDGA 4AHQA 4IX0A 4MYAA 4PL2A 1XDMA 4UTTA 4CCEA 1PCKA 1T0OA 5KSWA 3PSVA 3N73A 1YPFA 4UNKA 3N2XA 3C8FA 3GK0A 1J4EA 2E68A 2WNNA 3EXRA 4LW7A 1ALDA 1H51A 3IVSA 4NT0A 3W7JA 3UWZA 1HO1A 1JUBA 2CLFA 4FHAA 4N6FA 1K7XA 3NQ7A 3M7WA 3QQ0A 2YSWA 2ISSA 4FNSA 3PBYA 3NQFA 1YADA 4IMEA 3W1LA 5LHEA 3RFAA 5AFDA 2X2GA 4DELA 3LCWA 1FCUA 1W56A 3M5VA 1JRCA 3LLFA 2CZEA 1JCXA 3W86A 2YW4A 4FIQA 2ZBTA 4N02A 1XC4A 4LTSA 3O05A 1TIMA 5SWUA 2EHHA 2GJNA 3Q37A 1IXNA 5FESA 3E02A 4A29A 5EKYA 3G18A 2EAWA 1FCBA 3W71A 5KINA 3TR2A 2A7PA 4NQ1A 1OFAA 1G4EA 4ADSA 1ZAHA 2GVJA 5CPOA 2YR1A 4ICNA 1QCWA 1TPDA 1TQXA 4JX5A 3IGUA 3WK2A 1P1XA 3FS2A 3P5ZA 1SZNA 1JQVA 2BSLA 1Q6OA 1U83A 1IF2A 4GXMA 2WO5A 4UTWC 1QPQA 3U2OA 3OG3A 3UWWA 5AB3A 1O5KA 4AWUA 1DV7A 1GG1A 3QF0A 3MYPA 3G3MA 4A22A 5L6UA 1PHQA 2QAFA 2YGYA 3L0NA 4JNMA 3FA5A 3W7QA 1VYSX 4CNOA 3L66A 2ZFAA 2GPTA 3QC3A 1RVGA 2E6AA 4CQAA 3SJ3A 1KV5A 1LRTA 5HMSA 2C15A 4PODA 2W0UA 3MI2A 4WZHA 1SFLA 3IIVA 3LRMA 4GUJA 4Z1BA 2DZTA 2QDHA 2A4AA 3ZS4A 1QOQA 3BLEA 2QCDB 2R91A 4MUZA 3W85A 5K9XA 3W84A 3N34A 4JTIA 4ORMA 2VOMA 1VR6A 1OG0A 5AHMA 1YTDA 2QCDA 3ZWSA 4XTDA 3U6WA 3SW6A 1FCVA 1T96A 4JTTA 3C2EA 3JS3A 4ZL1A 4N9BA 3C4UA 3M0ZA 3QW3A 1TQJA 4ADTA 5K3VA 4PA8A 4BI7A 3HJZA 1JCLA 3G3DA 5D04C 4HNUA 4CQ9A 3QMTA 1ZY9A 3H53A 1C9DA 2ZZ2A 4JGDA 4UTWA 3LCFA 4PTNA 3WK0A 2IQTA 4AVFA 1MXSA 1UBSA 2B7OA 4O16A 3I7QA 2Z0IA 2ZA2A 5G4EA 5AHNA 4XQ6A 1KM2A 3LBCA 1SQ7A 3KVMA 3G8EA 2J9YA 3UD6A 5GVJA 4HNVA 2H3DA 1UASA 5KITA 4N2YA 3O15A 3W83A 1LTDA 2FFCA 3TH6A 2YXGA 1E51A 1AK5A 1SZGA 4RR4A 1L6YA 3MJYA 2WJZA 4CNNA 1I2NA 4LU0A 3CEUA 3NQ6A 4JTSA 3EX4A 4Y90A 4E0CA 2ISWA 3M16A 1O4UA 1R2SA 3W7MA 1K7FA 1AW2A 1HUVA 1TRIA 3BK0A 1ME7A 3TIMA 5DCDA 2QR6A 3P67A 2W79A 1EX5A 3N9SA 1H7PA 2ZZ6A 1F5ZA 2CLHA 4HHPA 4IQLA 3UWYA 1TPVA 2VXNA 2E6DA 3C2RA 1SO3A 3W2LA 4YXGA 3GDMA 2V8ZA 2GQAA 1PVNA 2Y61A 4O10A 1D3GA 4U28A 3MMTA 4AMAA 1SPQA 3FOKA 2GOUA 1H61A 2JK2A 4DF1A 4Q33A 2VEMA 4RK8A 1R47A 1HFBA 1GTEA 3HG5A 3GX9A 3S5YA 2C1HA 1KFLA 4LNYA 1KFCA 1VHNA 2OT0A 4DBDA 3UY8A 5DXXA 2V5LA 1H7WA 3P8JA 4S2CA 5LHFA 3SY5A 1H7XA 3T7VA 3KVLA 1F2JA 2CFFA 5DY3A 2E5CA 5K2ZA 4ADUA 3GXTA 4JXCA 1VQTA 4CLMA 1OX4B 5D2VA 1A50A 1TSIA 3FKRA 2RH9A 3EWWA 1NEYA 3UNDA 2FPTA 3GDKA 1OHLA 1I2PA 3PY2A 4MY8A 5CSRA 2E5DA 2PCQA 4OV4A 2ZA1A 1VC4A 4H3DA 3R8RA 3RLUA 2HS6A 3N14A 5AC7A 4XUGA 3BGGA 3KRSA 2Y85A 1IGSA 3BO9A 1W54A 4LS2A 2DZVA 3DFQA 5F4XA 3SFKA 2RDUA 1I2RA 3A5FA 3W74A 1YDOA 1IXPA 3LBMA 2QAPA 3STEA 2Y89A 1GVRA 3GB6A 3LXAA 1ONRA 4O12A 5C54A 2AGKA 4GC4A 4N9EA 1JJKA 1I2QA 1BEUA 4GNJA 2VFIA 3BG3A 1W5PA 4C1KA 4C1LA 4LS1A 3R12A 3NQAA 2C14A 2YX0A 3C61A 1OF8A 3HPZA 1TCDA 1TMHA 4FXRA 1SO6A 4RCXA 2NXGA 3GKFA 3S1VA 3DGRA 4JYDA 3O6CA 3JR2A 3HIJA 1CW2A 4IXXA 1K8ZA 1G7VA 1XDLA 2I9EA 1ZALA 3M5XA 2PRLA 2V2CA 2XN2A 1GJPA 1LYXA 1V7YA 3PUOA 5CPNA 3NZ1A 3CPRA 4R53A 3W3OA 4M6PA 4H4IA 4ORIA 5CG7A 5G2IA 4XWUA 2ZZ7A 3GLCA 3YPIA 3O07A 1OF6A 5LKYA 2ZRVA 3HBLA 2HSAA 1I8JA 3M44A 4NJJA 4HSNA 1OFEA 2DJXA 3E9AA 1Z42A 2A85A 1WXJA 2A21A 2Y7DA 3QMSA 4NNAA 4ONVA 2ISVA 3W7OA 3LGEA 4MFEA 1SO5A 3TKFA 1TPH1 5H2ZA 4FNPA 3HO8A 1YXDA 3W1NA 1KM3A 3IV3A 1DJNA 4AF0B 2YPIA 3NPUA 2DZSA 3IVUA 3DFPA 1AL8A 1GG0A 1MZHA 4NX5A 4AF0A 1KM5A 1S3HA 2EKCA 4X2RA 4O4WA 4M5PA 1Q45A 1W0MA 3HGJA 4O8RA 3R13A 3EKZA 4OBTA 5AYYA 3QYQA 1SSGA 1SW0A 1OYCA 3LRKA 1VGAA 4M19A 5IBXC 1GYNA 2YZRA 4IJBA 4KFNA 3UWUA 4NJIA 3M9YA 3ELFA 2I1OA 3IIPA 3MHFA 4O0KA 4UXDA 1CI1A 1OFRA 3STGA 4GJ1A 4Y96A 5U7SA 2V5BA 3PB0A 2NV1A 4JTKA 3PG9A 1WA3A 3B05A 3W7CA 2DORA 5FEZA 1D3HA 3FYOA 5BNKA 3QEZA 3VE7A 2NV2A 5G4WA 3SI9A 2BZNA 5KTLA 3PF3A 4D2JA 1G69A 1ZHAA 4EF9A 5D2TA 6ALDA 3O6DA 4H6KA 3TQKA 3RU6A 4JICA 3LLDA 1F05A 1LBFA 1YXYA 2V2HA 3GR7A 4WJEA 1EA0A 4YLWA 1O95A 1LRNA 3A5VA 3W76A 3NPVA 2JGYA 1ZJIA 3HGRA 5KMYA 3DFNA 3MI3A 2G97A 3P8IA 4HNTA 3W88A 1UUOA 1Z41A 1NSJA 4BI6A 3MWAA 3I7RA 4AB4A 4UMAA 5LGZA 2R8WA 3HPXA 2YFOA 4LV9A 1VPXA 3IIZA 3T78A 5A5WA 1SR9A 5U4NA 2VFFA 1YTEA 4MLRA 1F73A 5DXYA 5HNRA 3W2UA 5IBXA 2B7QA 4LRSA 2Z2UA 2V0TA 3Q2DA 3T40A 4N9CA 3TFCA 3S5OA 1T8XA 3H55A 1GTHA 4O28A 3PS7A 1TTQA 1VYRA 2KZHA 4BWLC 4HT3A 4QM1A 5H91A 3L68A 4JYEA 2RFGA 4E2DA 3W6YA 4NZJA 2NUYA 1JCYA 3M5ZA 1KLYA 2QKFA 4S2BA 3TSBA 3OVRA 1VH7A 1WYIA 3CC1A 3GNNA 3NR0A 1XXXA 5TQLA 4P61A 2FPVA 2V82A 2H6RA 1F7BA 1V5XA 2GVLA 3L5AA 1N7KA 2CLOA 4N4PA 1KTBA 2DZXA 1SFJA 3NL2A 5DCEA 3DBPA 3VFLA 2H3BA 1SSDA 1W3IA 2P0OA 3TV8A 2QJGA 3PR2A 1HL2A 4KWVA 3C56A 4TIMA 4UCGA 3G24A 5HWJA 3P61A 2ATSA 4L4MA 2V81A 5HJLA 2QCEA 3NEVA 2ZDRA 4JTUA 4Z0JA 1W37A 4AHPA 5CZ0A 2ZA3A 4P2VA 1KM0A 1QPRA 4GE8A 5G1TA 4JR5A 4JX6A 4M6QA 5I3GA 3UXDA 3DAQA 4MZ8A 4JDYA 1Q3NA 3MUXA 1HO4A 1YLVA 2C3ZA 4MZ1A 3C52A 3DFOA 4E38A 4LVBA 2YDAA 3A21A 5HWMA 4BWLA 5K4ZA 3E96A 4MOZA 1DKWA 3STCA 5C2XA 2GQ8A 1H1YA 3LM7A 2A6NA 2CLEA 4UTHA 3W7RA 2J24A 3L5LA 5D38A 5C5YA 3HG2A 2WNQA 5DELA 1L2UA 4JN6A 3IGSA 3W2NA 4NU7A 3M41A 3EX1A 2OT1A 5IM51 4R33A 2A5HA 1F6PA 3L9CA 3L2IA 5AHLA 3O1NA 1GVQA 4E2BA 3N19B 3GIYA 2E5BA 4I7VA 4K37A 4QSHA 4CQ8A 4LUIA 4DPQA 4DXVA 2XN0A 1TV5A 4LOCA 4K6AA 3LHWA 2ZZ1A 4RZ6A 4HN4A 5F1UA 1GOXA 4O1AA 4UFKA 3M43A 3I6RA 3BG5A 4O0ZA 1X7FA 1KM4A 3QH2A 2ATMA 2JBMA 3BW2A 3W7GA 4RXFA 1GZGA 5AC8A 4W9TA 2VC6A 5HQEA 2DZWA 1WOAA 1ZNNA 3QMRA 1FUYA 1N55A 2FJKA 4XBKA 3TJLA 4ZQMA 4IXHA 3QPZA 3CWOX 2H8XA 4YMZA 4YCOA 1KTCA 4I7WA 3UYCA 3MP5A 1AW5A 2PURA 1LOSA 1W31A 3PUEA 1FXPA 5DY2A 4NJKA 2BLEA 2H90A 3TAOA 1XI3A 3OBKA 1I45A 5T26A 3LCHA 2B4GA 4O17A 3Q94A 3IIOA 1OK4A 5K9DA 3ANYA 2X1TA 1TPWA 2CLLA 4JS3A 3HMJG 4GUGA 1W3TA 3W1QA 1OX6A 1FDYA 2TYSA 4PFMA 3A23A 1NFBA 4TX9A 2QCMA 2J27A 4AWSA 3TC6A 1FXQA 2FB3A 4CNPA 3U8GA 4MLJA 3ATZA 1LROA 3UZ5A 1DBTA 4HKPA 3DKLA 3S42A 3EWYA 3RLVA 3NQ2A 3RF9A 4I7UA 2Q3RA 3GDRA 3LV5A 4WQ6A 2ABAA 2FIQA 5AHFA 4A3UA 1Z44A 3C2VA 1RQHA 2VENA 2ZTJA 4S1FA 5HUPA 4QQ3A 5HR6A 5FF0A 3GR8A 4UTJA 3KAOA 3W7PA 3B4UA 4OU1A 4BR1A 3LI0A 2DP3A 5EPDA 2LLEA 1X8FA 3PBWA 2FQIA 1VYPX 3HGSA 3LCGA 1TJPA 3EXTA 1I4NA 3G8RA 4NXSA 3QJAA 2JKAA 4UUIA 1YXCA 1G4SA 1P0KA 3BVJA 3LXCA 1L6WA 5I3KA 1EWEA 4X9SA 2BTMA 3G1XA 1KA9F 1LOQA 3NAVA 3LI1A 4TU1A 2PRMA 1TRDA 1P0NA 3TMQA 3DFSA 4DF0A 2WPBA 4JTFA 3P82A 4B5NA 1K8YA 4MZYA 2ZRXA 1W5NA 3CIXA 3NDOA 4UTMA 4RZ4A 4K36A 4A2SA 3HG4A 1MEHA 1TPB1 4LRTA 3R2GA 4A2RA 2QCHA 4IMFA 1LM1A 1JULA 4O1DA 3GNDA 3GDTA 1SO4A 2CWNA 5F2IA 3LTSA 1PCWA 4NZFA 3EB2A 4UMBA 2VFHA 2RDTA 5CZSA 3W73A 1TREA 5MHBA 3CU2A 3P74A 5CPMA 1KM1A 4K8HA 4YL2A 1B57A 1S5TA 1B4EA 1T99A 1WBHA 4IWWA 3T4CA 1LLZA 1F74A 1LOLA 3NQVA 5FF2A 5K4XA 3N9RA 3C0JA 4BFAA 2YW3A 1FDJA 2BX7A 3UWQA 3S6DA 3G1FA 1QPOA 3OHIA 4OGZA 3ABOA 1HTIA 4O57A 5L9FA 5C6MA 1ZENA 4XBSA 4YCPA 4NNBA 5BMWA 1O60A 3W07A 1OX4A 1EIXA 3VKJA 4JTGA 2OJPA 3LDVA 1GVFA 3L0GA 5D2YA 3I68A 1AMKA 4NX0A 3CTLA 2OZ0A 3CB8A 2H8ZA 3DENA 3O6YX 4JY8A 4AEOA 4RV8A 2NX1A 4ZQRA 3UPBA 4J9JA 1PS9A 3D0CA 5F2LA 1TB3A 3C2OA 1KV8A 3EX6A 2P10A 2VEIA 3MW7A 2ZCGA 3EWZA 3S9YA 4UTLA 3BLIA 1X1ZA 4DBEA 2E77A 3STFA 4JTHA 4UC5A 1FWSA 4QITA 4Z1AA 1M7OA 3I65A 1R2TA 1WX0A 1NF0A 2DU2A 4O13A 3EKLA 1YYAA 3PUDA 1DORA 5CPLA 4XKYB 3L65A 4JDBA 3HG3A 1MEWA 2YYTA 2PE4A 4JTLA 1OFPA 4MYXA 1JCMP 1XBVA 1Y0EA 4XKYA 1TTIA 4GFSA 3TC7A 4JYFA 3S1WA 5AYZA 1VZWA 2QCNA 1UCWA 2GVGA 4IPIA 4LC8A 3VE9A 1IIHA 3M1ZA 4R7JA 1KFKA 3O16A 1XBZA 1OFQA 2NLIA 1A5SA 1WQ5A 2QUUA 4MY1A 1L9WA 2ZRWA 1DJQA 1YPIA 3GAKA 3S1XA 3P81A 3BLFA 3DU0A 3MHGA 4Z1CA 4QNEA 5LNRA 3DXIA 2Y7FA 2OCZA 3ZR4A 1G6CA 1RPXA 3GYEA 3PWAA 3W7NA 1X1OA 5AN7A 4IOTA 3G0UA 1IIGA 3G1SA 3O06A 1VCFA 4HIBA 1VHCA 3SGUA 2A2IA 4EWND 1VJIA 2Y7GA 4Y8FA 1P4CA 1P5BA 3CT7A 4WY0B 1H7RA 4FIRA 3TMLA 2C13A 3W7IA 4FXSA 1S5WA 1C29A 1K8XA 3WJWA 3QSTA 3W22A 3HF3A 1C8VA 2TMDA 3KX6A 2B7NA 2ZYFA 4OT7A 3BW4A 3W1RA 1KFJA 1KTNA 3IEBA 4DO5A 2X1UA 1JQXA 4DO6A 4GWEA 5DCBA 1B9BA 3CWNA 1OFDA 1A53A 4R34A 2Z6IA 3PBUA 4LUJA 1JRBA 3G1YA 4JTEA 2CZFA 2GUUA 4KKXA 3ZWTA 1PHWA 5G2WA 1UB3A 4G1KA 2DZUA 5I3JA 2Y88A 5D2XA 3B06A 1B3OA 1W3NA 3LRLA
chains in the Genus database with same CATH superfamily
8XIAA 2SFPA 4IMCA 1IEVA 4NVTA 4D6JA 1XFBA 2Z2BA 4UTUA 4DWSA 3W23A 3PPHA 1T41A 2HMCA 1SJBA 4AWTA 1TPFA 3BW3A 4O50A 2XH2A 4FLRA 3WJSA 3QKEA 4K39A 1LF1A 3NQCA 2ISDA 5D02A 3NDYA 2EKGA 3B9EA 4E6MA 4RNJA 4S3CA 1BWLA 1C91A 1Q6DA 2BVDA 1CNVA 2OLHA 5M03A 3AIUA 1R7AA 1TX0A 4AY8A 3QN3A 2HZGA 4A8IA 4B5SA 1R3QA 3GC5A 3NL6A 4O4VA 3QV9A 1EP2A 4O19A 2WLYA 4L6OA 2PD5A 1W9UA 3NVTA 5EGRA 2EO7A 2XN1A 1Y5VA 1FHDA 1BKHA 1EX1A 2WVSA 1OCBA 3OHMB 3SURA 1XYBA 3R79A 3T55A 1B5TA 4R5EA 4NHVA 1NAL1 4IUOA 1W1YA 3PTQA 1JDEA 4AWEA 3P80A 4KRZA 3CQ0A 4E8CA 1KR0A 4WSKA 5REQA 5K7JA 1H41A 1XH0A 4PMYA 1IWPA 1IGWA 3TVAA 1EJ7L 3DX5A 2NW0A 3QPEA 4UZUA 4YPJA 2HJPA 2YB4A 4WX2A 1XKYA 1KB3A 3EX2A 4O11A 1EXPA 5CPTA 4IM4A 3L12A 3CQIA 3J7HA 3RIKA 3PSWA 4QR6A 3MJMA 1VCGA 1OBAA 3TYEA 2QCLA 1Q6FA 2R94A 3W7HA 2EPLX 2WHKA 3E0IA 3TDFA 4MM1A 4C5ZA 4PH6A 1NH6A 3NOEA 3S46A 2Y63A 4KCUA 4LVGA 1RSCA 1OX5A 3LHZA 1C92A 1OGGA 4GH1A 1KKRA 4UFJA 3BTNA 1PKLA 2CW6A 1JAKA 2UZ9A 4IMGA 4GUHA 1F3XA 3TROA 4FX6M 1BAGA 1CGYA 1EH9A 1JPIA 1MSSA 3LPFA 1AJ2A 3DYOA 3KVJA 4GIYA 3VGGA 3S8HA 4K7VA 4CVUA 5CZTA 3SUVA 3CV2A 5I79A 1XDJA 5B80A 3POHA 3EWUA 4UR7A 1LBMA 5HJXA 2D3NA 3PBVA 1TWIA 3LSCA 2HK0A 1JNDA 3QC0A 5F2MA 3EMCA 1G67A 4P5UA 1I1WA 2UV8G 4JY9A 4CN6A 1SZFA 1U5VA 4O1CA 4QG9A 1W1PA 3WQEA 3GUWA 1KGWA 4IUGA 4PE8A 1GQNA 4CD4A 1F3EA 1HJXA 1KBLA 2X7VA 3T2PA 3TK7A 1CGVA 3T44A 1RQEA 1SW7A 2D24A 2WZEA 3VC6A 4OOUA 4HPHA 3H7UA 3UCCA 4TVUA 3NO1A 4O8AA 3GZAA 4H2CA 3N11A 4RV3A 1JUEA 1OINA 1WV2A 5LNUA 3ABQA 3JRKA 2CLIA 2VELA 1T6MA 1OFOA 3LCXA 2VFDA 3CYJA 1FDZA 2VL4A 3WMLA 1EWDA 5C55A 5BMXA 4F0LA 2HROA 4WY0F 4D6CA 1DQWA 5A8MA 3BGJA 4W8AA 2X40A 3OLDA 4O1FA 3PM6A 4C7FA 4QROA 7REQA 4L61A 2G95A 2J9XA 2GQ9A 3WY1A 3NL5A 4NY2A 4QNWA 4PN2A 2O0TA 3GC4A 1TR9A 1Z7AA 4FZIA 3KRUA 4DO4A 1EEPA 1NF7A 4YTQA 4LPCA 3RK8A 3B8WA 4LB4A 3DUGA 1QWKA 4GRSA 3G1AA 4NNCA 1IE7C 4U31A 1HJQA 2IPGA 3WDHA 4FI4A 2X8RA 2JIWA 4DLFA 3L4XA 3MUAA 3ZLFA 2OSYA 2QVHA 4LXFA 4LSBA 4AZ6A 4J28A 1I9CB 4IG2B 2WHMA 1J0KA 3ARYA 4JAWA 3VGBA 1A0CA 1ISVA 2W63A 3WQ8A 1GZJA 2NUXA 3SIZA 3USZA 4Q32A 3QW4B 1A5CA 2PGFA 2YBTA 4I90A 3NPWA 3TFXA 3TTSA 3PPCA 3L21A 1K8CA 2J9ZA 2E09A 4EVZA 2P1FA 1TPC1 1XIEA 4OQVA 1TYGA 4GBDA 1DE5A 3W0KA 4C60A 4JTJA 7XIMA 1DPMA 4JTQA 2O7SA 1E4LA 1SMDA 5I3IA 3U5UA 1RXOB 2HS8A 1WKYA 3PN8A 3MO7A 4W86A 2BVWA 4FMVA 3MVIA 4WCJA 3CZKA 3K1DA 2E1DA 2PFHA 3WH6A 2B7PA 2Y24A 3FKKA 1ISWA 4LUSA 5IRPA 2VDIA 1LL7A 5E0KA 3VCCA 2GGGA 3PUGA 5AC6A 1ZQ5A 3EDKA 1ICPA 3V4BA 1GKPA 2QIWA 3UZYA 1H60A 5A8GA 3QGAC 5G2HA 2D73A 1JZ8A 4AIOA 1F8MA 4HBKA 2VGFA 4QIUA 1S2CA 4DJDA 3LERA 2GUBA 3VX0A 4H8HA 1HZYA 3QGKC 1T8QA 3GAYA 3BUVA 1AQ0A 2E1WA 3R11A 5AZ0A 1Y7VA 3VIKA 1XLFA 3SGGA 1EJVC 1VS1A 2VGBA 4E2OA 3E12A 3HURA 3IJ7A 1DQXA 1E6NA 3SUSA 2QJIA 4K7YA 1ZSXA 4UFLA 4FX7A 3SCPA 3VKKA 3W7DA 4F66A 1EGMA 4HCDA 5A6JA 3IUHA 4MPKA 5E09A 3O63A 1KM6A 4MAZA 1XLLA 1IZKA 3MUCA 2GGIA 1Y5XA 1UKSA 4RE4A 1RP9A 3V5OA 3WD3A 3K1GA 5DT7A 3RJYA 4MKNA 3ALFA 1BLIA 3L0KA 2DZPA 5LNSA 5LYRA 1LP6A 1JFHA 4B2DD 3KVKA 1TVLA 3PFRA 4PBGA 3BPWA 4LVFA 1TVNA 5DBUA 3S1GA 1GQJA 2PP1A 4D6FA 1QXLA 2PTZA 2NX9A 4W8BA 3PC0A 1CX9A 2VD9A 2VCAA 1OCNA 3VOIA 3LTPA 1R9ZA 3CPGA 3BQ6A 2D22A 3EWXA 1XIHA 2F7FA 3B3DA 5A8QA 3GFZA 5E0CA 1QHZA 3I7SA 2BP1A 2HXTA 1QHPA 2HQAA 2PC4A 4LT9A 4GPNA 1N8FA 2QJHA 3IV8A 4PMDA 4DF2A 1BG9A 1JFXA 2FTPA 4DLMA 3QV6A 3N17A 2QXWA 2YFNA 1E1FA 2E6YA 4QS5A 4HOXA 2RDXA 5A6SA 1Q7MA 2VYOA 2WMIB 3C2FA 5HNNA 5DMMA 4AD0A 1PKMA 3E49A 1XIJA 2AAAA 1SJAA 3I3EA 1FTXA 1BWKA 1XLJA 5CGQA 4RXGA 1U30A 3AZTA 4EPEC 1QTWA 3P7YA 4ZO9A 3SUUA 1XLBA 3OQ8A 4LALA 2O55A 2WZTA 1B54A 4UFMA 1CECA 4KFPA 2ALDA 1VB9A 4N4QA 4UWMA 1J18A 4RZ5A 1YRRA 4HCHA 3UZJA 4LVAA 3G1DA 4UTTC 3MSGA 4M1BA 1TA3B 3CZ8A 1XP3A 3VD7A 1I75A 4OUEA 3WH5A 4LY4A 2JQXA 4HVXA 1Y5WA 2CESA 4PL1A 5D9OA 3DBNA 4PCTA 5FF3A 2J78A 3BE7A 1TTPA 1UD6A 3N2CA 4IGNA 4WJXA 4B5XA 4LH8A 3TNOA 2GK1A 2W67A 3NFUA 3WDQA 1H63A 1M41A 2PSNA 3L67A 2X1RA 1LLWA 3LCLA 4IMAA 3P84A 1KQYA 2ZUUA 5CSSA 4OOZA 2IUZA 5C9UA 4FS9A 1HXJA 3B9AA 3K4AA 3KL3A 4MJMA 1UJPA 1YBQB 3BAJA 3NYZA 1MUWA 2QJNA 4JFTA 1K9DA 1XRSA 2Y62A 1V4YA 2CYGA 1PX4A 4XD3A 1SU5A 3C0LA 2QDGA 4AHQA 1MRAA 4MYAA 4PL2A 1V3MA 1ADSA 4CCEA 1AQMA 1Z6KA 3N73A 3ZSTA 3N2XA 1WCGA 5CAKA 3VNIA 2WNNA 4NZCA 1ALDA 1JNEA 1H51A 1SR0A 4HA1A 3SN4A 3W7JA 1HO1A 1JUBA 4N6FA 1RH9A 3BJTA 1BSIA 3Q4DA 3EA2A 3N6HA 4LEFA 2YSWA 4PB4A 3PBYA 3NQFA 4QJ4B 4XZWA 1LG1A 3GR4A 2YW4A 3KL5A 2ZBTA 1UR0A 1YDYA 2GSJA 3CHCA 1E1EA 2BOGX 2XH4A 3DERA 4KW2A 1US3A 3Q37A 4XUYA 1IXNA 2PDMA 3U2CA 2A7PA 4NQ1A 1OFAA 5IHRA 1ZAHA 4G56A 2Y8VA 1QCWA 4JX5A 3IGUA 3WK2A 4IIFA 1P1XA 1XR2A 1U83A 2FKPA 3G2GA 4C65A 3WLJA 3UWWA 1E15A 1VFSA 5AB3A 3UJEA 5I3DA 1GNXA 1G94A 3UR2A 3T1GA 4A22A 1QNOA 5L6UA 1PHQA 5LIKX 4HTBA 2WVVB 3L0NA 3WMBA 3RITA 2HISA 4HMNA 1LRTA 2C15A 2FGLA 1X98A 1UD2A 3D5HA 4WZHA 1SFLA 3IIVA 1A47A 3LRMA 4Z1BA 1V77A 2ZUTA 4X61A 1GONA 3ZS4A 2QCDB 4G2DA 1VBRA 4JEJA 3W84A 1UA7A 3AHTA 4ORMA 1VR6A 1OG0A 5AHMA 4KERA 2VX4A 5A3HA 4GINA 4NZ5A 3UYIA 3QR1A 3VUPA 4PUUA 1FCVA 1AQHA 3C2EA 4KETA 3QW3A 1TQJA 3DYMA 1UPPA 4BI7A 5D04C 4CQ9A 3QMTA 4V15A 1QBAA 4ACYA 3G6MA 2PTWA 4XVEA 4PTNA 1XLDA 4MDPA 2PPGA 2IQTA 4AVFA 2MNRA 3GTIA 2VO5A 3KVMA 2J9YA 2ACRA 3A3WA 2YKKA 2ZXDA 1Q6CA 4V28A 3W83A 2WSPA 2YXGA 4H83A 1BYAA 1VJZA 2ALRA 1BXNA 1L6YA 5FACA 4CNNA 2VTFA 1RLDA 1QK0A 4B15A 1GVEA 2ADAA 4GO8A 3M7SA 4GI8A 2GGEA 1M7JA 3UXIA 8A3HA 1CEOA 4JZ5A 3TIMA 3BOFA 4U5IA 4QHRA 1RHCA 3OTRA 2OEMA 2ZZ6A 4HYRA 1F5ZA 4IQLA 2AL2A 2NLYA 3CMFA 1LT7A 3W29A 3S6TA 1GHSA 4C6LA 3BMVA 1D3GA 3P0WA 3A12A 2ZXBA 1SPQA 3FOKA 2ACUA 2GOUA 2PTXA 1H61A 3K2GA 3EOEA 2VEMA 3OA5A 4QEEA 1KFLA 3CMJA 4XIMA 3S2MA 4GACA 3UY8A 1QASA 3P8JA 4JTAA 4PMNA 3KM8A 1U22A 3SY5A 1H7XA 3T7VA 3F5LA 3DFHA 1REQA 4M82A 2EPNA 5DY3A 3M07A 2EQDA 4CLMA 4IJRA 5C9XA 2NQHA 3LPPA 1A50A 4KCVA 2Y0FA 3RCNA 4R7OA 4H6QA 3CQJA 3PY2A 7ODCA 3VMOA 3JUGA 2PD9A 2PCQA 3AOFA 2ZA1A 1H5VA 5AC7A 1FVPA 3CMGA 2VEFA 2Y85A 3QY7A 1BRLA 2ZE3A 4LS2A 4KS0A 5FL0A 5F4XA 3U9IA 3RO6A 2RDUA 1IXPA 1H2JA 2QAPA 3PK7A 5AYIA 1ONRA 1UR8A 4GC4A 2INEA 2VMFA 2VFIA 4A3YA 4LS1A 3R12A 4ZOBA 1PZ1A 4ZSTA 3KCLA 2A3CA 1V6WA 4NAFA 1FWHC 1S2WA 3V0UA 4MB4A 1ZALA 2PRLA 1EDGA 3W01A 5CPNA 2XHYA 3UETA 3CPRA 3W3OA 1D3CA 4H4IA 3WDIA 5AC5A 2O4MA 3CAVA 2YBUA 1UR2A 3R0KA 3YPIA 1OFEA 4GYPA 2DJXA 2A21A 4M81A 3TN4A 2FGZA 2ISVA 1C90A 3W7OA 1SJDA 1UIOA 1PZ2A 1OCJA 1NWRA 3TYCA 5H2ZA 4FNPA 4HOWA 4C6DA 1L0PA 2YPIA 3NPUA 3AHYA 2OKOA 3MT1A 1P6WA 3W6MA 3W4RA 1DIDA 1GCYA 1Q6GA 1GG0A 1KD0A 1MZHA 1S3HA 4X2RA 1Q45A 1G0CA 4C6JA 4O8RA 1SSGA 3LRKA 5C2CA 1US2A 3EYPA 2WC3A 1IEWA 2A3AA 4O0KA 3I4EA 3AXXA 3OB8A 4RW5A 1EGVA 3UPMA 2R1LA 2V5BA 5U7SA 2GGJA 5D9PA 3PB0A 2NV1A 2OFJA 4JTKA 1WA3A 3B05A 3WLLA 5FEZA 1E5JA 5BNKA 5G4WA 3SI9A 3ISIX 1ZHAA 1VFOA 3N29A 1BF6A 4GXPA 1A5OC 1F05A 1YXYA 2V2HA 3GR7A 1IZCA 2O9TA 3A5VA 3MUZ1 2J7CA 2X0HA 3OZMA 2JGYA 3VD5A 2PGWA 3QVQA 3DC8A 1NFGA 4BF7A 2WNWA 5FAGA 5LIXX 4HNTA 3W88A 1UUOA 4BF5A 1Z41A 4BI6A 2GDUA 3BANA 3GH5A 3V1HA 2R8WA 4QSFA 3N25A 4PB5A 5D9MA 2PLKA 4FOKA 1XC6A 1F73A 3W2UA 4LYQA 3VGDA 1DJYA 3I6EA 1EF3A 2DVXA 1QNSA 5T91A 3LZ5A 3Q2DA 3TFCA 1UR3M 2WB5A 4ZOCA 1JL8A 1ZCCA 4WKHA 2OX4A 2DUZA 1A5KC 5I00A 3PS7A 1TTQA 1ZB5A 3KL0A 3WFLA 1HVQA 4BWLC 5DF0A 1DXFA 4GKLA 4CNTA 3L68A 4E2DA 2NUYA 1HL8A 3M5ZA 1ECQA 3I10A 1DJZA 3IUDA 1R9XA 3GNNA 1UMYA 1XXXA 2ZUWA 3BAWA 4W85A 3Q45A 2V82A 2H6RA 3PZ9A 3WQ4A 3L5AA 3U48A 2CLOA 3CV7A 2ZUVA 4N4PA 1KTBA 4WR3A 1V0MA 3NL2A 1Z69A 3S9ZA 1CGTA 2H3BA 4DYJA 1W3IA 1QI0A 4IPNB 3TV8A 3MY9A 3PR2A 4PRWA 2WQDA 3KDOA 4DNMA 4TIMA 4U3AA 2FVMA 5C9ZA 3LMYA 1XSKA 2ACQA 5HJLA 3NO3A 2QCEA 4JTUA 5LA2A 3IPWA 4AHPA 5CZ0A 4DI9A 4K3ZA 2DT0A 2AOSA 4GE8A 3LNMA 3FCPA 4JX6A 1PAMA 5I3GA 1OWQA 4Y2WA 4HP5A 3DAQA 5AKQA 1M9HA 1UW9A 1FKWA 2YOCA 3ARSA 3ECQA 3VFCA 2W27A 1XQKA 3KWSA 4D6GA 3CT2A 2YDAA 3A21A 4ZFMA 1TG7A 1QNPA 3GFYA 3PZVA 4KCTA 4Z2GA 5C2XA 3B4YA 4OBSA 2Z27A 2A6NA 2CLEA 1M1BA 1P7TA 3VOJA 4UTHA 5F7UA 1GORA 2J24A 1UD8A 2WNQA 1EJTC 3VIMA 3LUTA 3EX1A 5IM51 3PBGA 1BVZA 1DQUA 4TVDA 2O9PA 2HPIA 3SCWA 2DH3A 4HCLA 5A6BD 1GVQA 3MS8A 4HZMA 4F48A 2E5BA 3FA4A 4QRNA 1TV5A 4M80A 1ZJAA 1UWUA 3C86A 4AVNA 4AISA 4O1AA 4LAKA 4UFKA 4J2MA 4BEUA 3OJGA 1JYXA 1J9YA 3LN3A 3F4DA 4W84A 2ATMA 3ARWA 1GZGA 1DJXA 1WOAA 2XZ7A 3WBWA 1E4NA 4IPLA 4GJJA 4XBKA 1RJQA 4YCOA 4FAMA 3BDKA 1AW5A 2PURA 5DRIA 3GM8A 1FXPA 5DY2A 1NOWA 4BA0A 3MA8A 4XISA 1I45A 2C0HA 3OBEA 2B4GA 4Q6JA 3R6IA 4TTUA 1FWEC 1GUVA 3KLKA 3WF0A 3IIOA 1OK4A 5K9DA 3ANYA 3OO2A 1TPWA 2ESCA 4YTUA 5AECA 3AI0A 4PCSA 1FFQA 4DM1A 1OX6A 4PFMA 3N1AA 3VNLA 2XFRA 1FXQA 3TYZA 1EO7A 2DIEA 4UOZA 4FLOA 2VX7A 1YE4A 4MLJA 2XFFA 3ATZA 4HKPA 3EWYA 3NQ2A 5I6SA 5I5RA 3A4JA 3TJIA 3N2OA 1JPMA 2Q3RA 4QX4A 1XGDA 4PUKA 4PTVA 2FIQA 1CENA 2XVLA 1LT8A 3F2BA 2PWUA 4IZGA 4MB3A 3UXLA 1FWAC 2PLJA 1A4LA 4UTJA 4OU1A 4CN4A 4HA0A 4B3LA 5EPDA 3HGSA 1XD0A 1R3SA 3CHEA 3G8RA 1EJRC 1O1HA 4C6QA 3ANUA 4JFSA 5LIUX 1G4SA 1L6WA 4X9SA 2BTMA 3T0AA 4D1IA 1LOQA 2PAJA 2DFAA 3NAVA 3WQDA 4TU1A 4J3UA 2PRMA 3TMQA 4DF0A 3CGTA 7A3HA 2E9LA 4JTFA 1DWGM 3ZJ6A 3BZJA 4MZYA 2ZRXA 2W9MA 4UTMA 5M5DA 4LRTA 3GXIA 1OD8A 3R2GA 4B4HA 2QCHA 4IMFA 3AIBA 3QOKA 2POTA 3GXDA 3UG5A 4Q8OA 2NT1A 3NXLA 5C7VA 5BOFA 4K8HA 4YL2A 4W8LA 3QOMA 4R88A 1B4EA 1WBHA 4IWWA 2QIIA 1LOLA 4GH3A 2CBVA 1DWHM 1FRBA 4UOJA 3RRAA 3PZIA 5FJIA 3F5JA 4XZNX 4ZA0A 3ABOA 1HTIA 4O57A 4ZE5A 3PPFA 5C6MA 1ZENA 1VIWA 4DZHA 5FJJA 2OYLA 4A8RA 3W07A 4E8GA 2QVNA 1EIXA 1MQRA 1EKOA 2PZ0A 3L0GA 1J6PA 1K70A 2PU1A 4U2ZA 3HA1A 4JY8A 4EXAA 2H9AB 1GZ1A 1OT1A 1VBHA 4AQLA 2OLAA 1DTNA 2F38A 3EX6A 4Q8QA 1K4HA 4JIEA 3UZWA 2XGBA 2QPUA 4DB7A 2DGAA 1V3IA 4DBEA 1EJWC 3ZYZA 2YDQA 2OB3A 2BGNE 5CPLA 3CJPA 1DXIA 4XKYB 4GI9A 5H8PA 1MEWA 4Q4MA 2G4JA 3CV1A 4JTLA 3S6OA 1JCMP 1Y0EA 2BOFX 2PBGA 3SCVA 4AYGA 3IRSA 5FIPA 4JYFA 4EP8C 3PZQA 5AYZA 5FJUA 1JPDX 2GJRA 4ENLA 3UF9A 2UY2A 1PB0A 3IJ6A 2OVLA 3ZMRA 3RXZA 3P2VA 3WQWA 3V16A 1XBZA 2NLIA 4X60A 1A5SA 4FXJA 1L9WA 1R3RA 4HK7A 4DWSC 3BLFA 4EXBA 1EXBA 2BHZA 1ESWA 1OB0A 1TELA 2OZ3A 3G1SA 1VCFA 4HIBA 3FW6A 3SGUA 1JD9A 4EWND 1B30A 1QW8A 1VJIA 1P4CA 1Q6EA 1WNOA 4F0RA 1H0GA 4XZLX 3W7IA 1UBPC 4PUJA 5GNZA 3MKCA 3MKVA 3W22A 2GVYA 1C8VA 3EOLA 3T08A 3RJXA 2QGHA 3N15A 3GBEA 3V3WA 3IEBA 3UXKA 3TTOA 2OEKA 3QXBA 3RM9A 4D8AA 4DO7A 3MCNA 3TONA 1Q2SA 1BD0A 3A3XA 2HPMA 3R1ZA 1O5QA 1E5NA 5DCBA 4NILA 3WQPA 2CZFA 3NEHA 3IAQA 4IQDA 3G5EA 3WF3A 3F5KA 2Y88A 5D2XA 2CERA 4C90A 2NXHA 1YNQA 2EGZA 5HR7A 1OQFA 2VCBA 2CLMA 4UIOA 1MW1A 2G5WA 3TXZA 5D32A 1FCQA 6A3HA 2IPWA 1V08A 1XLMA 4QJ5B 1EUNA 3IWPA 1JEZA 1QOXA 3CHVA 3W38A 2GVEA 4EOUA 3V75A 4M7SA 4H7VA 1KLZA 2OKTA 4GABA 3GVRA 4PTWA 4MWAE 3RLGA 1YX1A 2QUVA 5EB8A 1KRCC 4FNQA 3DCPA 1UWRA 1TJ1A 4UTKA 1MI3A 1NJJA 4TR9A 3RNDA 1LRQA 3CH9A 1XICA 1AG1O 3JVAA 4J4KA 4GKTA 3WLOA 1QW7A 3B0PA 3N3MA 4GGBA 2PDWA 4BK9A 3K4WA 3OA3A 2XG9A 4C1NB 1A5LC 2RHGA 4HNLA 3SSJA 2X16A 3AMDA 3GU2A 4IF2A 1I0DA 4KESA 3FK4A 1PTDA 2QDDA 4PC8A 3LNPA 1UA3A 5HQLA 1PE1A 5BCAA 1XCXA 4GLEA 1C7SA 2PWHA 2VQUA 3VNKA 1H62A 2JGQA 4AHOA 2OWWA 3GC2A 4F0SA 3N3TA 3NA8A 4IHCA 4RDVA 4AC7C 2NVCA 4LCQA 3W7KA 1CWYA 2EF9A 3UPWA 2Z2AA 1FWRA 1GVOA 2V68A 2WSYA 2YA1A 4NJGA 4PMUA 1V3HA 3ZVIA 1R5YA 5CZJA 4MFDA 1DIOA 5H8UA 5CJMA 1QNQA 3DHDA 4KGLA 1IXQA 2V63A 1AD1A 1SMAA 1GPWA 3N2MA 5IXEA 4IPJA 1TE6A 2QNEA 1OGSA 4P7RA 3I3DA 1XQLA 3H8AA 1O6IA 1RJRA 3W1AA 3QQ1A 1K3UA 3BSGA 4Y9MA 2Y1HA 3BCFA 3PG8A 3AYSA 3A22A 1T7LA 3W6LA 1X1NA 2G50A 3VIFA 5KZ6A 1L8PA 1XPYA 4MVAA 2EJAA 5I78A 3T81A 2PLMA 1AL7A 3MSRA 3KP1A 3RDKA 4A8NA 5E93A 1EHAA 1EC9A 2PA6A 5PTDA 1NVMA 1CXIA 2G0WA 1L8NA 1VLWA 2CHOA 1YKWA 2WV8A 2HVMA 3CB3A 1WB0A 4L6DA 3SZ8A 6PTDA 3AO0A 5F4SA 2F9RA 4MGGA 3TTEA 3EGJA 2VC7A 3QSRA 1M03A 3R8GA 3ES7A 2XUCA 4LWWA 5DRCA 2IPFA 4US5D 4AY7A 4W5UA 1OYBA 4P8UA 4F8XA 6TIMA 4I8YA 1R2RA 4P8XA 4ZOEA 3PULA 4IGHA 4GO9A 4RDWA 3QPYA 3ITCA 5HOSA 5E1QA 3NCOA 5F2GA 2R6OA 1QBBA 3CV6A 3SUTA 4MPQA 1KBKA 4HNNA 3DHFA 1AZ1A 3BJSA 2VEPA 1H7NA 5C2GA 2XINA 2FPYA 4S3JA 5D2WA 5E6ZA 2I17A 1W5QA 3HB9A 2D2JA 5DQPA 1Q4WA 3OVGA 3G0SA 1KGXA 4FF7A 5LXXA 3GY1A 4JTDA 3CUHA 4N0RA 3B0XA 2OX1A 4NKCA 1JDDA 4X3ZA 3IACA 1Q6RA 4JTCA 5F1VA 3FYPA 2W6RA 1HL9A 4M24A 5HUOA 3ARQA 5FEXA 1FWDC 1H1ZA 1VBGA 3G22A 1M6JA 1J8VA 3CUFA 1ICQA 1R87A 1FP8A 3NQ8A 4FNTA 3GNPA 3F1QA 2WBGA 1K6WA 2QUTA 2E8ZA 3P60A 4WHBA 4O1BA 3GG7A 4HYWA 2ABBA 3LX9A 2ZRYA 1UD4A 4U2YA 1TV8A 4RNHA 1C8YA 4MJZA 5IOBA 3C3UA 1QPNA 3TCSA 5D09A 1MDRA 1E3XA 3MKKA 3F4CA 3UERA 2QQ6A 3TCEA 1UKPA 3WCZA 3BG9A 2RJHA 2X05A 4HTYA 3BWWA 1FWBC 4DUWA 4WUIA 4DI8A 4FXFA 4ML4A 2IW0A 1UH2A 1OABA 4PB3A 3OIXA 4QE1A 4QG6A 4QP0A 3TXVA 1IEXA 2QF7A 4DJDC 3VOFA 5BZAA 4FO4A 3BURA 2V2DA 3N4AA 2OOGA 5D4YA 1OC7A 3ZFHA 1JVNA 4F2TA 5D33A 4EF8A 4ES4A 2WJEA 2BY3A 3WJXA 3ORWA 3WD0A 3T05A 2OELA 3PVFA 3N12A 3W28A 4V27A 3CQHA 3G0XA 2P8BA 1XINA 1DTUA 2R9RA 1A49A 2J8FA 2YCEA 4EE9A 4J3TA 5HWNA 5FOOA 1F3WA 1REQB 1BG4A 3VNDA 1S2UA 3CHFA 2VZVA 1ITCA 5DX7A 1RBAA 1NQKA 4GQRA 4Y6GA 2A1YA 2YA0A 1K6AA 3MSDA 3DHPA 3NL3A 1E43A 4PCFA 1YNPA 1LBLA 3LV6A 3CZEA 4WIWA 4OBRA 4Q6XA 2R14A 2QUNA 3B0UX 5HDRA 1Q7QA 3GVVA 2ON3A 1EPXA 2E28A 2XIMA 3RILA 1BRLB 1PPIA 2WC7A 1J0JA 1JZ3A 2NQJA 4ZVJA 4IX2A 3ZR6A 3W70A 2V5CA 2V9DA 3TQ0A 1PIIA 3KOYA 4HMCA 3OP2A 4INFA 4PSRA 4YNGA 1P0EA 1I1XA 3UESA 5JBFA 2QEZA 4OJYA 4MF4A 3TX9A 3ARZA 1RCXB 3M46A 4DN1A 4WEVX 1FH9A 3GTFA 1LZOA 4NAFB 1QR7A 1XUUA 3KHJA 1EJSC 1VFFA 3B8DA 3L5MA 1PSCA 3EPNA 2VZTA 2FDSA 4WRHA 3THUA 3P0XA 3EEGA 2TRSA 3TJXA 1XLGA 1E6SM 3TTQA 2WMGA 1J12A 4Q4RA 3EX3A 1FWCC 2IS7A 5A6TC 1NOUA 2GJPA 3W2KA 3ZT7A 1QFEA 1S5NA 2YL5A 4QJ1A 3MMWA 4MJ2A 5CJ5A 5BYWA 4U4MA 3AWOA 1I60A 4W93A 2EG6A 3GYCA 5CLTA 2CHNA 4DYKA 3GDLA 4QAIA 1EIBA 3JU2A 1E56A 2TSYA 2ZUMA 3FXGA 4JIPA 4P8WA 4LVDA 3H54A 3W37A 1DYSA 3GW3A 3LENA 1FBAA 3VXGA 3W7LA 1ZZMA 3FN9A 3EWBX 3UR5A 1X6UA 3L23A 1QO5A 4AZIA 3JZUA 4UOQA 3VCRA 1ITXA 1QPKA 1FWWA 3RX3A 4HD5A 2HE8A 1LORA 2O7QA 3ITXA 4MY9A 5EL1A 4EANA 2C6QA 1OJXA 1IHIA 4YVXA 5BRQA 4Q22A 1TZZA 3TSDA 4IP4A 2YDSA 1O7AA 2ZRZA 1LWJA 4PMXA 3MI6A 2KAUC 4DAIA 1VEMA 4BQ5A 1VP5A 2YL6A 2JALA 3PJXA 1UUMA 4ML9A 3BV4A 3VKDA 5D8WA 5LZLA 5DMNA 3TW6A 1DVJA 3SQLA 3FEMA 2EXOA 3KDNA 3CUJA 2B0MA 3LHVA 3NXFA 1MO0A 5E0FA 5GJNA 1ME9A 2VFGA 2VRJA 3IRDA 3DI1A 3TU9A 5I24A 4UFHA 2NQ9A 5AOUA 3UY7A 3GTXA 3DI0A 4L4LA 1AW1A 4Q4PA 1QI3A 2CEQA 3LCIA 4LCRA 1YE6A 2WQPA 3WUBA 1RUSA 4Z1YA 1H09A 3KXQA 1ZUAX 1BXCA 2JEQA 1KFEA 5DBTA 4Q4OA 5KEZA 1CXHA 2UBPC 3TA6A 1S3TC 4JFWA 3DG7A 4AEFA 4LS0A 4EIVA 4ZXLA 1TPUA 1DOSA 2E0PA 1G4TA 4I5RA 1NQ6A 3GW0A 4UR8A 1FWTA 1HG3A 1L6SA 4DNHA 1TKKA 1VFHA 1DJGA 4RJEA 1V02E 4M7TA 3N6JA 1PDYA 2PS2A 4JPGA 3GTHA 4LUYA 8CGTA 5FSDC 2P3EA 4S3GA 1QJWA 4LX4A 1PX3A 3NGJA 1QW9A 1X96A 4E3VA 2WSQA 4L1XA 1WDQA 2OG9A 4POCA 3IIXA 5EMUA 4NXKA 4XBJA 3KFTA 3MCOA 3QZEA 3K4DA 1VJSA 2C19A 1D8CA 3R5EA 1HKVA 4IX0A 2GQ3A 3VD9A 1PCKA 4YU1A 2E25A 2V69A 1T0OA 2Y5EA 3WD2A 1TUFA 5BRPA 3M0KA 3KTCA 3QR0A 3IVSA 1MNSA 4NT0A 2VNCA 3FHQA 2VCCA 4J3WA 4GFIA 3NQ7A 3GRIA 4UR9A 5JBDA 2ISSA 4NF7A 4J3VA 3OLIA 3RFAA 1DIEA 2GJXA 1BXBA 4DJED 1FCUA 3MMDA 1P7TB 4GYJA 2CZEA 1JCXA 3W86A 1EHNA 1JZ6A 4N02A 1W17A 3OLGA 4LTSA 5SWUA 2G8ZA 4OVXA 4EPKA 5A95A 1I0BA 4ICCX 3R10A 2HCVA 4H9XA 5FESA 3E02A 3G18A 2AKMA 3FV9A 1XIGA 2XZ9A 1E73M 5FCZA 1K77A 1F6YA 4I5XA 5A6KA 5CPOA 4ICNA 2OQYA 4S3DA 2VT0A 3FS2A 1SZNA 2PC8A 4M1RA 5CSUA 2DV0A 1Q6OA 4PEEA 1IF2A 3GU1A 1QPQA 3OG3A 2XVPA 4YTSA 1Q8AA 1GG1A 3WLSA 2WZIA 4H01A 1OD0A 4TV5A 3QF0A 3G3MA 3KLLA 4RNFA 4WDWA 4G7FA 4RL3A 3MWCA 4H9TA 5FL1A 2JE8A 4PMOA 1KV5A 1OC6A 3MI2A 1M53A 1FFRA 2BMBA 1W1TA 1A0DA 1A80A 1G01A 1KXHA 2DZTA 4GIEA 2A4AA 1CB7B 4G8TA 3FDGA 5K9XA 3M0MA 4JTIA 3DHUA 2QCDA 2GUYA 3U6WA 3SW6A 3MDUA 4CVWA 4ZL1A 4N9BA 4KT2A 3M0ZA 4M0XA 4JHOA 4HA4A 1JCLA 3G3DA 4B9YA 1CXFA 3FA3A 1WPCA 4DJEA 3W27A 1CYGA 3NUKA 4UTWA 3LCFA 3IGHX 2V5JA 4AYSA 4YWSA 1MXSA 3H2NA 4H19A 3QGVA 3CUZA 2B7OA 1ITUA 2BNJA 2Z0IA 3TN5A 4XQ6A 1KM2A 1YEYA 2QYGA 3G8EA 1RA5A 3KOXA 5GVJA 1UASA 1CLXA 4N2YA 5KITA 4CQCA 2FFCA 5A69A 1NDYA 1E51A 1AK5A 1OZMA 1E0WA 2QLYA 4XB3A 4CD5A 1Z9AA 3EDDA 3NIYA 3SSZA 2VRKA 3GUGA 2PP3A 2QS8A 1W32A 1JF6A 4OFCA 3W7MA 1K7FA 3HPFA 1CIUA 1AW2A 4BHYA 2ZIDA 3OYXA 2UY5A 4HZ6A 2WKLA 3ERPA 2QR6A 3P67A 2W79A 3WNNA 5GNXA 1TV3A 2D69A 1TPVA 1F9CA 2VXNA 3C2RA 3W2LA 1PVNA 2Y61A 4AXNA 5HMDA 4BS0A 3MMTA 3SEPA 1MW2A 3ZOAA 4Q7BA 1GW9A 1R47A 3HG5A 2ZICA 2C1HA 1D8WA 2OT0A 4GD0A 2V5LA 1H7WA 1GJUA 2QULA 1ELSA 1EYEA 3A4XA 3VDCA 5I77A 3EPOA 1A0EA 2CFFA 2DZAA 2OODA 2WM0A 3R58A 1NARA 3HV9A 5D2VA 3FKRA 4H7ZA 4P7OA 4LGXA 1QU4A 3B0YA 2FZBA 1AA1B 4DM2A 1I2PA 4GYPC 5C9WA 1U1HA 2XIIA 3OGSA 3ZT5A 2OSWA 4OV4A 5HANA 5AYBA 3SB0A 2PF8A 3R8RA 2HS6A 2J7GA 3REQB 3MC5A 3KRSA 3BO9A 3MUY1 3VUSA 4H8UA 4OKDA 1I2RA 5KETA 1YDOA 4J35A 4O12A 5C54A 4Q8TA 2AGKA 1JJKA 2RGMA 1I2QA 1BEUA 3BG3A 1PEZA 3BGAA 1W5PA 3E0WA 4C1KA 4C1LA 3NQAA 2C14A 9XIMA 3AHZA 3APGA 1TCDA 4JTRA 3UFYA 3BICA 4KEUA 3QLDA 4MB5A 4JYDA 2REQA 4W7WA 3QY8A 4GX8A 3I3BA 2I9EA 3M5XA 1J0YA 1P0BA 2XN2A 3AMLA 3VIGA 4R53A 3NZGA 4M6PA 4J5NA 3BSMA 5G2IA 4L7ZA 3VNMA 3WX7A 5LKYA 3LEPA 3HBLA 2HSAA 1VAHA 3ZIZA 3IS4A 3E9AA 1PZ3A 1Z42A 2A85A 3H7RA 4KWUA 1WXJA 2Y7DA 4KIRA 3ZJKA 3LGEA 4MFEA 5XIMA 1DWAM 3HO8A 1TVPA 1YXDA 4WK9A 3W1NA 4IJCA 4AF0B 2R1KA 1KCXA 2DZSA 3IVUA 3DFPA 3MV01 1MDLA 2DY3A 4C6KA 3WD1A 2EKCA 4Y8EA 4O4WA 4M5PA 2ZX6A 1W0MA 3HGJA 2WXDM 1LJYA 5AYYA 1ONXA 2FHBA 1CGXA 2FHFA 2OYMA 1VGAA 2OXNA 4L9YA 2J7FA 1K9FA 4KFNA 3UWUA 3ELFA 1KR1A 3IK2A 4UXDA 1W9BM 3BAYA 4GJ1A 1XWYA 4Y96A 2AL1A 2AQOA 1ZJBA 2PP0A 1FKXA 2DORA 3SBFA 3W02A 2WKGA 3VE7A 1XRFA 4QCFA 2BZNA 5KTLA 7TAAA 3PF3A 1G69A 3AYVA 3BMXA 3EDJA 2GSHA 4C6NA 2YCJA 4H6KA 6ALDA 4DJFA 3TQKA 5JH2A 1F3TA 3E6EA 4XVDA 2GL5A 4H1ZA 1EA0A 3W76A 5EFFA 1BSLA 3DFNA 1GPFA 3ZJ7A 4Q4QA 1EC8A 1XIBA 3M0IA 3SN0A 2Y8KA 1NSJA 3MWAA 3I7RA 1SGJA 4AB4A 3FHAA 2VHLA 1BYDA 3O0FA 3IIZA 4AIBA 2VFFA 5C71A 1YTEA 2D1ZA 4MLRA 3OGRA 1EA9C 5HPCA 5HNRA 5IBXA 4IICA 4NYUA 2EEXA 2Z2UA 1EFZA 3T40A 2VC5A 1XSIA 3H55A 4ACZA 4ZR8A 4GJIA 4ICMA 1HT6A 4HT3A 2WMHA 3S9IA 4JYEA 1KGUA 2GFTA 4KPLA 1XJBA 4NZJA 1KLYA 1E0UA 2QKFA 4LCSA 5M1TA 4S2BA 4BZYA 4LYPA 3TSBA 2V67A 4L64A 1KCLA 2DPEA 2D0FA 1V5XA 3UG4A 5HAOA 1Q8JA 4D72A 2BOEX 4MJ4A 3T8QA 5CBBA 1SFJA 5DCEA 4PMZA 2EBNA 1SSDA 4GQ0A 1SFTA 1XV8A 2YLLA 3TOYA 3GH7A 4KWVA 5A1AA 4UCGA 5TF0A 3G24A 2DDXA 2DIKA 4K1GA 2ATSA 4L4MA 4H6RA 2V81A 3NEVA 2ZDRA 4QLLA 4Z0JA 1W37A 2PF0A 4S3BA 4P2VA 4LNCA 3BMWA 5G1TA 2BS9A 1B3OA 1BVWA 1W2PA 4MZ8A 3WLTA 3ZZ1A 4JQAA 4UNIA 3ZLGA 3MUXA 1QI2A 3TTYA 1VFUA 4XK2A 1YLVA 2C3ZA 1TCMA 4MZ1A 3C52A 3DFOA 3RLHA 4EPDC 1GKQA 2XVKA 3STCA 2FTWA 2GQ8A 3QV8A 2VEGA 2O56A 1WXYA 5CCZA 3L4TA 3L5LA 5D38A 4G7EB 5DELA 1RCQA 3IGSA 2TAAA 4GY1A 5I7GA 2OT1A 2A5HA 1F6PA 2YCLB 4JQ4A 3L2IA 1G5AA 3N19B 5CBIA 4K37A 4CQ8A 3E2RA 4QTGA 4LOCA 4K6AA 2YXOA 2OYKA 4HN4A 4WJ8A 3U5YA 3I4KA 3C8NA 4E5TA 1ADDA 3I6RA 1MRQA 2CETA 2PWEA 3BG5A 2P50A 2JBMA 1QRQA 1VRXA 5AC8A 3ITVA 2J8GA 2P8CA 1UMLA 3VPLA 2WHLA 1N55A 3GG8A 4IFRA 3TJLA 1UZHA 1J96A 4IXHA 5CG0A 3QPZA 4ROQA 3H2FA 3MP5A 2PBOA 4MKSA 1W9DM 2CCRA 3KW3A 3DIPA 3OBKA 3LCHA 4O17A 3QZ6A 4H9MA 1XLKA 2AGTA 2WMJA 2X1TA 2VQTA 4UB9A 4XD6A 5LIYX 2ACSA 3HMJG 1B1YA 3VINA 1RY0A 2TYSA 1V3KA 3A23A 1AUSL 4C6BA 1KRMA 2J27A 4AWSA 4XAFA 4REQB 3S3GA 4EWJA 3DKLA 3RLVA 4BEQA 2XVGA 3THDA 4WQ6A 2ABAA 5CSYA 3R4IA 2W91A 2C7FA 1IT7A 1LLOA 2PDGA 3C2VA 2GOKA 1JI1A 2VENA 3RR4A 1IZJA 1TMLA 4HK5A 3P14A 1OC5A 4QLJA 5FF0A 3W26A 2FZ8A 3KAOA 3W7PA 4D71A 4B91A 3RG6A 2OR2A 2PDUA 1XIDA 4D6DA 3ARXA 1EC7A 4DJDD 3LS9A 1I4NA 4NXSA 2CLPA 3QJAA 1BTCA 2VX5A 4AD3A 5CC5A 3LXCA 5I3KA 1EWEA 2VWSA 4KEVA 1E0VA 1KA9F 2ZXQA 3PZGA 3WLKX 1TRDA 3DFSA 2WPBA 3U0HA 1V6VA 1DEDA 4B5NA 3TR9A 3UZXA 3VAVA 4JQ3A 1UYQA 1W1B1 3VU2A 5EBAA 2AMGA 1E6PA 1MEHA 1XLHA 3CAQA 1WZAA 1RBOB 4A2RA 1RLCL 4O1DA 1D7FA 3GNDA 4OECA 1SO4A 3Q65A 1JDFA 1PCWA 4NZFA 3TYDA 3EB2A 4UMBA 3RAOA 3WKZA 2RDTA 3W73A 5MHBA 4OIFA 4PRRA 5CPMA 1KM1A 3L2LA 3XINA 5A6LA 4CQDA 3UGRA 4P7QA 1F74A 3PZTA 2D2GA 5FF2A 1FDJA 3BLDA 3S6DA 3G1FA 5ABFA 1O66A 3SCTA 1MNZA 4XBSA 4RDYA 2NQLA 2D23A 3OZPA 3CTTA 3TC3A 4HYVA 5H1WA 1OX4A 3GWQA 1XLEA 4JTGA 3U7BA 3LDVA 4B5UA 4P8VA 2OZ0A 2R24A 2H8ZA 1LUCA 2QJMA 1BGAA 1JIBA 4J7RA 3U2ZA 1TZ9A 4AEOA 5GJMA 4BKNA 4PUDA 1KV8A 2Y8UA 3WBXA 2H9AA 4IIGA 2VEIA 1EO5A 3ZQ9A 1F4HA 2GWGA 4PGLA 3AIEA 2W5FA 3F4VA 3BLIA 1X1ZA 4UQAA 4YVVA 4Z1AA 4CNSA 4O13A 2DW7A 3KCOA 1YYAA 1VPYA 1FHUA 4Z2KA 4NI3A 2YYTA 1J10A 1SYTA 4JIHA 1TV4A 4M3PA 4MYXA 1XBVA 4XKYA 1T5AA 1B3XA 1POKA 3S1WA 1AJ0A 4EAMA 3FX4A 4WGXA 3DN5A 3MU7A 2GVGA 2I7GA 4IPIA 4ERGA 1WUEA 4LC8A 3LLXA 1KFKA 3O16A 1WQ5A 3B97A 4C6PA 2ZRWA 3URQA 4HQVA 4NZ4A 3G77A 1E0TA 1UC4A 4C6EA 3H2MA 2F6UA 1RPXA 3GYEA 2BGSA 2XIJA 2P5NA 3WYZA 1IIGA 2I16A 2Q8XA 1VHCA 4F2BA 4GY7A 3SY1A 1P5BA 3CT7A 2XIOA 2P0IA 2C13A 4H9ZA 4J1OA 1QNRA 3KTSA 2VVSA 3HF3A 1TIWA 5DANA 4MMWA 1B0IA 4OT7A 3MO4A 1KFJA 2X1UA 1JQXA 4J27A 2J77A 3WQ6A 4ROPA 1CB2A 2A3EA 4DO6A 5IFTA 3B40A 4YHGA 4PTXA 3HMCA 1DP0A 1OFDA 3ARPA 1A53A 4GYFA 2Z6IA 5HNUA 4C7DA 3B8UA 4QGCA 1M04A 1XGEA 2J7BA 3ZWTA 1JDAA 4E2VA 3EKGA 1UB3A 3HV8A 4FR6A 3QHNA 1W91A 2DZUA 1KRBC 5I3JA 4Q8WA 3BLOA 5CPQA 2E6FA 1ME8A 4ALDA 3SCNA 4XD4A 2G96A 3NM1A 1YDNA 2XFWA 3ID7A 3M5YA 2CNCA 4DHGA 1QWGA 4YWIA 5D37A 3NURA 3BH4A 3UJFA 1EDTA 5AHIA 3ARVA 3KBVA 2YXXA 3CUIA 4LBRA 4ZQCA 2YJQA 3AMGA 2CBUA 3KOWA 4MUPA 2ZTKA 3IVTA 2VFEA 3R0DA 3S4TA 1JCTA 1Y65A 2F8QA 4RUBA 1ISZA 4KRUA 4KWWA 4Q8VA 4AY1A 1K02A 5HA7A 3P6LA 1GWJA 2VEKA 2GDQA 2O9OA 4JQ2A 4WXZA 1MUCA 3SRKA 2XM1A 1E6ZA 3M0LA 4FR1A 4K38A 4AZGA 4ASTA 2TPSA 3W72A 1QOPA 1W8SA 3SM0A 2BDQA 4AX7A 4PUMA 1TJRA 4OE7A 4C1NA 4PUWA 1V6XA 4CN1A 4I9JA 5EA9A 1B3WA 3GXPA 2DT3A 1S38A 1HQTA 1YTKA 3WUFA 3PJTA 4V1XA 2HTMA 1GOOA 2WOQA 2FZDA 3G1HA 2FDMA 4FOUA 5FEPA 3FJLA 1WAUA 3VCNA 2CLKA 3MDWA 3ZO9A 5CJNA 3KOFA 1OCQA 3UBPC 5HJYA 5A6AA 4H6EA 2JF6A 3S47A 3F7JA 1B9ZA 4R3UA 1H50A 1X39A 3F03K 1Q66A 2HV5A 4B3KA 8TIMA 4C91A 5I3HA 1FX6A 1HN1A 2POZA 2PWFA 5DN1A 4E4UA 3VDGA 3LHYA 4AC1X 4PCPA 3TSMA 3N18A 1EL3A 1BGGA 5FEWA 1QMLA 4Z2IA 4O52A 5BXTA 2R1NA 4MWAA 2CZ5A 3WF1A 4GVGA 3N6QA 4E4PA 2NZLA 4GGHA 5A2CA 5T9BG 2O4QA 2V3FA 1E4MM 2GJXB 3ATYA 5IFPA 1TPEA 4LF2A 2ODOA 2Q6ZA 4B90A 4W89A 1EJUC 1VCVA 4CCDA 4TMBA 4Q7IA 2Y6ZA 4ZO7A 1RPKA 5LIWX 1XM3A 1LDCA 1EP3A 4ZZ9A 3NSXA 5EMYA 4PMJA 3UVAA 2DSWA 3PAJA 3IGXA 4YHEA 1UP0A 1E1CA 1Z3NA 1M7PA 4M8UA 3A47A 1XCFA 3NNTA 5FA5A 4MNKA 1K9TA 2ICSA 4GOAA 4ZSUA 1B3YA 3OVPA 2Y5SA 1RBLA 3B9DA 1N82A 1FQ0A 4V2XA 4KIEA 3CQKA 5JIPA 4FLQA 2FGBA 4LB3A 4RZBA 1ISXA 1RD6A 4FX8A 4GZJA 3NQGA 4HHHA 1FY6A 4O53A 2WC4A 1TZ7A 4M6VA 3ARRA 2UY4A 3BARA 4HPXA 1JCNA 2NUWA 2QJJA 1FH7A 5EU9A 4OWGA 4N6EA 4IP5A 3E2VA 3CM4A 1MZRA 3VDBA 1GOQA 2Z28A 2CC0A 1ZP3A 3E0VA 3LD5A 5C0QA 3DFTA 1EQCA 1TV7A 2HE5A 4QCEA 4UTIA 3CEPA 1R3YA 3K5XA 1J2WA 2Z6JA 2A3BA 2PWVA 3ARUA 5LNVA 4CEXC 2Y4SA 3AXHA 3KBJA 4FNUA 3B04A 5TIMA 3SCOA 4CU8A 1U1JA 2C18A 4ZEPA 4C6MA 3IAPA 3GVQA 3DECA 5DFAA 3WFAA 2BXYA 4K2SA 2RAGA 5D03A 3GFXA 3N04A 4IQJA 1XYLA 4XZ9A 3HOJA 3EAUA 4XSLA 3QTPA 3FYYA 5LNWA 1CLVA 1ADOA 1ZBCA 3S5NA 4IISA 4RW3A 4RKAA 3UA3A 2DIJA 3WQGA 1EEXA 4QBXA 1LCOA 3UVIA 1IWAA 3OVQA 4JEQA 3URNA 1Q6QA 6XIMA 3PWGA 4LEQA 3PB2A 3U4AA 1X7IA 4DVOA 1DL3A 4WXYA 1R38A 3BOXA 5K9CA 2C16A 4DBWA 4KWOA 2FZNA 3GH4A 4TMCA 2OLSA 1PWMA 4C6IA 4YJ5A 5KZEA 4CKQA 4I9MA 3E0LA 4DQWA 4RNIA 1ENUA 2GDVA 3QFEA 1C7TA 1MYRA 3WLMA 4TQTA 1PKYA 1H49A 2E8YA 4NZ3A 2PEVA 4Z1DA 2RJGA 2E40A 4Q8PA 4QDPA 1G4PA 2ZZ5A 2Y7EA 4JN7A 3P5YA 4S3AA 2I57A 2A0NA 1K7EA 1V0NA 1P6CA 3GVGA 1BQCA 2WPGA 3GO2A 1ICSA 3PJWA 3W87A 3WEMA 3NDZA 1EDQA 2FHCA 1KW1A 2PCEA 1RD5A 3WLNA 1A3XA 3SCQA 3UR8A 4LAUA 4CD7A 2IQ0A 1HP5A 1U5JA 1GYLA 4TUFA 1XBYA 1WBJA 2BXZA 3ONCA 4MNJA 3UEQA 3VYLA 1Y8BA 1GVYA 4F40A 1Q63A 4WD0A 1JYNA 1WDDA 1JAEA 2DQWA 1SJCA 3OEXA 3M6YA 1AMYA 1EBHA 2ZZ3A 4AFYA 4BI5A 2VOTA 4MADA 3O8AA 4YS1A 3M0XA 2Z1BA 1X8CA 4U5KA 3USBA 3NQMA 3M0YA 2BXVA 2V3EA 3LU2A 2NWSA 1XIIA 5AZ1A 3EB3A 1KBIA 3ITTA 3B9NA 4M51A 2ISFA 3NQEA 4TOQA 5I0DA 3EWDA 5BW6A 1QNVA 5EY5A 1DE6A 4TXEA 4LC6A 3EMQA 3AC0A 3A24A 3U57A 4F9JA 3EXSA 4G6CA 2JIEA 3NZRA 2PWGA 2REQB 1LL4A 2XTKA 5HULA 2NXIA 3TAKA 4JX4A 4UFIA 1OFBA 4L9ZA 2GJLA 3FLUA 1DHPA 2HEJA 1HIZA 3ALGA 4W87A 1AVAA 3W1UA 1R30A 3DKJA 4GA8A 1THFD 3U3HA 3CIWA 3B03A 3TUUA 3W00A 1B4KA 2WWCA 3ABXA 4I9AA 3WDRA 2ONEA 4LY8A 2W66A 5G1MA 1H5YA 1WKFA 2WSKA 3AU6A 3NSMA 3WNOA 3RPMA 1QDSA 1R7OA 2EPHA 3HJEA 3KCJA 3D3FA 4O14A 3W53A 1W1ZA 3T0TA 1HGWA 4L6HA 3MQTA 4X9YA 5A8PA 1RV8A 5A2AA 4WY0A 3QRHA 3POCA 1V0KA 3B0VC 2JFEX 4AG0A 2ZQ0A 4B16A 3M0JA 1FWNA 1VBJA 1R3WA 3THQA 2FLIA 3W1PA 3O0KA 3A13A 5TBOA 3WO8A 1ZP4A 2E7FA 3RM8A 2YIHA 3S0CA 4MNMA 1K03A 3AXMA 4LUTB 2ZX8A 2PB1A 4L65A 5CGMA 4UQDA 4AD1A 4HMDA 1GOIA 1NELA 1SZEA 3S5ZA 3SQSA 1QI5A 1X97A 3AFBA 3A9IA 1NDWA 7TIMA 4HU8A 7PTDA 1OM0A 2QMKA 3NPXA 2VR4A 1RALA 1BTMA 3L4YA 5I3FA 3PHAA 4DPPA 3GSMA 1KNWA 4H9VA 3W1TA 2PGRA 3WBAA 1Z89A 1UQZA 1H7OA 4HPJA 1TJ0A 3RUBL 5KZMA 3TYAA 3CZLA 1UWIA 6REQB 1V8EA 4UNLA 1JR1A 1WOBA 1M68A 2O92A 1E3ZA 4HPGA 1R46A 3ME3A 3IJDA 5KZDA 2PRHA 3ZVHA 3S2CA 5AYXA 1KCKA 4DUXA 2QCGA 4L80A 3FEQA 2PU0A 2WW5A 2A6LA 3WUGA 3C6CA 3OZOA 4DBSA 3AJXA 4PFHA 1W8GA 3HQ1A 4DXXA 3NQDA 3H2AA 3DC0A 4AIEA 4HK6A 4ACZB 4LFYA 3RMJA 5JU6A 3WJYA 1F07A 2OZTA 3DH7A 4IIEA 1TTJA 2RKXA 1D2KA 4NJHA 1XLIA 4CU7A 5JXQA 1GVSA 1NDVA 3CL7A 3JZEA 1UWQA 3K30A 2Q8LA 5BWFA 4O54A 1CXLA 3MYOA 3HFYA 2NQ5A 1XLCA 1TE1A 1XIMA 2IPJA 5CGTA 2X1SA 4O0QA 4ZTXA 4G1NA 1RK6A 1Q6LA 2J6XA 4GYKA 4J3SA 1EF2A 1EZWA 4B5VA 1XPGA 3M64A 3BCDA 4CCZA 3D47A 1XDMA 4DZAA 4B3ZA 5KSWA 1PDZA 1J79A 4UNKA 1UD3A 3GK0A 4HA3A 2E68A 4NRRA 1R9YA 1N2VA 4ZCWA 4LW7A 1NDZA 2J62A 4C6CA 4FHAA 3TLQA 2B31A 1UKTA 3M7WA 1R86A 3MMUA 1ZJHA 2DT2A 4IMEA 3W1LA 3SIMA 4DELA 2QV5A 3LCWA 1W56A 3M5VA 1JRCA 1POJA 2J66A 3V0TA 1KO0A 3KWXA 1TIMA 3OU8A 1RAKA 2OSXA 1S1RA 4WLCA 3FGCB 5FKYA 1P1MA 1Q5MA 5EKYA 1FCBA 3LGDA 5KINA 3TR2A 2VWTA 1U2YA 4L5ZA 1G4EA 4KEMA 4ADSA 1BWVA 3MZ2A 1V02A 4HHLA 3GXMA 2WYSA 2I5IA 3OYZA 3P5ZA 4JNZA 3SADA 1T40A 5MKGB 4DJEC 4HNOA 3M4HA 5H6HA 2PUZA 3RCYA 3RO8A 1EZ2A 1GOKA 4UTWC 3U2OA 5I23A 3IUIA 2VX6A 2L5HA 4L56A 4XO7A 3L7RA 4AWUA 2G3FA 3MYPA 2IKGA 2WBKA 3CO4A 1XH1A 3V36A 4JNMA 3FA5A 3W7QA 4CNOA 3L66A 4GQQA 2ZFAA 2WZMA 2PDKA 4CQAA 3SJ3A 1B3ZA 5HMSA 4PODA 3BJFA 1HGYA 1MW0A 2YZ5A 3R7MA 5CXPA 3CL8A 4J40A 5ECVA 4GUJA 2ZADA 3WQFA 2OGJA 1IT0A 1XRVA 2QDHA 1MXDA 1QOQA 1Z32X 3BLEA 3NGFA 2G3MA 1KXVA 2BVTA 3N34A 2VOMA 4GG9A 2HRWA 4DIAA 1M65A 2D2OA 5TAOA 2QF8A 4XTDA 1CTNA 4NL1A 4Q7NA 4JTTA 4LF1A 1QATA 5BU9A 3TN6A 4HZ7A 3TEVA 1ZTVA 3H2OA 5A94A 4NAEB 2UY3A 3E5PA 2XM2A 4P7LA 3WK0A 1UQYA 4YTRA 2PDCA 3B8VA 5ENLA 4O16A 2G3JA 3O2LA 1DIKA 3I7QA 1HKJA 2ZA2A 3AROA 2BGQA 2OWXA 2XSXA 5AHNA 2BG5A 1ZBVA